BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2125
         (756 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AK117863_1815873 Arabidopsis thaliana At1g79620 mRNA for unkn...   220   2e-56   
gb:AE005173_895483 Arabidopsis thaliana chromosome 1, bottom arm...   220   2e-56   
gb:BT006486_1639373 Arabidopsis thaliana At5g49760 gene, complet...   219   3e-56   
gb:AB025613_1516372 Arabidopsis thaliana genomic DNA, chromosome...   219   3e-56   
gb:AB025613_1516373 Arabidopsis thaliana genomic DNA, chromosome...   209   4e-53   
gb:AB025613_1516374 Arabidopsis thaliana genomic DNA, chromosome...   194   1e-48   
gb:AP003411_1829038 Oryza sativa (japonica cultivar-group) genom...   180   2e-44   
gb:AB025613_1516371 Arabidopsis thaliana genomic DNA, chromosome...   149   4e-35   
gb:AC093952_1736170 Oryza sativa (japonica cultivar-group) chrom...   145   6e-34   
gb:AY059802_1564646 Arabidopsis thaliana leucine-rich repeat pro...   106   4e-22   
gb:AF136588_1771155 Arabidopsis thaliana leucine-rich repeat pro...   106   5e-22   
gb:AY057648_1564061 Arabidopsis thaliana At3g12148/T23B7.11 mRNA...   104   2e-21   
gb:AC069472_1540863 Arabidopsis thaliana chromosome 3 BAC F28J15...   102   1e-20   
gb:AP004562_1841637 Oryza sativa (japonica cultivar-group) genom...   100   3e-20   
gb:AP003489_1829912 Oryza sativa (japonica cultivar-group) genom...    99   1e-19   
gb:AX093392_1461116 Sequence 11 from Patent WO0118061.                 97   2e-19   
gb:AP004747_1844318 Oryza sativa (japonica cultivar-group) genom...    97   3e-19   
gb:AC073395_1541016 Arabidopsis thaliana chromosome 3 BAC F11B9 ...    95   1e-18   
gb:AP000391_1819980 Oryza sativa (japonica cultivar-group) genom...    94   3e-18   
gb:AY332474_1600056 Oryza sativa (japonica cultivar-group) trans...    94   3e-18   
gb:AY518289_1610791 Arabidopsis thaliana strubbelig receptor fam...    94   3e-18   
pir|E86312|E86312 F11A6.9 protein - Arabidopsis thaliana>gb:AE00...    93   6e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AK117429_1815463 Arabidopsis thaliana At3g11010 mRNA for puta...    92   1e-17   
pir|A85043|A85043 probable LRR receptor-like protein kinase [imp...    90   4e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AP003992_1836055 Oryza sativa (japonica cultivar-group) genom...    89   9e-17   
gb:ATAC011620_1543299 Arabidopsis thaliana chromosome III BAC F1...    89   9e-17   
gb:AP004234_1839081 Oryza sativa (japonica cultivar-group) genom...    89   1e-16   
pir|B84594|B84594 probable LRR receptor protein kinase [imported...    89   1e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AP002908_1823802 Oryza sativa (japonica cultivar-group) genom...    88   1e-16   
gb:ATAC009991_1543120 Arabidopsis thaliana chromosome III BAC F9...    88   2e-16   
gb:AB008270_1510484 Arabidopsis thaliana genomic DNA, chromosome...    88   2e-16   
pir|C96756|C96756 receptor-like protein kinase homolog [imported...    88   2e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AC006234_1533809 Arabidopsis thaliana chromosome 2 clone F5H1...    87   2e-16   
pir|T05250|T05250 probable disease resistance protein F18A5.200 ...    87   2e-16   Arabidopsis thaliana [mouse-ear cress]
sp|P93194|RPK1_PHANI|RPK1_PHANI Receptor-like protein kinase precursor (EC ...    87   2e-16   Ipomoea nil [qian niu]
gb:ATH496433_1552814 Arabidopsis thaliana mRNA for extra sporoge...    87   3e-16   
sp|Q9LYN8|EXS_ARATH|EXS_ARATH Leucine-rich repeat receptor protein kinase ...    87   3e-16   Arabidopsis thaliana [mouse-ear cress]
pir|H86459|H86459 hypothetical protein T1E4.2 - Arabidopsis thal...    87   4e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AK117178_1815224 Arabidopsis thaliana At1g73080 mRNA for unkn...    86   6e-16   
gb:AC137619_1743655 Oryza sativa (japonica cultivar-group) chrom...    86   6e-16   
gb:SBRLK1_1704899 Sorghum bicolor mRNA for protein serine/threon...    86   6e-16   
gb:AY139779_1582396 Arabidopsis thaliana At1g73080/F3N23_28 mRNA...    86   6e-16   
pir|T18536|T18536 receptor-like protein kinase - Ipomoea nil (Ja...    86   6e-16   Ipomoea nil [qian niu]
pir|D96756|D96756 receptor-like protein kinase homolog [imported...    86   6e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AY518288_1610790 Arabidopsis thaliana strubbelig receptor fam...    86   7e-16   
pir|T10725|T10725 protein kinase Xa21 (EC 2.7.1.-) A1, receptor ...    86   9e-16   Oryza longistaminata [long-staminate rice]
gb:AP004564_1841660 Oryza sativa (japonica cultivar-group) genom...    85   1e-15   
gb:AP004069_1837219 Oryza sativa (japonica cultivar-group) genom...    85   1e-15   
gb:AP003633_1831828 Oryza sativa (japonica cultivar-group) genom...    85   1e-15   
gb:AF384969_1794544 Arabidopsis thaliana somatic embryogenesis r...    85   1e-15   
gb:AY518290_1610792 Arabidopsis thaliana strubbelig receptor fam...    85   1e-15   
pir|B84659|B84659 probable receptor-like protein kinase, ERECTA ...    85   1e-15   Arabidopsis thaliana [mouse-ear cress]
pir|D86466|D86466 69.4K hypothetical protein F23M19.11 - Arabido...    85   1e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AP005841_1858891 Oryza sativa (japonica cultivar-group) genom...    85   2e-15   
gb:OSJN00196_1696553 Oryza sativa genomic DNA, chromosome 4, BAC...    85   2e-15   
gb:AY090373_1574121 Arabidopsis thaliana AT3g05370/T12H1_34 mRNA...    85   2e-15   
gb:ATAC009177_1542875 Arabidopsis thaliana chromosome III BAC T1...    85   2e-15   
gb:AE016959_1020920 Oryza sativa (japonica cultivar-group) chrom...    85   2e-15   
pir|B84742|B84742 probable receptor-like protein kinase [importe...    85   2e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AC099732_1737183 Oryza sativa (japonica cultivar-group) chrom...    84   2e-15   
gb:OSJN00271_1697720 Oryza sativa genomic DNA, chromosome 4, BAC...    84   2e-15   
gb:AB019227_1514079 Arabidopsis thaliana genomic DNA, chromosome...    84   2e-15   
gb:AP004764_1844639 Oryza sativa (japonica cultivar-group) genom...    84   3e-15   
gb:AP004764_1844638 Oryza sativa (japonica cultivar-group) genom...    84   3e-15   
pir|T10636|T10636 hypothetical protein T13K14.100 - Arabidopsis ...    84   3e-15   Arabidopsis thaliana [mouse-ear cress]
pir|E84527|E84527 hypothetical protein At2g15320 [imported] - Ar...    84   3e-15   Arabidopsis thaliana [mouse-ear cress]
gb:ZMA400869_1731517 Zea mays serk2 gene for somatic embryogenes...    84   4e-15   
gb:ZMA277703_1731488 Zea mays mRNA for SERK2 protein.                  84   4e-15   
gb:AF053996_1764490 Lycopersicon pimpinellifolium Hcr2-2A (Hcr2-...    83   5e-15   
gb:AY086058_1571119 Arabidopsis thaliana clone 20900 mRNA, compl...    83   5e-15   
gb:AY072083_1566979 Arabidopsis thaliana putative receptor prote...    83   5e-15   
gb:AB011476_1511391 Arabidopsis thaliana genomic DNA, chromosome...    83   5e-15   
gb:AP005849_1859071 Oryza sativa (japonica cultivar-group) genom...    83   6e-15   
gb:AP003962_1835750 Oryza sativa (japonica cultivar-group) genom...    82   8e-15   
gb:AK117901_1815909 Arabidopsis thaliana At5g49660 mRNA for puta...    82   8e-15   
gb:AC091787_1735101 Oryza sativa (japonica cultivar-group) chrom...    82   8e-15   
gb:AY102147_1577752 Arabidopsis thaliana At1g68400/T2E12_5 mRNA,...    82   8e-15   
gb:AC016163_1538126 Arabidopsis thaliana chromosome 1 BAC F26A9 ...    82   8e-15   
gb:AB103395_1526454 Oryza sativa (japonica cultivar-group) MSP1 ...    82   8e-15   
pir|T07079|T07079 leucine-rich repeat protein LRP - tomato>gb:LE...    82   8e-15   Solanum lycopersicum
pir|H96707|H96707 probable receptor kinase T2E12.5 [imported] - ...    82   8e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AP005966_1860372 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AP002540_1822585 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AF053994_1764488 Lycopersicon esculentum Hcr2-0A (Hcr2-0A) ge...    82   1e-14   
gb:ZMA400870_1731518 Zea mays partial mRNA for somatic embryogen...    82   1e-14   
gb:AB120627_1527973 Populus nigra PnLRK1 mRNA for leucine-rich r...    82   1e-14   
gb:AB010073_1510938 Arabidopsis thaliana genomic DNA, chromosome...    82   1e-14   
gb:AP006064_1860783 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:U42445_1726335 Lycopersicon pimpinellifolium leucine rich rep...    82   1e-14   
gb:AY059776_1564626 Arabidopsis thaliana putative disease resist...    82   1e-14   
pir|T10504|T10504 disease resistance protein Cf-2.1 - currant to...    82   1e-14   Solanum pimpinellifolium [currant tomato]
pir|A71400|A71400 probable disease resistance protein - Arabidop...    82   1e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AP002522_1822349 Oryza sativa (japonica cultivar-group) genom...    81   2e-14   
gb:AY364476_1602838 Oryza sativa (indica cultivar-group) bacteri...    81   2e-14   
gb:AC129718_1740646 Oryza sativa (japonica cultivar-group) chrom...    81   2e-14   
gb:OSJN00297_1698139 Oryza sativa genomic DNA, chromosome 4, BAC...    81   2e-14   
gb:F15P11_1677567 Arabidopsis thaliana BAC F15P11.                     81   2e-14   
gb:AY091019_1574250 Arabidopsis thaliana unknown protein (At1g11...    81   2e-14   
pir|D86245|D86245 hypothetical protein [imported] - Arabidopsis ...    81   2e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AP005966_1860351 Oryza sativa (japonica cultivar-group) genom...    80   3e-14   
gb:AC097367_1736630 Oryza sativa chromosome 3 BAC OSJNBa0051C19 ...    80   3e-14   
gb:AY128385_1580684 Arabidopsis thaliana putative disease resist...    80   3e-14   
gb:AB016874_1512940 Arabidopsis thaliana genomic DNA, chromosome...    80   3e-14   
pir|G84524|G84524 probable disease resistance protein [imported]...    80   3e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AP005966_1860381 Oryza sativa (japonica cultivar-group) genom...    80   4e-14   
gb:AP004006_1836240 Oryza sativa (japonica cultivar-group) genom...    80   4e-14   
gb:BT003880_1637007 Arabidopsis thaliana clone RAFL15-22-I19 (R2...    80   4e-14   
gb:AB010698_1511224 Arabidopsis thaliana genomic DNA, chromosome...    80   4e-14   
gb:AX093382_1461111 Sequence 1 from Patent WO0118061.                  80   4e-14   
pir|G84652|G84652 probable receptor-like protein kinase [importe...    80   4e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AP000366_1819745 Oryza sativa (japonica cultivar-group) genom...    80   5e-14   
gb:PSA495759_1701999 Pisum sativum sym29 gene for serine-threoni...    80   5e-14   
gb:BT010407_1640353 Arabidopsis thaliana At3g43740 mRNA, complet...    80   5e-14   
gb:AY664415_1620622 Zea mays cultivar B73 locus 9009, complete s...    80   5e-14   
gb:AY162176_1585779 Medicago truncatula somatic embryogenesis re...    80   5e-14   
gb:AB018110_1513754 Arabidopsis thaliana genomic DNA, chromosome...    80   5e-14   
gb:AC087553_1734109 Oryza sativa (japonica cultivar-group) chrom...    79   7e-14   
gb:AC084817_1733844 Oryza sativa (japonica cultivar-group) chrom...    79   7e-14   
gb:AP003513_1830178 Oryza sativa (japonica cultivar-group) genom...    79   9e-14   
gb:ZMA277702_1731487 Zea mays mRNA for SERK1 protein.>gb:ZMA4008...    79   9e-14   
gb:AY518293_1610795 Arabidopsis thaliana strubbelig receptor fam...    79   9e-14   
gb:AY075690_1567829 Arabidopsis thaliana AT5g20480/F7C8_70 mRNA,...    79   9e-14   
pir|B86479|B86479 hypothetical protein F14D7.1 - Arabidopsis tha...    79   9e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AF244890_1780447 Glycine max receptor-like protein kinase 3 (...    79   1e-13   
pir|T14818|T14818 leucine-rich repeat protein LRP - sorghum>gb:S...    79   1e-13   Sorghum bicolor [broomcorn]
gb:AP005473_1852497 Oryza sativa (japonica cultivar-group) genom...    78   2e-13   
gb:AP003044_1824341 Oryza sativa (japonica cultivar-group) genom...    78   2e-13   
gb:AP000386_1819927 Arabidopsis thaliana genomic DNA, chromosome...    78   2e-13   
gb:AE016959_1022362 Oryza sativa (japonica cultivar-group) chrom...    78   2e-13   
pir|T04313|T04313 protein kinase Xa21 (EC 2.7.1.-), receptor typ...    78   2e-13   Oryza sativa [red rice]
pir|D84889|D84889 probable receptor-like protein kinase [importe...    78   2e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AP004769_1844738 Oryza sativa (japonica cultivar-group) genom...    78   2e-13   
gb:AK176791_1818779 Arabidopsis thaliana mRNA, complete cds, clo...    78   2e-13   
gb:AC092781_1735750 Oryza sativa chromosome 3 BAC OSJNBb0094O03 ...    78   2e-13   
gb:AY224517_1590714 Oryza sativa (japonica cultivar-group) isola...    78   2e-13   
gb:AY080729_1568448 Arabidopsis thaliana putative disease resist...    78   2e-13   
pir|T05322|T05322 hypothetical protein F18F4.240 - Arabidopsis t...    78   2e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AP002862_1823249 Oryza sativa (japonica cultivar-group) genom...    77   3e-13   
gb:AP000815_1820620 Oryza sativa (japonica cultivar-group) genom...    77   3e-13   
gb:AF196891_1776050 Fragaria vesca isolate Fr_ve_A_6 polygalactu...    77   3e-13   
gb:AB018109_1513744 Arabidopsis thaliana genomic DNA, chromosome...    77   3e-13   
gb:AB017061_1513313 Arabidopsis thaliana genomic DNA, chromosome...    77   3e-13   
gb:CQ768545_1451790 Sequence 40 from Patent WO2004007712.>gb:AY0...    77   3e-13   
pir|T10727|T10727 protein kinase Xa21 (EC 2.7.1.-) D, receptor t...    77   3e-13   Oryza longistaminata [long-staminate rice]
pir|T05050|T05050 protein kinase homolog M3E9.30 - Arabidopsis t...    77   3e-13   Arabidopsis thaliana [mouse-ear cress]
pir|T00712|T00712 protein kinase homolog F22O13.7 - Arabidopsis ...    77   3e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AF244888_1780445 Glycine max receptor-like protein kinase 1 (...    77   3e-13   
gb:AF053993_1764487 Lycopersicon esculentum disease resistance p...    77   3e-13   
gb:AY652735_1620180 Oryza sativa (japonica cultivar-group) somat...    77   3e-13   
gb:AY085401_1570470 Arabidopsis thaliana clone 15013 mRNA, compl...    77   3e-13   
gb:ATH550163_1552879 Arabidopsis thaliana mRNA for LRR receptor-...    77   3e-13   
gb:CQ768565_1451800 Sequence 60 from Patent WO2004007712.              77   3e-13   
gb:AE016959_1021016 Oryza sativa (japonica cultivar-group) chrom...    77   3e-13   
pir|T46070|T46070 hypothetical protein T18N14.120 - Arabidopsis ...    77   3e-13   Arabidopsis thaliana [mouse-ear cress]
pir|H84421|H84421 probable receptor-like protein kinase [importe...    77   3e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AJ841698_1814401 Poa pratensis serk1 gene for somatic embryog...    77   4e-13   
gb:AF364177_1791593 Oryza sativa leucine-rich repeat protein mRN...    77   4e-13   
gb:AY804250_1628647 Daucus carota antifreeze protein mRNA, compl...    77   4e-13   
gb:AY603422_1617457 Pyrus pyrifolia isolate Kousui2 leucine-rich...    77   4e-13   
gb:AY603421_1617456 Pyrus pyrifolia isolate Kousui1 leucine-rich...    77   4e-13   
gb:AY518287_1610789 Arabidopsis thaliana strubbelig receptor fam...    77   4e-13   
gb:AY463361_1607685 Oryza sativa (indica cultivar-group) benzoth...    77   4e-13   
gb:AY182165_1587873 Elaeis guineensis clone Rlk-OPff receptor-li...    77   4e-13   
gb:AC016163_1538127 Arabidopsis thaliana chromosome 1 BAC F26A9 ...    77   4e-13   
gb:AX008789_1456287 Sequence 1 from Patent WO9964600.>gb:AF05312...    77   4e-13   
pir|T00971|T00971 probable disease resistance protein [imported]...    77   4e-13   Arabidopsis thaliana [mouse-ear cress]
pir|F86410|F86410 protein F3M18.12 [imported] - Arabidopsis thal...    77   4e-13   Arabidopsis thaliana [mouse-ear cress]
pir|A57676|A57676 protein kinase Xa21 (EC 2.7.1.-), receptor typ...    77   4e-13   Oryza sativa [red rice]
gb:AP005966_1860364 Oryza sativa (japonica cultivar-group) genom...    76   6e-13   
gb:AC144737_1744140 Oryza sativa (japonica cultivar-group) chrom...    76   6e-13   
gb:AC133334_1741356 Oryza sativa chromosome 3 BAC OSJNBa0004L11 ...    76   6e-13   
gb:AC079633_1732635 Genomic Sequence for Oryza sativa, Nipponbar...    76   6e-13   
gb:OSJN00075_1694384 Oryza sativa genomic DNA, chromosome 4, BAC...    76   6e-13   
gb:OSJN00072_1694323 Oryza sativa genomic DNA, chromosome 4, BAC...    76   6e-13   
gb:BT004058_1637167 Arabidopsis thaliana clone RAFL15-09-P09 (R2...    76   6e-13   
gb:AY736123_1626037 Triticum aestivum leucine-rich repeat protei...    76   6e-13   
gb:AE005173_893273 Arabidopsis thaliana chromosome 1, bottom arm...    76   6e-13   
pir|T30553|T30553 disease resistance protein Hcr2-5D - tomato>gb...    76   6e-13   Solanum lycopersicum
pir|F96577|F96577 hypothetical protein F22G10.3 [imported] - Ara...    76   6e-13   Arabidopsis thaliana [mouse-ear cress]
pir|T01268|T01268 leucine-rich repeat transmembrane protein kina...    76   6e-13   Zea mays [maize]
pir|H84632|H84632 probable receptor-like protein kinase [importe...    76   6e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AP003434_1829316 Oryza sativa (japonica cultivar-group) genom...    76   8e-13   
gb:AP003210_1825238 Oryza sativa (japonica cultivar-group) genom...    76   8e-13   
gb:AC149487_1745022 Solanum demissum chromosome 5 clone PGEC407 ...    76   8e-13   
gb:BT000466_1634744 Arabidopsis thaliana putative disease resist...    76   8e-13   
gb:AY075617_1567762 Arabidopsis thaliana AT3g25560/MWL2_18 mRNA,...    76   8e-13   
gb:AB025639_1516701 Arabidopsis thaliana genomic DNA, chromosome...    76   8e-13   
gb:CQ768553_1451794 Sequence 48 from Patent WO2004007712.              76   8e-13   
gb:A91926_1451169 Sequence 6 from Patent WO9822591.>gb:DCA131340...    76   8e-13   
pir|A86460|A86460 99.9K hypothetical protein T1E4.10 - Arabidops...    76   8e-13   Arabidopsis thaliana [mouse-ear cress]
pir|T05259|T05259 probable disease resistance protein F18A5.290 ...    76   8e-13   Arabidopsis thaliana [mouse-ear cress]
pir|T10659|T10659 probable serine/threonine-specific protein kin...    76   8e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AP005966_1860357 Oryza sativa (japonica cultivar-group) genom...    75   1e-12   
gb:AP005420_1851511 Oryza sativa (japonica cultivar-group) genom...    75   1e-12   
gb:AP002522_1822351 Oryza sativa (japonica cultivar-group) genom...    75   1e-12   
gb:AJ620355_1812309 Rubus idaeus partial pgip1 gene for putative...    75   1e-12   
gb:AJ620336_1812307 Rubus idaeus mRNA for putative polygalacturo...    75   1e-12   
gb:AF466358_1802293 Oryza sativa (japonica cultivar-group) flora...    75   1e-12   
gb:AF053997_1764491 Lycopersicon esculentum Hcr2-5B (Hcr2-5B) ge...    75   1e-12   
gb:AF053995_1764489 Lycopersicon esculentum Hcr2-0B (Hcr2-0B) ge...    75   1e-12   
gb:OSJN00042_1693769 Oryza sativa genomic DNA, chromosome 4, BAC...    75   1e-12   
gb:AY603423_1617458 Pyrus pyrifolia isolate Kinchaku leucine-ric...    75   1e-12   
gb:AY048200_1561662 Arabidopsis thaliana At1g71830/F14O23_24 mRN...    75   1e-12   
gb:AC026815_1539693 Oryza sativa chromosome 10 BAC OSJNBa0079L16...    75   1e-12   
gb:A67827_1450282 Sequence 32 from Patent WO9743427.>gb:CQ768543...    75   1e-12   
gb:A67825_1450281 Sequence 30 from Patent WO9743427.                   75   1e-12   
gb:A67821_1450279 Sequence 26 from Patent WO9743427.                   75   1e-12   
gb:A67819_1450278 Sequence 24 from Patent WO9743427.>gb:AY081542...    75   1e-12   
gb:AE016959_1023026 Oryza sativa (japonica cultivar-group) chrom...    75   1e-12   
pir|T05251|T05251 probable disease resistance protein F18A5.210 ...    75   1e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AF023164_1762043 Zea mays leucine-rich repeat transmembrane p...    75   1e-12   
gb:AB188247_1529358 Oryza sativa (japonica cultivar-group) OsSER...    75   1e-12   
gb:AB029327_1518169 Nicotiana tabacum mRNA for elicitor-inducibl...    75   1e-12   
gb:CQ768541_1451788 Sequence 36 from Patent WO2004007712.              75   1e-12   
pir|T01267|T01267 leucine-rich repeat transmembrane protein kina...    75   1e-12   Zea mays [maize]
gb:AP004762_1844627 Oryza sativa (japonica cultivar-group) genom...    75   2e-12   
gb:AP003705_1832164 Oryza sativa (japonica cultivar-group) genom...    75   2e-12   
gb:AP003453_1829707 Oryza sativa (japonica cultivar-group) genom...    75   2e-12   
gb:AP002522_1822343 Oryza sativa (japonica cultivar-group) genom...    75   2e-12   
gb:AF436829_1799881 Arabidopsis thaliana AT4g26540/M3E9_30 mRNA,...    75   2e-12   
gb:AC116926_1739356 Genomic sequence for Oryza sativa (japonica ...    75   2e-12   
gb:AC104427_1737594 Oryza sativa (japonica cultivar-group) chrom...    75   2e-12   
gb:AC079633_1732639 Genomic Sequence for Oryza sativa, Nipponbar...    75   2e-12   
gb:AB025621_1516426 Arabidopsis thaliana genomic DNA, chromosome...    75   2e-12   
gb:AE016959_1023023 Oryza sativa (japonica cultivar-group) chrom...    75   2e-12   
gb:AE016959_1022229 Oryza sativa (japonica cultivar-group) chrom...    75   2e-12   
gb:AE016959_1020712 Oryza sativa (japonica cultivar-group) chrom...    75   2e-12   
pir|B84852|B84852 probable receptor-like protein kinase [importe...    75   2e-12   Arabidopsis thaliana [mouse-ear cress]
pir|B84431|B84431 probable receptor protein kinase [imported] - ...    75   2e-12   Arabidopsis thaliana [mouse-ear cress]
pir|B86465|B86465 probable Protein kinase [imported] - Arabidops...    75   2e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AP005966_1860355 Oryza sativa (japonica cultivar-group) genom...    74   2e-12   
gb:AP004991_1846852 Oryza sativa (japonica cultivar-group) genom...    74   2e-12   
gb:AP004256_1839206 Oryza sativa (japonica cultivar-group) genom...    74   2e-12   
gb:AP004039_1836723 Oryza sativa (japonica cultivar-group) genom...    74   2e-12   
gb:AP003858_1834409 Oryza sativa (japonica cultivar-group) genom...    74   2e-12   
gb:AJ864508_1814988 Phaseolus vulgaris ppgip3 gene for polygalac...    74   2e-12   
gb:AJ786410_1814068 Phaseolus vulgaris bpgip3 gene for polygalac...    74   2e-12   
gb:AF529693_1809051 Brassica napus polygalacturonase inhibitor p...    74   2e-12   
gb:AF084034_1767051 Arabidopsis thaliana receptor-like protein k...    74   2e-12   
gb:AY064972_1566148 Arabidopsis thaliana AT4g08850/T32A17_160 mR...    74   2e-12   
gb:AY054256_1563076 Arabidopsis thaliana AT5g67280/K3G17_4 mRNA,...    74   2e-12   
gb:ATH550162_1552878 Arabidopsis thaliana mRNA for LRR receptor-...    74   2e-12   
gb:AB071018_1522721 Citrus hystrix PGIP gene for polygalacturona...    74   2e-12   
gb:AB025614_1516378 Arabidopsis thaliana genomic DNA, chromosome...    74   2e-12   
gb:AE016959_1023018 Oryza sativa (japonica cultivar-group) chrom...    74   2e-12   
gb:AE016959_1022230 Oryza sativa (japonica cultivar-group) chrom...    74   2e-12   
pir|G96524|G96524 protein T1N15.9 [imported] - Arabidopsis thali...    74   2e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AP005846_1858989 Oryza sativa (japonica cultivar-group) genom...    74   3e-12   
gb:AP003883_1834801 Oryza sativa (japonica cultivar-group) genom...    74   3e-12   
gb:AJ841697_1814400 Poa pratensis serk2 gene for somatic embryog...    74   3e-12   
gb:AF196890_1776049 Fragaria iinumae isolate Fr_ii_PCR polygalac...    74   3e-12   
pir|B85089|B85089 receptor protein kinase-like protein [imported...    74   3e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AP005633_1855149 Oryza sativa (japonica cultivar-group) genom...    74   4e-12   
gb:AP004661_1842839 Oryza sativa (japonica cultivar-group) genom...    74   4e-12   
gb:AP003742_1832731 Oryza sativa (japonica cultivar-group) genom...    74   4e-12   
gb:AF196909_1776068 Physocarpus capitatus isolate Ph_ca_7 polyga...    74   4e-12   
gb:AF196869_1776033 Aruncus dioicus isolate Ar_di_8 polygalactur...    74   4e-12   
gb:AF196868_1776032 Aruncus dioicus isolate Ar_di_5 polygalactur...    74   4e-12   
gb:AC120509_1739833 Oryza sativa chromosome 3 BAC OSJNBb0081K01 ...    74   4e-12   
gb:AC084380_1733540 Oryza sativa chromosome 3 BAC OSJNBa0090P23 ...    74   4e-12   
gb:AB062508_1522128 Citrus jambhiri PGIP1 mRNA for polygalacturo...    74   4e-12   
gb:AB019235_1514215 Arabidopsis thaliana genomic DNA, chromosome...    74   4e-12   
pir|T00914|T00914 leucine-rich repeat protein F21B7.28 - Arabido...    74   4e-12   Arabidopsis thaliana [mouse-ear cress]
pir|A86166|A86166 protein F21B7.6 [imported] - Arabidopsis thali...    74   4e-12   Arabidopsis thaliana [mouse-ear cress]
pir|T46033|T46033 receptor protein kinase-like protein - Arabido...    74   4e-12   Arabidopsis thaliana [mouse-ear cress]
pir|T04568|T04568 protein kinase homolog T12H17.120 - Arabidopsi...    74   4e-12   Arabidopsis thaliana [mouse-ear cress]
pir|T05898|T05898 hypothetical protein F6H11.170 - Arabidopsis t...    74   4e-12   Arabidopsis thaliana [mouse-ear cress]
pir|C86203|C86203 hypothetical protein [imported] - Arabidopsis ...    74   4e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AP004747_1844315 Oryza sativa (japonica cultivar-group) genom...    73   5e-12   
gb:AP004611_1842079 Oryza sativa (japonica cultivar-group) genom...    73   5e-12   
gb:AP004326_1840210 Oryza sativa (japonica cultivar-group) genom...    73   5e-12   
gb:AF466199_1802194 Sorghum bicolor putative receptor protein ki...    73   5e-12   
gb:OSJN00174_1696186 Oryza sativa genomic DNA, chromosome 4, BAC...    73   5e-12   
gb:OSB6015_1692796 Oryza sativa indica(GLA4) genomic DNA, chromo...    73   5e-12   
gb:AY903226_1632099 Prunus americana polygalacturonase-inhibitin...    73   5e-12   
gb:AY903219_1632092 Prunus persica polygalacturonase-inhibiting ...    73   5e-12   
gb:AY352426_1601791 Prunus persica polygalacturonase inhibiting ...    73   5e-12   
gb:AB013397_1512201 Citrus jambhiri pgip A gene for polygalactur...    73   5e-12   
gb:AF196925_1776079 Prunus dulcis isolate Pr_du_PCR polygalactur...    73   6e-12   
gb:AF049920_1764119 Petunia x hybrida PGPS/D4 (PGPS/D4) mRNA, co...    73   6e-12   
gb:AY244746_1592517 Arabidopsis thaliana ERECTA-like kinase 2 (E...    73   6e-12   
gb:AY182166_1587874 Elaeis guineensis clone Rlk-OPmf receptor-li...    73   6e-12   
pir|T48489|T48489 receptor-like protein kinase - Arabidopsis tha...    73   6e-12   
pir|A86383|A86383 76.4K protein kinase homolog F4F7.29 - Arabido...    73   6e-12   
gb:AP005826_1858575 Oryza sativa (japonica cultivar-group) genom...    72   8e-12   
gb:AP004039_1836725 Oryza sativa (japonica cultivar-group) genom...    72   8e-12   
gb:AP003622_1831610 Oryza sativa (japonica cultivar-group) genom...    72   8e-12   
gb:AF196947_1776100 Sorbaria sorbifolia isolate So_so_3 polygala...    72   8e-12   
gb:PSY250467_1702600 Pinus sylvestris mRNA for receptor protein ...    72   8e-12   
gb:AY903224_1632097 Prunus mume polygalacturonase-inhibiting pro...    72   8e-12   
pir|T45645|T45645 receptor kinase-like protein - Arabidopsis tha...    72   8e-12   
gb:AP004752_1844402 Oryza sativa (japonica cultivar-group) genom...    72   1e-11   
gb:AP003858_1834408 Oryza sativa (japonica cultivar-group) genom...    72   1e-11   
gb:AK117435_1815469 Arabidopsis thaliana At5g41180 mRNA for puta...    72   1e-11   
gb:AF529691_1809049 Brassica napus polygalacturonase inhibitor p...    72   1e-11   
gb:AF384970_1794545 Arabidopsis thaliana somatic embryogenesis r...    72   1e-11   
gb:AF305093_1784440 Vitis vinifera polygalacturonase inhibiting ...    72   1e-11   
gb:AF196926_1776080 Prunus emarginata isolate Pr_em_1 polygalact...    72   1e-11   
gb:OSJN00123_1695267 Oryza sativa genomic DNA, chromosome 4, BAC...    72   1e-11   
gb:AY903220_1632093 Prunus persica polygalacturonase-inhibiting ...    72   1e-11   
gb:AY088040_1573064 Arabidopsis thaliana clone 40594 mRNA, compl...    72   1e-11   
gb:AY040533_1560597 Gossypium hirsutum leucine-rich repeat resis...    72   1e-11   
gb:AB071017_1522720 Citrus latipes PGIP gene for polygalacturona...    72   1e-11   
gb:AB022211_1514984 Arabidopsis thaliana genomic DNA, chromosome...    72   1e-11   
gb:AB010072_1510934 Arabidopsis thaliana genomic DNA, chromosome...    72   1e-11   
gb:AE016959_1021557 Oryza sativa (japonica cultivar-group) chrom...    72   1e-11   
pir|T45647|T45647 receptor protein kinase-like protein - Arabido...    72   1e-11   
pir|T05897|T05897 protein kinase homolog F6H11.160 - Arabidopsis...    72   1e-11   
sp|Q94F62|BAK1_ARATH|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated re...    72   1e-11   
gb:AF365929_1791620 Lycopersicon esculentum verticillium wilt di...    72   1e-11   
gb:AC132489_1741183 Oryza sativa (japonica cultivar-group) chrom...    72   1e-11   
gb:BT006038_1638932 Arabidopsis thaliana clone U50539 putative d...    72   1e-11   
gb:BT000348_1634626 Arabidopsis thaliana Unknown protein (At1g07...    72   1e-11   
gb:AY088297_1573317 Arabidopsis thaliana clone 5344 mRNA, comple...    72   1e-11   
gb:AC013288_1537852 Arabidopsis thaliana chromosome 1 BAC F4N21 ...    72   1e-11   
gb:AB092809_1525111 Lotus corniculatus var. japonicus HAR1 gene ...    72   1e-11   
gb:AB062509_1522129 Citrus jambhiri PGIP2 mRNA for polygalacturo...    72   1e-11   
gb:CQ768569_1451802 Sequence 64 from Patent WO2004007712.              72   1e-11   
pir|B86272|B86272 protein F16A14.12 [imported] - Arabidopsis tha...    72   1e-11   
sp|Q9M5J9|PGI1_ARATH|PGI1_ARATH Polygalacturonase inhibitor 1 precursor (Po...    72   1e-11   
gb:AP005966_1860358 Oryza sativa (japonica cultivar-group) genom...    71   2e-11   
gb:AP003952_1835675 Oryza sativa (japonica cultivar-group) genom...    71   2e-11   
gb:AF243040_1780205 Lycopersicon esculentum receptor-like protei...    71   2e-11   
gb:AF196908_1776067 Physocarpus capitatus isolate Ph_ca_2 polyga...    71   2e-11   
gb:AF023166_1762045 Zea mays leucine-rich repeat transmembrane p...    71   2e-11   
gb:AY099851_1576876 Arabidopsis thaliana receptor protein kinase...    71   2e-11   
gb:AY070043_1566686 Arabidopsis thaliana putative receptor kinas...    71   2e-11   
gb:AB115767_1527521 Citrus unshiu SERK mRNA for somatic embryoge...    71   2e-11   
gb:AB092811_1525116 Glycine max NTS1 gene for LRR receptor-like ...    71   2e-11   
gb:AB015643_1512714 Citrus sp. cv. Sainumphung gene for Polygala...    71   2e-11   
gb:CQ768563_1451799 Sequence 58 from Patent WO2004007712.              71   2e-11   
pir|T01296|T01296 leucine-rich repeat transmembrane protein kina...    71   2e-11   
pir|T50850|T50850 receptor protein kinase homolog [imported] - s...    71   2e-11   
pir|T04587|T04587 hypothetical protein F23E13.70 - Arabidopsis t...    71   2e-11   
pir|T08575|T08575 protein kinase homolog T22F8.170 - Arabidopsis...    71   2e-11   
gb:AP003977_1835846 Oryza sativa (japonica cultivar-group) genom...    71   2e-11   
gb:AP003915_1835150 Oryza sativa (japonica cultivar-group) genom...    71   2e-11   
gb:AJ609275_1812000 Cicer arietinum mRNA for leucine rich repeat...    71   2e-11   
gb:AF531456_1809324 Brassica napus polygalacturonase inhibitory ...    71   2e-11   
gb:AF503433_1806732 Sorghum bicolor BAC 170F8, complete sequence.      71   2e-11   
gb:AF196953_1776106 Stephanandra chinensis isolate St_ch_C polyg...    71   2e-11   
gb:AF196951_1776104 Stephanandra chinensis isolate St_ch_A polyg...    71   2e-11   
gb:AF196949_1776102 Spiraea densiflora isolate Sp_de_1 polygalac...    71   2e-11   
gb:AF196910_1776069 Physocarpus opulifolius isolate Ph_op_A poly...    71   2e-11   
gb:AC121365_1740180 Oryza sativa (japonica cultivar-group) chrom...    71   2e-11   
gb:AC111015_1738814 Oryza sativa (japonica cultivar-group) chrom...    71   2e-11   
gb:AC084817_1733839 Oryza sativa (japonica cultivar-group) chrom...    71   2e-11   
gb:OSJN00152_1695767 Oryza sativa genomic DNA, chromosome 4, BAC...    71   2e-11   
gb:AY883417_1631947 Prunus americana polygalacturonase-inhibitin...    71   2e-11   
gb:AB071020_1522723 Citrus aurantiifolia PGIP gene for polygalac...    71   2e-11   
pir|C84524|C84524 probable disease resistance protein [imported]...    71   2e-11   
gb:AP005846_1858988 Oryza sativa (japonica cultivar-group) genom...    70   3e-11   
gb:AP005064_1847429 Oryza sativa (japonica cultivar-group) genom...    70   3e-11   
gb:AP004747_1844313 Oryza sativa (japonica cultivar-group) genom...    70   3e-11   
gb:AP003630_1831761 Oryza sativa (japonica cultivar-group) genom...    70   3e-11   
gb:AP002061_1821787 Arabidopsis thaliana genomic DNA, chromosome...    70   3e-11   
gb:AF497474_1805875 Aegilops tauschii leucine-rich-like protein ...    70   3e-11   
gb:AF196950_1776103 Spiraea densiflora isolate Sp_de_2 polygalac...    70   3e-11   
gb:AF196911_1776070 Physocarpus opulifolius isolate Ph_op_D poly...    70   3e-11   
gb:AF196870_1776034 Cercocarpus ledifolius isolate Ce_le_PCR pol...    70   3e-11   
gb:AY903218_1632091 Prunus persica polygalacturonase-inhibiting ...    70   3e-11   
gb:AY618864_1618283 Glycine max cultivar PI 548402 LRR-kinase pr...    70   3e-11   
gb:AY062680_1565336 Arabidopsis thaliana Unknown protein (At1g09...    70   3e-11   
gb:ATAC018363_1543678 Arabidopsis thaliana chromosome III BAC F1...    70   3e-11   
pir|S47965|S47965 polygalacturonase inhibitor protein - tomato>g...    70   3e-11   
pir|T00502|T00502 probable receptor-like protein kinase At2g2330...    70   3e-11   
pir|B86234|B86234 hypothetical protein [imported] - Arabidopsis ...    70   3e-11   
gb:AP005709_1856432 Oryza sativa (japonica cultivar-group) genom...    70   4e-11   
gb:AP003276_1827044 Oryza sativa (japonica cultivar-group) genom...    70   4e-11   
gb:AF196905_1776064 Lyonothamnus floribundus isolate Ly_fl_D pol...    70   4e-11   
gb:AF196903_1776062 Lyonothamnus floribundus isolate Ly_fl_B pol...    70   4e-11   
gb:AF196901_1776060 Kerria japonica isolate Ke_ja_B_2 polygalact...    70   4e-11   
gb:AF196899_1776058 Kerria japonica isolate Ke_ja_A_6 polygalact...    70   4e-11   
gb:AF172282_1774418 Oryza sativa adh1-adh2 region.                     70   4e-11   
gb:AF137354_1771222 Pisum sativum leucine-rich repeat protein (L...    70   4e-11   
gb:OSJN00093_1694775 Oryza sativa genomic DNA, chromosome 4, BAC...    70   4e-11   
gb:AY534122S2_1612167 Aegilops tauschii transposons Caspar, XJ, ...    70   4e-11   
gb:AY279356_1594617 Gossypium barbadense polygalacturonase-inhib...    70   4e-11   
gb:AY226583_1591035 X Citrofortunella mitis leucine-rich repeat ...    70   4e-11   
gb:AY070033_1566676 Arabidopsis thaliana unknown protein (At3g56...    70   4e-11   
gb:AY050535_1562263 Arabidopsis thaliana leucine-rich repeat rec...    70   4e-11   
gb:AB064546_1522366 Citrus sp. cv. Sainumphung PGIP3 gene for po...    70   4e-11   
gb:AB019230_1514140 Arabidopsis thaliana genomic DNA, chromosome...    70   4e-11   
gb:AB016206_1512781 Citrus iyo gene for polygalacturonase inhibi...    70   4e-11   
gb:AB016204_1512779 Citrus unshiu gene for polygalacturonase inh...    70   4e-11   
gb:AB015356_1512469 Citrus sp. cv. Sainumphung gene for polygala...    70   4e-11   
gb:AE016959_1020720 Oryza sativa (japonica cultivar-group) chrom...    70   4e-11   
pir|T49038|T49038 hypothetical protein T5P19.20 - Arabidopsis th...    70   4e-11   
pir|C96654|C96654 hypothetical protein F16P17.10 [imported] - Ar...    70   4e-11   
gb:AP003282_1827213 Oryza sativa (japonica cultivar-group) genom...    70   5e-11   
gb:AF196906_1776065 Neviusia alabamensis isolate Ne_al_4 polygal...    70   5e-11   
gb:AF196900_1776059 Kerria japonica isolate Ke_ja_B_1 polygalact...    70   5e-11   
gb:AF196876_1776040 Chamaebatiaria millefolium isolate Ch_mi_2_3...    70   5e-11   
gb:OSJN00195_1696533 Oryza sativa genomic DNA, chromosome 4, BAC...    70   5e-11   
gb:AY903222_1632095 Prunus mume polygalacturonase-inhibiting pro...    70   5e-11   
gb:AY764131_1627105 Prunus mume polygalacturonase inhibiting pro...    70   5e-11   
gb:AY618863_1618282 Glycine max cultivar PI 437488 LRR-kinase pr...    70   5e-11   
gb:AY618857_1618276 Glycine max cultivar PI 567660-B LRR-kinase ...    70   5e-11   
gb:AY618847_1618266 Glycine max cultivar PI 437770 LRR-kinase pr...    70   5e-11   
gb:AY597126_1617100 Glycine max cultivar PI 79609 LRR-kinase pro...    70   5e-11   
gb:AY597123_1617097 Glycine max cultivar PI 567577 LRR-kinase pr...    70   5e-11   
gb:AY597077_1617051 Glycine max cultivar PI 567432-A LRR-kinase ...    70   5e-11   
gb:AY597073_1617047 Glycine max cultivar PI 54591 LRR-kinase pro...    70   5e-11   
gb:AY597071_1617045 Glycine max cultivar PI 87631-1 LRR-kinase p...    70   5e-11   
gb:AY534122S2_1612170 Aegilops tauschii transposons Caspar, XJ, ...    70   5e-11   
gb:AY333105_1600070 Pyrus communis cultivar Flemish Beauty polyg...    70   5e-11   
gb:AY086189_1571244 Arabidopsis thaliana clone 22221 mRNA, compl...    70   5e-11   
gb:AB064547_1522367 Citrus sp. cv. Sainumphung PGIP1 gene for po...    70   5e-11   
gb:AB015198_1512445 Citrus jambhiri PGIP B gene for polygalactur...    70   5e-11   
pir|T51383|T51383 receptor protein kinase-like protein - Arabido...    70   5e-11   
pir|T05335|T05335 hypothetical protein F1C12.190 - Arabidopsis t...    70   5e-11   
gb:AP005593_1854663 Oryza sativa (japonica cultivar-group) genom...    69   7e-11   
gb:AP004564_1841662 Oryza sativa (japonica cultivar-group) genom...    69   7e-11   
gb:AP004308_1839999 Oryza sativa (japonica cultivar-group) genom...    69   7e-11   
gb:AF196927_1776081 Purshia tridentata isolate Pu_tr_2 polygalac...    69   7e-11   
gb:AF196874_1776038 Chamaebatiaria millefolium isolate Ch_mi_1_1...    69   7e-11   
gb:LES303345_1684557 Lycopersicon esculentum lateral suppressor ...    69   7e-11   
gb:AY084350_1569441 Arabidopsis thaliana clone 105146 mRNA, comp...    69   7e-11   
gb:AB020529_1514523 Fortunella margarita gene for polygalacturon...    69   7e-11   
gb:AB020528_1514522 Poncirus trifoliata gene for Polygalacturona...    69   7e-11   
gb:AB006705_1509997 Arabidopsis thaliana genomic DNA, chromosome...    69   7e-11   
gb:CQ768551_1451793 Sequence 46 from Patent WO2004007712.              69   7e-11   
pir|T10263|T10263 probable polygalacturonase-inhibiting protein ...    69   7e-11   
pir|B84782|B84782 probable receptor-like protein kinase [importe...    69   7e-11   
gb:AP003898_1834956 Oryza sativa (japonica cultivar-group) genom...    69   9e-11   
gb:AJ786411_1814069 Phaseolus vulgaris bpgip4 gene for polygalac...    69   9e-11   
gb:AF499451_1806114 Vitis vinifera polygalacturonase-inhibiting ...    69   9e-11   
gb:AF244889_1780446 Glycine max receptor-like protein kinase 2 (...    69   9e-11   
gb:AF196948_1776101 Spiraea cantoniensis isolate Sp_ca_PCR polyg...    69   9e-11   
gb:AF196873_1776037 Chamaebatia foliolosa isolate Ch_fo_2 polyga...    69   9e-11   
gb:AY618862_1618281 Glycine max cultivar PI 567562-A LRR-kinase ...    69   9e-11   
gb:AY618861_1618280 Glycine max cultivar PI 404198-B LRR-kinase ...    69   9e-11   
gb:AY618860_1618279 Glycine max cultivar PI 437679 LRR-kinase pr...    69   9e-11   
gb:AY618859_1618278 Glycine max cultivar PI 339868-B LRR-kinase ...    69   9e-11   
gb:AY618858_1618277 Glycine max cultivar PI 509095 LRR-kinase pr...    69   9e-11   
gb:AY618848_1618267 Glycine max cultivar PI 507471 LRR-kinase pr...    69   9e-11   
gb:AY618846_1618265 Glycine max cultivar PI 437725 LRR-kinase pr...    69   9e-11   
gb:AY618845_1618264 Glycine max cultivar PI 567445-A LRR-kinase ...    69   9e-11   
gb:AY597124_1617098 Glycine max cultivar PI 548349 LRR-kinase pr...    69   9e-11   
gb:AY597074_1617048 Glycine max cultivar PI 567568-A LRR-kinase ...    69   9e-11   
gb:AY597072_1617046 Glycine max cultivar PI 84751 LRR-kinase pro...    69   9e-11   
gb:AY597056_1617032 Glycine max cultivar PI 408192-2 LRR-kinase ...    69   9e-11   
gb:AY056243_1563564 Arabidopsis thaliana unknown protein (At2g13...    69   9e-11   
gb:AC009894_1536869 Arabidopsis thaliana chromosome I BAC T6H22 ...    69   9e-11   
gb:AB178084_1528917 Daucus carota LRR-S/T-RLK mRNA for putative ...    69   9e-11   
gb:CQ768567_1451801 Sequence 62 from Patent WO2004007712.              69   9e-11   
pir|G86459|G86459 Hypothetical 55.6 kDa protein - Arabidopsis th...    69   9e-11   
sp|P47735|RLK5_ARATH|RLK5_ARATH Receptor-like protein kinase 5 precursor (E...    69   9e-11   
sp|Q8L899|BRI1_LYCPE|BRI1_LYCPE Systemin receptor SR160 precursor (EC 2.7.1...    69   9e-11   
sp|Q8GUQ5|BRI1_LYCES|BRI1_LYCES Brassinosteroid LRR receptor kinase precurs...    69   9e-11   
gb:AF196945_1776098 Rhodotypos scandens isolate Rh_sc_2_A1 polyg...    69   1e-10   
gb:BT010733_1640679 Arabidopsis thaliana At3g57830 gene, complet...    69   1e-10   
gb:AY445043_1606515 Eucalyptus grandis polygalacturonase-inhibit...    69   1e-10   
gb:AB109215_1526831 Hordeum vulgare BRI1 gene for putative brass...    69   1e-10   
gb:AB088206_1524763 Hordeum vulgare BRI1 mRNA for putative brass...    69   1e-10   
pir|T46005|T46005 receptor-like protein kinase - Arabidopsis tha...    69   1e-10   
pir|T45718|T45718 receptor-kinase like protein - Arabidopsis tha...    69   1e-10   
sp|Q05091|PGIP_PYRCO|PGIP_PYRCO Polygalacturonase inhibitor precursor (Poly...    69   1e-10   
gb:AP006163_1861161 Oryza sativa (japonica cultivar-group) genom...    68   2e-10   
gb:AP005966_1860365 Oryza sativa (japonica cultivar-group) genom...    68   2e-10   
gb:AK118516_1816488 Arabidopsis thaliana At1g17230 mRNA for puta...    68   2e-10   
gb:AF272367_1782238 Lycopersicon esculentum verticillium wilt di...    68   2e-10   
gb:AF272366_1782237 Lycopersicon esculentum verticillium wilt di...    68   2e-10   
gb:AF196942_1776095 Rhodotypos scandens isolate Rh_sc_2_2 polyga...    68   2e-10   
gb:AF159171_1773210 Eucalyptus nitens polygalacturonase-inhibiti...    68   2e-10   
gb:OSJN00195_1696534 Oryza sativa genomic DNA, chromosome 4, BAC...    68   2e-10   
gb:OSJN00093_1694777 Oryza sativa genomic DNA, chromosome 4, BAC...    68   2e-10   
gb:AY282579_1594709 Solanum lycopersicoides disease resistance p...    68   2e-10   
gb:AY268139_1593942 Hordeum vulgare BAC 184G9, complete sequece.       68   2e-10   
gb:AY088110_1573134 Arabidopsis thaliana clone 41409 mRNA, compl...    68   2e-10   
gb:AY039985_1560489 Arabidopsis thaliana unknown protein (At5g12...    68   2e-10   
gb:AB104529_1526474 Pisum sativum LKA mRNA for brassinosteroid r...    68   2e-10   
gb:AB022220_1515144 Arabidopsis thaliana genomic DNA, chromosome...    68   2e-10   
pir|T04868|T04868 hypothetical protein F28A21.170 - Arabidopsis ...    68   2e-10   
pir|T49908|T49908 hypothetical protein T24H18.110 - Arabidopsis ...    68   2e-10   
pir|T50851|T50851 receptor protein kinase homolog [imported] - s...    68   2e-10   
pir|E86308|E86308 hypothetical protein F20D23.7 - Arabidopsis th...    68   2e-10   
gb:AP005826_1858573 Oryza sativa (japonica cultivar-group) genom...    68   2e-10   
gb:AP003865_1834503 Oryza sativa (japonica cultivar-group) genom...    68   2e-10   
gb:AP003227_1825640 Oryza sativa (japonica cultivar-group) genom...    68   2e-10   
gb:AP002522_1822355 Oryza sativa (japonica cultivar-group) genom...    68   2e-10   
gb:AK117932_1815939 Arabidopsis thaliana At1g63430 mRNA for puta...    68   2e-10   
gb:AF531457_1809325 Brassica napus polygalacturonase inhibitory ...    68   2e-10   
gb:AF263465_1781689 Prunus mahaleb polygalacturonase inhibiting ...    68   2e-10   
gb:AF196944_1776097 Rhodotypos scandens isolate Rh_sc_2_7 polyga...    68   2e-10   
gb:OSJN00189_1696455 Oryza sativa genomic DNA, chromosome 4, BAC...    68   2e-10   
gb:AB010697_1511196 Arabidopsis thaliana genomic DNA, chromosome...    68   2e-10   
pir|T45692|T45692 receptor-like protein kinase homolog - Arabido...    68   2e-10   
gb:AP005536_1853704 Oryza sativa (japonica cultivar-group) genom...    67   3e-10   
gb:AF196928_1776082 Purshia tridentata isolate Pu_tr_4 polygalac...    67   3e-10   
gb:AC133334_1741357 Oryza sativa chromosome 3 BAC OSJNBa0004L11 ...    67   3e-10   
gb:AC119796_1739716 Oryza sativa (japonica cultivar-group) chrom...    67   3e-10   
gb:AC084818_1733860 Oryza sativa (japonica cultivar-group) chrom...    67   3e-10   
gb:T1N24_1723666 Arabidopsis thaliana BAC T1N24.                       67   3e-10   
gb:OSJN00093_1694778 Oryza sativa genomic DNA, chromosome 4, BAC...    67   3e-10   
gb:BT002464_1636067 Arabidopsis thaliana disease resistance prot...    67   3e-10   
gb:AY333103_1600068 Pyrus pyrifolia cultivar Kinchaku polygalact...    67   3e-10   
gb:AY188755_1588361 Zea mays atypical receptor-like kinase MARK ...    67   3e-10   
gb:AP003302_1827702 Oryza sativa (japonica cultivar-group) genom...    67   3e-10   
gb:AP003255_1826441 Oryza sativa (japonica cultivar-group) genom...    67   3e-10   


>gb:AK117863_1815873 Arabidopsis thaliana At1g79620 mRNA for unknown
           protein, complete cds, clone: RAFL19-03-A10.
          Length = 971

 Score =  220 bits (560), Expect = 2e-56
 Identities = 106/196 (54%), Positives = 131/196 (66%)
 Frame = +3

Query: 162 FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLS 341
           F  F  I + TD  D  A+++L D W N PPSW    DPCG  WEGV CN SR+ +L LS
Sbjct: 22  FTVFSMISSVTDPRDAAALRSLMDQWDNTPPSWGGSDDPCGTPWEGVSCNNSRITALGLS 81

Query: 342 SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS 521
           +M L G LSGDI EL+EL+ LDLS+N+ LTGSL   +G+L+KL  LIL GCGF G IP+ 
Sbjct: 82  TMGLKGRLSGDIGELAELRSLDLSFNRGLTGSLTSRLGDLQKLNILILAGCGFTGTIPNE 141

Query: 522 IGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVG 701
           +G              F G IP SLG L+++YWLDLADNQLTG IP+S G++PGLD+L+ 
Sbjct: 142 LGYLKDLSFLALNSNNFTGKIPASLGNLTKVYWLDLADNQLTGPIPISSGSSPGLDLLLK 201

Query: 702 TKHFHFGXNKFSGEIP 749
            KHFHF  N+ SG IP
Sbjct: 202 AKHFHFNKNQLSGTIP 217



 Score = 32.3 bits (72), Expect = 9.5
 Identities = 30/123 (24%), Positives = 53/123 (43%), Gaps = 1/123 (0%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF-G 506
           L L    LTG++  ++  L+ +  L+L++NK L GSLP ++ ++K +  + L    F   
Sbjct: 254 LRLDRNTLTGKVPENLSNLTNIIELNLAHNK-LVGSLP-DLSDMKSMNYVDLSNNSFDPS 311

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
             P                    GP+P  L    +L  + L  N   G++ + D   P L
Sbjct: 312 ESPLWFSTLPSLTTLVMEYGSLQGPLPNKLFGFPQLQQVRLKKNAFNGTLSLGDTVGPEL 371

Query: 687 DML 695
            ++
Sbjct: 372 QLV 374



>gb:AE005173_895483 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC010793_1537061 Genomic sequence
           for Arabidopsis thaliana BAC F20B17 from chromosome I,
           complete sequence.
          Length = 980

 Score =  220 bits (560), Expect = 2e-56
 Identities = 106/196 (54%), Positives = 131/196 (66%)
 Frame = +3

Query: 162 FIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLS 341
           F  F  I + TD  D  A+++L D W N PPSW    DPCG  WEGV CN SR+ +L LS
Sbjct: 22  FTVFSMISSVTDPRDAAALRSLMDQWDNTPPSWGGSDDPCGTPWEGVSCNNSRITALGLS 81

Query: 342 SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS 521
           +M L G LSGDI EL+EL+ LDLS+N+ LTGSL   +G+L+KL  LIL GCGF G IP+ 
Sbjct: 82  TMGLKGRLSGDIGELAELRSLDLSFNRGLTGSLTSRLGDLQKLNILILAGCGFTGTIPNE 141

Query: 522 IGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVG 701
           +G              F G IP SLG L+++YWLDLADNQLTG IP+S G++PGLD+L+ 
Sbjct: 142 LGYLKDLSFLALNSNNFTGKIPASLGNLTKVYWLDLADNQLTGPIPISSGSSPGLDLLLK 201

Query: 702 TKHFHFGXNKFSGEIP 749
            KHFHF  N+ SG IP
Sbjct: 202 AKHFHFNKNQLSGTIP 217



 Score = 32.3 bits (72), Expect = 9.5
 Identities = 29/126 (23%), Positives = 55/126 (43%), Gaps = 1/126 (0%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           ++ + L    LTG++  ++  L+ +  L+L++NK L GSLP ++ ++K +  + L    F
Sbjct: 227 LIHVRLDRNTLTGKVPENLSNLTNIIELNLAHNK-LVGSLP-DLSDMKSMNYVDLSNNSF 284

Query: 501 F-GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
                P                    GP+P  L    +L  + L  N   G++ + D   
Sbjct: 285 DPSESPLWFSTLPSLTTLVMEYGSLQGPLPNKLFGFPQLQQVRLKKNAFNGTLSLGDTVG 344

Query: 678 PGLDML 695
           P L ++
Sbjct: 345 PELQLV 350



>gb:BT006486_1639373 Arabidopsis thaliana At5g49760 gene, complete
           cds.>gb:AK117123_1815170 Arabidopsis thaliana At5g49760
           mRNA for putative receptor protein kinase, complete cds,
           clone: RAFL16-66-A16.
          Length = 953

 Score =  219 bits (559), Expect = 3e-56
 Identities = 111/205 (54%), Positives = 135/205 (65%), Gaps = 1/205 (0%)
 Frame = +3

Query: 144 LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV 323
           LLL+  F Q   + A T+  D  A+ AL+  W   P  W EGSDPCG +W G+ C   RV
Sbjct: 9   LLLILFFFQICSVSALTNGLDASALNALKSEWTTPPDGW-EGSDPCGTNWVGITCQNDRV 67

Query: 324 VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF 503
           VS++L ++DL G+L  DI  LSEL+ILDLSYN  L+G LP  IGNL KL NLILVGC F 
Sbjct: 68  VSISLGNLDLEGKLPADISFLSELRILDLSYNPKLSGPLPPNIGNLGKLRNLILVGCSFS 127

Query: 504 GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP 680
           G IP+SIG              F G IPPS+G LS+LYW D+ADNQ+ G +PVS+G + P
Sbjct: 128 GQIPESIGTLKELIYLSLNLNKFSGTIPPSIGLLSKLYWFDIADNQIEGELPVSNGTSAP 187

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
           GLDML+ TKHFHFG NK SG IP +
Sbjct: 188 GLDMLLQTKHFHFGKNKLSGNIPKE 212



 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 33/126 (26%), Positives = 50/126 (39%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           ++ +       TGE+   +  +  L +L L  NK L G +P  + NL  L  L L    F
Sbjct: 220 LIHVLFDGNQFTGEIPETLSLVKTLTVLRLDRNK-LIGDIPSYLNNLTNLNELYLANNRF 278

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G +P+                    PIP  +  L  L  L +   QL G IP+S  + P
Sbjct: 279 TGTLPNLTSLTSLYTLDVSNNTLDFSPIPSWISSLPSLSTLRMEGIQLNGPIPISFFSPP 338

Query: 681 GLDMLV 698
            L  ++
Sbjct: 339 QLQTVI 344



>gb:AB025613_1516372 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K2I5.
          Length = 941

 Score =  219 bits (559), Expect = 3e-56
 Identities = 111/205 (54%), Positives = 135/205 (65%), Gaps = 1/205 (0%)
 Frame = +3

Query: 144 LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV 323
           LLL+  F Q   + A T+  D  A+ AL+  W   P  W EGSDPCG +W G+ C   RV
Sbjct: 9   LLLILFFFQICSVSALTNGLDASALNALKSEWTTPPDGW-EGSDPCGTNWVGITCQNDRV 67

Query: 324 VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF 503
           VS++L ++DL G+L  DI  LSEL+ILDLSYN  L+G LP  IGNL KL NLILVGC F 
Sbjct: 68  VSISLGNLDLEGKLPADISFLSELRILDLSYNPKLSGPLPPNIGNLGKLRNLILVGCSFS 127

Query: 504 GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP 680
           G IP+SIG              F G IPPS+G LS+LYW D+ADNQ+ G +PVS+G + P
Sbjct: 128 GQIPESIGTLKELIYLSLNLNKFSGTIPPSIGLLSKLYWFDIADNQIEGELPVSNGTSAP 187

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
           GLDML+ TKHFHFG NK SG IP +
Sbjct: 188 GLDMLLQTKHFHFGKNKLSGNIPKE 212



 Score = 38.9 bits (89), Expect = 0.10
 Identities = 32/126 (25%), Positives = 49/126 (38%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           ++ +       TGE+   +  +  L +L L  NK L G +P  + NL  L  L L    F
Sbjct: 220 LIHVLFDGNQFTGEIPETLSLVKTLTVLRLDRNK-LIGDIPSYLNNLTNLNELYLANNRF 278

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G +P+                         L  L+ LY L +   QL G IP+S  + P
Sbjct: 279 TGTLPN-------------------------LTSLTSLYTLRMEGIQLNGPIPISFFSPP 313

Query: 681 GLDMLV 698
            L  ++
Sbjct: 314 QLQTVI 319



>gb:AB025613_1516373 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K2I5.
          Length = 946

 Score =  209 bits (532), Expect = 4e-53
 Identities = 107/203 (52%), Positives = 138/203 (67%), Gaps = 2/203 (0%)
 Frame = +3

Query: 147 LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG-SRV 323
           LL+ LF Q   + AFTD +D+ A++AL++ W  +  SW + SDPCG  W G+ CN  +RV
Sbjct: 12  LLILLFFQIYSVYAFTDGSDFTALQALKNEWDTLSKSW-KSSDPCGTEWVGITCNNDNRV 70

Query: 324 VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF 503
           VS++L++ +L G+L  +I  LSELQ LDL+ N +L+G LP  IGNL+KL  L L+GC F 
Sbjct: 71  VSISLTNRNLKGKLPTEISTLSELQTLDLTGNPELSGPLPANIGNLRKLTFLSLMGCAFN 130

Query: 504 GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP 680
           G IPDSIG              F G IP S+G+LS+LYW D+ADNQL G +PVSDG + P
Sbjct: 131 GPIPDSIGNLEQLTRLSLNLNKFSGTIPASMGRLSKLYWFDIADNQLEGKLPVSDGASLP 190

Query: 681 GLDMLVGTKHFHFGXNKFSGEIP 749
           GLDML+ T HFHFG NK SGEIP
Sbjct: 191 GLDMLLQTGHFHFGNNKLSGEIP 213



 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 1/82 (1%)
 Frame = +3

Query: 417 NKDLTGSLPREIGNLKK-LYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPS 593
           N  L+G +P ++ + +  L +++  G  F G IP+S+G                G IP S
Sbjct: 205 NNKLSGEIPEKLFSSEMTLLHVLFDGNQFTGSIPESLGLVQNLTVLRLDRNRLSGDIPSS 264

Query: 594 LGQLSELYWLDLADNQLTGSIP 659
           L  L+ L  L L+DN+ TGS+P
Sbjct: 265 LNNLTNLQELHLSDNKFTGSLP 286



>gb:AB025613_1516374 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K2I5.
          Length = 1006

 Score =  194 bits (493), Expect = 1e-48
 Identities = 101/203 (49%), Positives = 132/203 (65%), Gaps = 1/203 (0%)
 Frame = +3

Query: 144 LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV 323
           +LL+ L  QF  + A T+  D  A++ L+      P +W +G DPCG +W G+ C   RV
Sbjct: 85  VLLILLSFQFCSVSAQTNGFDADALQYLKSSLTIPPRNW-KGYDPCGTNWVGIACEYGRV 143

Query: 324 VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF 503
           V+++L +++L G+L   I  LSEL  LDL+ N +LTG LP  IGNLK+L NL L+GCGF 
Sbjct: 144 VNISLGNLNLEGKLPAFITTLSELHTLDLTSNPNLTGPLPLNIGNLKELTNLNLMGCGFS 203

Query: 504 GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTP 680
           G IP+SIG              F G IP S+G LS+LYW D+ADNQ+ G +PVSDG + P
Sbjct: 204 GQIPESIGSLEQLVTLSLNSNKFNGTIPASIGLLSKLYWFDIADNQIEGKLPVSDGASLP 263

Query: 681 GLDMLVGTKHFHFGXNKFSGEIP 749
           GLDML+ TKHFHFG NK SG+IP
Sbjct: 264 GLDMLLQTKHFHFGKNKLSGDIP 286



 Score = 42.4 bits (98), Expect = 0.009
 Identities = 37/145 (25%), Positives = 59/145 (40%), Gaps = 31/145 (21%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNK------------------------- 422
           ++V+L+L+S    G +   I  LS+L   D++ N+                         
Sbjct: 215 QLVTLSLNSNKFNGTIPASIGLLSKLYWFDIADNQIEGKLPVSDGASLPGLDMLLQTKHF 274

Query: 423 -----DLTGSLPREIGNLKK-LYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPI 584
                 L+G +P ++ +    L +L+  G    G IP S+                 G I
Sbjct: 275 HFGKNKLSGDIPEKLFSANMTLKHLLFDGNLLTGEIPQSLSLVKTLTVLRLDRNRLSGEI 334

Query: 585 PPSLGQLSELYWLDLADNQLTGSIP 659
           PPSL  L+ L  L L+DN+ TGS+P
Sbjct: 335 PPSLNNLTNLQELYLSDNKFTGSLP 359



>gb:AP003411_1829038 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1148D12.
          Length = 1083

 Score =  180 bits (457), Expect = 2e-44
 Identities = 95/202 (47%), Positives = 123/202 (60%)
 Frame = +3

Query: 144 LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRV 323
           +LLV L + F    + T+  D  A++AL   W+N P SW   +DPC   W+G+ C+  RV
Sbjct: 12  MLLVSLRLSF----SQTNPQDVSALQALMKNWQNEPQSWMGSTDPCTS-WDGISCSNGRV 66

Query: 324 VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF 503
             + LS ++L G LS  I++LS L  LDLS N +L G LP  I NLK+L  LIL+GC F 
Sbjct: 67  TEMRLSGINLQGTLSNAIDQLSSLTYLDLSNNLNLGGPLPPSIVNLKQLTTLILLGCSFT 126

Query: 504 GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG 683
           G IP+ IG              F G IPP+LG LS+L+WLDL+DNQL+G IPVS G+ PG
Sbjct: 127 GDIPEQIGALRQLTFLALNSNKFTGGIPPTLGLLSKLFWLDLSDNQLSGKIPVSSGSNPG 186

Query: 684 LDMLVGTKHFHFGXNKFSGEIP 749
           LD LV  +H  F  N F+G IP
Sbjct: 187 LDQLVNAEHLIFDNNNFTGPIP 208



 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 38/139 (27%), Positives = 59/139 (42%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L   + + TG + G +  +S +QI+ L +N+  +G +P  I NL +L  L L      G 
Sbjct: 196 LIFDNNNFTGPIPGSLGRVSSIQIIRLDHNQ-FSGPVPGSIANLSRLMELSLASNQLNGT 254

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           +PD                    P P     L+ L  L +  + LTG+IP +  + P L 
Sbjct: 255 VPDLTSANALTYVDLSNNNFMSSPAPRWFSTLTSLTTLFMDSDHLTGTIPSALFSFPQLQ 314

Query: 690 MLVGTKHFHFGXNKFSGEI 746
            +   K      N FSGE+
Sbjct: 315 QISLAK------NSFSGEL 327



>gb:AB025613_1516371 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K2I5.
          Length = 349

 Score =  149 bits (377), Expect = 4e-35
 Identities = 81/146 (55%), Positives = 99/146 (67%), Gaps = 4/146 (2%)
 Frame = +3

Query: 324 VSLTLSSM---DLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           V +T SS+   +L G LS  I  LSEL+ILDLS+N  LTG LP  IG+LKKL NLILVGC
Sbjct: 25  VPMTASSLVNHNLEGTLSEYILALSELEILDLSFNIGLTGPLPSNIGDLKKLKNLILVGC 84

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG- 671
           G  G IPDSIG              F G IP S+G+LS+L W D+A+NQ+ G +P+S+G 
Sbjct: 85  GLSGQIPDSIGSLEQIINLSLNLNKFSGTIPASIGRLSKLDWFDIAENQIEGELPISNGT 144

Query: 672 NTPGLDMLVGTKHFHFGXNKFSGEIP 749
           ++PGLDML  T+HFHFG NK SG IP
Sbjct: 145 SSPGLDMLTQTQHFHFGKNKLSGHIP 170



 Score = 40.8 bits (94), Expect = 0.027
 Identities = 29/101 (28%), Positives = 47/101 (46%), Gaps = 1/101 (0%)
 Frame = +3

Query: 357 GELSGDIEELSELQILDLSYNKDLTGSLPREIGNLK-KLYNLILVGCGFFGLIPDSIGXX 533
           G  S  ++ L++ Q      NK L+G +P ++ N    L +++     F G IP+S+   
Sbjct: 143 GTSSPGLDMLTQTQHFHFGKNK-LSGHIPEKLFNSNMSLIHVLFNNNQFTGKIPESLSLV 201

Query: 534 XXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSI 656
                         G IPPSL  L+ L  LD+++N L  S+
Sbjct: 202 TTLLVLRLDTNRLSGDIPPSLNNLTSLNQLDVSNNTLEFSL 242



>gb:AC093952_1736170 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1004_E02, complete sequence.
          Length = 909

 Score =  145 bits (367), Expect = 6e-34
 Identities = 75/147 (51%), Positives = 92/147 (62%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           C   RV +L LSS+ L G LS  I +L +L  LDLS+N +L G LP EIGNL +L  LIL
Sbjct: 2   CTNGRVTTLRLSSVSLQGTLSSSIGQLGQLTYLDLSFNINLGGPLPAEIGNLGELTTLIL 61

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
            GC F G IP +IG              F G IP S+G L+ L WLDLADNQLTGS+P+S
Sbjct: 62  AGCSFTGNIPIAIGNLRKLGFLALNSNKFSGGIPSSIGVLTNLLWLDLADNQLTGSVPIS 121

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEI 746
              +PGLD LV T+HFHF  N+ +G +
Sbjct: 122 TSTSPGLDQLVKTQHFHFNKNQLTGTL 148



 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 35/116 (30%), Positives = 56/116 (48%), Gaps = 6/116 (5%)
 Frame = +3

Query: 330 LTLSSMDLTGEL------SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG 491
           L L+   LTG +      S  +++L + Q    + N+ LTG+L     +   L +++   
Sbjct: 107 LDLADNQLTGSVPISTSTSPGLDQLVKTQHFHFNKNQ-LTGTLTGLFNSNMTLIHILFDS 165

Query: 492 CGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
             F G IP  +G              F G IP ++G L +L  L+LA+N+LTGS+P
Sbjct: 166 NKFSGSIPAEVGTVSTLEVLRLDRNGFTGAIPATIGSLVKLNELNLANNKLTGSVP 221



 Score = 42.4 bits (98), Expect = 0.009
 Identities = 34/143 (23%), Positives = 60/143 (41%), Gaps = 1/143 (0%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           ++ +   S   +G +  ++  +S L++L L  N   TG++P  IG+L KL  L L     
Sbjct: 158 LIHILFDSNKFSGSIPAEVGTVSTLEVLRLDRN-GFTGAIPATIGSLVKLNELNLANNKL 216

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPS-LGQLSELYWLDLADNQLTGSIPVSDGNT 677
            G +PD +               F   + PS    L+ L  + +    L+G +P      
Sbjct: 217 TGSVPD-LSNMTNLNVVDLSNNTFDPSVAPSWFTSLTSLASVSIVSGSLSGQVPKGLFTL 275

Query: 678 PGLDMLVGTKHFHFGXNKFSGEI 746
           P L  +V + +   G  + +G I
Sbjct: 276 PTLQQVVLSNNQFNGTLEITGNI 298



>gb:AY059802_1564646 Arabidopsis thaliana leucine-rich repeat
           protein FLR1 (T23B7.10) mRNA, complete
           cds.>gb:AY085937_1570999 Arabidopsis thaliana clone
           19879 mRNA, complete sequence.>gb:BT001172_1635427
           Arabidopsis thaliana leucine-rich repeat protein FLR1
           mRNA, complete cds.>gb:AP002063_1821825 Arabidopsis
           thaliana genomic DNA, chromosome 3, BAC clone: T23B7.
          Length = 325

 Score =  106 bits (265), Expect = 4e-22
 Identities = 72/199 (36%), Positives = 100/199 (50%), Gaps = 2/199 (1%)
 Frame = +3

Query: 159 LFIQFLGIVAFTDNNDYVAIKALRDGWKNVP--PSWAEGSDPCGDHWEGVGCNGSRVVSL 332
           LFI      + T+N D  A+  ++    N P   SW   +D C   W GV C   RV  L
Sbjct: 14  LFITLPSSYSCTEN-DKNALLQIKKALGNPPLLSSWNPRTDCCTG-WTGVECTNRRVTGL 71

Query: 333 TLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLI 512
           +++S +++G++S  I +L +L+ LD SY   LTG++PR I  LK L  L L      G I
Sbjct: 72  SVTSGEVSGQISYQIGDLVDLRTLDFSYLPHLTGNIPRTITKLKNLNTLYLKHTSLSGPI 131

Query: 513 PDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM 692
           PD I               F GPIP SL Q+ +L  + + DN+LTGSIP S G+  G   
Sbjct: 132 PDYISELKSLTFLDLSFNQFTGPIPGSLSQMPKLEAIQINDNKLTGSIPNSFGSFVG--- 188

Query: 693 LVGTKHFHFGXNKFSGEIP 749
                + +   NK SG+IP
Sbjct: 189 --NVPNLYLSNNKLSGKIP 205



>gb:AF136588_1771155 Arabidopsis thaliana leucine-rich repeat
           protein FLR1 (FLR1) mRNA, complete cds.
          Length = 324

 Score =  106 bits (264), Expect = 5e-22
 Identities = 68/185 (36%), Positives = 94/185 (50%), Gaps = 2/185 (1%)
 Frame = +3

Query: 201 NDYVAIKALRDGWKNVP--PSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGD 374
           ND  A+  ++    N P   SW   +D C   W GV C   RV  L+++S +++G++S  
Sbjct: 27  NDKNALLQIKKALGNPPLLSSWNPRTDCCTG-WTGVECTNRRVTGLSVTSGEVSGQISYQ 85

Query: 375 IEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXX 554
           I +L +L+ LD SY   LTG++PR I  LK L  L L      G IPD I          
Sbjct: 86  IGDLVDLRTLDFSYLPHLTGNIPRTITKLKNLNTLYLKHTSLSGPIPDYISELKSLTFLD 145

Query: 555 XXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKF 734
                F GPIP SL Q+ +L  + + DN+LTGSIP S G+  G        + +   NK 
Sbjct: 146 LSFNQFTGPIPGSLSQMPKLEAIQINDNKLTGSIPNSFGSFVG-----NVPNLYLSNNKL 200

Query: 735 SGEIP 749
           SG+IP
Sbjct: 201 SGKIP 205



>gb:AY057648_1564061 Arabidopsis thaliana At3g12148/T23B7.11 mRNA,
           complete cds.
          Length = 325

 Score =  104 bits (260), Expect = 2e-21
 Identities = 74/203 (36%), Positives = 100/203 (49%), Gaps = 6/203 (2%)
 Frame = +3

Query: 159 LFIQFLGIVAFTDNNDYVAIKALRDGWKNVP--PSWAEGSDPCGDHWEGVGCNGSRVVSL 332
           LFI      + T+N D  A+  ++    N P   SW   +D C   W GV C   RV  L
Sbjct: 14  LFITLPSSYSCTEN-DKNALLQIKKALGNPPLLSSWNPRTDCCTG-WTGVECTNRRVTGL 71

Query: 333 TLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLI 512
           +++S +++G++S  I +L +L+ LD SY   LTG++PR I  LK L  L L      G I
Sbjct: 72  SVTSGEVSGQISYQIGDLVDLRTLDFSYLPHLTGNIPRTITKLKNLNTLYLKHTSLSGPI 131

Query: 513 PDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS----DGNTP 680
           PD I               F GPIP SL Q+ +L  + + DN+LTGSIP S     GN P
Sbjct: 132 PDYISELKSLTFLDLSFNQFTGPIPGSLSQMPKLEAIQINDNKLTGSIPNSFSSFVGNVP 191

Query: 681 GLDMLVGTKHFHFGXNKFSGEIP 749
            L         +   NK SG+IP
Sbjct: 192 NL---------YLSNNKLSGKIP 205



>gb:AC069472_1540863 Arabidopsis thaliana chromosome 3 BAC F28J15
           genomic sequence, complete sequence.
          Length = 203

 Score =  102 bits (253), Expect = 1e-20
 Identities = 70/196 (35%), Positives = 97/196 (49%), Gaps = 2/196 (1%)
 Frame = +3

Query: 159 LFIQFLGIVAFTDNNDYVAIKALRDGWKNVP--PSWAEGSDPCGDHWEGVGCNGSRVVSL 332
           LFI      + T+N D  A+  ++    N P   SW   +D C   W GV C   RV  L
Sbjct: 14  LFITLPSSYSCTEN-DKNALLQIKKALGNPPLLSSWNPRTDCCTG-WTGVECTNRRVTGL 71

Query: 333 TLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLI 512
           +++S +++G++S  I +L +L+ LD SY   LTG++PR I  LK L  L L      G I
Sbjct: 72  SVTSGEVSGQISYQIGDLVDLRTLDFSYLPHLTGNIPRTITKLKNLNTLYLKHTSLSGPI 131

Query: 513 PDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM 692
           PD I               F GPIP SL Q+ +L  + + DN+LTGSIP S G+  G   
Sbjct: 132 PDYISELKSLTFLDLSFNQFTGPIPGSLSQMPKLEAIQINDNKLTGSIPNSFGSFVG--- 188

Query: 693 LVGTKHFHFGXNKFSG 740
                + +   NK SG
Sbjct: 189 --NVPNLYLSNNKLSG 202



>gb:AP004562_1841637 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0470F10.
          Length = 702

 Score =  100 bits (249), Expect = 3e-20
 Identities = 77/215 (35%), Positives = 101/215 (46%), Gaps = 11/215 (5%)
 Frame = +3

Query: 144 LLLVPLFIQFLGIVAFTDNNDYVA--------IKALRDGWKNVPPSWAEGSDPC--GDHW 293
           LLL PL    L  VA    +   A        +KA  D    + PSWA G DPC  GD++
Sbjct: 17  LLLFPLLHSSLADVAAAAPSSASAAEVDALMELKAALDPSGRLLPSWARGGDPCGRGDYF 76

Query: 294 EGVGCNG-SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKL 470
           EGV C+   RV +++L    L G +S  +  L  L  L L YN +L G++PR++G+L  L
Sbjct: 77  EGVSCDARGRVAAVSLQGKGLAGAISPAVAMLPGLTGLYLHYN-ELAGAIPRQLGDLPML 135

Query: 471 YNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTG 650
             L L      G IP  +G                G IP  LGQL +L  L L  NQLTG
Sbjct: 136 AELYLGVNNLSGTIPVELGRLPALQVLQLGYNQLSGSIPTQLGQLKKLTVLALQSNQLTG 195

Query: 651 SIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           +IP S G+ P L  L          N+  G IP++
Sbjct: 196 AIPASLGDLPELARL------DLSSNRLFGSIPSK 224



>gb:AP003489_1829912 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0568D10.
          Length = 1060

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 73/215 (33%), Positives = 102/215 (47%), Gaps = 8/215 (3%)
 Frame = +3

Query: 129 IPRIQLLLVPLFIQFL--GIVAFTDNNDYVAIKALRDGWKNVP----PSWAEGSDPCGDH 290
           +P    + V +FI FL  G +    +ND+ A+ + + G  N P     +W    + C  +
Sbjct: 4   VPISVFVFVFIFIFFLLDGSIPTLGSNDHSALMSFKSGVSNDPNGALANWGS-LNVC--N 60

Query: 291 WEGVGCNGSR--VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLK 464
           W GV C+ SR  VV L L    L+GE+S  +  LS L IL+LS N    G +P E+GNL 
Sbjct: 61  WTGVSCDASRRRVVKLMLRDQKLSGEVSPALGNLSHLNILNLSGNL-FAGRVPPELGNLF 119

Query: 465 KLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQL 644
           +L  L +    F G +P  +G              F G +PP LG LS+L  L L +N L
Sbjct: 120 RLTLLDISSNTFVGRVPAELGNLSSLNTLDLSRNLFTGEVPPELGDLSKLQQLSLGNNLL 179

Query: 645 TGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            G IPV       L  +    + + G N  SG IP
Sbjct: 180 EGKIPVE------LTRMSNLSYLNLGENNLSGRIP 208



 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 48/147 (32%), Positives = 70/147 (47%), Gaps = 1/147 (0%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLP-REIGNLKKLYNLILVGC 494
           R+  L LS   L+GE+   + E+  L ++DLS N+ L G +P   + NL +L  L+L   
Sbjct: 395 RLERLYLSDNMLSGEIPPSLGEVPRLGLVDLSRNR-LAGGIPAAALSNLTQLRWLVLHHN 453

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G+IP  I                 G IP  L +LS L +L+L+ N L G IP + G 
Sbjct: 454 HLAGVIPPGIAQCVNLQNLDLSHNMLRGKIPDDLSELSGLLYLNLSSNLLEGMIPATIGR 513

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
              L +L      +   N+ SG+IP Q
Sbjct: 514 MAMLQVL------NLSSNRLSGDIPTQ 534



 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 46/141 (32%), Positives = 64/141 (45%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           +L LS   L G++  D+ ELS L  L+LS N  L G +P  IG +  L  L L      G
Sbjct: 471 NLDLSHNMLRGKIPDDLSELSGLLYLNLSSNL-LEGMIPATIGRMAMLQVLNLSSNRLSG 529

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
            IP  IG                G +P ++  L  L  LD++ N L+G++P      P L
Sbjct: 530 DIPTQIGGCVALEYVNVSGNALEGGLPDAVAALPFLQVLDVSYNGLSGALP------PSL 583

Query: 687 DMLVGTKHFHFGXNKFSGEIP 749
                 +  +F  N FSGE+P
Sbjct: 584 GAAASLRRVNFSYNGFSGEVP 604



 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 42/148 (28%), Positives = 64/148 (43%), Gaps = 2/148 (1%)
 Frame = +3

Query: 312 GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSL-PREIGNLKKLYNLILV 488
           G  +  L L    + G +  ++  L+ L  L+LS+N  + GS+ P  +  +++L  L L 
Sbjct: 344 GPGLTQLHLEYNSIFGAIPANLSNLTNLTALNLSHNL-INGSIPPAAVAGMRRLERLYLS 402

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIP-PSLGQLSELYWLDLADNQLTGSIPVS 665
                G IP S+G                G IP  +L  L++L WL L  N L G IP  
Sbjct: 403 DNMLSGEIPPSLGEVPRLGLVDLSRNRLAGGIPAAALSNLTQLRWLVLHHNHLAGVIP-- 460

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
               PG+   V  ++     N   G+IP
Sbjct: 461 ----PGIAQCVNLQNLDLSHNMLRGKIP 484



 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 34/115 (29%), Positives = 57/115 (49%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S ++ L LSS  L G +   I  ++ LQ+L+LS N+ L+G +P +IG    L  + + G 
Sbjct: 491 SGLLYLNLSSNLLEGMIPATIGRMAMLQVLNLSSNR-LSGDIPTQIGGCVALEYVNVSGN 549

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
              G +PD++                 G +PPSLG  + L  ++ + N  +G +P
Sbjct: 550 ALEGGLPDAVAALPFLQVLDVSYNGLSGALPPSLGAAASLRRVNFSYNGFSGEVP 604



 Score = 41.6 bits (96), Expect = 0.016
 Identities = 42/146 (28%), Positives = 62/146 (42%), Gaps = 7/146 (4%)
 Frame = +3

Query: 333 TLSSMDLTG-ELSGDIEELSE-----LQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           +L  + + G EL+G I  ++      L  L L YN  + G++P  + NL  L  L L   
Sbjct: 321 SLKELGVAGNELAGVIPPIAGRLGPGLTQLHLEYNS-IFGAIPANLSNLTNLTALNLSHN 379

Query: 495 GFFGLIPDS-IGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG 671
              G IP + +                 G IPPSLG++  L  +DL+ N+L G IP +  
Sbjct: 380 LINGSIPPAAVAGMRRLERLYLSDNMLSGEIPPSLGEVPRLGLVDLSRNRLAGGIPAA-- 437

Query: 672 NTPGLDMLVGTKHFHFGXNKFSGEIP 749
               L  L   +      N  +G IP
Sbjct: 438 ---ALSNLTQLRWLVLHHNHLAGVIP 460



>gb:AX093392_1461116 Sequence 11 from Patent WO0118061.
          Length = 1059

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 78/227 (34%), Positives = 100/227 (44%), Gaps = 17/227 (7%)
 Frame = +3

Query: 126 MIPRIQLLLVPLFIQFL--------------GIVAFTDNNDYVAIKALRDGWKNVPPSWA 263
           M P I LLL+P  +Q +              G    TD +  +  KA          SW 
Sbjct: 1   MSPSILLLLLPYVLQLMPTSFAQVSTLPLPFGNETATDRDALLQFKASLSQQSPTLVSWN 60

Query: 264 EGSDPCGDHWEGVGCN---GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTG 434
           + SD C  HW GV C+     RV +L LSS  L G LS  I  L+ L+ILDLS N +L G
Sbjct: 61  KTSDFC--HWTGVTCSLRHKGRVSALNLSSAGLVGSLSPAIGNLTFLKILDLSSN-NLQG 117

Query: 435 SLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSEL 614
            +P  IG L++L  L+  G    G I D +                 G IP  LG   +L
Sbjct: 118 GIPSTIGRLRRLQYLVFTGNSLHGGITDGLSNCTGLVIIFLGNNHLTGEIPSWLGGFPKL 177

Query: 615 YWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
             LDL+ N LTGSIP S GN      L   +  +   N+  G IP +
Sbjct: 178 AALDLSKNNLTGSIPPSLGN------LTSLQELYLQINQLEGSIPKE 218



 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 51/159 (32%), Positives = 73/159 (45%), Gaps = 4/159 (2%)
 Frame = +3

Query: 291 WEGVGC--NGSRVVSLTLSSMDLTGELSGDIEELSE--LQILDLSYNKDLTGSLPREIGN 458
           WE V    N +R+  L+  +  L GEL   +  LS   LQ+L   +N ++ G++P  I N
Sbjct: 339 WEFVTLLTNCTRLRVLSFRNNMLAGELPPSVGNLSSTHLQVLYTGWN-EIYGNIPPGISN 397

Query: 459 LKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADN 638
           L  L  L L    F G +P++IG                G IPPS+G L+ L  + + +N
Sbjct: 398 LVNLQKLFLSQNHFTGALPNTIGRLKMMRALGIDGNLLSGTIPPSIGNLTLLQIITMDNN 457

Query: 639 QLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L GS+P S  N   L +           N F+G IP Q
Sbjct: 458 NLEGSLPSSISNLQMLSIAT------LSRNAFAGPIPKQ 490



 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 48/140 (34%), Positives = 64/140 (45%), Gaps = 1/140 (0%)
 Frame = +3

Query: 333 TLSSMDLTGELSGDIEELSELQ-ILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           TLS     G +   I  LS L  ILDLS N    GSLP E+G L KL  L +      G 
Sbjct: 477 TLSRNAFAGPIPKQIFNLSSLSYILDLSDNL-FNGSLPPEVGRLTKLVYLNISRNNLSGS 535

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           +PD +               F G +P S+ ++  L  L+L +N L+G+IP   G   GL+
Sbjct: 536 LPD-LSNCQSLLQLHLDGNSFSGSLPASITEMYGLVVLNLTENSLSGAIPQEFGRMKGLE 594

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
            L      +   N  SG+IP
Sbjct: 595 EL------YLAHNNLSGQIP 608



 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 52/177 (29%), Positives = 63/177 (35%), Gaps = 42/177 (23%)
 Frame = +3

Query: 348 DLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG 527
           ++ G +   I  L  LQ L LS N   TG+LP  IG LK +  L + G    G IP SIG
Sbjct: 386 EIYGNIPPGISNLVNLQKLFLSQNH-FTGALPNTIGRLKMMRALGIDGNLLSGTIPPSIG 444

Query: 528 XXX------------------------XXXXXXXXXXXFIGPIPPSLGQLSEL-YWLDLA 632
                                                 F GPIP  +  LS L Y LDL+
Sbjct: 445 NLTLLQIITMDNNNLEGSLPSSISNLQMLSIATLSRNAFAGPIPKQIFNLSSLSYILDLS 504

Query: 633 DNQLTGSIPVS-----------------DGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           DN   GS+P                    G+ P L         H   N FSG +PA
Sbjct: 505 DNLFNGSLPPEVGRLTKLVYLNISRNNLSGSLPDLSNCQSLLQLHLDGNSFSGSLPA 561



>gb:AP004747_1844318 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0407A09.
          Length = 1001

 Score = 97.1 bits (240), Expect = 3e-19
 Identities = 75/212 (35%), Positives = 103/212 (48%), Gaps = 8/212 (3%)
 Frame = +3

Query: 138 IQLLLVPLFIQFLGIVAFTDNN-DYVAIKALRDGWKNVP----PSWAEGSDPCGDHWEGV 302
           I LL   L    +G V    N  D +++   + G  N P     +W   +  C   W+GV
Sbjct: 14  IILLAFILLCHGIGNVDCRGNRADQLSLLDFKKGITNDPYGALATWNTSTHFC--RWQGV 71

Query: 303 GCNGS---RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLY 473
            C  +   RV++L LSS  LTG++   +  LS L ILDL  N +L GSLPR +GNLK+L 
Sbjct: 72  KCTSTGPWRVMALNLSSQSLTGQIRSSLGNLSFLNILDLGDN-NLLGSLPR-LGNLKQLQ 129

Query: 474 NLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGS 653
            L L      G+IPD +                 G +PP+LG LS L +L L+ N+LTG+
Sbjct: 130 ALYLYKNNLTGIIPDELTNCSSLTYIDLSGNALTGALPPNLGSLSNLAYLYLSANKLTGT 189

Query: 654 IPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           IP + GN   L         +   N+F G IP
Sbjct: 190 IPQALGNITTL------VEIYLDTNRFEGGIP 215



 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 45/140 (32%), Positives = 66/140 (47%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L+L   +LTG++   + +L++LQ L L +  + +GS+P  I  L +L  L L    F G 
Sbjct: 402 LSLDLNNLTGKIDEWVPKLTKLQKL-LLHRNNFSGSIPSSIAELPRLSTLSLAYNAFDGP 460

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S+G                G IPP L  L +L  L L++N+LTG IP +      L 
Sbjct: 461 IPSSLGNLSGLQKLYLSHNNLEGVIPPELSYLKQLINLSLSENKLTGEIPGT------LS 514

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
                 +   G N  +G IP
Sbjct: 515 QCKDLANIQMGNNFLTGNIP 534



 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 43/145 (29%), Positives = 64/145 (44%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           +++  L L   + +G +   I EL  L  L L+YN    G +P  +GNL  L  L L   
Sbjct: 421 TKLQKLLLHRNNFSGSIPSSIAELPRLSTLSLAYNA-FDGPIPSSLGNLSGLQKLYLSHN 479

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G+IP  +                 G IP +L Q  +L  + + +N LTG+IPV+ G+
Sbjct: 480 NLEGVIPPELSYLKQLINLSLSENKLTGEIPGTLSQCKDLANIQMGNNFLTGNIPVTFGD 539

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIP 749
              L +L      +   N  SG IP
Sbjct: 540 LKSLGVL------NLSHNSLSGTIP 558



 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 38/119 (31%), Positives = 55/119 (46%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +  L LS  +L G +  ++  L +L  L LS NK LTG +P  +   K L N+ + 
Sbjct: 467 NLSGLQKLYLSHNNLEGVIPPELSYLKQLINLSLSENK-LTGEIPGTLSQCKDLANIQMG 525

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                G IP + G                G IP +L  L  +  LDL+ N+L G IP++
Sbjct: 526 NNFLTGNIPVTFGDLKSLGVLNLSHNSLSGTIPTTLNDLPVMSKLDLSYNRLQGKIPMT 584



 Score = 39.7 bits (91), Expect = 0.060
 Identities = 43/154 (27%), Positives = 63/154 (40%), Gaps = 6/154 (3%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNK----DLTG-SLPREIGNLKKLY 473
           N  ++  +++++   TG++     +LS+L  + L  N     D  G      + N   L 
Sbjct: 292 NALQLTEISMANNYFTGQIPSSFGKLSKLSYISLENNSLEASDGQGWEFLHALRNCSNLE 351

Query: 474 NLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFI-GPIPPSLGQLSELYWLDLADNQLTG 650
            L L      G IP+SIG               + G +P S+G L  L+ L L  N LTG
Sbjct: 352 LLSLAQNQLQGEIPNSIGDLPLKLQQLVLSENKLSGEVPASIGNLQGLFRLSLDLNNLTG 411

Query: 651 SIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            I   D   P L  L   +      N FSG IP+
Sbjct: 412 KI---DEWVPKLTKL---QKLLLHRNNFSGSIPS 439



>gb:AC073395_1541016 Arabidopsis thaliana chromosome 3 BAC F11B9
           genomic sequence, complete
           sequence.>gb:ATAC009991_1543114 Arabidopsis thaliana
           chromosome III BAC F9F8 genomic sequence, complete
           sequence.
          Length = 943

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 69/189 (36%), Positives = 87/189 (46%), Gaps = 4/189 (2%)
 Frame = +3

Query: 198 NNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN--GSRVVSLTLSSMDLTGEL-- 365
           +NDY      R        SW   SD C  +WEG+ C+     V+ L LS   L G    
Sbjct: 60  SNDYCYRNNSRVSPHPTTESWRNNSDCC--NWEGITCDTKSGEVIELDLSCSWLYGSFHS 117

Query: 366 SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXX 545
           +  +  L  L++LDL+ N DL G +P  IGNL  L +L L    F GLIP SI       
Sbjct: 118 NSSLFRLQNLRVLDLTQN-DLDGEIPSSIGNLSHLTSLHLSYNQFLGLIPSSIENLSRLT 176

Query: 546 XXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGX 725
                   F G IP S+G LS L  L+L+ NQ +G IP S GN   L  L          
Sbjct: 177 SLHLSSNQFSGQIPSSIGNLSHLTSLELSSNQFSGQIPSSIGNLSNLTFL------SLPS 230

Query: 726 NKFSGEIPA 752
           N F G+IP+
Sbjct: 231 NDFFGQIPS 239



 Score = 87.0 bits (214), Expect = 3e-16
 Identities = 56/147 (38%), Positives = 76/147 (51%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N SR+ SL LSS   +G++   I  LS L  L+LS N+  +G +P  IGNL  L  L L 
Sbjct: 171 NLSRLTSLHLSSNQFSGQIPSSIGNLSHLTSLELSSNQ-FSGQIPSSIGNLSNLTFLSLP 229

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
              FFG IP SIG              F+G IP S G L++L  L +  N+L+G++P+S 
Sbjct: 230 SNDFFGQIPSSIGNLARLTYLYLSYNNFVGEIPSSFGNLNQLIVLQVDSNKLSGNVPISL 289

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            N   L  L+         N+F+G IP
Sbjct: 290 LNLTRLSALL------LSHNQFTGTIP 310



 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 46/147 (31%), Positives = 72/147 (48%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N +R+  L LS  +  GE+      L++L +L +  NK L+G++P  + NL +L  L+L 
Sbjct: 243 NLARLTYLYLSYNNFVGEIPSSFGNLNQLIVLQVDSNK-LSGNVPISLLNLTRLSALLLS 301

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
              F G IP++I               F G +P SL  +  L  LDL+DNQL G++   +
Sbjct: 302 HNQFTGTIPNNISLLSNLMDFEASNNAFTGTLPSSLFNIPPLIRLDLSDNQLNGTLHFGN 361

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            ++P        ++   G N F G IP
Sbjct: 362 ISSPS-----NLQYLIIGSNNFIGTIP 383



 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 33/105 (31%), Positives = 48/105 (45%), Gaps = 1/105 (0%)
 Frame = +3

Query: 438  LPREIGNLKKLYNLI-LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSEL 614
            L  E+  +  +Y  +   G  F G IP SIG              F G IP S+G L+ L
Sbjct: 745  LAMELVRILTIYTALDFSGNKFEGEIPKSIGLLKELLVLNLSNNAFGGHIPSSMGNLTAL 804

Query: 615  YWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
              LD++ N+LTG IP   G+   L       + +F  N+ +G +P
Sbjct: 805  ESLDVSQNKLTGEIPQELGDLSFL------AYMNFSHNQLAGLVP 843



 Score = 36.2 bits (82), Expect = 0.66
 Identities = 22/62 (35%), Positives = 34/62 (54%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS+    G +   +  L+ L+ LD+S NK LTG +P+E+G+L  L  +        GL
Sbjct: 783 LNLSNNAFGGHIPSSMGNLTALESLDVSQNK-LTGEIPQELGDLSFLAYMNFSHNQLAGL 841

Query: 510 IP 515
           +P
Sbjct: 842 VP 843



 Score = 36.2 bits (82), Expect = 0.66
 Identities = 36/127 (28%), Positives = 57/127 (44%), Gaps = 1/127 (0%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKK-LYNLILVGCG 497
           ++ L  S+ + TG++   I  L  L  LDLS N +  GS+PR +  LK  L+ L L    
Sbjct: 547 MIHLFASNNNFTGKIPSFICGLRSLNTLDLSEN-NYNGSIPRCMEKLKSTLFVLNLRQNN 605

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
             G +P  I                +G +P SL + S L  L++  N++  + P    + 
Sbjct: 606 LSGGLPKHI--FESLRSLDVGHNLLVGKLPRSLIRFSNLEVLNVESNRINDTFPFWLSSL 663

Query: 678 PGLDMLV 698
             L +LV
Sbjct: 664 SKLQVLV 670



 Score = 32.7 bits (73), Expect = 7.3
 Identities = 35/121 (28%), Positives = 48/121 (39%), Gaps = 10/121 (8%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEEL----SELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S ++ S+ L+G    D  E+     EL  LD+S NK + G +P  +  L  L+ L L   
Sbjct: 467 SQSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNK-IKGQVPGWLWTLPNLFYLNLSNN 525

Query: 495 GFFGLIPDSIGXXXXXXXX------XXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSI 656
            F      S                      F G IP  +  L  L  LDL++N   GSI
Sbjct: 526 TFISFESSSKKHGLSSVRKPSMIHLFASNNNFTGKIPSFICGLRSLNTLDLSENNYNGSI 585

Query: 657 P 659
           P
Sbjct: 586 P 586



>gb:AP000391_1819980 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0538C01.>gb:AP000559_1820304 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6,
           clone:P0493C11.
          Length = 980

 Score = 94.0 bits (232), Expect = 3e-18
 Identities = 70/200 (35%), Positives = 93/200 (46%), Gaps = 20/200 (10%)
 Frame = +3

Query: 210 VAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSR--VVSLTLSSMDLTGELSGDIEE 383
           + +KA      N    W  G+D C   W GV C+ +   V++L LS+++L GE+S  I E
Sbjct: 40  MGVKAGFGNAANALVDWDGGADHCA--WRGVTCDNASFAVLALNLSNLNLGGEISPAIGE 97

Query: 384 LSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXX 563
           L  LQ +DL  NK LTG +P EIG+   L  L L G   +G IP SI             
Sbjct: 98  LKNLQFVDLKGNK-LTGQIPDEIGDCISLKYLDLSGNLLYGDIPFSISKLKQLEELILKN 156

Query: 564 XXFIGPIPPSLGQLSELYWLDLADNQLTGSIP------------------VSDGNTPGLD 689
               GPIP +L Q+  L  LDLA NQLTG IP                  ++   +P + 
Sbjct: 157 NQLTGPIPSTLSQIPNLKTLDLAQNQLTGDIPRLIYWNEVLQYLGLRGNSLTGTLSPDMC 216

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
            L G  +F    N  +G IP
Sbjct: 217 QLTGLWYFDVRGNNLTGTIP 236



 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 50/145 (34%), Positives = 72/145 (49%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           +V +L+L    LTG++   I  +  L +LDLS N +L G +P  +GNL     L L G  
Sbjct: 267 QVATLSLQGNRLTGKIPDVIGLMQALAVLDLSEN-ELVGPIPSILGNLSYTGKLYLHGNK 325

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
             G+IP  +G               +G IP  LG+L EL+ L+LA+N L G IP +  + 
Sbjct: 326 LTGVIPPELGNMSKLSYLQLNDNELVGTIPAELGKLEELFELNLANNNLQGPIPANISSC 385

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIPA 752
             L+       F+   NK +G IPA
Sbjct: 386 TALN------KFNVYGNKLNGSIPA 404



 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 42/135 (31%), Positives = 63/135 (46%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           L G +    ++L  L  L+LS N +  G++P E+G++  L  L L    F G +P +IG 
Sbjct: 398 LNGSIPAGFQKLESLTYLNLSSN-NFKGNIPSELGHIINLDTLDLSYNEFSGPVPATIGD 456

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH 710
                          GP+P   G L  +  +D+++N L+GS+P   G    LD L+    
Sbjct: 457 LEHLLELNLSKNHLDGPVPAEFGNLRSVQVIDMSNNNLSGSLPEELGQLQNLDSLI---- 512

Query: 711 FHFGXNKFSGEIPAQ 755
                N   GEIPAQ
Sbjct: 513 --LNNNNLVGEIPAQ 525



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 44/140 (31%), Positives = 60/140 (42%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LSS +  G +  ++  +  L  LDLSYN + +G +P  IG+L+ L  L L      G 
Sbjct: 415 LNLSSNNFKGNIPSELGHIINLDTLDLSYN-EFSGPVPATIGDLEHLLELNLSKNHLDGP 473

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           +P   G                G +P  LGQL  L  L L +N L G IP    N   L+
Sbjct: 474 VPAEFGNLRSVQVIDMSNNNLSGSLPEELGQLQNLDSLILNNNNLVGEIPAQLANCFSLN 533

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
            L      +   N  SG +P
Sbjct: 534 NL------NLSYNNLSGHVP 547



 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 38/140 (27%), Positives = 61/140 (43%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L +  LTG +   + ++  L+ LDL+ N+ LTG +PR I   + L  L L G    G 
Sbjct: 152 LILKNNQLTGPIPSTLSQIPNLKTLDLAQNQ-LTGDIPRLIYWNEVLQYLGLRGNSLTGT 210

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           +   +                 G IP S+G  +    LD++ NQ++G IP + G      
Sbjct: 211 LSPDMCQLTGLWYFDVRGNNLTGTIPESIGNCTSFEILDISYNQISGEIPYNIG------ 264

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
             +         N+ +G+IP
Sbjct: 265 -FLQVATLSLQGNRLTGKIP 283



>gb:AY332474_1600056 Oryza sativa (japonica cultivar-group)
           transmembrane protein kinase (PK3) mRNA, complete cds.
          Length = 999

 Score = 94.0 bits (232), Expect = 3e-18
 Identities = 70/200 (35%), Positives = 93/200 (46%), Gaps = 20/200 (10%)
 Frame = +3

Query: 210 VAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSR--VVSLTLSSMDLTGELSGDIEE 383
           + +KA      N    W  G+D C   W GV C+ +   V++L LS+++L GE+S  I E
Sbjct: 40  MGVKAGFGNAANALVDWDGGADHCA--WRGVTCDNASFAVLALNLSNLNLGGEISPAIGE 97

Query: 384 LSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXX 563
           L  LQ +DL  NK LTG +P EIG+   L  L L G   +G IP SI             
Sbjct: 98  LKNLQFVDLKGNK-LTGQIPDEIGDCISLKYLDLSGNLLYGDIPFSISKLKQLEELILKN 156

Query: 564 XXFIGPIPPSLGQLSELYWLDLADNQLTGSIP------------------VSDGNTPGLD 689
               GPIP +L Q+  L  LDLA NQLTG IP                  ++   +P + 
Sbjct: 157 NQLTGPIPSTLSQIPNLKTLDLAQNQLTGDIPRLIYWNEVLQYLGLRGNSLTGTLSPDMC 216

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
            L G  +F    N  +G IP
Sbjct: 217 QLTGLWYFDVRGNNLTGTIP 236



 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 50/145 (34%), Positives = 72/145 (49%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           +V +L+L    LTG++   I  +  L +LDLS N +L G +P  +GNL     L L G  
Sbjct: 267 QVATLSLQGNRLTGKIPDVIGLMQALAVLDLSEN-ELVGPIPSILGNLSYTGKLYLHGNK 325

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
             G+IP  +G               +G IP  LG+L EL+ L+LA+N L G IP +  + 
Sbjct: 326 LTGVIPPELGNMSKLSYLQLNDNELVGTIPAELGKLEELFELNLANNNLQGPIPANISSC 385

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIPA 752
             L+       F+   NK +G IPA
Sbjct: 386 TALN------KFNVYGNKLNGSIPA 404



 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 42/135 (31%), Positives = 63/135 (46%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           L G +    ++L  L  L+LS N +  G++P E+G++  L  L L    F G +P +IG 
Sbjct: 398 LNGSIPAGFQKLESLTYLNLSSN-NFKGNIPSELGHIINLDTLDLSYNEFSGPVPATIGD 456

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH 710
                          GP+P   G L  +  +D+++N L+GS+P   G    LD L+    
Sbjct: 457 LEHLLELNLSKNHLDGPVPAEFGNLRSVQVIDMSNNNLSGSLPEELGQLQNLDSLI---- 512

Query: 711 FHFGXNKFSGEIPAQ 755
                N   GEIPAQ
Sbjct: 513 --LNNNNLVGEIPAQ 525



 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 38/140 (27%), Positives = 61/140 (43%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L +  LTG +   + ++  L+ LDL+ N+ LTG +PR I   + L  L L G    G 
Sbjct: 152 LILKNNQLTGPIPSTLSQIPNLKTLDLAQNQ-LTGDIPRLIYWNEVLQYLGLRGNSLTGT 210

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           +   +                 G IP S+G  +    LD++ NQ++G IP + G      
Sbjct: 211 LSPDMCQLTGLWYFDVRGNNLTGTIPESIGNCTSFEILDISYNQISGEIPYNIG------ 264

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
             +         N+ +G+IP
Sbjct: 265 -FLQVATLSLQGNRLTGKIP 283



>gb:AY518289_1610791 Arabidopsis thaliana strubbelig receptor family
           4 (SRF4) mRNA, complete cds.
          Length = 687

 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 72/215 (33%), Positives = 103/215 (47%), Gaps = 7/215 (3%)
 Frame = +3

Query: 129 IPRIQLLLVPLFIQFLGIV-AFTDNNDYVAIKALRDGWKNV-PPS----WAE-GSDPCGD 287
           + RI L+ +  F  F  +V A TD+ D   + AL D +K++  PS    W+  G DPCGD
Sbjct: 5   LQRIVLVFIACFGIFTSVVLAKTDSQD---VSALNDAYKSMNSPSKLKGWSSSGGDPCGD 61

Query: 288 HWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKK 467
            W+G+ C GS V  + +S   L+G L   +  L  L  LD+S N +L G+LP ++ +  K
Sbjct: 62  SWDGITCKGSSVTEIKVSGRGLSGSLGYQLGNLKSLTYLDVSKN-NLNGNLPYQLPD--K 118

Query: 468 LYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLT 647
           L  L      F G +P S+                 G +     +L +L  +DL+ NQLT
Sbjct: 119 LTYLDGSENDFNGNVPYSVSLMNDLSYLNLGRNNLNGELSDMFQKLPKLETIDLSSNQLT 178

Query: 648 GSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           G +P S  N      L G K  H   N+F G I A
Sbjct: 179 GKLPQSFAN------LTGLKTLHLQENQFKGSINA 207



>pir|E86312|E86312 F11A6.9 protein - Arabidopsis
           thaliana>gb:AE005172_890741 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC034257_1539927 Arabidopsis thaliana
           chromosome I BAC F11A6 genomic sequence, complete
           sequence.
          Length = 1088

 Score = 92.8 bits (229), Expect = 6e-18
 Identities = 72/211 (34%), Positives = 101/211 (47%), Gaps = 9/211 (4%)
 Frame = +3

Query: 147 LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVP----PSWAEGSD---PCGDHWEGVG 305
           LL  LF+ F      + N+D +A+ +L   +  VP     +W E +    PC ++W GV 
Sbjct: 11  LLCSLFVYFRIDSVSSLNSDGLALLSLLKHFDKVPLEVASTWKENTSETTPCNNNWFGVI 70

Query: 306 CN--GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL 479
           C+  G+ V +L LS+  L+G+L  +I EL  L  LDLS N   +G LP  +GN   L  L
Sbjct: 71  CDLSGNVVETLNLSASGLSGQLGSEIGELKSLVTLDLSLNS-FSGLLPSTLGNCTSLEYL 129

Query: 480 ILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
            L    F G +PD  G                G IP S+G L EL  L ++ N L+G+IP
Sbjct: 130 DLSNNDFSGEVPDIFGSLQNLTFLYLDRNNLSGLIPASVGGLIELVDLRMSYNNLSGTIP 189

Query: 660 VSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
              GN   L+ L          NK +G +PA
Sbjct: 190 ELLGNCSKLEYLA------LNNNKLNGSLPA 214



 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 55/187 (29%), Positives = 71/187 (37%), Gaps = 40/187 (21%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNK---------------------- 422
           N S + +L L+   L GE+   + +L +LQ L+L +NK                      
Sbjct: 314 NCSSLETLKLNDNQLQGEIPPALSKLKKLQSLELFFNKLSGEIPIGIWKIQSLTQMLVYN 373

Query: 423 -DLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLG 599
             LTG LP E+  LK L  L L   GF+G IP S+G              F G IPP L 
Sbjct: 374 NTLTGELPVEVTQLKHLKKLTLFNNGFYGDIPMSLGLNRSLEEVDLLGNRFTGEIPPHLC 433

Query: 600 QLSELYWLDLADNQLTGSIPVS-----------------DGNTPGLDMLVGTKHFHFGXN 728
              +L    L  NQL G IP S                  G  P     +   + + G N
Sbjct: 434 HGQKLRLFILGSNQLHGKIPASIRQCKTLERVRLEDNKLSGVLPEFPESLSLSYVNLGSN 493

Query: 729 KFSGEIP 749
            F G IP
Sbjct: 494 SFEGSIP 500



 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 45/140 (32%), Positives = 64/140 (45%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L +S+  L G L        +L  LDLS+N D  G +P EIGN   L++L++V C   G 
Sbjct: 225 LFVSNNSLGGRLHFGSSNCKKLVSLDLSFN-DFQGGVPPEIGNCSSLHSLVMVKCNLTGT 283

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S                        +G L ++  +DL+DN+L+G+IP   GN   L+
Sbjct: 284 IPSS------------------------MGMLRKVSVIDLSDNRLSGNIPQELGNCSSLE 319

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
            L          N+  GEIP
Sbjct: 320 TL------KLNDNQLQGEIP 333



 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 45/170 (26%), Positives = 63/170 (37%), Gaps = 22/170 (12%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNK--------------------- 422
           C+G ++    L S  L G++   I +   L+ + L  NK                     
Sbjct: 433 CHGQKLRLFILGSNQLHGKIPASIRQCKTLERVRLEDNKLSGVLPEFPESLSLSYVNLGS 492

Query: 423 -DLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLG 599
               GS+PR +G+ K L  + L      GLIP  +G                GP+P  L 
Sbjct: 493 NSFEGSIPRSLGSCKNLLTIDLSQNKLTGLIPPELGNLQSLGLLNLSHNYLEGPLPSQLS 552

Query: 600 QLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
             + L + D+  N L GSIP S  +   L  LV         N F G IP
Sbjct: 553 GCARLLYFDVGSNSLNGSIPSSFRSWKSLSTLV------LSDNNFLGAIP 596



 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 43/140 (30%), Positives = 58/140 (41%), Gaps = 1/140 (0%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS   L G L   +   + L   D+  N  L GS+P    + K L  L+L    F G 
Sbjct: 536 LNLSHNYLEGPLPSQLSGCARLLYFDVGSNS-LNGSIPSSFRSWKSLSTLVLSDNNFLGA 594

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSEL-YWLDLADNQLTGSIPVSDGNTPGL 686
           IP  +               F G IP S+G L  L Y LDL+ N  TG IP +      L
Sbjct: 595 IPQFLAELDRLSDLRIARNAFGGKIPSSVGLLKSLRYGLDLSANVFTGEIPTT------L 648

Query: 687 DMLVGTKHFHFGXNKFSGEI 746
             L+  +  +   NK +G +
Sbjct: 649 GALINLERLNISNNKLTGPL 668



>gb:AK117429_1815463 Arabidopsis thaliana At3g11010 mRNA for
           putative disease resistance protein, complete cds,
           clone: RAFL17-03-J22.
          Length = 894

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 67/194 (34%), Positives = 84/194 (43%), Gaps = 28/194 (14%)
 Frame = +3

Query: 255 SWAEGSDPCGDHWEGVGCNGS--RVVSLTLSSM--------------------------D 350
           SW   SD C  +WEGV CN     V+ L LS                            D
Sbjct: 12  SWGNNSDCC--NWEGVTCNAKSGEVIELNLSCSSLHGRFHSNSSIRNLHFLTTLDRSHND 69

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
             G+++  IE LS L  LDLSYN+  +G +   IGNL +L +L L    F G IP SI  
Sbjct: 70  FEGQITSSIENLSHLTSLDLSYNR-FSGQILNSIGNLSRLTSLDLSFNQFSGQIPSSIDN 128

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH 710
                        F G IP S+G LS L +L L+ N+  G  P S G    L  L     
Sbjct: 129 LSHLTFLGLSGNRFFGQIPSSIGNLSHLTFLGLSGNRFFGQFPSSIGGLSNLTNL----- 183

Query: 711 FHFGXNKFSGEIPA 752
            H   NK+SG+IP+
Sbjct: 184 -HLSYNKYSGQIPS 196



 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 56/147 (38%), Positives = 67/147 (45%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N SR+ SL LS    +G++   I+ LS L  L LS N+   G +P  IGNL  L  L L 
Sbjct: 104 NLSRLTSLDLSFNQFSGQIPSSIDNLSHLTFLGLSGNR-FFGQIPSSIGNLSHLTFLGLS 162

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
           G  FFG  P SIG              + G IP S+G LS+L  L L+ N   G IP S 
Sbjct: 163 GNRFFGQFPSSIGGLSNLTNLHLSYNKYSGQIPSSIGNLSQLIVLYLSVNNFYGEIPSSF 222

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           GN   L  L          NK  G  P
Sbjct: 223 GNLNQLTRL------DVSFNKLGGNFP 243



 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 38/111 (34%), Positives = 54/111 (48%)
 Frame = +3

Query: 327  SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
            S+ L +  +  EL   +  L+    +D S NK   G +P+ IG LK+L+ L L    F G
Sbjct: 686  SMVLMNKGVESEL---VRILTIYTAVDFSGNK-FEGEIPKSIGLLKELHVLNLSNNTFTG 741

Query: 507  LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
             IP SIG                G IP  +G LS L +++ + NQLTG +P
Sbjct: 742  HIPSSIGNLTALESLDVSQNKLYGEIPQEIGNLSLLSYMNFSHNQLTGLVP 792



 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 55/191 (28%), Positives = 69/191 (36%), Gaps = 43/191 (22%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +  L LS     G+    I  LS L  L LSYNK  +G +P  IGNL +L  L L 
Sbjct: 152 NLSHLTFLGLSGNRFFGQFPSSIGGLSNLTNLHLSYNK-YSGQIPSSIGNLSQLIVLYLS 210

Query: 489 GCGFFGLIPDSIGXX------------------------XXXXXXXXXXXXFIGPIPPSL 596
              F+G IP S G                                      F G +PP++
Sbjct: 211 VNNFYGEIPSSFGNLNQLTRLDVSFNKLGGNFPNVLLNLTGLSVVSLSNNKFTGTLPPNI 270

Query: 597 GQLSELYWLDLADNQLTGSIPVSDGNTPGL-------DMLVGTKHF------------HF 719
             LS L     +DN  TG+ P      P L       + L GT  F            + 
Sbjct: 271 TSLSNLMAFYASDNAFTGTFPSFLFIIPSLTYLGLSGNQLKGTLEFGNISSPSNLQYLNI 330

Query: 720 GXNKFSGEIPA 752
           G N F G IP+
Sbjct: 331 GSNNFIGPIPS 341



 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 39/132 (29%), Positives = 59/132 (44%), Gaps = 5/132 (3%)
 Frame = +3

Query: 369  GDIEELSELQILDLSYNKD----LTGSLPREIGNLKKLYNLI-LVGCGFFGLIPDSIGXX 533
            G  E+ S +  L   Y +D    +   +  E+  +  +Y  +   G  F G IP SIG  
Sbjct: 667  GTYEDGSNVNYLGSGYYQDSMVLMNKGVESELVRILTIYTAVDFSGNKFEGEIPKSIGLL 726

Query: 534  XXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHF 713
                        F G IP S+G L+ L  LD++ N+L G IP   GN   L +L    + 
Sbjct: 727  KELHVLNLSNNTFTGHIPSSIGNLTALESLDVSQNKLYGEIPQEIGN---LSLL---SYM 780

Query: 714  HFGXNKFSGEIP 749
            +F  N+ +G +P
Sbjct: 781  NFSHNQLTGLVP 792



 Score = 42.4 bits (98), Expect = 0.009
 Identities = 37/115 (32%), Positives = 52/115 (45%), Gaps = 4/115 (3%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEEL----SELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S ++ S+ L+G    D  E+     EL  LD+S NK + G +P  +  L  L+ L L   
Sbjct: 424 SQSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNK-IKGQVPGWLWTLPNLFYLNLSNN 482

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
            F G    +                F G IP  + +L  LY LDL+DN  +GSIP
Sbjct: 483 TFIGFQRPT-KPEPSMAYLLGSNNNFTGKIPSFICELRSLYTLDLSDNNFSGSIP 536



 Score = 32.7 bits (73), Expect = 7.3
 Identities = 33/118 (27%), Positives = 50/118 (42%), Gaps = 1/118 (0%)
 Frame = +3

Query: 282 GDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNL 461
           G ++  V  N + +  ++LS+   TG L  +I  LS L     S N   TG+ P  +  +
Sbjct: 239 GGNFPNVLLNLTGLSVVSLSNNKFTGTLPPNITSLSNLMAFYASDNA-FTGTFPSFLFII 297

Query: 462 KKLYNLILVGCGFFGLIP-DSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLA 632
             L  L L G    G +   +I               FIGPIP S+ +L  L  L ++
Sbjct: 298 PSLTYLGLSGNQLKGTLEFGNISSPSNLQYLNIGSNNFIGPIPSSISKLINLQELGIS 355



>pir|A85043|A85043 probable LRR receptor-like protein kinase
           [imported] - Arabidopsis thaliana>gb:AC005275_1532370
           Arabidopsis thaliana BAC F4C21 from chromosome IV, top
           arm, near 17 cM, complete sequence.>gb:ATCHRIV8_1547320
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 8.
          Length = 754

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 63/209 (30%), Positives = 103/209 (49%), Gaps = 7/209 (3%)
 Frame = +3

Query: 144 LLLVPLFIQFLGIV-----AFTDNNDYVAIKALRDGW-KNVPPSW-AEGSDPCGDHWEGV 302
           LLL+PL +  L  +     A T+ +D  AI  L       V P W A G DPCG+ W+G+
Sbjct: 10  LLLLPLLLSLLIWIPSISLAATNPDDVAAINGLFAALGAPVLPGWIASGGDPCGEAWQGI 69

Query: 303 GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI 482
            CN S ++S+T+++ +L GEL  ++ + + ++ +D S N+ + GS+P  +     L +  
Sbjct: 70  ICNVSDIISITVNAANLQGELGDNLAKFTSIRGIDFSNNR-IGGSIPSTLP--VTLQHFF 126

Query: 483 LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPV 662
           L    F G IP+S+G                G +P     L  L  LD++ N ++G++P 
Sbjct: 127 LSANQFTGSIPESLGTLSFLNDMSLNDNLLSGELPDVFQNLVGLINLDISSNNISGTLP- 185

Query: 663 SDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
                P ++ L+     +   N FSG IP
Sbjct: 186 -----PSMENLLTLTTLNIENNLFSGPIP 209



 Score = 32.7 bits (73), Expect = 7.3
 Identities = 23/65 (35%), Positives = 36/65 (55%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           ++L+   L+GEL    + L  L  LD+S N +++G+LP  + NL  L  L +    F G 
Sbjct: 149 MSLNDNLLSGELPDVFQNLVGLINLDISSN-NISGTLPPSMENLLTLTTLNIENNLFSGP 207

Query: 510 IPDSI 524
           IPD +
Sbjct: 208 IPDKL 212



>gb:AP003992_1836055 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1077_E05.
          Length = 795

 Score = 89.0 bits (219), Expect = 9e-17
 Identities = 58/188 (30%), Positives = 85/188 (45%), Gaps = 22/188 (11%)
 Frame = +3

Query: 252 PSW-AEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYN--- 419
           P W A G DPCGD W+GV C GS + S+  ++ +L G+L G +   + +  ++LS N   
Sbjct: 62  PKWTANGGDPCGDGWQGVVCIGSNIDSIIFNAANLEGQL-GSLGNFTSITTINLSNNNIG 120

Query: 420 ------------------KDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXX 545
                               LTGS+P  +  L+ L ++ L      G +PD+ G      
Sbjct: 121 GTIPEDLPVTLQHFFMSDNQLTGSIPTSLSMLQSLTDMSLNDNHLDGKLPDAFGSLTGLV 180

Query: 546 XXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGX 725
                   F G +PPSLG LS L  L + DNQL+G++ V           +  K  +   
Sbjct: 181 NFDISSNNFSGSLPPSLGSLSSLTTLHMQDNQLSGTLDVLQD--------LPLKDLNIEN 232

Query: 726 NKFSGEIP 749
           N FSG +P
Sbjct: 233 NLFSGPVP 240



>gb:ATAC011620_1543299 Arabidopsis thaliana chromosome III BAC F18C1
           genomic sequence, complete sequence.
          Length = 883

 Score = 89.0 bits (219), Expect = 9e-17
 Identities = 63/174 (36%), Positives = 80/174 (45%), Gaps = 7/174 (4%)
 Frame = +3

Query: 255 SWAEGSDPCGDHWEGVGCNGS--RVVSLTLSSMDLTGELSGD-----IEELSELQILDLS 413
           SW  GSD C  HW+G+ C+     V+ + L    L G    +     ++    L  LDLS
Sbjct: 62  SWENGSDCC--HWDGITCDAKTGEVIEIDLMCSCLHGWFHSNSNLSMLQNFHFLTTLDLS 119

Query: 414 YNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPS 593
           YN  L+G +   IGNL  L  L L G  F G IP S+G              F G IP S
Sbjct: 120 YNH-LSGQISSSIGNLSHLTTLDLSGNNFSGWIPSSLGNLFHLTSLHLYDNNFGGEIPSS 178

Query: 594 LGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           LG LS L +LDL+ N   G IP S G+   L +L          NK SG +P +
Sbjct: 179 LGNLSYLTFLDLSTNNFVGEIPSSFGSLNQLSIL------RLDNNKLSGNLPLE 226



 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 47/147 (31%), Positives = 72/147 (48%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +  L LS+ +  GE+      L++L IL L  NK L+G+LP E+ NL KL  + L 
Sbjct: 181 NLSYLTFLDLSTNNFVGEIPSSFGSLNQLSILRLDNNK-LSGNLPLEVINLTKLSEISLS 239

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
              F G +P +I               F+G IP SL  +  +  + L +NQL+G++   +
Sbjct: 240 HNQFTGTLPPNITSLSILESFSASGNNFVGTIPSSLFTIPSITLIFLDNNQLSGTLEFGN 299

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            ++P  ++LV       G N   G IP
Sbjct: 300 ISSPS-NLLV----LQLGGNNLRGPIP 321



 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 35/105 (33%), Positives = 49/105 (46%), Gaps = 1/105 (0%)
 Frame = +3

Query: 438 LPREIGNLKKLYNLI-LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSEL 614
           L  E+  + K+Y  +   G  F G IP SIG              F G IP S+G L EL
Sbjct: 678 LEMELVRILKIYTALDFSGNKFEGEIPRSIGLLKELHILNLSSNGFTGHIPSSMGNLREL 737

Query: 615 YWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
             LD++ N+L+G IP   GN   L       + +F  N+  G++P
Sbjct: 738 ESLDVSRNKLSGEIPQELGNLSYL------AYMNFSHNQLVGQVP 776



 Score = 40.8 bits (94), Expect = 0.027
 Identities = 22/47 (46%), Positives = 30/47 (63%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKL 470
           L LSS   TG +   +  L EL+ LD+S NK L+G +P+E+GNL  L
Sbjct: 716 LNLSSNGFTGHIPSSMGNLRELESLDVSRNK-LSGEIPQELGNLSYL 761



>gb:AP004234_1839081 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0001H02.
          Length = 647

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 64/183 (34%), Positives = 88/183 (48%), Gaps = 1/183 (0%)
 Frame = +3

Query: 210 VAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCN-GSRVVSLTLSSMDLTGELSGDIEEL 386
           +A+K   D    V  SWA   +PCG  + GV C+ G RV +++L    L+G L   I  L
Sbjct: 1   MALKESLDPAGRVLGSWARSGEPCGGSFVGVTCDSGGRVTAISLQGRGLSGTLPPAIAGL 60

Query: 387 SELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXX 566
             L  L L YN  + G++PREIG+L +L +L L      G +P  I              
Sbjct: 61  RRLTGLYLHYN-GIKGAIPREIGSLSELTDLYLDVNHLTGPLPVEIAAMENLQVLQLGYN 119

Query: 567 XFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEI 746
              G IPP LG+L++L  L L  NQLTG+IP + G+   L  L          N   G I
Sbjct: 120 QLTGSIPPQLGKLNKLAVLALQSNQLTGAIPATLGDLTQLARL------DLSFNSLFGSI 173

Query: 747 PAQ 755
           P++
Sbjct: 174 PSK 176



>pir|B84594|B84594 probable LRR receptor protein kinase [imported] -
           Arabidopsis thaliana
          Length = 767

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 65/211 (30%), Positives = 95/211 (45%), Gaps = 23/211 (10%)
 Frame = +3

Query: 183 VAFTDNNDYVAIKALRDGWKN-VPPSW-AEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLT 356
           +A T+ +D  AI +L    ++ + P W A G DPCG+ W+GV CN S+V ++ L S +L 
Sbjct: 30  LALTNPDDVAAINSLFLALESPLLPGWVASGGDPCGESWQGVLCNASQVETIILISANLG 89

Query: 357 GELSGDIEELSELQILDLSYN---------------------KDLTGSLPREIGNLKKLY 473
           GEL   +   + L+ +D S N                      + TG++P  + +LK L 
Sbjct: 90  GELGVGLNMFTSLKAMDFSNNHIGGSIPSTLPVSLQNLFLSGNNFTGTIPESLSSLKSLS 149

Query: 474 NLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGS 653
            + L      G IPD                   GP+PPS+  LS L  LDL+ N L+G 
Sbjct: 150 VMSLNNNLLSGKIPDVFQDLGLMINIDLSSNNLSGPLPPSMQNLSTLTSLDLSSNNLSGP 209

Query: 654 IPVSDGNTPGLDMLVGTKHFHFGXNKFSGEI 746
           +P S  N   L  L+         N  SGE+
Sbjct: 210 LPPSMQNLSTLTSLL------LQNNHLSGEL 234



>gb:AP002908_1823802 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0013G02.>gb:AP003310_1827792 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0022F12.
          Length = 689

 Score = 88.2 bits (217), Expect = 1e-16
 Identities = 63/174 (36%), Positives = 82/174 (47%), Gaps = 6/174 (3%)
 Frame = +3

Query: 252 PSWAEGSDPCGDH----WEGVGCNGSR--VVSLTLSSMDLTGELSGDIEELSELQILDLS 413
           PSWA G DPCG      +EGV C+G+   V +++L    L G L   +  L+ L  L L 
Sbjct: 51  PSWAPGRDPCGREGGGGFEGVACDGATGAVANVSLQGKGLAGTLPPAVAGLTALTGLYLH 110

Query: 414 YNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPS 593
           YN+ LTG+LPRE+  L +L +L L    F G IP  I                 G +P  
Sbjct: 111 YNR-LTGALPRELAALSRLTDLYLNVNNFSGPIPPEIAAMPSLQVVQLCYNQLTGGVPTQ 169

Query: 594 LGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           LG L  L  L+L  N L+G+IP S G+ P L  L          N   G IP +
Sbjct: 170 LGLLKRLTVLELQSNHLSGAIPASLGDLPQLVRL------DLSFNNLFGSIPVR 217



>gb:ATAC009991_1543120 Arabidopsis thaliana chromosome III BAC F9F8
           genomic sequence, complete sequence.
          Length = 957

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 71/217 (32%), Positives = 86/217 (39%), Gaps = 51/217 (23%)
 Frame = +3

Query: 255 SWAEGSDPCGDHWEGVGCNGS--RVVSLTLSSM--------------------------D 350
           SW   SD C  +WEGV CN     V+ L LS                            D
Sbjct: 75  SWGNNSDCC--NWEGVTCNAKSGEVIELNLSCSSLHGRFHSNSSIRNLHFLTTLDRSHND 132

Query: 351 LTGELSGDIEELSELQILDLSYNK-----------------------DLTGSLPREIGNL 461
             G+++  IE LS L  LDLSYN+                         +G +P  IGNL
Sbjct: 133 FEGQITSSIENLSHLTSLDLSYNRFSGQILNSIGNLSRLTSLDLSFNQFSGQIPSSIGNL 192

Query: 462 KKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQ 641
             L  L L G  FFG IP SIG              F G  P S+G LS L  L L+ N+
Sbjct: 193 SHLTFLGLSGNRFFGQIPSSIGNLSHLTFLGLSGNRFFGQFPSSIGGLSNLTNLHLSYNK 252

Query: 642 LTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            +G IP S GN   L +L      +   N F GEIP+
Sbjct: 253 YSGQIPSSIGNLSQLIVL------YLSVNNFYGEIPS 283



 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 56/147 (38%), Positives = 66/147 (44%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N SR+ SL LS    +G++   I  LS L  L LS N+   G +P  IGNL  L  L L 
Sbjct: 167 NLSRLTSLDLSFNQFSGQIPSSIGNLSHLTFLGLSGNR-FFGQIPSSIGNLSHLTFLGLS 225

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
           G  FFG  P SIG              + G IP S+G LS+L  L L+ N   G IP S 
Sbjct: 226 GNRFFGQFPSSIGGLSNLTNLHLSYNKYSGQIPSSIGNLSQLIVLYLSVNNFYGEIPSSF 285

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           GN   L  L          NK  G  P
Sbjct: 286 GNLNQLTRL------DVSFNKLGGNFP 306



 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 38/111 (34%), Positives = 54/111 (48%)
 Frame = +3

Query: 327  SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
            S+ L +  +  EL   +  L+    +D S NK   G +P+ IG LK+L+ L L    F G
Sbjct: 749  SMVLMNKGVESEL---VRILTIYTAVDFSGNK-FEGEIPKSIGLLKELHVLNLSNNAFTG 804

Query: 507  LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
             IP SIG                G IP  +G LS L +++ + NQLTG +P
Sbjct: 805  HIPSSIGNLTALESLDVSQNKLYGEIPQEIGNLSLLSYMNFSHNQLTGLVP 855



 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 55/191 (28%), Positives = 69/191 (36%), Gaps = 43/191 (22%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +  L LS     G+    I  LS L  L LSYNK  +G +P  IGNL +L  L L 
Sbjct: 215 NLSHLTFLGLSGNRFFGQFPSSIGGLSNLTNLHLSYNK-YSGQIPSSIGNLSQLIVLYLS 273

Query: 489 GCGFFGLIPDSIGXX------------------------XXXXXXXXXXXXFIGPIPPSL 596
              F+G IP S G                                      F G +PP++
Sbjct: 274 VNNFYGEIPSSFGNLNQLTRLDVSFNKLGGNFPNVLLNLTGLSVVSLSNNKFTGTLPPNI 333

Query: 597 GQLSELYWLDLADNQLTGSIPVSDGNTPGL-------DMLVGTKHF------------HF 719
             LS L     +DN  TG+ P      P L       + L GT  F            + 
Sbjct: 334 TSLSNLMAFYASDNAFTGTFPSFLFIIPSLTYLGLSGNQLKGTLEFGNISSPSNLQYLNI 393

Query: 720 GXNKFSGEIPA 752
           G N F G IP+
Sbjct: 394 GSNNFIGPIPS 404



 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 39/132 (29%), Positives = 59/132 (44%), Gaps = 5/132 (3%)
 Frame = +3

Query: 369  GDIEELSELQILDLSYNKD----LTGSLPREIGNLKKLYNLI-LVGCGFFGLIPDSIGXX 533
            G  E+ S +  L   Y +D    +   +  E+  +  +Y  +   G  F G IP SIG  
Sbjct: 730  GTYEDGSNVNYLGSGYYQDSMVLMNKGVESELVRILTIYTAVDFSGNKFEGEIPKSIGLL 789

Query: 534  XXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHF 713
                        F G IP S+G L+ L  LD++ N+L G IP   GN   L +L    + 
Sbjct: 790  KELHVLNLSNNAFTGHIPSSIGNLTALESLDVSQNKLYGEIPQEIGN---LSLL---SYM 843

Query: 714  HFGXNKFSGEIP 749
            +F  N+ +G +P
Sbjct: 844  NFSHNQLTGLVP 855



 Score = 42.4 bits (98), Expect = 0.009
 Identities = 37/115 (32%), Positives = 52/115 (45%), Gaps = 4/115 (3%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEEL----SELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S ++ S+ L+G    D  E+     EL  LD+S NK + G +P  +  L  L+ L L   
Sbjct: 487 SQSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNK-IKGQVPGWLWTLPNLFYLNLSNN 545

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
            F G    +                F G IP  + +L  LY LDL+DN  +GSIP
Sbjct: 546 TFIGFQRPT-KPEPSMAYLLGSNNNFTGKIPSFICELRSLYTLDLSDNNFSGSIP 599



 Score = 32.7 bits (73), Expect = 7.3
 Identities = 33/118 (27%), Positives = 50/118 (42%), Gaps = 1/118 (0%)
 Frame = +3

Query: 282 GDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNL 461
           G ++  V  N + +  ++LS+   TG L  +I  LS L     S N   TG+ P  +  +
Sbjct: 302 GGNFPNVLLNLTGLSVVSLSNNKFTGTLPPNITSLSNLMAFYASDNA-FTGTFPSFLFII 360

Query: 462 KKLYNLILVGCGFFGLIP-DSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLA 632
             L  L L G    G +   +I               FIGPIP S+ +L  L  L ++
Sbjct: 361 PSLTYLGLSGNQLKGTLEFGNISSPSNLQYLNIGSNNFIGPIPSSISKLINLQELGIS 418



>gb:AB008270_1510484 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MTG13.>gb:BT011691_1641213 Arabidopsis thaliana
           At5g16590 gene, complete cds.>gb:BT012270_1641476
           Arabidopsis thaliana At5g16590 gene, complete cds.
          Length = 625

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 65/199 (32%), Positives = 92/199 (46%), Gaps = 2/199 (1%)
 Frame = +3

Query: 159 LFIQFLGIVAFTDN--NDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSL 332
           +F  F+ +V+ T +   D  A+ ALRDG    P  W   + PC   W GV C   RV +L
Sbjct: 11  VFFFFICLVSVTSDLEADRRALIALRDGVHGRPLLWNLTAPPCT--WGGVQCESGRVTAL 68

Query: 333 TLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLI 512
            L  + L+G L   I  L++L+ L   +N  L G LP +  NL  L  L L G  F G I
Sbjct: 69  RLPGVGLSGPLPIAIGNLTKLETLSFRFNA-LNGPLPPDFANLTLLRYLYLQGNAFSGEI 127

Query: 513 PDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM 692
           P  +               F+G IP ++   + L  L L DNQLTG IP         ++
Sbjct: 128 PSFLFTLPNIIRINLAQNNFLGRIPDNVNSATRLATLYLQDNQLTGPIP---------EI 178

Query: 693 LVGTKHFHFGXNKFSGEIP 749
            +  + F+   N+ +G IP
Sbjct: 179 KIKLQQFNVSSNQLNGSIP 197



 Score = 36.2 bits (82), Expect = 0.66
 Identities = 20/59 (33%), Positives = 30/59 (50%)
 Frame = +3

Query: 576 GPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           GP+P ++G L++L  L    N L G +P      P    L   ++ +   N FSGEIP+
Sbjct: 77  GPLPIAIGNLTKLETLSFRFNALNGPLP------PDFANLTLLRYLYLQGNAFSGEIPS 129



>pir|C96756|C96756 receptor-like protein kinase homolog [imported] -
           Arabidopsis thaliana>gb:AE005173_894853 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC008017_1536451 Arabidopsis thaliana
           chromosome I BAC F3N23 genomic sequence, complete
           sequence.>gb:AK117384_1815422 Arabidopsis thaliana
           At1g73070 mRNA for unknown protein, complete cds, clone:
           RAFL16-96-P09.
          Length = 598

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 64/210 (30%), Positives = 100/210 (47%), Gaps = 8/210 (3%)
 Frame = +3

Query: 144 LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPP----SW---AEGSDPCGDHWEGV 302
           LLL  LF+    +     N+D + + +LR     VPP    +W   A  + PC  +W G+
Sbjct: 10  LLLFCLFVSVRIVSVSCLNSDGLTLLSLRKHLDKVPPELTSTWKTNASEATPC--NWFGI 67

Query: 303 GCNGSR-VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL 479
            C+ S+ V SL  +   ++G+L  +I +L  L+ILD+S N + +G +P  +GN   L  +
Sbjct: 68  ICDDSKKVTSLNFTGSGVSGQLGPEIGQLKSLEILDMSSN-NFSGIIPSSLGNCSSLVYI 126

Query: 480 ILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
            L    F G +PD++G                G +P SL ++  L +L +  N LTG IP
Sbjct: 127 DLSENSFSGKVPDTLGSLKSLADLYLYSNSLTGELPKSLFRIPVLNYLHVEHNNLTGLIP 186

Query: 660 VSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            + G    L       H     N+F+G IP
Sbjct: 187 QNVGEAKEL------LHLRLFDNQFTGTIP 210



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 49/145 (33%), Positives = 65/145 (44%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +  L +++  L G +     +   L  LDLSYN +  G +P E+GN   L  L++V    
Sbjct: 243 LTDLFVANNSLRGTVQFGSTKCRNLVTLDLSYN-EFEGGVPPELGNCSSLDALVIVSGNL 301

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IP S+G                G IP  LG  S L  L L DNQL G IP + G   
Sbjct: 302 SGTIPSSLGMLKNLTILNLSENRLSGSIPAELGNCSSLNLLKLNDNQLVGGIPSALGKLR 361

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L+ L          N+FSGEIP +
Sbjct: 362 KLESL------ELFENRFSGEIPIE 380



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 45/145 (31%), Positives = 69/145 (47%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +  L L S  LTGEL   +  +  L  L + +N +LTG +P+ +G  K+L +L L    F
Sbjct: 147 LADLYLYSNSLTGELPKSLFRIPVLNYLHVEHN-NLTGLIPQNVGEAKELLHLRLFDNQF 205

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IP+SIG               +G +P SL  L  L  L +A+N L G+  V  G+T 
Sbjct: 206 TGTIPESIGNCSKLEILYLHKNKLVGSLPASLNLLESLTDLFVANNSLRGT--VQFGSTK 263

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
             +++          N+F G +P +
Sbjct: 264 CRNLVT----LDLSYNEFEGGVPPE 284



 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 45/144 (31%), Positives = 62/144 (43%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           ++ SL L     +GE+  +I ++  L  L L Y  +LTG LP EI  LK L  + L    
Sbjct: 362 KLESLELFENRFSGEIPIEIWKIQSLTQL-LVYRNNLTGKLPEEITKLKNLKIVTLFNNS 420

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
           F+G+IP ++G              F G IP +L     L   +L  N+L G IP S    
Sbjct: 421 FYGVIPPNLGLNSNLEIIDFIGNNFTGEIPRNLCHGKMLTVFNLGSNRLHGKIPASVSQC 480

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIP 749
             L        F    N  SG +P
Sbjct: 481 KTL------SRFILRENNLSGFLP 498



 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 49/165 (29%), Positives = 72/165 (43%), Gaps = 18/165 (10%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S + +L + S +L+G +   +  L  L IL+LS N+ L+GS+P E+GN   L  L L 
Sbjct: 287 NCSSLDALVIVSGNLSGTIPSSLGMLKNLTILNLSENR-LSGSIPAELGNCSSLNLLKLN 345

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP--- 659
                G IP ++G              F G IP  + ++  L  L +  N LTG +P   
Sbjct: 346 DNQLVGGIPSALGKLRKLESLELFENRFSGEIPIEIWKIQSLTQLLVYRNNLTGKLPEEI 405

Query: 660 --------VSDGNT-------PGLDMLVGTKHFHFGXNKFSGEIP 749
                   V+  N        P L +    +   F  N F+GEIP
Sbjct: 406 TKLKNLKIVTLFNNSFYGVIPPNLGLNSNLEIIDFIGNNFTGEIP 450



 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 37/136 (27%), Positives = 58/136 (42%)
 Frame = +3

Query: 348 DLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG 527
           + TGE+  ++     L + +L  N+ L G +P  +   K L   IL      G +P    
Sbjct: 444 NFTGEIPRNLCHGKMLTVFNLGSNR-LHGKIPASVSQCKTLSRFILRENNLSGFLP-KFS 501

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTK 707
                         F GPIP SLG    L  ++L+ N+LT +IP        L+ L    
Sbjct: 502 KNQDLSFLDLNSNSFEGPIPRSLGSCRNLTTINLSRNKLTRNIPRE------LENLQNLS 555

Query: 708 HFHFGXNKFSGEIPAQ 755
           H + G N  +G +P++
Sbjct: 556 HLNLGSNLLNGTVPSK 571



 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 44/154 (28%), Positives = 61/154 (39%), Gaps = 18/154 (11%)
 Frame = +3

Query: 348 DLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG 527
           +LTG +  ++ E  EL  L L ++   TG++P  IGN  KL  L L      G +P S+ 
Sbjct: 180 NLTGLIPQNVGEAKELLHLRL-FDNQFTGTIPESIGNCSKLEILYLHKNKLVGSLPASLN 238

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLV--- 698
                           G +     +   L  LDL+ N+  G +P   GN   LD LV   
Sbjct: 239 LLESLTDLFVANNSLRGTVQFGSTKCRNLVTLDLSYNEFEGGVPPELGNCSSLDALVIVS 298

Query: 699 ----GTKHFHFG-----------XNKFSGEIPAQ 755
               GT     G            N+ SG IPA+
Sbjct: 299 GNLSGTIPSSLGMLKNLTILNLSENRLSGSIPAE 332



>gb:AC006234_1533809 Arabidopsis thaliana chromosome 2 clone F5H14
           map mi148, complete sequence.>gb:AY056176_1563501
           Arabidopsis thaliana putative LRR receptor protein
           kinase (At2g20850) mRNA, complete
           cds.>gb:AY518286_1610788 Arabidopsis thaliana strubbelig
           receptor family 1 (SRF1) mRNA, complete
           cds.>gb:BT001939_1635542 Arabidopsis thaliana clone
           C105466 putative LRR receptor protein kinase (At2g20850)
           mRNA, complete cds.
          Length = 772

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 62/190 (32%), Positives = 91/190 (47%), Gaps = 2/190 (1%)
 Frame = +3

Query: 183 VAFTDNNDYVAIKALRDGWKN-VPPSW-AEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLT 356
           +A T+ +D  AI +L    ++ + P W A G DPCG+ W+GV CN S+V ++ L S +L 
Sbjct: 27  LALTNPDDVAAINSLFLALESPLLPGWVASGGDPCGESWQGVLCNASQVETIILISANLG 86

Query: 357 GELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXX 536
           GEL   +   + L+ +D S N  + GS+P  +     L NL L G  F G IP+S+    
Sbjct: 87  GELGVGLNMFTSLKAMDFS-NNHIGGSIPSTLP--VSLQNLFLSGNNFTGTIPESLSSLK 143

Query: 537 XXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFH 716
                        G IP     L  +  +DL+ N L+G +P S  N   L  L+      
Sbjct: 144 SLSVMSLNNNLLSGKIPDVFQDLGLMINIDLSSNNLSGPLPPSMQNLSTLTSLL------ 197

Query: 717 FGXNKFSGEI 746
              N  SGE+
Sbjct: 198 LQNNHLSGEL 207



>pir|T05250|T05250 probable disease resistance protein F18A5.200 -
           Arabidopsis thaliana>gb:ATCHRIV37_1545145 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           37.>gb:ATF18A5_1549066 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F18A5 (ESSA project).
          Length = 741

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 65/179 (36%), Positives = 81/179 (45%), Gaps = 14/179 (7%)
 Frame = +3

Query: 258 WAEGSDPCGDHWEGVGCNGSR--VVSLTLSSMDLTGEL--SGDIEELSELQILDLSYNKD 425
           W   +D C   W+GV C+     VV L L    L G L  +  +  L  LQ L L  N  
Sbjct: 5   WRNNTDCCS--WDGVSCDPKTGVVVELDLQYSHLNGPLRSNSSLFRLQHLQKLVLGSNH- 61

Query: 426 LTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLG-- 599
           L+G LP  IGNLK+L  L+LV C  FG IP S+G              F    P S+G  
Sbjct: 62  LSGILPDSIGNLKRLKVLVLVNCNLFGKIPSSLGNLSYLTHLDLSYNDFTSEGPDSMGNL 121

Query: 600 --------QLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
                   +LS + W+DL DNQL G +P    N   L  L   + F    N FSG IP+
Sbjct: 122 NRLTDMLLKLSSVTWIDLGDNQLKGMLP---SNMSSLSKL---EAFDISGNSFSGTIPS 174



 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 54/189 (28%), Positives = 71/189 (37%), Gaps = 49/189 (25%)
 Frame = +3

Query: 330  LTLSSMDLTGEL--SGDIEELSELQILDLSYNKDLTGSLP-------------------- 443
            L L S +  G +   GD    S L+I D+S N+  TG LP                    
Sbjct: 471  LVLRSNEFYGPIFSPGDSLSFSRLRIFDISENR-FTGVLPSDYFVGWSVMSSVVDIDGRI 529

Query: 444  --------------REIGNLKKLYNLILVGCGFF-------------GLIPDSIGXXXXX 542
                          + +  + K   + LVG GF              G IP+SIG     
Sbjct: 530  IQYTVTGIDRDFYHKSVALINKGLKMELVGSGFTIYKTIDVSGNRLEGDIPESIGLLKEV 589

Query: 543  XXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFG 722
                     F G IPPSL  LS L  LDL+ N+L+GSIP   G    L+ +      +F 
Sbjct: 590  IVLSMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGKLTFLEWM------NFS 643

Query: 723  XNKFSGEIP 749
             N+  G IP
Sbjct: 644  HNRLEGPIP 652



 Score = 33.1 bits (74), Expect = 5.6
 Identities = 24/76 (31%), Positives = 34/76 (44%), Gaps = 16/76 (21%)
 Frame = +3

Query: 570 FIGPIPPSLGQLSELYWLDLADNQLTGSIP------------VSDGNTPGLDMLVGTKH- 710
           F G IP ++ +L  L  L L++N  +GSIP            + + N  G+       H 
Sbjct: 360 FSGEIPKTICELDNLRILVLSNNNFSGSIPRCFENLHLYVLHLRNNNLSGIFPEEAISHH 419

Query: 711 ---FHFGXNKFSGEIP 749
              F  G N FSGE+P
Sbjct: 420 LQSFDVGHNLFSGELP 435



>sp|P93194|RPK1_PHANI Receptor-like protein kinase precursor (EC
           2.7.1.37).>gb:INU77888_1683175 Ipomoea nil receptor-like
           protein kinase INRPK1 (inrpk1) gene, complete cds,
           alternatively spliced.
          Length = 1109

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 66/195 (33%), Positives = 92/195 (47%), Gaps = 6/195 (3%)
 Frame = +3

Query: 186 AFTDNNDYVAIKALRDGWKNVPP----SW-AEGSDPCGDHWEGVGCNGSRVV-SLTLSSM 347
           AF  N+D  A+ +L   W ++P     SW A  S PC   W GV C+  + V +L LSS 
Sbjct: 21  AFALNSDGAALLSLTRHWTSIPSDITQSWNASDSTPCS--WLGVECDRRQFVDTLNLSSY 78

Query: 348 DLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG 527
            ++GE   +I  L  L+ + LS N    GS+P ++GN   L ++ L    F G IPD++G
Sbjct: 79  GISGEFGPEISHLKHLKKVVLSGN-GFFGSIPSQLGNCSLLEHIDLSSNSFTGNIPDTLG 137

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTK 707
                          IGP P SL  +  L  +    N L GSIP + GN   L  L    
Sbjct: 138 ALQNLRNLSLFFNSLIGPFPESLLSIPHLETVYFTGNGLNGSIPSNIGNMSELTTL---- 193

Query: 708 HFHFGXNKFSGEIPA 752
                 N+FSG +P+
Sbjct: 194 --WLDDNQFSGPVPS 206



 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 45/147 (30%), Positives = 58/147 (39%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N   +V L + +  L G +  D     ++  + LS N   TG LP  +GN   L      
Sbjct: 234 NLENLVYLDVRNNSLVGAIPLDFVSCKQIDTISLS-NNQFTGGLPPGLGNCTSLREFGAF 292

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
            C   G IP   G              F G IPP LG+   +  L L  NQL G IP   
Sbjct: 293 SCALSGPIPSCFGQLTKLDTLYLAGNHFSGRIPPELGKCKSMIDLQLQQNQLEGEIPGE- 351

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
                L ML   ++ H   N  SGE+P
Sbjct: 352 -----LGMLSQLQYLHLYTNNLSGEVP 373



 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 49/162 (30%), Positives = 73/162 (45%), Gaps = 17/162 (10%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S++  L L + +L+GE+   I ++  LQ L L Y  +L+G LP ++  LK+L +L L   
Sbjct: 356 SQLQYLHLYTNNLSGEVPLSIWKIQSLQSLQL-YQNNLSGELPVDMTELKQLVSLALYEN 414

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
            F G+IP  +G              F G IPP+L    +L  L L  N L GS+P   G 
Sbjct: 415 HFTGVIPQDLGANSSLEVLDLTRNMFTGHIPPNLCSQKKLKRLLLGYNYLEGSVPSDLGG 474

Query: 675 TPGLDMLVGTKH-----------------FHFGXNKFSGEIP 749
              L+ L+  ++                 F    N F+G IP
Sbjct: 475 CSTLERLILEENNLRGGLPDFVEKQNLLFFDLSGNNFTGPIP 516



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 46/147 (31%), Positives = 67/147 (45%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N   V ++ LSS  L+G +  ++  L +L+ L+LS+N  L G LP E+ N  KL  L   
Sbjct: 521 NLKNVTAIYLSSNQLSGSIPPELGSLVKLEHLNLSHN-ILKGILPSELSNCHKLSELDAS 579

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP ++G              F G IP SL Q ++L  L L  N L G I    
Sbjct: 580 HNLLNGSIPSTLGSLTELTKLSLGENSFSGGIPTSLFQSNKLLNLQLGGNLLAGDI---- 635

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
              P +  L   +  +   NK +G++P
Sbjct: 636 ---PPVGALQALRSLNLSSNKLNGQLP 659



 Score = 35.4 bits (80), Expect = 1.1
 Identities = 31/91 (34%), Positives = 42/91 (46%), Gaps = 4/91 (4%)
 Frame = +3

Query: 336 LSSMDLTGEL-SGDIEELSELQIL---DLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF 503
           L ++ L G L +GDI  +  LQ L   +LS NK L G LP ++G LK L  L +      
Sbjct: 621 LLNLQLGGNLLAGDIPPVGALQALRSLNLSSNK-LNGQLPIDLGKLKMLEELDVSHNNLS 679

Query: 504 GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSL 596
           G +   +               F GP+PPSL
Sbjct: 680 GTLR-VLSTIQSLTFINISHNLFSGPVPPSL 709



 Score = 33.5 bits (75), Expect = 4.3
 Identities = 24/66 (36%), Positives = 40/66 (60%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           SL LSS  L G+L  D+ +L  L+ LD+S+N +L+G+L R +  ++ L  + +    F G
Sbjct: 646 SLNLSSNKLNGQLPIDLGKLKMLEELDVSHN-NLSGTL-RVLSTIQSLTFINISHNLFSG 703

Query: 507 LIPDSI 524
            +P S+
Sbjct: 704 PVPPSL 709



>gb:ATH496433_1552814 Arabidopsis thaliana mRNA for extra sporogenous
            cells (ESP gene).
          Length = 1192

 Score = 87.0 bits (214), Expect = 3e-16
 Identities = 55/145 (37%), Positives = 78/145 (53%)
 Frame = +3

Query: 321  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
            +V ++LS+  L+GE+   +  L+ L ILDLS N  LTGS+P+E+GN  KL  L L     
Sbjct: 606  LVEISLSNNHLSGEIPASLSRLTNLTILDLSGNA-LTGSIPKEMGNSLKLQGLNLANNQL 664

Query: 501  FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
             G IP+S G                GP+P SLG L EL  +DL+ N L+G +        
Sbjct: 665  NGHIPESFGLLGSLVKLNLTKNKLDGPVPASLGNLKELTHMDLSFNNLSGEL---SSELS 721

Query: 681  GLDMLVGTKHFHFGXNKFSGEIPAQ 755
             ++ LVG    +   NKF+GEIP++
Sbjct: 722  TMEKLVG---LYIEQNKFTGEIPSE 743



 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 58/186 (31%), Positives = 82/186 (44%), Gaps = 19/186 (10%)
 Frame = +3

Query: 255 SWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTG 434
           SW   S      W GV C   RV SL+L S+ L G++  +I  L  L+ L L+ N+  +G
Sbjct: 45  SWNVSSSASHCDWVGVTCLLGRVNSLSLPSLSLRGQIPKEISSLKNLRELCLAGNQ-FSG 103

Query: 435 SLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSEL 614
            +P EI NLK L  L L G    GL+P                          L +L EL
Sbjct: 104 KIPPEIWNLKHLQTLDLSGNSLTGLLPSR------------------------LSELPEL 139

Query: 615 YWLDLADNQLTGSIPVS-------------DGNT------PGLDMLVGTKHFHFGXNKFS 737
            +LDL+DN  +GS+P+S               N+      P +  L    + + G N FS
Sbjct: 140 LYLDLSDNHFSGSLPLSFFISLPALSSLDVSNNSLSGEIPPEIGKLSNLSNLYMGLNSFS 199

Query: 738 GEIPAQ 755
           G+IP++
Sbjct: 200 GQIPSE 205



 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 49/145 (33%), Positives = 62/145 (42%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +++L L S + TGE+   + + + L     SYN+ L G LP EIGN   L  L+L     
Sbjct: 426 LMALDLDSNNFTGEIPKSLWKSTNLMEFTASYNR-LEGYLPAEIGNAASLKRLVLSDNQL 484

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IP  IG              F G IP  LG  + L  LDL  N L G IP       
Sbjct: 485 TGEIPREIGKLTSLSVLNLNANMFQGKIPVELGDCTSLTTLDLGSNNLQGQIPDKITALA 544

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L  LV         N  SG IP++
Sbjct: 545 QLQCLV------LSYNNLSGSIPSK 563



 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 51/153 (33%), Positives = 62/153 (40%), Gaps = 24/153 (15%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLS------------------------Y 416
           N   + +L LS   LTG L   + EL EL  LDLS                         
Sbjct: 111 NLKHLQTLDLSGNSLTGLLPSRLSELPELLYLDLSDNHFSGSLPLSFFISLPALSSLDVS 170

Query: 417 NKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSL 596
           N  L+G +P EIG L  L NL +    F G IP  IG              F GP+P  +
Sbjct: 171 NNSLSGEIPPEIGKLSNLSNLYMGLNSFSGQIPSEIGNTSLLKNFAAPSCFFNGPLPKEI 230

Query: 597 GQLSELYWLDLADNQLTGSIPVSDGNTPGLDML 695
            +L  L  LDL+ N L  SIP S G    L +L
Sbjct: 231 SKLKHLAKLDLSYNPLKCSIPKSFGELQNLSIL 263



 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 49/149 (32%), Positives = 65/149 (43%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S + +    S    G L  +I +L  L  LDLSYN  L  S+P+  G L+ L  L LV
Sbjct: 208 NTSLLKNFAAPSCFFNGPLPKEISKLKHLAKLDLSYNP-LKCSIPKSFGELQNLSILNLV 266

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP  +G                GP+P  L ++  L       NQL+GS+P   
Sbjct: 267 SAELIGSIPPELGNCKSLKSLMLSFNSLSGPLPLELSEIP-LLTFSAERNQLSGSLPSWI 325

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           G    LD L+         N+FSGEIP +
Sbjct: 326 GKWKVLDSLL------LANNRFSGEIPRE 348



 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 46/143 (32%), Positives = 62/143 (43%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           SL +S+  L+GE+  +I +LS L  L +  N   +G +P EIGN   L N     C F G
Sbjct: 166 SLDVSNNSLSGEIPPEIGKLSNLSNLYMGLNS-FSGQIPSEIGNTSLLKNFAAPSCFFNG 224

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
            +P  I                   IP S G+L  L  L+L   +L GSIP   GN   L
Sbjct: 225 PLPKEISKLKHLAKLDLSYNPLKCSIPKSFGELQNLSILNLVSAELIGSIPPELGNCKSL 284

Query: 687 DMLVGTKHFHFGXNKFSGEIPAQ 755
             L+         N  SG +P +
Sbjct: 285 KSLM------LSFNSLSGPLPLE 301



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 50/153 (32%), Positives = 67/153 (43%), Gaps = 6/153 (3%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           + ++  T S   L G L  +I   + L+ L LS N+ LTG +PREIG L  L  L L   
Sbjct: 448 TNLMEFTASYNRLEGYLPAEIGNAASLKRLVLSDNQ-LTGEIPREIGKLTSLSVLNLNAN 506

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG- 671
            F G IP  +G                G IP  +  L++L  L L+ N L+GSIP     
Sbjct: 507 MFQGKIPVELGDCTSLTTLDLGSNNLQGQIPDKITALAQLQCLVLSYNNLSGSIPSKPSA 566

Query: 672 -----NTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
                + P L  L     F    N+ SG IP +
Sbjct: 567 YFHQIDMPDLSFLQHHGIFDLSYNRLSGPIPEE 599



 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 50/155 (32%), Positives = 72/155 (46%), Gaps = 12/155 (7%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL----ILV 488
           + +L L S +L G++   I  L++LQ L LSYN +L+GS+P +        ++     L 
Sbjct: 522 LTTLDLGSNNLQGQIPDKITALAQLQCLVLSYN-NLSGSIPSKPSAYFHQIDMPDLSFLQ 580

Query: 489 GCGFFGL--------IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQL 644
             G F L        IP+ +G                G IP SL +L+ L  LDL+ N L
Sbjct: 581 HHGIFDLSYNRLSGPIPEELGECLVLVEISLSNNHLSGEIPASLSRLTNLTILDLSGNAL 640

Query: 645 TGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           TGSIP   GN+  L  L      +   N+ +G IP
Sbjct: 641 TGSIPKEMGNSLKLQGL------NLANNQLNGHIP 669



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 49/146 (33%), Positives = 68/146 (46%), Gaps = 5/146 (3%)
 Frame = +3

Query: 333 TLSSMDLTGEL-SGDIEEL----SELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           +L ++DL+G L SG IEE+    S L  L L+ N  + GS+P ++  L  L  L L    
Sbjct: 378 SLEAIDLSGNLLSGTIEEVFDGCSSLGELLLT-NNQINGSIPEDLWKLP-LMALDLDSNN 435

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
           F G IP S+                 G +P  +G  + L  L L+DNQLTG IP   G  
Sbjct: 436 FTGEIPKSLWKSTNLMEFTASYNRLEGYLPAEIGNAASLKRLVLSDNQLTGEIPREIGKL 495

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIPAQ 755
             L +L      +   N F G+IP +
Sbjct: 496 TSLSVL------NLNANMFQGKIPVE 515



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 51/172 (29%), Positives = 68/172 (39%), Gaps = 25/172 (14%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKD-LTGSLPREIGNLKKLYNLIL 485
           N   + SL LS   L+G L     ELSE+ +L  S  ++ L+GSLP  IG  K L +L+L
Sbjct: 280 NCKSLKSLMLSFNSLSGPLP---LELSEIPLLTFSAERNQLSGSLPSWIGKWKVLDSLLL 336

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSL-----------------GQLSEL 614
               F G IP  I                 G IP  L                 G + E+
Sbjct: 337 ANNRFSGEIPREIEDCPMLKHLSLASNLLSGSIPRELCGSGSLEAIDLSGNLLSGTIEEV 396

Query: 615 Y-------WLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           +        L L +NQ+ GSIP      P + +           N F+GEIP
Sbjct: 397 FDGCSSLGELLLTNNQINGSIPEDLWKLPLMAL-------DLDSNNFTGEIP 441



>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS
            precursor (EC 2.7.1.37) (Extra sporogenous cells protein)
            (EXCESS MICROSPOROCYTES1 protein).>pir|T48499|T48499
            receptor-like protein kinase-like protein - Arabidopsis
            thaliana>gb:ATH488154_1552685 Arabidopsis thaliana mRNA
            for receptor-like protein kinase-like protein (ems1
            gene).>gb:ATT28J14_1555609 Arabidopsis thaliana DNA
            chromosome 5, BAC clone T28J14 (ESSA project).
          Length = 1192

 Score = 87.0 bits (214), Expect = 3e-16
 Identities = 55/145 (37%), Positives = 78/145 (53%)
 Frame = +3

Query: 321  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
            +V ++LS+  L+GE+   +  L+ L ILDLS N  LTGS+P+E+GN  KL  L L     
Sbjct: 606  LVEISLSNNHLSGEIPASLSRLTNLTILDLSGNA-LTGSIPKEMGNSLKLQGLNLANNQL 664

Query: 501  FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
             G IP+S G                GP+P SLG L EL  +DL+ N L+G +        
Sbjct: 665  NGHIPESFGLLGSLVKLNLTKNKLDGPVPASLGNLKELTHMDLSFNNLSGEL---SSELS 721

Query: 681  GLDMLVGTKHFHFGXNKFSGEIPAQ 755
             ++ LVG    +   NKF+GEIP++
Sbjct: 722  TMEKLVG---LYIEQNKFTGEIPSE 743



 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 56/186 (30%), Positives = 80/186 (43%), Gaps = 19/186 (10%)
 Frame = +3

Query: 255 SWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTG 434
           SW   S      W GV C   RV SL+L S+ L G++  +I  L  L+ L L+ N+  +G
Sbjct: 45  SWNVSSSASHCDWVGVTCLLGRVNSLSLPSLSLRGQIPKEISSLKNLRELCLAGNQ-FSG 103

Query: 435 SLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSEL 614
            +P EI NLK L  L L G    GL+P                          L +L +L
Sbjct: 104 KIPPEIWNLKHLQTLDLSGNSLTGLLPRL------------------------LSELPQL 139

Query: 615 YWLDLADNQLTGSIP-------------------VSDGNTPGLDMLVGTKHFHFGXNKFS 737
            +LDL+DN  +GS+P                   +S    P +  L    + + G N FS
Sbjct: 140 LYLDLSDNHFSGSLPPSFFISLPALSSLDVSNNSLSGEIPPEIGKLSNLSNLYMGLNSFS 199

Query: 738 GEIPAQ 755
           G+IP++
Sbjct: 200 GQIPSE 205



 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 49/145 (33%), Positives = 62/145 (42%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +++L L S + TGE+   + + + L     SYN+ L G LP EIGN   L  L+L     
Sbjct: 426 LMALDLDSNNFTGEIPKSLWKSTNLMEFTASYNR-LEGYLPAEIGNAASLKRLVLSDNQL 484

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IP  IG              F G IP  LG  + L  LDL  N L G IP       
Sbjct: 485 TGEIPREIGKLTSLSVLNLNANMFQGKIPVELGDCTSLTTLDLGSNNLQGQIPDKITALA 544

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L  LV         N  SG IP++
Sbjct: 545 QLQCLV------LSYNNLSGSIPSK 563



 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 50/147 (34%), Positives = 64/147 (43%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S + +    S    G L  +I +L  L  LDLSYN  L  S+P+  G L  L  L LV
Sbjct: 208 NISLLKNFAAPSCFFNGPLPKEISKLKHLAKLDLSYNP-LKCSIPKSFGELHNLSILNLV 266

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                GLIP  +G                GP+P  L ++  L       NQL+GS+P   
Sbjct: 267 SAELIGLIPPELGNCKSLKSLMLSFNSLSGPLPLELSEI-PLLTFSAERNQLSGSLPSWM 325

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           G    LD L+         N+FSGEIP
Sbjct: 326 GKWKVLDSLL------LANNRFSGEIP 346



 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 50/153 (32%), Positives = 62/153 (40%), Gaps = 24/153 (15%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLS------------------------Y 416
           N   + +L LS   LTG L   + EL +L  LDLS                         
Sbjct: 111 NLKHLQTLDLSGNSLTGLLPRLLSELPQLLYLDLSDNHFSGSLPPSFFISLPALSSLDVS 170

Query: 417 NKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSL 596
           N  L+G +P EIG L  L NL +    F G IP  IG              F GP+P  +
Sbjct: 171 NNSLSGEIPPEIGKLSNLSNLYMGLNSFSGQIPSEIGNISLLKNFAAPSCFFNGPLPKEI 230

Query: 597 GQLSELYWLDLADNQLTGSIPVSDGNTPGLDML 695
            +L  L  LDL+ N L  SIP S G    L +L
Sbjct: 231 SKLKHLAKLDLSYNPLKCSIPKSFGELHNLSIL 263



 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 50/153 (32%), Positives = 66/153 (43%), Gaps = 6/153 (3%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           + ++  T S   L G L  +I   + L+ L LS N+ LTG +PREIG L  L  L L   
Sbjct: 448 TNLMEFTASYNRLEGYLPAEIGNAASLKRLVLSDNQ-LTGEIPREIGKLTSLSVLNLNAN 506

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG- 671
            F G IP  +G                G IP  +  L++L  L L+ N L+GSIP     
Sbjct: 507 MFQGKIPVELGDCTSLTTLDLGSNNLQGQIPDKITALAQLQCLVLSYNNLSGSIPSKPSA 566

Query: 672 -----NTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
                  P L  L     F    N+ SG IP +
Sbjct: 567 YFHQIEMPDLSFLQHHGIFDLSYNRLSGPIPEE 599



 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 50/155 (32%), Positives = 74/155 (47%), Gaps = 12/155 (7%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPR---------EIGNLKKLY 473
           + +L L S +L G++   I  L++LQ L LSYN +L+GS+P          E+ +L  L 
Sbjct: 522 LTTLDLGSNNLQGQIPDKITALAQLQCLVLSYN-NLSGSIPSKPSAYFHQIEMPDLSFLQ 580

Query: 474 NLILVGCGF---FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQL 644
           +  +    +    G IP+ +G                G IP SL +L+ L  LDL+ N L
Sbjct: 581 HHGIFDLSYNRLSGPIPEELGECLVLVEISLSNNHLSGEIPASLSRLTNLTILDLSGNAL 640

Query: 645 TGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           TGSIP   GN+  L  L      +   N+ +G IP
Sbjct: 641 TGSIPKEMGNSLKLQGL------NLANNQLNGHIP 669



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 49/146 (33%), Positives = 68/146 (46%), Gaps = 5/146 (3%)
 Frame = +3

Query: 333 TLSSMDLTGEL-SGDIEEL----SELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           +L ++DL+G L SG IEE+    S L  L L+ N  + GS+P ++  L  L  L L    
Sbjct: 378 SLEAIDLSGNLLSGTIEEVFDGCSSLGELLLT-NNQINGSIPEDLWKLP-LMALDLDSNN 435

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
           F G IP S+                 G +P  +G  + L  L L+DNQLTG IP   G  
Sbjct: 436 FTGEIPKSLWKSTNLMEFTASYNRLEGYLPAEIGNAASLKRLVLSDNQLTGEIPREIGKL 495

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIPAQ 755
             L +L      +   N F G+IP +
Sbjct: 496 TSLSVL------NLNANMFQGKIPVE 515



 Score = 43.5 bits (101), Expect = 0.004
 Identities = 50/172 (29%), Positives = 68/172 (39%), Gaps = 25/172 (14%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKD-LTGSLPREIGNLKKLYNLIL 485
           N   + SL LS   L+G L     ELSE+ +L  S  ++ L+GSLP  +G  K L +L+L
Sbjct: 280 NCKSLKSLMLSFNSLSGPLP---LELSEIPLLTFSAERNQLSGSLPSWMGKWKVLDSLLL 336

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSL-----------------GQLSEL 614
               F G IP  I                 G IP  L                 G + E+
Sbjct: 337 ANNRFSGEIPHEIEDCPMLKHLSLASNLLSGSIPRELCGSGSLEAIDLSGNLLSGTIEEV 396

Query: 615 Y-------WLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           +        L L +NQ+ GSIP      P + +           N F+GEIP
Sbjct: 397 FDGCSSLGELLLTNNQINGSIPEDLWKLPLMAL-------DLDSNNFTGEIP 441



>pir|H86459|H86459 hypothetical protein T1E4.2 - Arabidopsis
           thaliana>gb:AE005172_892172 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC069299_1540788 Arabidopsis thaliana
           chromosome 1 BAC T1E4 genomic sequence, complete
           sequence.
          Length = 478

 Score = 86.7 bits (213), Expect = 4e-16
 Identities = 59/193 (30%), Positives = 90/193 (46%), Gaps = 10/193 (5%)
 Frame = +3

Query: 201 NDYVAIKALRDGWKNVPP----SWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMD------ 350
           +D   + A + G    P     SW +G+D C   W+GVGC  +RV  LT++         
Sbjct: 31  DDEAGLLAFKSGITQDPTGILSSWKKGTDCCS--WKGVGCLTNRVTGLTINGQSDVTGSF 88

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           L+G +S  + +L  L  +  +  +++TGS P+ +  L  +  +        G +P +IG 
Sbjct: 89  LSGTISPSLAKLQHLVGIYFTNLRNITGSFPQFLFQLPNVKQVYFTNSRLSGPLPANIGA 148

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH 710
                        F GPIP S+  L+ LY L+L DN LTG+IP+      GL  L     
Sbjct: 149 LSELGELSLDGNLFTGPIPSSISNLTRLYLLNLGDNLLTGTIPL------GLANLKILLS 202

Query: 711 FHFGXNKFSGEIP 749
            +FG N+ S  IP
Sbjct: 203 LNFGNNRLSETIP 215



 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 44/171 (25%), Positives = 64/171 (37%), Gaps = 25/171 (14%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S +  L+L     TG +   I  L+ L +L+L  N  LTG++P  + NLK L +L     
Sbjct: 150 SELGELSLDGNLFTGPIPSSISNLTRLYLLNLGDNL-LTGTIPLGLANLKILLSLNFGNN 208

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELY------------------- 617
                IPD                 F G +PPS+  L  +                    
Sbjct: 209 RLSETIPDIFKSMQKLQSLTLSRNKFSGNLPPSIASLKPILNYLDLSQNNLSGTIPTFLS 268

Query: 618 ------WLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
                  LDL+ N+ +G +P S  N P L       H +   N  +G +PA
Sbjct: 269 NFKVLDSLDLSRNRFSGVVPKSLANMPKL------FHLNLSHNFLTGPLPA 313



 Score = 37.0 bits (84), Expect = 0.39
 Identities = 29/116 (25%), Positives = 56/116 (48%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N  ++  L LS   LTG L   ++ +  L  LDLSYN+    ++P+ + +   +Y+L LV
Sbjct: 293 NMPKLFHLNLSHNFLTGPLPA-MKNVDGLATLDLSYNQFHLKTIPKWVTSSPSMYSLKLV 351

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSI 656
            CG    + +                    P+ P++      +++DL++N+++GS+
Sbjct: 352 KCGINMSLDN------------------WKPVRPNI-----YFYIDLSENEISGSL 384



>gb:AK117178_1815224 Arabidopsis thaliana At1g73080 mRNA for unknown
           protein, complete cds, clone: RAFL16-72-A13.
          Length = 1123

 Score = 86.3 bits (212), Expect = 6e-16
 Identities = 72/213 (33%), Positives = 102/213 (47%), Gaps = 8/213 (3%)
 Frame = +3

Query: 135 RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPP----SW---AEGSDPCGDHW 293
           +I LL   LF+    I     N+D + + +L      VPP    +W   A  + PC  +W
Sbjct: 9   KILLLFFCLFLSTHIISVSCLNSDGLTLLSLLKHLDRVPPQVTSTWKINASEATPC--NW 66

Query: 294 EGVGCNGSR-VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKL 470
            G+ C+ S+ V SL  +   ++G+L  +I EL  LQILDLS N + +G++P  +GN  KL
Sbjct: 67  FGITCDDSKNVASLNFTRSRVSGQLGPEIGELKSLQILDLSTN-NFSGTIPSTLGNCTKL 125

Query: 471 YNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTG 650
             L L   GF   IPD++                 G +P SL ++ +L  L L  N LTG
Sbjct: 126 ATLDLSENGFSDKIPDTLDSLKRLEVLYLYINFLTGELPESLFRIPKLQVLYLDYNNLTG 185

Query: 651 SIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            IP S G+   L  L          N+FSG IP
Sbjct: 186 PIPQSIGDAKELVEL------SMYANQFSGNIP 212



 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 48/145 (33%), Positives = 63/145 (43%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           + +L + +  L G +         L  LDLSYN +  G +P  +GN   L  L++V    
Sbjct: 245 LTTLFVGNNSLQGPVRFGSPNCKNLLTLDLSYN-EFEGGVPPALGNCSSLDALVIVSGNL 303

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IP S+G                G IP  LG  S L  L L DNQL G IP + G   
Sbjct: 304 SGTIPSSLGMLKNLTILNLSENRLSGSIPAELGNCSSLNLLKLNDNQLVGGIPSALGKLR 363

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L+ L          N+FSGEIP +
Sbjct: 364 KLESL------ELFENRFSGEIPIE 382



 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 44/133 (33%), Positives = 62/133 (46%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           LTGEL   +  + +LQ+L L YN +LTG +P+ IG+ K+L  L +    F G IP+SIG 
Sbjct: 159 LTGELPESLFRIPKLQVLYLDYN-NLTGPIPQSIGDAKELVELSMYANQFSGNIPESIGN 217

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH 710
                         +G +P SL  L  L  L + +N L G +     N   L  L     
Sbjct: 218 SSSLQILYLHRNKLVGSLPESLNLLGNLTTLFVGNNSLQGPVRFGSPNCKNLLTL----- 272

Query: 711 FHFGXNKFSGEIP 749
                N+F G +P
Sbjct: 273 -DLSYNEFEGGVP 284



 Score = 59.3 bits (142), Expect = 7e-08
 Identities = 49/165 (29%), Positives = 70/165 (42%), Gaps = 18/165 (10%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S + +L + S +L+G +   +  L  L IL+LS N+ L+GS+P E+GN   L  L L 
Sbjct: 289 NCSSLDALVIVSGNLSGTIPSSLGMLKNLTILNLSENR-LSGSIPAELGNCSSLNLLKLN 347

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS- 665
                G IP ++G              F G IP  + +   L  L +  N LTG +PV  
Sbjct: 348 DNQLVGGIPSALGKLRKLESLELFENRFSGEIPIEIWKSQSLTQLLVYQNNLTGELPVEM 407

Query: 666 -----------------DGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
                                PGL +    +   F  NK +GEIP
Sbjct: 408 TEMKKLKIATLFNNSFYGAIPPGLGVNSSLEEVDFIGNKLTGEIP 452



 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 48/175 (27%), Positives = 73/175 (41%), Gaps = 23/175 (13%)
 Frame = +3

Query: 297 GVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYN 476
           G+G N S +  +      LTGE+  ++    +L+IL+L  N  L G++P  IG+ K +  
Sbjct: 430 GLGVNSS-LEEVDFIGNKLTGEIPPNLCHGRKLRILNLGSNL-LHGTIPASIGHCKTIRR 487

Query: 477 LILVGCGFFGLIPD-----------------------SIGXXXXXXXXXXXXXXFIGPIP 587
            IL      GL+P+                       S+G              F G IP
Sbjct: 488 FILRENNLSGLLPEFSQDHSLSFLDFNSNNFEGPIPGSLGSCKNLSSINLSRNRFTGQIP 547

Query: 588 PSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           P LG L  L +++L+ N L GS+P        L   V  + F  G N  +G +P+
Sbjct: 548 PQLGNLQNLGYMNLSRNLLEGSLPAQ------LSNCVSLERFDVGFNSLNGSVPS 596



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 45/144 (31%), Positives = 64/144 (44%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           ++ SL L     +GE+  +I +   L  L L Y  +LTG LP E+  +KKL    L    
Sbjct: 364 KLESLELFENRFSGEIPIEIWKSQSLTQL-LVYQNNLTGELPVEMTEMKKLKIATLFNNS 422

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
           F+G IP  +G                G IPP+L    +L  L+L  N L G+IP S G+ 
Sbjct: 423 FYGAIPPGLGVNSSLEEVDFIGNKLTGEIPPNLCHGRKLRILNLGSNLLHGTIPASIGHC 482

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIP 749
             +      + F    N  SG +P
Sbjct: 483 KTI------RRFILRENNLSGLLP 500



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 43/134 (32%), Positives = 59/134 (44%), Gaps = 1/134 (0%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG- 527
           L G +  +      L  L LS N+  +G +P+ +  LKKL  L +    F G IP SIG 
Sbjct: 590 LNGSVPSNFSNWKGLTTLVLSENR-FSGGIPQFLPELKKLSTLQIARNAFGGEIPSSIGL 648

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTK 707
                           G IP  LG L +L  L++++N LTGS+ V  G       L    
Sbjct: 649 IEDLIYDLDLSGNGLTGEIPAKLGDLIKLTRLNISNNNLTGSLSVLKG-------LTSLL 701

Query: 708 HFHFGXNKFSGEIP 749
           H     N+F+G IP
Sbjct: 702 HVDVSNNQFTGPIP 715



 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 47/163 (28%), Positives = 64/163 (39%), Gaps = 21/163 (12%)
 Frame = +3

Query: 330 LTLSSMDLTGELS---GDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           L L   +LTG +    GD +EL EL +    Y    +G++P  IGN   L  L L     
Sbjct: 176 LYLDYNNLTGPIPQSIGDAKELVELSM----YANQFSGNIPESIGNSSSLQILYLHRNKL 231

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G +P+S+                 GP+         L  LDL+ N+  G +P + GN  
Sbjct: 232 VGSLPESLNLLGNLTTLFVGNNSLQGPVRFGSPNCKNLLTLDLSYNEFEGGVPPALGNCS 291

Query: 681 GLDMLV-------GTKHFHFG-----------XNKFSGEIPAQ 755
            LD LV       GT     G            N+ SG IPA+
Sbjct: 292 SLDALVIVSGNLSGTIPSSLGMLKNLTILNLSENRLSGSIPAE 334



>gb:AC137619_1743655 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0095J22, complete sequence.
          Length = 952

 Score = 86.3 bits (212), Expect = 6e-16
 Identities = 63/197 (31%), Positives = 93/197 (47%), Gaps = 9/197 (4%)
 Frame = +3

Query: 192 TDNNDYVAIKALR----DGWKNVPPSWAEGSDPCGDHWEGVGCNGS-----RVVSLTLSS 344
           TD ++  A+ A++    D   N+  +W  G DPC  +W GV C+        V  L L  
Sbjct: 28  TDPSEVSALMAIKGSLVDPMNNLK-NWNRG-DPCTKNWTGVFCHDLGDTYLHVTELQLFR 85

Query: 345 MDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSI 524
            +L+G L  ++  LS+L+ILD  +N +LTG++P+EIGN+  L  ++L G    GL+PD I
Sbjct: 86  RNLSGNLVPEVSLLSQLKILDFMWN-NLTGNIPKEIGNITTLKLILLNGNQLSGLLPDEI 144

Query: 525 GXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGT 704
           G                G IP S   L  +  L + +N L+G IP        L  L   
Sbjct: 145 GNLQSLTRLQVDQNHLSGAIPKSFANLRSVKHLHMNNNSLSGQIPSE------LSRLNTL 198

Query: 705 KHFHFGXNKFSGEIPAQ 755
            H     N  SG +P +
Sbjct: 199 LHLLVDNNNLSGPLPPE 215



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 36/145 (24%), Positives = 59/145 (40%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           ++ L + + +L+G L  ++     L+IL    N     S+P    N+  L+ L L  C  
Sbjct: 198 LLHLLVDNNNLSGPLPPELAAAKSLKILQADNNNFSGSSIPTLYYNMSGLFKLSLRNCSL 257

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IPD +                 G IP +    S +  +DL+ N L G+IP +    P
Sbjct: 258 QGAIPD-LSAIPQLDYLDLSWNQLTGSIPTN-KLASNITTIDLSHNMLNGTIPSNFSGLP 315

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L +L          N   G +P++
Sbjct: 316 YLQLL------SLKNNLLDGSVPSE 334



>gb:SBRLK1_1704899 Sorghum bicolor mRNA for protein serine/threonine
           kinase RLK1.
          Length = 619

 Score = 86.3 bits (212), Expect = 6e-16
 Identities = 64/171 (37%), Positives = 82/171 (47%), Gaps = 1/171 (0%)
 Frame = +3

Query: 240 KNVPPSWAEGS-DPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSY 416
           + V   W +    PC  +WE V C  ++V ++TLSS  LTG LS  I +L+ LQ L L  
Sbjct: 47  RGVLSDWKDNQMSPC--YWEYVNCQDNKVSTITLSSSGLTGTLSPSIAKLTTLQQLKLD- 103

Query: 417 NKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSL 596
           N ++TG +P E GNL  L  L L      G IPDS                        L
Sbjct: 104 NNNITGGIPPEFGNLSSLTILNLGRNNLNGSIPDS------------------------L 139

Query: 597 GQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           GQLS+L  LDL+ N L+G+IP S  N P L+        +   N  SGEIP
Sbjct: 140 GQLSKLQILDLSHNHLSGNIPSSFSNPPSLN------DINLAYNNISGEIP 184



>gb:AY139779_1582396 Arabidopsis thaliana At1g73080/F3N23_28 mRNA,
           complete cds.
          Length = 1123

 Score = 86.3 bits (212), Expect = 6e-16
 Identities = 72/213 (33%), Positives = 102/213 (47%), Gaps = 8/213 (3%)
 Frame = +3

Query: 135 RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPP----SW---AEGSDPCGDHW 293
           +I LL   LF+    I     N+D + + +L      VPP    +W   A  + PC  +W
Sbjct: 9   KILLLFFCLFLSTHIISVSCLNSDGLTLLSLLKHLDRVPPQVTSTWKINASEATPC--NW 66

Query: 294 EGVGCNGSR-VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKL 470
            G+ C+ S+ V SL  +   ++G+L  +I EL  LQILDLS N + +G++P  +GN  KL
Sbjct: 67  FGITCDDSKNVASLNFTRSRVSGQLGPEIGELKSLQILDLSTN-NFSGTIPSTLGNCTKL 125

Query: 471 YNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTG 650
             L L   GF   IPD++                 G +P SL ++ +L  L L  N LTG
Sbjct: 126 ATLDLSENGFSDKIPDTLDSLKRLEVLYLYINFLTGELPESLFRIPKLQVLYLDYNNLTG 185

Query: 651 SIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            IP S G+   L  L          N+FSG IP
Sbjct: 186 PIPQSIGDAKELVEL------SMYANQFSGNIP 212



 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 44/133 (33%), Positives = 62/133 (46%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           LTGEL   +  + +LQ+L L YN +LTG +P+ IG+ K+L  L +    F G IP+SIG 
Sbjct: 159 LTGELPESLFRIPKLQVLYLDYN-NLTGPIPQSIGDAKELVELSMYANQFSGNIPESIGN 217

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH 710
                         +G +P SL  L  L  L + +N L G +     N   L  L     
Sbjct: 218 SSSLQILYLHRNKLVGSLPESLNLLGNLTTLFVGNNSLQGPVRFGSPNCKNLLTL----- 272

Query: 711 FHFGXNKFSGEIP 749
                N+F G +P
Sbjct: 273 -DLSYNEFEGGVP 284



 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 47/145 (32%), Positives = 62/145 (42%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           + +L + +  L G +         L  LDLSYN +  G +P  + N   L  L++V    
Sbjct: 245 LTTLFVGNNSLQGPVRFGSPNCKNLLTLDLSYN-EFEGGVPPALENCSSLDALVIVSGNL 303

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IP S+G                G IP  LG  S L  L L DNQL G IP + G   
Sbjct: 304 SGTIPSSLGMLKNLTILNLSENRLSGSIPAELGNCSSLNLLKLNDNQLVGGIPSALGKLR 363

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L+ L          N+FSGEIP +
Sbjct: 364 KLESL------ELFENRFSGEIPIE 382



 Score = 59.3 bits (142), Expect = 7e-08
 Identities = 49/165 (29%), Positives = 70/165 (42%), Gaps = 18/165 (10%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S + +L + S +L+G +   +  L  L IL+LS N+ L+GS+P E+GN   L  L L 
Sbjct: 289 NCSSLDALVIVSGNLSGTIPSSLGMLKNLTILNLSENR-LSGSIPAELGNCSSLNLLKLN 347

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS- 665
                G IP ++G              F G IP  + +   L  L +  N LTG +PV  
Sbjct: 348 DNQLVGGIPSALGKLRKLESLELFENRFSGEIPIEIWKSQSLTQLLVYQNNLTGELPVEM 407

Query: 666 -----------------DGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
                                PGL +    +   F  NK +GEIP
Sbjct: 408 TEMKKLKIATLFNNSFYGAIPPGLGVNSSLEEVDFIGNKLTGEIP 452



 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 48/175 (27%), Positives = 73/175 (41%), Gaps = 23/175 (13%)
 Frame = +3

Query: 297 GVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYN 476
           G+G N S +  +      LTGE+  ++    +L+IL+L  N  L G++P  IG+ K +  
Sbjct: 430 GLGVNSS-LEEVDFIGNKLTGEIPPNLCHGRKLRILNLGSNL-LHGTIPASIGHCKTIRR 487

Query: 477 LILVGCGFFGLIPD-----------------------SIGXXXXXXXXXXXXXXFIGPIP 587
            IL      GL+P+                       S+G              F G IP
Sbjct: 488 FILRENNLSGLLPEFSQDHSLSFLDFNSNNFEGPIPGSLGSCKNLSSINLSRNRFTGQIP 547

Query: 588 PSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           P LG L  L +++L+ N L GS+P        L   V  + F  G N  +G +P+
Sbjct: 548 PQLGNLQNLGYMNLSRNLLEGSLPAQ------LSNCVSLERFDVGFNSLNGSVPS 596



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 45/144 (31%), Positives = 64/144 (44%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           ++ SL L     +GE+  +I +   L  L L Y  +LTG LP E+  +KKL    L    
Sbjct: 364 KLESLELFENRFSGEIPIEIWKSQSLTQL-LVYQNNLTGELPVEMTEMKKLKIATLFNNS 422

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
           F+G IP  +G                G IPP+L    +L  L+L  N L G+IP S G+ 
Sbjct: 423 FYGAIPPGLGVNSSLEEVDFIGNKLTGEIPPNLCHGRKLRILNLGSNLLHGTIPASIGHC 482

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIP 749
             +      + F    N  SG +P
Sbjct: 483 KTI------RRFILRENNLSGLLP 500



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 43/134 (32%), Positives = 59/134 (44%), Gaps = 1/134 (0%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG- 527
           L G +  +      L  L LS N+  +G +P+ +  LKKL  L +    F G IP SIG 
Sbjct: 590 LNGSVPSNFSNWKGLTTLVLSENR-FSGGIPQFLPELKKLSTLQIARNAFGGEIPSSIGL 648

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTK 707
                           G IP  LG L +L  L++++N LTGS+ V  G       L    
Sbjct: 649 IEDLIYDLDLSGNGLTGEIPAKLGDLIKLTRLNISNNNLTGSLSVLKG-------LTSLL 701

Query: 708 HFHFGXNKFSGEIP 749
           H     N+F+G IP
Sbjct: 702 HVDVSNNQFTGPIP 715



 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 44/163 (26%), Positives = 62/163 (38%), Gaps = 21/163 (12%)
 Frame = +3

Query: 330 LTLSSMDLTGELS---GDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           L L   +LTG +    GD +EL EL +    Y    +G++P  IGN   L  L L     
Sbjct: 176 LYLDYNNLTGPIPQSIGDAKELVELSM----YANQFSGNIPESIGNSSSLQILYLHRNKL 231

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP------- 659
            G +P+S+                 GP+         L  LDL+ N+  G +P       
Sbjct: 232 VGSLPESLNLLGNLTTLFVGNNSLQGPVRFGSPNCKNLLTLDLSYNEFEGGVPPALENCS 291

Query: 660 ------VSDGNTPG-----LDMLVGTKHFHFGXNKFSGEIPAQ 755
                 +  GN  G     L ML      +   N+ SG IPA+
Sbjct: 292 SLDALVIVSGNLSGTIPSSLGMLKNLTILNLSENRLSGSIPAE 334



>pir|T18536|T18536 receptor-like protein kinase - Ipomoea nil
           (Japanese morning glory)
          Length = 1109

 Score = 86.3 bits (212), Expect = 6e-16
 Identities = 66/195 (33%), Positives = 91/195 (46%), Gaps = 6/195 (3%)
 Frame = +3

Query: 186 AFTDNNDYVAIKALRDGWKNVPP----SW-AEGSDPCGDHWEGVGCNGSRVV-SLTLSSM 347
           AF  N+D  A+ +L   W  +P     SW A  S PC   W GV C+  + V +L LSS 
Sbjct: 21  AFALNSDGAALLSLTRHWTPIPSDITQSWNASDSTPCS--WLGVECDRRQFVDTLNLSSY 78

Query: 348 DLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG 527
            ++GE   +I  L  L+ + LS N    GS+P ++GN   L ++ L    F G IPD++G
Sbjct: 79  GISGEFGPEISHLKHLKKVVLSGN-GFFGSIPSQLGNCSLLEHIDLSSNSFTGNIPDTLG 137

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTK 707
                          IGP P SL  +  L  +    N L GSIP + GN   L  L    
Sbjct: 138 ALQNLRNLSLFFNSLIGPFPESLLSIPHLETVYFTGNGLNGSIPSNIGNMSELTTL---- 193

Query: 708 HFHFGXNKFSGEIPA 752
                 N+FSG +P+
Sbjct: 194 --WLDDNQFSGPVPS 206



 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 45/147 (30%), Positives = 58/147 (39%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N   +V L + +  L G +  D     ++  + LS N   TG LP  +GN   L      
Sbjct: 234 NLENLVYLDVRNNSLVGAIPLDFVSCKQIDTISLS-NNQFTGGLPPGLGNCTSLREFGAF 292

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
            C   G IP   G              F G IPP LG+   +  L L  NQL G IP   
Sbjct: 293 SCALSGPIPSCFGQLTKLDTLYLAGNHFSGRIPPELGKCKSMIDLQLQQNQLEGEIPGE- 351

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
                L ML   ++ H   N  SGE+P
Sbjct: 352 -----LGMLSQLQYLHLYTNNLSGEVP 373



 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 49/162 (30%), Positives = 73/162 (45%), Gaps = 17/162 (10%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S++  L L + +L+GE+   I ++  LQ L L Y  +L+G LP ++  LK+L +L L   
Sbjct: 356 SQLQYLHLYTNNLSGEVPLSIWKIQSLQSLQL-YQNNLSGELPVDMTELKQLVSLALYEN 414

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
            F G+IP  +G              F G IPP+L    +L  L L  N L GS+P   G 
Sbjct: 415 HFTGVIPQDLGANSSLEVLDLTRNMFTGHIPPNLCSQKKLKRLLLGYNYLEGSVPSDLGG 474

Query: 675 TPGLDMLVGTKH-----------------FHFGXNKFSGEIP 749
              L+ L+  ++                 F    N F+G IP
Sbjct: 475 CSTLERLILEENNLRGGLPDFVEKQNLLFFDLSGNNFTGPIP 516



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 46/147 (31%), Positives = 67/147 (45%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N   V ++ LSS  L+G +  ++  L +L+ L+LS+N  L G LP E+ N  KL  L   
Sbjct: 521 NLKNVTAIYLSSNQLSGSIPPELGSLVKLEHLNLSHN-ILKGILPSELSNCHKLSELDAS 579

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP ++G              F G IP SL Q ++L  L L  N L G I    
Sbjct: 580 HNLLNGSIPSTLGSLTELTKLSLGENSFSGGIPTSLFQSNKLLNLQLGGNLLAGDI---- 635

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
              P +  L   +  +   NK +G++P
Sbjct: 636 ---PPVGALQALRSLNLSSNKLNGQLP 659



 Score = 59.3 bits (142), Expect = 7e-08
 Identities = 44/170 (25%), Positives = 69/170 (40%), Gaps = 23/170 (13%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNK---------------------- 422
           N S +  + LSS   TG +   +  L  L+ L L +N                       
Sbjct: 114 NCSLLEHIDLSSNSFTGNIPDTLGALQNLRNLSLFFNSLIGPFPESLLSIPHLETVYFTG 173

Query: 423 -DLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLG 599
             L GS+P  IGN+ +L  L L    F G +P S+G               +G +P +L 
Sbjct: 174 NGLNGSIPSNIGNMSELTTLWLDDNQFSGPVPSSLGNITTLQELYLNDNNLVGTLPVTLN 233

Query: 600 QLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            L  L +LD+ +N L G+IP+   +   +D +          N+F+G +P
Sbjct: 234 NLENLVYLDVRNNSLVGAIPLDFVSCKQIDTI------SLSNNQFTGGLP 277



 Score = 35.4 bits (80), Expect = 1.1
 Identities = 31/91 (34%), Positives = 42/91 (46%), Gaps = 4/91 (4%)
 Frame = +3

Query: 336 LSSMDLTGEL-SGDIEELSELQIL---DLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF 503
           L ++ L G L +GDI  +  LQ L   +LS NK L G LP ++G LK L  L +      
Sbjct: 621 LLNLQLGGNLLAGDIPPVGALQALRSLNLSSNK-LNGQLPIDLGKLKMLEELDVSHNNLS 679

Query: 504 GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSL 596
           G +   +               F GP+PPSL
Sbjct: 680 GTLR-VLSTIQSLTFINISHNLFSGPVPPSL 709



 Score = 33.5 bits (75), Expect = 4.3
 Identities = 24/66 (36%), Positives = 40/66 (60%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           SL LSS  L G+L  D+ +L  L+ LD+S+N +L+G+L R +  ++ L  + +    F G
Sbjct: 646 SLNLSSNKLNGQLPIDLGKLKMLEELDVSHN-NLSGTL-RVLSTIQSLTFINISHNLFSG 703

Query: 507 LIPDSI 524
            +P S+
Sbjct: 704 PVPPSL 709



>pir|D96756|D96756 receptor-like protein kinase homolog [imported] -
           Arabidopsis thaliana>gb:AE005173_894854 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC008017_1536452 Arabidopsis thaliana
           chromosome I BAC F3N23 genomic sequence, complete
           sequence.
          Length = 1123

 Score = 86.3 bits (212), Expect = 6e-16
 Identities = 72/213 (33%), Positives = 102/213 (47%), Gaps = 8/213 (3%)
 Frame = +3

Query: 135 RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPP----SW---AEGSDPCGDHW 293
           +I LL   LF+    I     N+D + + +L      VPP    +W   A  + PC  +W
Sbjct: 9   KILLLFFCLFLSTHIISVSCLNSDGLTLLSLLKHLDRVPPQVTSTWKINASEATPC--NW 66

Query: 294 EGVGCNGSR-VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKL 470
            G+ C+ S+ V SL  +   ++G+L  +I EL  LQILDLS N + +G++P  +GN  KL
Sbjct: 67  FGITCDDSKNVASLNFTRSRVSGQLGPEIGELKSLQILDLSTN-NFSGTIPSTLGNCTKL 125

Query: 471 YNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTG 650
             L L   GF   IPD++                 G +P SL ++ +L  L L  N LTG
Sbjct: 126 ATLDLSENGFSDKIPDTLDSLKRLEVLYLYINFLTGELPESLFRIPKLQVLYLDYNNLTG 185

Query: 651 SIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            IP S G+   L  L          N+FSG IP
Sbjct: 186 PIPQSIGDAKELVEL------SMYANQFSGNIP 212



 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 48/145 (33%), Positives = 63/145 (43%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           + +L + +  L G +         L  LDLSYN +  G +P  +GN   L  L++V    
Sbjct: 245 LTTLFVGNNSLQGPVRFGSPNCKNLLTLDLSYN-EFEGGVPPALGNCSSLDALVIVSGNL 303

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IP S+G                G IP  LG  S L  L L DNQL G IP + G   
Sbjct: 304 SGTIPSSLGMLKNLTILNLSENRLSGSIPAELGNCSSLNLLKLNDNQLVGGIPSALGKLR 363

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L+ L          N+FSGEIP +
Sbjct: 364 KLESL------ELFENRFSGEIPIE 382



 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 44/133 (33%), Positives = 62/133 (46%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           LTGEL   +  + +LQ+L L YN +LTG +P+ IG+ K+L  L +    F G IP+SIG 
Sbjct: 159 LTGELPESLFRIPKLQVLYLDYN-NLTGPIPQSIGDAKELVELSMYANQFSGNIPESIGN 217

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH 710
                         +G +P SL  L  L  L + +N L G +     N   L  L     
Sbjct: 218 SSSLQILYLHRNKLVGSLPESLNLLGNLTTLFVGNNSLQGPVRFGSPNCKNLLTL----- 272

Query: 711 FHFGXNKFSGEIP 749
                N+F G +P
Sbjct: 273 -DLSYNEFEGGVP 284



 Score = 59.3 bits (142), Expect = 7e-08
 Identities = 49/165 (29%), Positives = 70/165 (42%), Gaps = 18/165 (10%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S + +L + S +L+G +   +  L  L IL+LS N+ L+GS+P E+GN   L  L L 
Sbjct: 289 NCSSLDALVIVSGNLSGTIPSSLGMLKNLTILNLSENR-LSGSIPAELGNCSSLNLLKLN 347

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS- 665
                G IP ++G              F G IP  + +   L  L +  N LTG +PV  
Sbjct: 348 DNQLVGGIPSALGKLRKLESLELFENRFSGEIPIEIWKSQSLTQLLVYQNNLTGELPVEM 407

Query: 666 -----------------DGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
                                PGL +    +   F  NK +GEIP
Sbjct: 408 TEMKKLKIATLFNNSFYGAIPPGLGVNSSLEEVDFIGNKLTGEIP 452



 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 48/175 (27%), Positives = 73/175 (41%), Gaps = 23/175 (13%)
 Frame = +3

Query: 297 GVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYN 476
           G+G N S +  +      LTGE+  ++    +L+IL+L  N  L G++P  IG+ K +  
Sbjct: 430 GLGVNSS-LEEVDFIGNKLTGEIPPNLCHGRKLRILNLGSNL-LHGTIPASIGHCKTIRR 487

Query: 477 LILVGCGFFGLIPD-----------------------SIGXXXXXXXXXXXXXXFIGPIP 587
            IL      GL+P+                       S+G              F G IP
Sbjct: 488 FILRENNLSGLLPEFSQDHSLSFLDFNSNNFEGPIPGSLGSCKNLSSINLSRNRFTGQIP 547

Query: 588 PSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           P LG L  L +++L+ N L GS+P        L   V  + F  G N  +G +P+
Sbjct: 548 PQLGNLQNLGYMNLSRNLLEGSLPAQ------LSNCVSLERFDVGFNSLNGSVPS 596



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 45/144 (31%), Positives = 64/144 (44%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           ++ SL L     +GE+  +I +   L  L L Y  +LTG LP E+  +KKL    L    
Sbjct: 364 KLESLELFENRFSGEIPIEIWKSQSLTQL-LVYQNNLTGELPVEMTEMKKLKIATLFNNS 422

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
           F+G IP  +G                G IPP+L    +L  L+L  N L G+IP S G+ 
Sbjct: 423 FYGAIPPGLGVNSSLEEVDFIGNKLTGEIPPNLCHGRKLRILNLGSNLLHGTIPASIGHC 482

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIP 749
             +      + F    N  SG +P
Sbjct: 483 KTI------RRFILRENNLSGLLP 500



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 43/134 (32%), Positives = 59/134 (44%), Gaps = 1/134 (0%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG- 527
           L G +  +      L  L LS N+  +G +P+ +  LKKL  L +    F G IP SIG 
Sbjct: 590 LNGSVPSNFSNWKGLTTLVLSENR-FSGGIPQFLPELKKLSTLQIARNAFGGEIPSSIGL 648

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTK 707
                           G IP  LG L +L  L++++N LTGS+ V  G       L    
Sbjct: 649 IEDLIYDLDLSGNGLTGEIPAKLGDLIKLTRLNISNNNLTGSLSVLKG-------LTSLL 701

Query: 708 HFHFGXNKFSGEIP 749
           H     N+F+G IP
Sbjct: 702 HVDVSNNQFTGPIP 715



 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 47/163 (28%), Positives = 64/163 (39%), Gaps = 21/163 (12%)
 Frame = +3

Query: 330 LTLSSMDLTGELS---GDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           L L   +LTG +    GD +EL EL +    Y    +G++P  IGN   L  L L     
Sbjct: 176 LYLDYNNLTGPIPQSIGDAKELVELSM----YANQFSGNIPESIGNSSSLQILYLHRNKL 231

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G +P+S+                 GP+         L  LDL+ N+  G +P + GN  
Sbjct: 232 VGSLPESLNLLGNLTTLFVGNNSLQGPVRFGSPNCKNLLTLDLSYNEFEGGVPPALGNCS 291

Query: 681 GLDMLV-------GTKHFHFG-----------XNKFSGEIPAQ 755
            LD LV       GT     G            N+ SG IPA+
Sbjct: 292 SLDALVIVSGNLSGTIPSSLGMLKNLTILNLSENRLSGSIPAE 334



>gb:AY518288_1610790 Arabidopsis thaliana strubbelig receptor family
           3 (SRF3) mRNA, complete cds.
          Length = 776

 Score = 85.9 bits (211), Expect = 7e-16
 Identities = 67/225 (29%), Positives = 107/225 (47%), Gaps = 23/225 (10%)
 Frame = +3

Query: 144 LLLVPLFIQFLGIV-----AFTDNNDYVAIKALRDGW-KNVPPSW-AEGSDPCGDHWEGV 302
           LLL+PL +  L  +     A T+ +D  AI  L       V P W A G DPCG+ W+G+
Sbjct: 10  LLLLPLLLSLLIWIPSISLAATNPDDVAAINGLFAALGAPVLPGWIASGGDPCGEAWQGI 69

Query: 303 GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI 482
            CN S ++S+T+++ +L GEL  ++ + + ++ +D S N+ + GS+P  +     L +  
Sbjct: 70  ICNVSDIISITVNAANLQGELGDNLAKFTSIRGIDFSNNR-IGGSIPSTLP--VTLQHFF 126

Query: 483 LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPV 662
           L    F G IP+S+G                G +P     L  L  LD++ N ++G++P 
Sbjct: 127 LSANQFTGSIPESLGTLSFLNDMSLNDNLLSGELPDVFQNLVGLINLDISSNNISGTLPP 186

Query: 663 SDGN--------------TPGLDMLVG--TKHFHFGXNKFSGEIP 749
           S  N              +  LD+L G   +  +   N FSG IP
Sbjct: 187 SMENLLTLTTLRVQNNQLSGTLDVLQGLPLQDLNIENNLFSGPIP 231



>pir|T10725|T10725 protein kinase Xa21 (EC 2.7.1.-) A1, receptor
           type - long-staminate rice>gb:OLRKLP2_1692252 Oryza
           longistaminata receptor kinase-like protein gene, family
           member A1, complete cds.
          Length = 996

 Score = 85.5 bits (210), Expect = 9e-16
 Identities = 62/161 (38%), Positives = 79/161 (49%), Gaps = 5/161 (3%)
 Frame = +3

Query: 282 GDH--WEGVGC---NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPR 446
           G H  W GV C   +  RVV L L S +LTG +S  +  LS L+ L LS N  L+G +P+
Sbjct: 60  GQHCTWVGVVCGRRHPHRVVKLRLRSSNLTGIISPSLGNLSFLRTLQLS-NNHLSGKIPQ 118

Query: 447 EIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLD 626
           E+  L +L  L+L      G IP ++G                G IP SLG+L+ LY L 
Sbjct: 119 ELSRLSRLQQLVLNFNSLSGEIPAALGNLTSLSVLELTNNTLSGSIPSSLGKLTGLYNLA 178

Query: 627 LADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           LA+N L+GSIP S G    L  L          N  SG IP
Sbjct: 179 LAENMLSGSIPTSFGQLRRLSFL------SLAFNHLSGAIP 213



 Score = 79.0 bits (193), Expect = 9e-14
 Identities = 53/165 (32%), Positives = 73/165 (44%), Gaps = 19/165 (11%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S +VSL++    ++G L  DI  L  LQ L L+ N  LTGSLP     LK L  L +   
Sbjct: 348 SSLVSLSIRDNKISGSLPRDIGNLVNLQYLSLA-NNSLTGSLPSSFSKLKNLRRLTVDNN 406

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G +P +IG              F G IP +LG L++L+ ++L  N   G IP+   +
Sbjct: 407 RLIGSLPLTIGNLTQLTNMEVQFNAFGGTIPSTLGNLTKLFQINLGHNNFIGQIPIEIFS 466

Query: 675 TPGLDMLVGTKH-------------------FHFGXNKFSGEIPA 752
            P L  ++   H                   FH   NK SGEIP+
Sbjct: 467 IPALSEILDVSHNNLEGSIPKEIGKLKNIVEFHADSNKLSGEIPS 511



 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 50/166 (30%), Positives = 73/166 (43%), Gaps = 19/166 (11%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           SR+  L L+   L+GE+   +  L+ L +L+L+ N  L+GS+P  +G L  LYNL L   
Sbjct: 124 SRLQQLVLNFNSLSGEIPAALGNLTSLSVLELT-NNTLSGSIPSSLGKLTGLYNLALAEN 182

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD-G 671
              G IP S G                G IP  +  +S L   ++  N LTG++P +   
Sbjct: 183 MLSGSIPTSFGQLRRLSFLSLAFNHLSGAIPDPIWNISSLTIFEVVSNNLTGTLPANAFS 242

Query: 672 NTPGL-DMLVGTKHFH-----------------FGXNKFSGEIPAQ 755
           N P L  + +   HFH                  G N FSG +P +
Sbjct: 243 NLPNLQQVFMYYNHFHGPIPASIGNASSISIFTIGLNSFSGVVPPE 288



 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 48/148 (32%), Positives = 72/148 (48%), Gaps = 1/148 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSEL-QILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           N +++  + L   +  G++  +I  +  L +ILD+S+N +L GS+P+EIG LK +     
Sbjct: 442 NLTKLFQINLGHNNFIGQIPIEIFSIPALSEILDVSHN-NLEGSIPKEIGKLKNIVEFHA 500

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                 G IP +IG                G IP +L QL  L  LDL+ N L+G IP+S
Sbjct: 501 DSNKLSGEIPSTIGECQLLQHLFLQNNFLNGSIPIALTQLKGLDTLDLSGNNLSGQIPMS 560

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            G+   L  L      +   N F GE+P
Sbjct: 561 LGDMTLLHSL------NLSFNSFHGEVP 582



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 45/165 (27%), Positives = 65/165 (39%), Gaps = 25/165 (15%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           LT+ +  L G L   I  L++L  +++ +N    G++P  +GNL KL+ + L    F G 
Sbjct: 401 LTVDNNRLIGSLPLTIGNLTQLTNMEVQFNA-FGGTIPSTLGNLTKLFQINLGHNNFIGQ 459

Query: 510 IP-------------------------DSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSEL 614
           IP                           IG                G IP ++G+   L
Sbjct: 460 IPIEIFSIPALSEILDVSHNNLEGSIPKEIGKLKNIVEFHADSNKLSGEIPSTIGECQLL 519

Query: 615 YWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
             L L +N L GSIP++     GLD L          N  SG+IP
Sbjct: 520 QHLFLQNNFLNGSIPIALTQLKGLDTL------DLSGNNLSGQIP 558



 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 1/110 (0%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPRE-IGNLKKLYNLILVGC 494
           R+  L+L+   L+G +   I  +S L I ++  N +LTG+LP     NL  L  + +   
Sbjct: 197 RLSFLSLAFNHLSGAIPDPIWNISSLTIFEVVSN-NLTGTLPANAFSNLPNLQQVFMYYN 255

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQL 644
            F G IP SIG              F G +PP +G++  L  L+L +  L
Sbjct: 256 HFHGPIPASIGNASSISIFTIGLNSFSGVVPPEIGRMRNLQRLELPETLL 305



 Score = 43.5 bits (101), Expect = 0.004
 Identities = 32/124 (25%), Positives = 52/124 (41%), Gaps = 1/124 (0%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           +L L+   L+G +     +L  L  L L++N  L+G++P  I N+  L    +V     G
Sbjct: 176 NLALAENMLSGSIPTSFGQLRRLSFLSLAFNH-LSGAIPDPIWNISSLTIFEVVSNNLTG 234

Query: 507 LIP-DSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG 683
            +P ++                F GPIP S+G  S +    +  N  +G +P   G    
Sbjct: 235 TLPANAFSNLPNLQQVFMYYNHFHGPIPASIGNASSISIFTIGLNSFSGVVPPEIGRMRN 294

Query: 684 LDML 695
           L  L
Sbjct: 295 LQRL 298



>gb:AP004564_1841660 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0479C12.>gb:AP004665_1842911 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0429B05.
          Length = 1112

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 62/192 (32%), Positives = 90/192 (46%), Gaps = 1/192 (0%)
 Frame = +3

Query: 177 GIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSR-VVSLTLSSMDL 353
           G+   + + D +   ++   WK      A  + PC  +W+GV CN    VVSL LSS  +
Sbjct: 27  GLALLSLSRDLILPHSISSTWK------ASDTTPC--NWDGVSCNKKNSVVSLDLSSSGV 78

Query: 354 TGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXX 533
           +G L   I  +  LQ+L LS N  ++GS+P+E+GN   L  L L    F G IP S+G  
Sbjct: 79  SGSLGPQIGLMKSLQVLSLS-NNSISGSIPQELGNCSMLDQLDLSSNSFSGEIPASLGDI 137

Query: 534 XXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHF 713
                         G IP  L +   L  + L  N+L+GSIP++ G    L      ++ 
Sbjct: 138 KKLSSLSLYSNSLTGEIPEGLFKNQFLEQVYLHYNKLSGSIPLTVGEMTSL------RYL 191

Query: 714 HFGXNKFSGEIP 749
               NK SG +P
Sbjct: 192 WLHGNKLSGVLP 203



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 46/146 (31%), Positives = 69/146 (47%)
 Frame = +3

Query: 312 GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG 491
           G ++  +T +S   TGE++   E+  +L++  LS+N+ ++  +P  +GN   L  L  V 
Sbjct: 235 GLKIFDITANSF--TGEITFSFEDC-KLEVFILSFNQ-ISNEIPSWLGNCSSLTQLAFVN 290

Query: 492 CGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG 671
               G IP S+G                GPIPP +G    L WL+L  NQL G++P    
Sbjct: 291 NNISGQIPSSLGLLRNLSQLLLSENSLSGPIPPEIGNCQLLVWLELDANQLNGTVPKELA 350

Query: 672 NTPGLDMLVGTKHFHFGXNKFSGEIP 749
           N   L+ L     F F  N+  GE P
Sbjct: 351 NLRKLEKL-----FLF-ENRLIGEFP 370



 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 49/147 (33%), Positives = 63/147 (42%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N  ++  L L    L GE   DI  +  LQ + L Y    TG LP  +  LK L N+ L 
Sbjct: 351 NLRKLEKLFLFENRLIGEFPEDIWSIKSLQSV-LIYENSFTGRLPPVLAELKFLKNITLF 409

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
              F G+IP  +G              F+G IPP++     L  LDL  N L GSIP + 
Sbjct: 410 NNFFTGVIPPDLGVNSRLTQIDFTNNSFVGGIPPNICSGKRLRILDLGLNLLNGSIPSNV 469

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            + P L+       F    N  SG IP
Sbjct: 470 MDCPSLE------RFILQNNNLSGPIP 490



 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 55/158 (34%), Positives = 68/158 (43%), Gaps = 18/158 (11%)
 Frame = +3

Query: 330  LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
            L LS   L G L   I   S+L +LDLS+N  L GS    + NLK L  L L    F G 
Sbjct: 549  LNLSQNSLQGVLPVQISSCSKLYLLDLSFN-SLNGSALTTVSNLKFLSQLRLQENKFSGG 607

Query: 510  IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSEL-YWLDLADNQLTGSIP--------- 659
            IPDS+                 G IP SLG+L +L   L++  N L G IP         
Sbjct: 608  IPDSLSQLDMLIELQLGGNVLGGSIPSSLGRLVKLGIALNICSNGLVGGIPPLLSNLVEL 667

Query: 660  -----VSDGNTPGLDMLVGTKHFH---FGXNKFSGEIP 749
                   +G T  LDML   +  H      N+FSG +P
Sbjct: 668  QSLDLSLNGLTGDLDMLGNLQLLHVLNVSYNRFSGPVP 705



 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 44/140 (31%), Positives = 60/140 (42%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS   L+G +  +I     L  L+L  N+ L G++P+E+ NL+KL  L L      G 
Sbjct: 310 LLLSENSLSGPIPPEIGNCQLLVWLELDANQ-LNGTVPKELANLRKLEKLFLFENRLIGE 368

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
            P+ I               F G +PP L +L  L  + L +N  TG IP      P L 
Sbjct: 369 FPEDIWSIKSLQSVLIYENSFTGRLPPVLAELKFLKNITLFNNFFTGVIP------PDLG 422

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
           +        F  N F G IP
Sbjct: 423 VNSRLTQIDFTNNSFVGGIP 442



 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 39/132 (29%), Positives = 54/132 (40%), Gaps = 3/132 (2%)
 Frame = +3

Query: 363 LSGDIEEL---SELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXX 533
           LSG I +    + L  +DLS+N  L+G++P  +G    +  +        G IP  I   
Sbjct: 485 LSGPIPQFRNCANLSYIDLSHNS-LSGNIPASLGRCVNITMIKWSENKLVGPIPSEIRDL 543

Query: 534 XXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHF 713
                         G +P  +   S+LY LDL+ N L GS   +  N   L  L      
Sbjct: 544 VNLRVLNLSQNSLQGVLPVQISSCSKLYLLDLSFNSLNGSALTTVSNLKFLSQL------ 597

Query: 714 HFGXNKFSGEIP 749
               NKFSG IP
Sbjct: 598 RLQENKFSGGIP 609



 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 36/130 (27%), Positives = 56/130 (43%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           C+G R+  L L    L G +  ++ +   L+   L  N +L+G +P +  N   L  + L
Sbjct: 446 CSGKRLRILDLGLNLLNGSIPSNVMDCPSLERFILQ-NNNLSGPIP-QFRNCANLSYIDL 503

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                 G IP S+G               +GPIP  +  L  L  L+L+ N L G +PV 
Sbjct: 504 SHNSLSGNIPASLGRCVNITMIKWSENKLVGPIPSEIRDLVNLRVLNLSQNSLQGVLPVQ 563

Query: 666 DGNTPGLDML 695
             +   L +L
Sbjct: 564 ISSCSKLYLL 573



 Score = 42.7 bits (99), Expect = 0.007
 Identities = 24/59 (40%), Positives = 31/59 (52%)
 Frame = +3

Query: 576 GPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           G + P +G +  L  L L++N ++GSIP   GN   LD L          N FSGEIPA
Sbjct: 80  GSLGPQIGLMKSLQVLSLSNNSISGSIPQELGNCSMLDQL------DLSSNSFSGEIPA 132



>gb:AP004069_1837219 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1626_B09.
          Length = 999

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 68/194 (35%), Positives = 87/194 (44%), Gaps = 29/194 (14%)
 Frame = +3

Query: 258 WAEGSDPCGDHWEGVGCNGSR----VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKD 425
           W   + PC   W GV C   R    VV+L+L S  L+G +S  +  LS L++LDL  N+ 
Sbjct: 57  WNASNHPC--RWRGVACGRGRHAGSVVALSLGSSSLSGLISPFLGNLSFLRVLDLGANQ- 113

Query: 426 LTGSLPREIGNLKKLYNLIL--------------VGCGFF-----------GLIPDSIGX 530
           L G +P E+G L +L  L L              +GC              G IP  I  
Sbjct: 114 LVGQIPPELGRLGRLRELNLSGNSLEGGIPPALAIGCSKLESLSLDSNHLRGEIPGEIAA 173

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH 710
                          G IPPSLG LS LY+L+L  N L G IP S GN   L+ L G +H
Sbjct: 174 LRNLAYLNLRANNLSGEIPPSLGNLSSLYFLNLGFNMLFGEIPASLGNLSQLNAL-GIQH 232

Query: 711 FHFGXNKFSGEIPA 752
                N+ SG IP+
Sbjct: 233 -----NQLSGGIPS 241



 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 47/141 (33%), Positives = 70/141 (49%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L + +L+GE+   +  LS L  L+L +N  L G +P  +GNL +L  L +      G 
Sbjct: 180 LNLRANNLSGEIPPSLGNLSSLYFLNLGFNM-LFGEIPASLGNLSQLNALGIQHNQLSGG 238

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S+G               IG IPP++  +S L    + +N+L+G +P +  NT  L 
Sbjct: 239 IPSSLGHLNNLTSLLLQANGLIGSIPPNICNISFLKHFSVENNELSGMLPPNVFNT--LP 296

Query: 690 MLVGTKHFHFGXNKFSGEIPA 752
           ML   + F  G N F G IP+
Sbjct: 297 ML---ETFDAGENMFDGHIPS 314



 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 50/148 (33%), Positives = 67/148 (45%), Gaps = 1/148 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELS-ELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           N S++  L L +   +G L   I  LS  L IL L+ NK + G++PREIG L  L  L+ 
Sbjct: 372 NCSQLEVLELEANKFSGTLPSVISNLSASLTILTLASNK-IVGNMPREIGKLINLGALVA 430

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                 G  P S+G              F GP P  +  L+ +  LDL  N  +GSIP++
Sbjct: 431 HNNFLTGSPPSSLGMLQNLRILWLDNNYFSGPFPRVICNLTHMDSLDLGRNNFSGSIPIT 490

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            GN      +V      F  N F G IP
Sbjct: 491 VGN------MVSLSSLRFSFNNFIGTIP 512



 Score = 56.2 bits (134), Expect = 6e-07
 Identities = 46/159 (28%), Positives = 66/159 (41%), Gaps = 19/159 (11%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L +   +G     I  L+ +  LDL  N + +GS+P  +GN+  L +L      F G 
Sbjct: 452 LWLDNNYFSGPFPRVICNLTHMDSLDLGRN-NFSGSIPITVGNMVSLSSLRFSFNNFIGT 510

Query: 510 IPDSIGXXXXXXXXXXXXXXFI-GPIPPSLGQLSELYWLDLADNQLTGSIPVS------- 665
           IP S+                + G IPP +G L  L +LD   NQL+G IP++       
Sbjct: 511 IPTSLFNITTLSIYLDISYNHLDGSIPPEVGNLPNLVYLDARYNQLSGEIPITFEKCQLL 570

Query: 666 ----------DGNTP-GLDMLVGTKHFHFGXNKFSGEIP 749
                      GN P     + G +      N FSG+IP
Sbjct: 571 QILYLQNNSFIGNIPSSFSEMKGLEILDLSSNNFSGQIP 609



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 40/147 (27%), Positives = 57/147 (38%), Gaps = 1/147 (0%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           + + SL L +  L G +  +I  +S L+   +  N +L+G LP  + N   +      G 
Sbjct: 247 NNLTSLLLQANGLIGSIPPNICNISFLKHFSVE-NNELSGMLPPNVFNTLPMLETFDAGE 305

Query: 495 GFF-GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG 671
             F G IP S+               F G IPP LG L  L W  L +N L         
Sbjct: 306 NMFDGHIPSSLVNASKLSRFQIAENHFSGVIPPELGGLQGLKWFILTENDLEAKESNDWK 365

Query: 672 NTPGLDMLVGTKHFHFGXNKFSGEIPA 752
               L      +      NKFSG +P+
Sbjct: 366 FMKALTNCSQLEVLELEANKFSGTLPS 392



>gb:AP003633_1831828 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0637D03.
          Length = 1061

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 71/228 (31%), Positives = 100/228 (43%), Gaps = 22/228 (9%)
 Frame = +3

Query: 132 PRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPP----SWAEGSDPCGDHWEG 299
           P + LLL+PL        A  +++D  A+ A + G  + P     SW E    C   W G
Sbjct: 9   PVLLLLLLPL----AAATAAAESDDRDALMAFKAGVTSDPTGVLRSWNETVHFC--RWPG 62

Query: 300 VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL 479
           V C   RV SL +S   L GELS  +  L+ L +L+L+ N   +GS+P  +G L+++  L
Sbjct: 63  VNCTAGRVTSLDVSMGRLAGELSPAVANLTRLVVLNLTSNA-FSGSIPGGLGRLRRMRYL 121

Query: 480 ILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
            L    F G IPD++                +G +P  LG L  L  L L+ N L+G IP
Sbjct: 122 SLCDNAFAGEIPDALRNCTALAVAYLNNNNLVGGVPRWLGALPNLAVLRLSHNSLSGRIP 181

Query: 660 VS-----------------DGNTP-GLDMLVGTKHFHFGXNKFSGEIP 749
            S                 +G+ P GL  L          N  +GEIP
Sbjct: 182 PSLANLTKIFRLELDQNLLEGSIPDGLSRLPALGMLALSQNSLAGEIP 229



 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 55/149 (36%), Positives = 74/149 (49%), Gaps = 1/149 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQIL-DLSYNKDLTGSLPREIGNLKKLYNLIL 485
           N  ++  L LS  +LTG +  ++  LS L +L DLS N+ L G +P ++G L KL  + L
Sbjct: 459 NLHQLTLLNLSGNELTGHVPSELFTLSSLSLLMDLSDNQ-LDGPIPPDVGQLTKLAFMAL 517

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
            G  F G +P  +               F+G IPPSL  L  L  L+L  N+L+GSIP  
Sbjct: 518 SGNRFSGEVPTELESCQSLEFLDLARNVFVGSIPPSLSGLKGLRRLNLTGNRLSGSIPPE 577

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            G  PGL  L      +   N  SG IPA
Sbjct: 578 LGGMPGLQEL------YLSRNDLSGGIPA 600



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 51/165 (30%), Positives = 81/165 (49%), Gaps = 3/165 (1%)
 Frame = +3

Query: 270 SDPCGDHWEGVG--CNGSRVVSLTLSSMDLTGELSGDIEELS-ELQILDLSYNKDLTGSL 440
           +D  G  WE +    N S +  + L      G +   +  LS +L+ L+L+ N+ ++G +
Sbjct: 323 TDDAGGGWEFMDNLTNCSALAEILLDGNKFAGVMPPSVVRLSPQLEALNLAGNR-ISGVI 381

Query: 441 PREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYW 620
           P EI +L  L  L L    F G IP++IG                GP+P ++G L++L  
Sbjct: 382 PPEIESLVGLQTLCLQSNLFSGEIPEAIGKLKNLRELLLEQNELAGPVPSAIGDLTQLLK 441

Query: 621 LDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           LDL+ N L GSIP S GN   L +L      +   N+ +G +P++
Sbjct: 442 LDLSGNSLNGSIPPSLGNLHQLTLL------NLSGNELTGHVPSE 480



 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 47/161 (29%), Positives = 71/161 (44%), Gaps = 19/161 (11%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L   +L G +   I +L++L  LDLS N  L GS+P  +GNL +L  L L G    G 
Sbjct: 418 LLLEQNELAGPVPSAIGDLTQLLKLDLSGNS-LNGSIPPSLGNLHQLTLLNLSGNELTGH 476

Query: 510 IPDSIGXXXXXXXXXXXXXXFI-GPIPPSLGQLSELYWLDLADNQLTGSIPVS------- 665
           +P  +                + GPIPP +GQL++L ++ L+ N+ +G +P         
Sbjct: 477 VPSELFTLSSLSLLMDLSDNQLDGPIPPDVGQLTKLAFMALSGNRFSGEVPTELESCQSL 536

Query: 666 -----------DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
                          P L  L G +  +   N+ SG IP +
Sbjct: 537 EFLDLARNVFVGSIPPSLSGLKGLRRLNLTGNRLSGSIPPE 577



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 41/140 (29%), Positives = 60/140 (42%), Gaps = 1/140 (0%)
 Frame = +3

Query: 336 LSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIP 515
           L++ +L G +   +  L  L +L LS+N  L+G +P  + NL K++ L L      G IP
Sbjct: 147 LNNNNLVGGVPRWLGALPNLAVLRLSHNS-LSGRIPPSLANLTKIFRLELDQNLLEGSIP 205

Query: 516 DSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG-NTPGLDM 692
           D +                 G IP     ++ L  L LADN   G +P   G  TP L  
Sbjct: 206 DGLSRLPALGMLALSQNSLAGEIPVGFFNMTSLRGLALADNAFRGELPGDAGARTPNL-- 263

Query: 693 LVGTKHFHFGXNKFSGEIPA 752
               ++   G N  +G I A
Sbjct: 264 ----QYLFLGGNLLAGPISA 279



 Score = 38.9 bits (89), Expect = 0.10
 Identities = 37/149 (24%), Positives = 56/149 (37%), Gaps = 25/149 (16%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYN-----------------------KD 425
           +++  + LS    +GE+  ++E    L+ LDL+ N                         
Sbjct: 510 TKLAFMALSGNRFSGEVPTELESCQSLEFLDLARNVFVGSIPPSLSGLKGLRRLNLTGNR 569

Query: 426 LTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQL 605
           L+GS+P E+G +  L  L L                              G IP SL  +
Sbjct: 570 LSGSIPPELGGMPGLQELYL------------------------SRNDLSGGIPASLETM 605

Query: 606 SELYWLDLADNQLTGSIPVSD--GNTPGL 686
           S L  LD++ N+L G +PV     NT GL
Sbjct: 606 SSLMELDVSYNRLAGQVPVHGVFANTTGL 634



>gb:AF384969_1794544 Arabidopsis thaliana somatic embryogenesis
           receptor-like kinase 2 (SERK2) mRNA, complete cds.
          Length = 628

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 60/175 (34%), Positives = 91/175 (52%), Gaps = 5/175 (2%)
 Frame = +3

Query: 150 LVPLFIQFLGIVAFTDNNDYVAIKALRDGWK---NVPPSWAEGS-DPCGDHWEGVGCNGS 317
           L+ L + F  +   + N +  A+ +LR       NV  SW     +PC   W  V CN  
Sbjct: 14  LISLLLLFNSLWLASSNMEGDALHSLRANLVDPYNVLQSWDPTLVNPCT--WFHVTCNNE 71

Query: 318 R-VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
             V+ + L + DL+G+L   + +L  LQ L+L Y+ ++TG +P ++GNL  L +L L   
Sbjct: 72  NSVIRVDLGNADLSGQLVPQLGQLKNLQYLEL-YSNNITGPVPSDLGNLTNLVSLDLYLN 130

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
            F G IPDS+G                GPIP SL  ++ L  LDL++N+L+GS+P
Sbjct: 131 SFTGPIPDSLGKLFKLRFLRLNNNSLTGPIPMSLTNITTLQVLDLSNNRLSGSVP 185



 Score = 34.7 bits (78), Expect = 1.9
 Identities = 23/71 (32%), Positives = 36/71 (50%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + +VSL L     TG +   + +L +L+ L L+ N  LTG +P  + N+  L  L L 
Sbjct: 118 NLTNLVSLDLYLNSFTGPIPDSLGKLFKLRFLRLN-NNSLTGPIPMSLTNITTLQVLDLS 176

Query: 489 GCGFFGLIPDS 521
                G +PD+
Sbjct: 177 NNRLSGSVPDN 187



>gb:AY518290_1610792 Arabidopsis thaliana strubbelig receptor family
           5 (SRF5) mRNA, complete cds.
          Length = 699

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 65/212 (30%), Positives = 93/212 (43%), Gaps = 9/212 (4%)
 Frame = +3

Query: 138 IQLLLVPLFIQFLGIVAFTDNNDYVAIKAL---------RDGWKNVPPSWAEGSDPCGDH 290
           ++L++V L I    + A TDN +  A+  +           GWK      A G DPC D 
Sbjct: 6   VRLVIVSLAITVTLLQAKTDNQEVSALNVMFTSLNSPSKLKGWK------ANGGDPCEDS 59

Query: 291 WEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKL 470
           WEGV C GS V  L LS  +L G     +  L  L   DLS N +L G++P ++     +
Sbjct: 60  WEGVKCKGSSVTELQLSGFELGGSRGYLLSNLKSLTTFDLSKN-NLKGNIPYQLP--PNI 116

Query: 471 YNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTG 650
            NL        G +P S+                 G +P    +LS+L  LD + N+L+G
Sbjct: 117 ANLDFSENELDGNVPYSLSQMKNLQSINLGQNKLNGELPDMFQKLSKLETLDFSLNKLSG 176

Query: 651 SIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEI 746
            +P S  N      L   K  H   N+F+G+I
Sbjct: 177 KLPQSFAN------LTSLKKLHLQDNRFTGDI 202



>pir|B84659|B84659 probable receptor-like protein kinase, ERECTA
           [imported] - Arabidopsis thaliana>gb:AC004484_1531781
           Arabidopsis thaliana chromosome 2 clone T1D16 map B68,
           complete sequence.>gb:ATHER_1553162 Arabidopsis thaliana
           DNA for receptor protein kinase, complete
           cds.>gb:ATU47029_1557030 Arabidopisis thaliana ERECTA
           mRNA, complete cds.>gb:AY035110_1559881 Arabidopsis
           thaliana putative receptor protein kinase, ERECTA
           (At2g26330) mRNA, complete cds.
          Length = 976

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 70/221 (31%), Positives = 98/221 (44%), Gaps = 25/221 (11%)
 Frame = +3

Query: 162 FIQFLGIVAFTDNNDYVAIKALRDGWK---NVPPSWAEGSDPCGDH--WEGVGCNGS--R 320
           F+  L +VA   + +   +  ++  +K   NV   W   + P  D+  W GV C      
Sbjct: 12  FLFCLSLVATVTSEEGATLLEIKKSFKDVNNVLYDWT--TSPSSDYCVWRGVSCENVTFN 69

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           VV+L LS ++L GE+S  I +L  L  +DL  N+ L+G +P EIG+   L NL L     
Sbjct: 70  VVALNLSDLNLDGEISPAIGDLKSLLSIDLRGNR-LSGQIPDEIGDCSSLQNLDLSFNEL 128

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP------- 659
            G IP SI                IGPIP +L Q+  L  LDLA N+L+G IP       
Sbjct: 129 SGDIPFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEIPRLIYWNE 188

Query: 660 -----------VSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
                      +    +P L  L G  +F    N  +G IP
Sbjct: 189 VLQYLGLRGNNLVGNISPDLCQLTGLWYFDVRNNSLTGSIP 229



 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 50/140 (35%), Positives = 65/140 (46%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS   LTGE+  DI  L ++  L L  N+ L+G +P  IG ++ L  L L G    G 
Sbjct: 241 LDLSYNQLTGEIPFDIGFL-QVATLSLQGNQ-LSGKIPSVIGLMQALAVLDLSGNLLSGS 298

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP  +G                G IPP LG +S+L++L+L DN LTG IP      P L 
Sbjct: 299 IPPILGNLTFTEKLYLHSNKLTGSIPPELGNMSKLHYLELNDNHLTGHIP------PELG 352

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
            L      +   N   G IP
Sbjct: 353 KLTDLFDLNVANNDLEGPIP 372



 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 44/141 (31%), Positives = 66/141 (46%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L S  LTG +  ++  +S+L  L+L+ N  LTG +P E+G L  L++L +      G 
Sbjct: 312 LYLHSNKLTGSIPPELGNMSKLHYLELNDNH-LTGHIPPELGKLTDLFDLNVANNDLEGP 370

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IPD +               F G IP +  +L  + +L+L+ N + G IPV       LD
Sbjct: 371 IPDHLSSCTNLNSLNVHGNKFSGTIPRAFQKLESMTYLNLSSNNIKGPIPVELSRIGNLD 430

Query: 690 MLVGTKHFHFGXNKFSGEIPA 752
            L          NK +G IP+
Sbjct: 431 TL------DLSNNKINGIIPS 445



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 42/140 (30%), Positives = 63/140 (45%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LSS ++ G +  ++  +  L  LDLS NK + G +P  +G+L+ L  + L      G+
Sbjct: 408 LNLSSNNIKGPIPVELSRIGNLDTLDLSNNK-INGIIPSSLGDLEHLLKMNLSRNHITGV 466

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           +P   G                GPIP  L QL  +  L L +N LTG++  S  N   L 
Sbjct: 467 VPGDFGNLRSIMEIDLSNNDISGPIPEELNQLQNIILLRLENNNLTGNVG-SLANCLSLT 525

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
           +L      +   N   G+IP
Sbjct: 526 VL------NVSHNNLVGDIP 539



 Score = 52.4 bits (124), Expect = 9e-06
 Identities = 42/141 (29%), Positives = 61/141 (43%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L +  L G +   + ++  L+ILDL+ NK L+G +PR I   + L  L L G    G 
Sbjct: 145 LILKNNQLIGPIPSTLSQIPNLKILDLAQNK-LSGEIPRLIYWNEVLQYLGLRGNNLVGN 203

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           I   +                 G IP ++G  +    LDL+ NQLTG IP   G      
Sbjct: 204 ISPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDLSYNQLTGEIPFDIG------ 257

Query: 690 MLVGTKHFHFGXNKFSGEIPA 752
             +         N+ SG+IP+
Sbjct: 258 -FLQVATLSLQGNQLSGKIPS 277



 Score = 35.4 bits (80), Expect = 1.1
 Identities = 20/56 (35%), Positives = 33/56 (58%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           ++ + LS   +TG + GD   L  +  +DLS N D++G +P E   L +L N+IL+
Sbjct: 453 LLKMNLSRNHITGVVPGDFGNLRSIMEIDLS-NNDISGPIPEE---LNQLQNIILL 504



>pir|D86466|D86466 69.4K hypothetical protein F23M19.11 -
           Arabidopsis thaliana>gb:AE005172_892224 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:CQ768559_1451797 Sequence 54 from Patent
           WO2004007712.>gb:AX120063_1461711 Sequence 46 from
           Patent WO0129240.>gb:F23M19_1677952 Arabidopsis thaliana
           chromosome 1 BAC F23M19 sequence, complete sequence.
          Length = 628

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 60/175 (34%), Positives = 90/175 (51%), Gaps = 5/175 (2%)
 Frame = +3

Query: 150 LVPLFIQFLGIVAFTDNNDYVAIKALRDGW---KNVPPSWAEGS-DPCGDHWEGVGCNGS 317
           L+ L + F  +   + N +  A+ +LR       NV  SW     +PC   W  V CN  
Sbjct: 14  LISLLLLFNSLWLASSNMEGDALHSLRANLVDPNNVLQSWDPTLVNPCT--WFHVTCNNE 71

Query: 318 R-VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
             V+ + L + DL+G+L   + +L  LQ L+L Y+ ++TG +P ++GNL  L +L L   
Sbjct: 72  NSVIRVDLGNADLSGQLVPQLGQLKNLQYLEL-YSNNITGPVPSDLGNLTNLVSLDLYLN 130

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
            F G IPDS+G                GPIP SL  +  L  LDL++N+L+GS+P
Sbjct: 131 SFTGPIPDSLGKLFKLRFLRLNNNSLTGPIPMSLTNIMTLQVLDLSNNRLSGSVP 185



 Score = 34.7 bits (78), Expect = 1.9
 Identities = 23/71 (32%), Positives = 36/71 (50%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + +VSL L     TG +   + +L +L+ L L+ N  LTG +P  + N+  L  L L 
Sbjct: 118 NLTNLVSLDLYLNSFTGPIPDSLGKLFKLRFLRLN-NNSLTGPIPMSLTNIMTLQVLDLS 176

Query: 489 GCGFFGLIPDS 521
                G +PD+
Sbjct: 177 NNRLSGSVPDN 187



>gb:AP005841_1858891 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0052M16.
          Length = 1052

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 66/193 (34%), Positives = 91/193 (47%), Gaps = 8/193 (4%)
 Frame = +3

Query: 195 DNNDYVAIKALRDGWKN----VPPSWAEGSDPCGDHWEGVGCNG---SRVVSLTLSSMDL 353
           D++D  A+ A + G  +    +  +W  G+  C  HW GV C      RV +L L ++ L
Sbjct: 27  DDSDATALLAFKAGLSDPLGVLRLNWTSGTPSC--HWAGVSCGKRGHGRVTALALPNVPL 84

Query: 354 TGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXX 533
            G LS  +  LS L IL+L+ N  LTG +P E+G L +L  L L      G IP ++G  
Sbjct: 85  HGGLSPSLGNLSFLSILNLT-NASLTGEIPPELGRLSRLQYLNLNRNSLSGTIPGAMGNL 143

Query: 534 XXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS-DGNTPGLDMLVGTKH 710
                         G IP  L  L  L ++ L  N L+G IP S   NTP L +L     
Sbjct: 144 TSLQQLDLYHNHLSGQIPRELQNLGTLRYIRLDTNYLSGPIPDSVFNNTPLLSVL----- 198

Query: 711 FHFGXNKFSGEIP 749
            + G N  SG+IP
Sbjct: 199 -NLGNNSLSGKIP 210



 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 46/147 (31%), Positives = 71/147 (48%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           C   RV+SL+ +  +    +   +  L +L ++ L  N  + G++P  + NL +L  L L
Sbjct: 290 CRFLRVLSLSYNLFE--DVIPAWLTRLPQLTLISLGGNS-IAGTIPPALSNLTQLSQLDL 346

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
           V     G IP  +G                G IPPSLG LS +  LDLA N+L G+IP++
Sbjct: 347 VDSQLTGEIPVELGQLAQLTWLNLAANQLTGSIPPSLGNLSLVLQLDLAQNRLNGTIPIT 406

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEI 746
            GN   L ML   ++ +   N   G++
Sbjct: 407 FGN---LGML---RYLNVEANNLEGDL 427



 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 45/140 (32%), Positives = 68/140 (48%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L    +TG +  ++  LS L  LDLS+N  ++G+L  +IG+++ +  + L      G 
Sbjct: 515 LNLHDNLMTGSIPTEVGMLSSL--LDLSHNS-ISGALATDIGSMQAIVQIDLSTNQISGS 571

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S+G                  IP ++G+L+ L  LDL+DN L G+IP S  N   L 
Sbjct: 572 IPTSLGQLEMLTSLNLSHNLLQDKIPYTIGKLTSLVTLDLSDNSLVGTIPESLANVTYLT 631

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
            L      +   NK  G+IP
Sbjct: 632 SL------NLSFNKLEGQIP 645



 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 54/194 (27%), Positives = 75/194 (38%), Gaps = 49/194 (25%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLP----------------- 443
           S +  L L    L+G L   I  +SELQ++ L+  ++LTG++P                 
Sbjct: 217 SGLTLLVLQDNSLSGPLPPGIFNMSELQVIALAKTQNLTGTIPDNTSFHLPMLQVFSLSR 276

Query: 444 --------------REIGNLKKLYNLI------------------LVGCGFFGLIPDSIG 527
                         R +  L   YNL                   L G    G IP ++ 
Sbjct: 277 NEFQGRIPSGLAACRFLRVLSLSYNLFEDVIPAWLTRLPQLTLISLGGNSIAGTIPPALS 336

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTK 707
                           G IP  LGQL++L WL+LA NQLTGSIP S GN   L +++   
Sbjct: 337 NLTQLSQLDLVDSQLTGEIPVELGQLAQLTWLNLAANQLTGSIPPSLGN---LSLVL--- 390

Query: 708 HFHFGXNKFSGEIP 749
                 N+ +G IP
Sbjct: 391 QLDLAQNRLNGTIP 404



 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 48/169 (28%), Positives = 67/169 (39%), Gaps = 27/169 (15%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL---------- 479
           L L++  LTG +   +  LS +  LDL+ N+ L G++P   GNL  L  L          
Sbjct: 368 LNLAANQLTGSIPPSLGNLSLVLQLDLAQNR-LNGTIPITFGNLGMLRYLNVEANNLEGD 426

Query: 480 -----ILVGC-----------GFFGLIPDSIGXXXXXXXXXXXXXXFI-GPIPPSLGQLS 608
                 L  C            + G IPDS+G               I G +PP++  LS
Sbjct: 427 LHFLASLSNCRRLEYVDIAMNSYTGRIPDSVGNLSSKLDSFVAHSNQITGGLPPTMANLS 486

Query: 609 ELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L  + L  NQLT +IP        L ML      +   N  +G IP +
Sbjct: 487 NLIAIYLYANQLTETIPTHMMQMKNLQML------NLHDNLMTGSIPTE 529



 Score = 42.4 bits (98), Expect = 0.009
 Identities = 31/117 (26%), Positives = 51/117 (43%), Gaps = 3/117 (2%)
 Frame = +3

Query: 330 LTLSSMDLTGELS--GDIEELSELQILDLSYNKDLTGSLPREIGNLK-KLYNLILVGCGF 500
           L + + +L G+L     +     L+ +D++ N   TG +P  +GNL  KL + +      
Sbjct: 416 LNVEANNLEGDLHFLASLSNCRRLEYVDIAMNS-YTGRIPDSVGNLSSKLDSFVAHSNQI 474

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG 671
            G +P ++                   IP  + Q+  L  L+L DN +TGSIP   G
Sbjct: 475 TGGLPPTMANLSNLIAIYLYANQLTETIPTHMMQMKNLQMLNLHDNLMTGSIPTEVG 531



>gb:OSJN00196_1696553 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0020O11, complete sequence.
          Length = 664

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 62/174 (35%), Positives = 86/174 (49%), Gaps = 11/174 (6%)
 Frame = +3

Query: 261 AEGSDPCGDHWEGVGCN--GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTG 434
           ++  +PCG  W GVGC+   SRVV+L L++  L G L+ +IE LS LQ L L +N  L G
Sbjct: 62  SKDENPCG--WTGVGCSPFDSRVVTLELANSSLKGFLALEIESLSSLQKLILDHNT-LMG 118

Query: 435 SLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSEL 614
            +P+ IG L+ L  L L      G IP  IG                G IPP +G L+ L
Sbjct: 119 PIPKGIGKLRNLIMLNLSTNQLDGPIPIEIGDMPKISKIDLRANRLDGAIPPEIGNLTSL 178

Query: 615 YWLDLADNQLTGSIPVSDGNTP---------GLDMLVGTKHFHFGXNKFSGEIP 749
             L L++N LTG+IP S+ ++          GL  L          N  +G++P
Sbjct: 179 TELQLSNNSLTGTIPGSNDSSMVSTNRDGQIGLCRLTQLTDMDLSYNYLAGDVP 232



>gb:AY090373_1574121 Arabidopsis thaliana AT3g05370/T12H1_34 mRNA,
           complete cds.>gb:BT006359_1639246 Arabidopsis thaliana
           At3g05370/T12H1_34 gene, complete cds.
          Length = 860

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 59/167 (35%), Positives = 76/167 (45%), Gaps = 2/167 (1%)
 Frame = +3

Query: 255 SWAEGSDPCGDHWEGVGCNG--SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDL 428
           SW +  D C   WEGV C+   S V+SL LS + L   L                  K  
Sbjct: 62  SWNKSIDCCS--WEGVTCDAISSEVISLNLSHVPLNNSL------------------KPN 101

Query: 429 TGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLS 608
           +G     +  L+ L+NL L  C  +G IP S+G               +G +PPS+G LS
Sbjct: 102 SG-----LFKLQHLHNLTLSNCSLYGDIPSSLGNLFRLTLLDLSYNYLVGQVPPSIGNLS 156

Query: 609 ELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            L  LDL DN+L G +P S GN   L+ L+      F  NKFSG IP
Sbjct: 157 RLTILDLWDNKLVGQLPASIGNLTQLEYLI------FSHNKFSGNIP 197



 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 32/87 (36%), Positives = 38/87 (43%)
 Frame = +3

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
           G  F G IP+SIG              F G IP SL  L +L  LDL+ NQL+G IP   
Sbjct: 676 GNRFSGNIPESIGLLKELRHLNLSSNAFTGNIPQSLANLMKLEALDLSLNQLSGQIP--- 732

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
               GL  L      +F  N   G +P
Sbjct: 733 ---QGLGSLSFMSTMNFSYNFLEGPVP 756



 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 38/140 (27%), Positives = 57/140 (40%), Gaps = 25/140 (17%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPR---------------- 446
           +R+  L LS     G +   + +   L  LDLS+N +LTGS P                 
Sbjct: 278 TRLQYLFLSQNKFDGPIPDTLSQYLNLIELDLSFN-NLTGSFPTFLFTIPTLERVNLEGN 336

Query: 447 ------EIGNLKKLYNLILVGCG---FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLG 599
                 E GN+    +L  +      F G IP+S+               FIG IP S+ 
Sbjct: 337 HLKGPVEFGNMSSSSSLKFLNFAQNEFNGSIPESVSQYLNLEELHLSFNNFIGTIPRSIS 396

Query: 600 QLSELYWLDLADNQLTGSIP 659
           +L++L +  L DN + G +P
Sbjct: 397 KLAKLEYFCLEDNNMVGEVP 416



 Score = 43.1 bits (100), Expect = 0.005
 Identities = 54/216 (25%), Positives = 72/216 (33%), Gaps = 69/216 (31%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLY----- 473
           N SR+  L L    L G+L   I  L++L+ L  S+NK  +G++P    NL KL      
Sbjct: 154 NLSRLTILDLWDNKLVGQLPASIGNLTQLEYLIFSHNK-FSGNIPVTFSNLTKLLVVNLY 212

Query: 474 ----------------NLILVGCG---FFGLIPDSI------------------------ 524
                           NL     G   F G +P S+                        
Sbjct: 213 NNSFESMLPLDMSGFQNLDYFNVGENSFSGTLPKSLFTIPSLRWANLEGNMFKGPIEFRN 272

Query: 525 --GXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDML- 695
                            F GPIP +L Q   L  LDL+ N LTGS P      P L+ + 
Sbjct: 273 MYSPSTRLQYLFLSQNKFDGPIPDTLSQYLNLIELDLSFNNLTGSFPTFLFTIPTLERVN 332

Query: 696 ------------------VGTKHFHFGXNKFSGEIP 749
                                K  +F  N+F+G IP
Sbjct: 333 LEGNHLKGPVEFGNMSSSSSLKFLNFAQNEFNGSIP 368



 Score = 41.6 bits (96), Expect = 0.016
 Identities = 37/149 (24%), Positives = 55/149 (36%), Gaps = 22/149 (14%)
 Frame = +3

Query: 369 GDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXX 548
           G++   S L+ L+ + N +  GS+P  +     L  L L    F G IP SI        
Sbjct: 345 GNMSSSSSLKFLNFAQN-EFNGSIPESVSQYLNLEELHLSFNNFIGTIPRSISKLAKLEY 403

Query: 549 XXXXXXXFIGPIPP----------------SLGQLSE------LYWLDLADNQLTGSIPV 662
                   +G +P                 S G+ SE      + WLDL+ N   G  P 
Sbjct: 404 FCLEDNNMVGEVPSWLWRLTMVALSNNSFNSFGESSEGLDETQVQWLDLSSNSFQGPFPH 463

Query: 663 SDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
                  L++L+         N+F+G IP
Sbjct: 464 WICKLRSLEILI------MSDNRFNGSIP 486



 Score = 33.9 bits (76), Expect = 3.3
 Identities = 18/44 (40%), Positives = 28/44 (63%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNL 461
           L LSS   TG +   +  L +L+ LDLS N+ L+G +P+ +G+L
Sbjct: 696 LNLSSNAFTGNIPQSLANLMKLEALDLSLNQ-LSGQIPQGLGSL 738



>gb:ATAC009177_1542875 Arabidopsis thaliana chromosome III BAC T12H1
           genomic sequence, complete sequence.
          Length = 859

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 59/167 (35%), Positives = 76/167 (45%), Gaps = 2/167 (1%)
 Frame = +3

Query: 255 SWAEGSDPCGDHWEGVGCNG--SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDL 428
           SW +  D C   WEGV C+   S V+SL LS + L   L                  K  
Sbjct: 61  SWNKSIDCCS--WEGVTCDAISSEVISLNLSHVPLNNSL------------------KPN 100

Query: 429 TGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLS 608
           +G     +  L+ L+NL L  C  +G IP S+G               +G +PPS+G LS
Sbjct: 101 SG-----LFKLQHLHNLTLSNCSLYGDIPSSLGNLFRLTLLDLSYNYLVGQVPPSIGNLS 155

Query: 609 ELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            L  LDL DN+L G +P S GN   L+ L+      F  NKFSG IP
Sbjct: 156 RLTILDLWDNKLVGQLPASIGNLTQLEYLI------FSHNKFSGNIP 196



 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 32/87 (36%), Positives = 38/87 (43%)
 Frame = +3

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
           G  F G IP+SIG              F G IP SL  L +L  LDL+ NQL+G IP   
Sbjct: 675 GNRFSGNIPESIGLLKELRHLNLSSNAFTGNIPQSLANLMKLEALDLSLNQLSGQIP--- 731

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
               GL  L      +F  N   G +P
Sbjct: 732 ---QGLGSLSFMSTMNFSYNFLEGPVP 755



 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 38/140 (27%), Positives = 57/140 (40%), Gaps = 25/140 (17%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPR---------------- 446
           +R+  L LS     G +   + +   L  LDLS+N +LTGS P                 
Sbjct: 277 TRLQYLFLSQNKFDGPIPDTLSQYLNLIELDLSFN-NLTGSFPTFLFTIPTLERVNLEGN 335

Query: 447 ------EIGNLKKLYNLILVGCG---FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLG 599
                 E GN+    +L  +      F G IP+S+               FIG IP S+ 
Sbjct: 336 HLKGPVEFGNMSSSSSLKFLNFAQNEFNGSIPESVSQYLNLEELHLSFNNFIGTIPRSIS 395

Query: 600 QLSELYWLDLADNQLTGSIP 659
           +L++L +  L DN + G +P
Sbjct: 396 KLAKLEYFCLEDNNMVGEVP 415



 Score = 43.1 bits (100), Expect = 0.005
 Identities = 54/216 (25%), Positives = 72/216 (33%), Gaps = 69/216 (31%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLY----- 473
           N SR+  L L    L G+L   I  L++L+ L  S+NK  +G++P    NL KL      
Sbjct: 153 NLSRLTILDLWDNKLVGQLPASIGNLTQLEYLIFSHNK-FSGNIPVTFSNLTKLLVVNLY 211

Query: 474 ----------------NLILVGCG---FFGLIPDSI------------------------ 524
                           NL     G   F G +P S+                        
Sbjct: 212 NNSFESMLPLDMSGFQNLDYFNVGENSFSGTLPKSLFTIPSLRWANLEGNMFKGPIEFRN 271

Query: 525 --GXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDML- 695
                            F GPIP +L Q   L  LDL+ N LTGS P      P L+ + 
Sbjct: 272 MYSPSTRLQYLFLSQNKFDGPIPDTLSQYLNLIELDLSFNNLTGSFPTFLFTIPTLERVN 331

Query: 696 ------------------VGTKHFHFGXNKFSGEIP 749
                                K  +F  N+F+G IP
Sbjct: 332 LEGNHLKGPVEFGNMSSSSSLKFLNFAQNEFNGSIP 367



 Score = 41.6 bits (96), Expect = 0.016
 Identities = 37/149 (24%), Positives = 55/149 (36%), Gaps = 22/149 (14%)
 Frame = +3

Query: 369 GDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXX 548
           G++   S L+ L+ + N +  GS+P  +     L  L L    F G IP SI        
Sbjct: 344 GNMSSSSSLKFLNFAQN-EFNGSIPESVSQYLNLEELHLSFNNFIGTIPRSISKLAKLEY 402

Query: 549 XXXXXXXFIGPIPP----------------SLGQLSE------LYWLDLADNQLTGSIPV 662
                   +G +P                 S G+ SE      + WLDL+ N   G  P 
Sbjct: 403 FCLEDNNMVGEVPSWLWRLTMVALSNNSFNSFGESSEGLDETQVQWLDLSSNSFQGPFPH 462

Query: 663 SDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
                  L++L+         N+F+G IP
Sbjct: 463 WICKLRSLEILI------MSDNRFNGSIP 485



 Score = 33.9 bits (76), Expect = 3.3
 Identities = 18/44 (40%), Positives = 28/44 (63%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNL 461
           L LSS   TG +   +  L +L+ LDLS N+ L+G +P+ +G+L
Sbjct: 695 LNLSSNAFTGNIPQSLANLMKLEALDLSLNQ-LSGQIPQGLGSL 737



>gb:AE016959_1020920 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC074105_1541195
           Oryza sativa chromosome 10 clone OSJNBa0030B02, complete
           sequence.>gb:AE017056_1750739 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 10 of 77 of the
           complete sequence.
          Length = 110

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 44/64 (68%), Positives = 47/64 (73%)
 Frame = +3

Query: 336 LSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIP 515
           LSS  L+G LSGDI+ LSELQ LDLSYNK+L G LP  IG L KL NLILVGC F G IP
Sbjct: 39  LSSFGLSGTLSGDIQSLSELQYLDLSYNKNLRGPLPSTIGTLSKLQNLILVGCSFTGEIP 98

Query: 516 DSIG 527
             IG
Sbjct: 99  KEIG 102



>pir|B84742|B84742 probable receptor-like protein kinase [imported]
           - Arabidopsis thaliana>gb:AC002334_1530378 Arabidopsis
           thaliana chromosome 2 clone F25I18 map TEn5, complete
           sequence.
          Length = 1124

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 65/169 (38%), Positives = 77/169 (45%), Gaps = 9/169 (5%)
 Frame = +3

Query: 276 PCGDHWEGVGC---------NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDL 428
           PC  +W GV C         N   V SL LSSM+L+G +S  I  L  L  L+L+YN  L
Sbjct: 65  PC--NWIGVNCSSQGSSSSSNSLVVTSLDLSSMNLSGIVSPSIGGLVNLVYLNLAYNA-L 121

Query: 429 TGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLS 608
           TG +PREIGN  KL  + L    F G IP  I                 GP+P  +G L 
Sbjct: 122 TGDIPREIGNCSKLEVMFLNNNQFGGSIPVEINKLSQLRSFNICNNKLSGPLPEEIGDLY 181

Query: 609 ELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L  L    N LTG +P S GN   L        F  G N FSG IP +
Sbjct: 182 NLEELVAYTNNLTGPLPRSLGNLNKLTT------FRAGQNDFSGNIPTE 224



 Score = 72.4 bits (176), Expect = 8e-12
 Identities = 48/149 (32%), Positives = 68/149 (45%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N +++ +      D +G +  +I +   L++L L+ N  ++G LP+EIG L KL  +IL 
Sbjct: 203 NLNKLTTFRAGQNDFSGNIPTEIGKCLNLKLLGLAQNF-ISGELPKEIGMLVKLQEVILW 261

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
              F G IP  IG               +GPIP  +G +  L  L L  NQL G+IP   
Sbjct: 262 QNKFSGFIPKDIGNLTSLETLALYGNSLVGPIPSEIGNMKSLKKLYLYQNQLNGTIPKE- 320

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
                L  L       F  N  SGEIP +
Sbjct: 321 -----LGKLSKVMEIDFSENLLSGEIPVE 344



 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 56/146 (38%), Positives = 72/146 (49%), Gaps = 1/146 (0%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S +V+  +SS  LTG +  +I     LQ LDLS N    GSLP E+G+L +L  L L   
Sbjct: 541 SNLVTFNVSSNSLTGPIPSEIANCKMLQRLDLSRN-SFIGSLPPELGSLHQLEILRLSEN 599

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSEL-YWLDLADNQLTGSIPVSDG 671
            F G IP +IG              F G IPP LG LS L   ++L+ N  +G IP   G
Sbjct: 600 RFSGNIPFTIGNLTHLTELQMGGNLFSGSIPPQLGLLSSLQIAMNLSYNDFSGEIPPEIG 659

Query: 672 NTPGLDMLVGTKHFHFGXNKFSGEIP 749
           N   L +L+   +     N  SGEIP
Sbjct: 660 N---LHLLM---YLSLNNNHLSGEIP 679



 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 46/142 (32%), Positives = 65/142 (45%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L++   +  L  +I +LS L   ++S N  LTG +P EI N K L  L L    F G 
Sbjct: 522 LHLAANQFSSNLPNEISKLSNLVTFNVSSNS-LTGPIPSEIANCKMLQRLDLSRNSFIGS 580

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           +P  +G              F G IP ++G L+ L  L +  N  +GSIP   G    L 
Sbjct: 581 LPPELGSLHQLEILRLSENRFSGNIPFTIGNLTHLTELQMGGNLFSGSIPPQLGLLSSLQ 640

Query: 690 MLVGTKHFHFGXNKFSGEIPAQ 755
           + +   +     N FSGEIP +
Sbjct: 641 IAMNLSY-----NDFSGEIPPE 657



 Score = 66.2 bits (160), Expect = 6e-10
 Identities = 47/147 (31%), Positives = 70/147 (47%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S++  + L++    G +  +I +LS+L+  ++  NK L+G LP EIG+L  L  L+  
Sbjct: 131 NCSKLEVMFLNNNQFGGSIPVEINKLSQLRSFNICNNK-LSGPLPEEIGDLYNLEELVAY 189

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G +P S+G              F G IP  +G+   L  L LA N ++G +P   
Sbjct: 190 TNNLTGPLPRSLGNLNKLTTFRAGQNDFSGNIPTEIGKCLNLKLLGLAQNFISGELPKEI 249

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           G      MLV  +      NKFSG IP
Sbjct: 250 G------MLVKLQEVILWQNKFSGFIP 270



 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 46/145 (31%), Positives = 68/145 (46%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S+V+ +  S   L+GE+  ++ ++SEL++L L  NK LTG +P E+  L+ L  L L   
Sbjct: 325 SKVMEIDFSENLLSGEIPVELSKISELRLLYLFQNK-LTGIIPNELSKLRNLAKLDLSIN 383

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G IP                    G IP  LG  S L+ +D ++NQL+G IP     
Sbjct: 384 SLTGPIPPGFQNLTSMRQLQLFHNSLSGVIPQGLGLYSPLWVVDFSENQLSGKIPPFICQ 443

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIP 749
              L +L      + G N+  G IP
Sbjct: 444 QSNLILL------NLGSNRIFGNIP 462



 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 41/133 (30%), Positives = 59/133 (44%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           LTG+   ++ +L  L  ++L  N+  +G LP EIG  +KL  L L    F   +P+ I  
Sbjct: 481 LTGQFPTELCKLVNLSAIELDQNR-FSGPLPPEIGTCQKLQRLHLAANQFSSNLPNEISK 539

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH 710
                          GPIP  +     L  LDL+ N   GS+P   G+   L++L     
Sbjct: 540 LSNLVTFNVSSNSLTGPIPSEIANCKMLQRLDLSRNSFIGSLPPELGSLHQLEIL----- 594

Query: 711 FHFGXNKFSGEIP 749
                N+FSG IP
Sbjct: 595 -RLSENRFSGNIP 606



 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 46/150 (30%), Positives = 59/150 (39%), Gaps = 18/150 (12%)
 Frame = +3

Query: 354 TGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXX 533
           +G +  DI  L+ L+ L L Y   L G +P EIGN+K L  L L      G IP  +G  
Sbjct: 266 SGFIPKDIGNLTSLETLAL-YGNSLVGPIPSEIGNMKSLKKLYLYQNQLNGTIPKELGKL 324

Query: 534 XXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP------------------ 659
                         G IP  L ++SEL  L L  N+LTG IP                  
Sbjct: 325 SKVMEIDFSENLLSGEIPVELSKISELRLLYLFQNKLTGIIPNELSKLRNLAKLDLSINS 384

Query: 660 VSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           ++    PG   L   +      N  SG IP
Sbjct: 385 LTGPIPPGFQNLTSMRQLQLFHNSLSGVIP 414



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 37/139 (26%), Positives = 61/139 (43%)
 Frame = +3

Query: 339 SSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPD 518
           S   L+G++   I + S L +L+L  N+ + G++P  +   K L  L +VG    G  P 
Sbjct: 429 SENQLSGKIPPFICQQSNLILLNLGSNR-IFGNIPPGVLRCKSLLQLRVVGNRLTGQFPT 487

Query: 519 SIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLV 698
            +               F GP+PP +G   +L  L LA NQ + ++P        +  L 
Sbjct: 488 ELCKLVNLSAIELDQNRFSGPLPPEIGTCQKLQRLHLAANQFSSNLPNE------ISKLS 541

Query: 699 GTKHFHFGXNKFSGEIPAQ 755
               F+   N  +G IP++
Sbjct: 542 NLVTFNVSSNSLTGPIPSE 560



 Score = 37.7 bits (86), Expect = 0.23
 Identities = 34/118 (28%), Positives = 48/118 (40%), Gaps = 1/118 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQI-LDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           N + +  L +     +G +   +  LS LQI ++LSYN D +G +P EIGNL  L  L L
Sbjct: 611 NLTHLTELQMGGNLFSGSIPPQLGLLSSLQIAMNLSYN-DFSGEIPPEIGNLHLLMYLSL 669

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
                                         G IP +   LS L   + + N LTG +P
Sbjct: 670 ------------------------NNNHLSGEIPTTFENLSSLLGCNFSYNNLTGQLP 703



>gb:AC099732_1737183 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1203D03, complete sequence.
          Length = 1001

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 47/145 (32%), Positives = 71/145 (48%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           SR+  L LS  +LTGE+  ++  L+ L+ L L Y    TG +P E+G LK+L  L +  C
Sbjct: 177 SRIKYLALSGNELTGEIPPELGNLTTLRELYLGYFNSFTGGIPPELGRLKELVRLDMANC 236

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
           G  G++P  +                 G +PP +G +  L  LDL++N   G IP S  +
Sbjct: 237 GISGVVPPEVANLTSLDTLFLQINALSGRLPPEIGAMGALKSLDLSNNLFVGEIPASFAS 296

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIP 749
              L +L      +   N+ +GEIP
Sbjct: 297 LKNLTLL------NLFRNRLAGEIP 315



 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 71/247 (28%), Positives = 93/247 (37%), Gaps = 70/247 (28%)
 Frame = +3

Query: 222 ALRDGWKNVPPSWAEGSDPCGDHWEGVGCN--GSRVVSLTLSSMDLTGEL-SGDIEELSE 392
           AL D    +   W   +  C   W  + C+  GSRV+SL LS ++L+G + +  +  LS 
Sbjct: 48  ALGDPSGYLSTHWTHDTAFCS--WPRLSCDADGSRVLSLDLSGLNLSGPIPAAALSSLSH 105

Query: 393 LQILDLS------------------------YNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           LQ L+LS                        YN +LTG+LP  + NL  L +L L G  F
Sbjct: 106 LQSLNLSNNILNSTFPEGLIASLKNLRVLDFYNNNLTGALPAALPNLTNLVHLHLGGNFF 165

Query: 501 FGLIPDSIG-------------------------XXXXXXXXXXXXXXFIGPIPPSLGQL 605
           FG IP S G                                       F G IPP LG+L
Sbjct: 166 FGSIPRSYGQWSRIKYLALSGNELTGEIPPELGNLTTLRELYLGYFNSFTGGIPPELGRL 225

Query: 606 SELYWLDLADNQLTGSIPVSDGNTPGLDMLV------------------GTKHFHFGXNK 731
            EL  LD+A+  ++G +P    N   LD L                     K      N 
Sbjct: 226 KELVRLDMANCGISGVVPPEVANLTSLDTLFLQINALSGRLPPEIGAMGALKSLDLSNNL 285

Query: 732 FSGEIPA 752
           F GEIPA
Sbjct: 286 FVGEIPA 292



 Score = 56.2 bits (134), Expect = 6e-07
 Identities = 45/134 (33%), Positives = 61/134 (45%), Gaps = 1/134 (0%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLS-YNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG 527
           L+GEL  D   +S   I +LS YN  L+G +P  IG L  L  L++ G    G +P  IG
Sbjct: 431 LSGELRLDAGVVSP-SIGELSLYNNRLSGPVPVGIGGLVGLQKLLVAGNRLSGELPREIG 489

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTK 707
                           G IPP++     L +LDL+ N+L+G IP      P L  L    
Sbjct: 490 KLQQLSKADLSGNLISGEIPPAIAGCRLLTFLDLSGNRLSGRIP------PALAGLRILN 543

Query: 708 HFHFGXNKFSGEIP 749
           + +   N   GEIP
Sbjct: 544 YLNLSHNALDGEIP 557



 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 40/142 (28%), Positives = 60/142 (42%), Gaps = 19/142 (13%)
 Frame = +3

Query: 387 SELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXX 566
           + L+I+D+S N+ LTG LP E+   K+L   I +G   FG IPD +              
Sbjct: 347 TRLRIVDVSTNR-LTGVLPTELCAGKRLETFIALGNSLFGSIPDGLAGCPSLTRLRLGEN 405

Query: 567 XFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP-------------------GLD 689
              G IP  +  L  L  ++L DN L+G + +  G                      G+ 
Sbjct: 406 YLNGTIPAKMFTLQNLTQIELHDNLLSGELRLDAGVVSPSIGELSLYNNRLSGPVPVGIG 465

Query: 690 MLVGTKHFHFGXNKFSGEIPAQ 755
            LVG +      N+ SGE+P +
Sbjct: 466 GLVGLQKLLVAGNRLSGELPRE 487



 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 33/112 (29%), Positives = 53/112 (47%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L ++   L+GEL  +I +L +L   DLS N  ++G +P  I   + L  L L G    G 
Sbjct: 473 LLVAGNRLSGELPREIGKLQQLSKADLSGNL-ISGEIPPAIAGCRLLTFLDLSGNRLSGR 531

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
           IP ++                 G IPP++  +  L  +D +DN L+G +P +
Sbjct: 532 IPPALAGLRILNYLNLSHNALDGEIPPAIAGMQSLTAVDFSDNNLSGEVPAT 583



>gb:OSJN00271_1697720 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0002J11, complete
           sequence.>gb:OSJN00283_1697938 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBb0116K07, complete
           sequence.
          Length = 1104

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 67/202 (33%), Positives = 90/202 (44%), Gaps = 27/202 (13%)
 Frame = +3

Query: 231 DGWKNVPPSWAEGSDPCGDHWEGVGCNGSR---VVSLTLSSMDLTGELSGDIEELSELQI 401
           D W    PS      PCG  W+GV C+      VVSL LS+M+L+G +   I  L+EL  
Sbjct: 52  DDWNPEDPS------PCG--WKGVNCSSGSTPAVVSLNLSNMNLSGTVDPSIGGLAELTN 103

Query: 402 LDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF------------------------FGL 509
           LDLS+N   +G++P EIGN  KL  L L    F                        FG 
Sbjct: 104 LDLSFN-GFSGTIPAEIGNCSKLTGLNLNNNQFQGTIPAELGKLAMMITFNLCNNKLFGA 162

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IPD IG                G IP ++G+L  L  + L  N ++G+IPV  G    L+
Sbjct: 163 IPDEIGNMASLEDLVGYSNNLSGSIPHTIGRLKNLKTVRLGQNAISGNIPVEIGEC--LN 220

Query: 690 MLVGTKHFHFGXNKFSGEIPAQ 755
           ++V    F    NK  G +P +
Sbjct: 221 LVV----FGLAQNKLGGPLPKE 238



 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 53/148 (35%), Positives = 70/148 (47%), Gaps = 1/148 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S++V   +SS  L G +  +I   + LQ LDLS N    GSLP E+G+L +L  L   
Sbjct: 529 NLSKLVVFNISSNRLGGSIPLEIFNCTMLQRLDLSQNS-FEGSLPNEVGSLPQLELLSFA 587

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSEL-YWLDLADNQLTGSIPVS 665
                G IP  +G              F G IP  LG LS L   ++L+ N L+G+IP  
Sbjct: 588 DNRLSGEIPPILGKLSHLTALQIGGNQFSGGIPKELGLLSSLQIAMNLSYNNLSGNIPSE 647

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            GN   L+ L          NK +GEIP
Sbjct: 648 LGNLALLENL------FLNNNKLTGEIP 669



 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 49/150 (32%), Positives = 63/150 (42%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           CN   + ++ L      G +   I     LQ LDL+ N   T  LP+EIGNL KL    +
Sbjct: 480 CNLVNLTTIELGRNKFNGPIPPQIGNCKSLQRLDLT-NNYFTSELPQEIGNLSKLVVFNI 538

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                 G IP  I               F G +P  +G L +L  L  ADN+L+G IP  
Sbjct: 539 SSNRLGGSIPLEIFNCTMLQRLDLSQNSFEGSLPNEVGSLPQLELLSFADNRLSGEIP-- 596

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
               P L  L        G N+FSG IP +
Sbjct: 597 ----PILGKLSHLTALQIGGNQFSGGIPKE 622



 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 44/147 (29%), Positives = 65/147 (44%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           SR+  +  S+ ++TG++  D+   S L +L+L  NK L G++P  I + K L  L L   
Sbjct: 411 SRLWVVDFSNNNITGQIPRDLCRQSNLILLNLGANK-LIGNIPHGITSCKSLVQLRLADN 469

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G  P  +               F GPIPP +G    L  LDL +N  T  +P   GN
Sbjct: 470 SLTGSFPTDLCNLVNLTTIELGRNKFNGPIPPQIGNCKSLQRLDLTNNYFTSELPQEIGN 529

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
              L +      F+   N+  G IP +
Sbjct: 530 LSKLVV------FNISSNRLGGSIPLE 550



 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 44/143 (30%), Positives = 66/143 (46%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           ++ L    ++G +  +I E   L +  L+ NK L G LP+EIG L  + +LIL G     
Sbjct: 199 TVRLGQNAISGNIPVEIGECLNLVVFGLAQNK-LGGPLPKEIGKLTNMTDLILWGNQLSS 257

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
           +IP  IG               +GPIP ++G +  L  L L  N L G+IP+  GN    
Sbjct: 258 VIPPEIGNCINLRTIALYDNNLVGPIPATIGNIQNLQRLYLYRNLLNGTIPLEIGN---- 313

Query: 687 DMLVGTKHFHFGXNKFSGEIPAQ 755
             L   +   F  N  +G +P +
Sbjct: 314 --LSLAEEIDFSENVLTGGVPKE 334



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 47/147 (31%), Positives = 63/147 (42%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           SR++ L L +  L+G++       S L ++D S N ++TG +PR+   L +  NLIL+  
Sbjct: 387 SRLIQLQLFNNMLSGDIPPRFGIYSRLWVVDFS-NNNITGQIPRD---LCRQSNLILLNL 442

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
           G                         IG IP  +     L  L LADN LTGS P     
Sbjct: 443 G---------------------ANKLIGNIPHGITSCKSLVQLRLADNSLTGSFPTD--- 478

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
              L  LV       G NKF+G IP Q
Sbjct: 479 ---LCNLVNLTTIELGRNKFNGPIPPQ 502



 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 42/141 (29%), Positives = 58/141 (41%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           ++ L   +L G +   I  +  LQ L L Y   L G++P EIGNL     +        G
Sbjct: 271 TIALYDNNLVGPIPATIGNIQNLQRLYL-YRNLLNGTIPLEIGNLSLAEEIDFSENVLTG 329

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
            +P   G                GPIP  L  L  L  LDL+ N L+G IP        +
Sbjct: 330 GVPKEFGKIPRLYLLYLFQNQLTGPIPTELCVLRNLSKLDLSINTLSGPIPAC---FQYM 386

Query: 687 DMLVGTKHFHFGXNKFSGEIP 749
             L+  + F+   N  SG+IP
Sbjct: 387 SRLIQLQLFN---NMLSGDIP 404



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 34/116 (29%), Positives = 54/116 (46%), Gaps = 1/116 (0%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQI-LDLSYNKDLTGSLPREIGNLKKLYNLILVG 491
           S + +L +     +G +  ++  LS LQI ++LSYN +L+G++P E+GNL  L NL L  
Sbjct: 603 SHLTALQIGGNQFSGGIPKELGLLSSLQIAMNLSYN-NLSGNIPSELGNLALLENLFL-- 659

Query: 492 CGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
                                       G IP +   LS L   +++ N LTG++P
Sbjct: 660 ----------------------NNNKLTGEIPDTFANLSSLLEFNVSYNNLTGALP 693



>gb:AB019227_1514079 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MBM17.
          Length = 1102

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 73/211 (34%), Positives = 97/211 (45%), Gaps = 5/211 (2%)
 Frame = +3

Query: 138 IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSW-AEGSDPCGDHWEGVGCNG 314
           I LLL+ L  +  G+    +    + IK+     K    +W +  S PCG  W GV C+ 
Sbjct: 13  ISLLLILLISETTGLNL--EGQYLLEIKSKFVDAKQNLRNWNSNDSVPCG--WTGVMCSN 68

Query: 315 ----SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI 482
                 V+SL LSSM L+G+LS  I  L  L+ LDLSYN  L+G +P+EIGN   L  L 
Sbjct: 69  YSSDPEVLSLNLSSMVLSGKLSPSIGGLVHLKQLDLSYN-GLSGKIPKEIGNCSSLEILK 127

Query: 483 LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPV 662
           L    F G IP  IG                G +P  +G L  L  L    N ++G +P 
Sbjct: 128 LNNNQFDGEIPVEIGKLVSLENLIIYNNRISGSLPVEIGNLLSLSQLVTYSNNISGQLPR 187

Query: 663 SDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           S GN   L        F  G N  SG +P++
Sbjct: 188 SIGNLKRL------TSFRAGQNMISGSLPSE 212



 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 52/149 (34%), Positives = 67/149 (44%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N  R+ S       ++G L  +I     L +L L+ N+ L+G LP+EIG LKKL  +IL 
Sbjct: 191 NLKRLTSFRAGQNMISGSLPSEIGGCESLVMLGLAQNQ-LSGELPKEIGMLKKLSQVILW 249

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
              F G IP  I                +GPIP  LG L  L +L L  N L G+IP   
Sbjct: 250 ENEFSGFIPREISNCTSLETLALYKNQLVGPIPKELGDLQSLEFLYLYRNGLNGTIPREI 309

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           GN      L       F  N  +GEIP +
Sbjct: 310 GN------LSYAIEIDFSENALTGEIPLE 332



 Score = 69.7 bits (169), Expect = 5e-11
 Identities = 53/147 (36%), Positives = 74/147 (50%), Gaps = 1/147 (0%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S++ +L +SS  LTGE+  +I     LQ LD+  N + +G+LP E+G+L +L  L L   
Sbjct: 529 SQLGTLNISSNKLTGEVPSEIFNCKMLQRLDMCCN-NFSGTLPSEVGSLYQLELLKLSNN 587

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSEL-YWLDLADNQLTGSIPVSDG 671
              G IP ++G              F G IP  LG L+ L   L+L+ N+LTG IP    
Sbjct: 588 NLSGTIPVALGNLSRLTELQMGGNLFNGSIPRELGSLTGLQIALNLSYNKLTGEIP---- 643

Query: 672 NTPGLDMLVGTKHFHFGXNKFSGEIPA 752
             P L  LV  +      N  SGEIP+
Sbjct: 644 --PELSNLVMLEFLLLNNNNLSGEIPS 668



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 43/134 (32%), Positives = 58/134 (43%)
 Frame = +3

Query: 348 DLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG 527
           + +G +  +I   + L+ L L Y   L G +P+E+G+L+ L  L L   G  G IP  IG
Sbjct: 252 EFSGFIPREISNCTSLETLAL-YKNQLVGPIPKELGDLQSLEFLYLYRNGLNGTIPREIG 310

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTK 707
                           G IP  LG +  L  L L +NQLTG+IPV       L  L    
Sbjct: 311 NLSYAIEIDFSENALTGEIPLELGNIEGLELLYLFENQLTGTIPVE------LSTLKNLS 364

Query: 708 HFHFGXNKFSGEIP 749
                 N  +G IP
Sbjct: 365 KLDLSINALTGPIP 378



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 47/147 (31%), Positives = 66/147 (44%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S  + +  S   LTGE+  ++  +  L++L L  N+ LTG++P E+  LK L  L L 
Sbjct: 311 NLSYAIEIDFSENALTGEIPLELGNIEGLELLYLFENQ-LTGTIPVELSTLKNLSKLDLS 369

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP                    G IPP LG  S+L+ LD++DN L+G IP   
Sbjct: 370 INALTGPIPLGFQYLRGLFMLQLFQNSLSGTIPPKLGWYSDLWVLDMSDNHLSGRIP--- 426

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
                L +       + G N  SG IP
Sbjct: 427 ---SYLCLHSNMIILNLGTNNLSGNIP 450



 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 47/169 (27%), Positives = 70/169 (41%), Gaps = 24/169 (14%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +V L L+  +L G    ++ +   +  ++L  N+   GS+PRE+GN   L  L L   GF
Sbjct: 459 LVQLRLARNNLVGRFPSNLCKQVNVTAIELGQNR-FRGSIPREVGNCSALQRLQLADNGF 517

Query: 501 FGLIPDSIGXXXXXXXXXXXX------------------------XXFIGPIPPSLGQLS 608
            G +P  IG                                      F G +P  +G L 
Sbjct: 518 TGELPREIGMLSQLGTLNISSNKLTGEVPSEIFNCKMLQRLDMCCNNFSGTLPSEVGSLY 577

Query: 609 ELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           +L  L L++N L+G+IPV+ GN   L  L        G N F+G IP +
Sbjct: 578 QLELLKLSNNNLSGTIPVALGNLSRLTEL------QMGGNLFNGSIPRE 620



 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 46/147 (31%), Positives = 60/147 (40%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + + +L L    L G +  ++ +L  L+ L L Y   L G++PREIGNL     +   
Sbjct: 263 NCTSLETLALYKNQLVGPIPKELGDLQSLEFLYL-YRNGLNGTIPREIGNLSYAIEIDFS 321

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP  +G                G IP  L  L  L  LDL+ N LTG IP+  
Sbjct: 322 ENALTGEIPLELGNIEGLELLYLFENQLTGTIPVELSTLKNLSKLDLSINALTGPIPL-- 379

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
               G   L G        N  SG IP
Sbjct: 380 ----GFQYLRGLFMLQLFQNSLSGTIP 402



 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 33/94 (35%), Positives = 43/94 (45%), Gaps = 1/94 (1%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQI-LDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           N SR+  L +      G +  ++  L+ LQI L+LSYNK LTG +P E+ NL  L  L+L
Sbjct: 599 NLSRLTELQMGGNLFNGSIPRELGSLTGLQIALNLSYNK-LTGEIPPELSNLVMLEFLLL 657

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIP 587
                 G IP S                  GPIP
Sbjct: 658 NNNNLSGEIPSSFANLSSLLGYNFSYNSLTGPIP 691



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 36/136 (26%), Positives = 56/136 (41%), Gaps = 25/136 (18%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L +   + +G L  ++  L +L++L LS N +L+G++P  +GNL +L  L + G  F G 
Sbjct: 558 LDMCCNNFSGTLPSEVGSLYQLELLKLS-NNNLSGTIPVALGNLSRLTELQMGGNLFNGS 616

Query: 510 IPDSIGXXXXXXXXXXXXXXFI-------------------------GPIPPSLGQLSEL 614
           IP  +G               +                         G IP S   LS L
Sbjct: 617 IPRELGSLTGLQIALNLSYNKLTGEIPPELSNLVMLEFLLLNNNNLSGEIPSSFANLSSL 676

Query: 615 YWLDLADNQLTGSIPV 662
              + + N LTG IP+
Sbjct: 677 LGYNFSYNSLTGPIPL 692



>gb:AP004764_1844639 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0708B04.
          Length = 678

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 69/217 (31%), Positives = 101/217 (46%), Gaps = 11/217 (5%)
 Frame = +3

Query: 126 MIPRIQLLLVPLFIQFLGIVAFTD---NNDYVAIKALRDGWKN---VPPSWAEGS-DPCG 284
           M   + LLL  L + +   +AF+    N +  A+ A+R G  +   V  +W E S DPC 
Sbjct: 1   MASNLFLLLFFLVVSYAPFLAFSSEPLNPEVEALIAIRQGLVDPHGVLNNWDEDSVDPCS 60

Query: 285 DHWEGVGCNGSR-VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNL 461
             W  V C+    V+ L   S  L+G LSG I  L+ L+ + L  N ++TG LP E+G L
Sbjct: 61  --WAMVTCSAHNLVIGLGAPSQGLSGTLSGRIANLTNLEQV-LLQNNNITGRLPPELGAL 117

Query: 462 KKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQ 641
            +L  L L    F G +PD++G                G  P SL ++ +L +LDL+ N 
Sbjct: 118 PRLQTLDLSNNRFSGRVPDTLGRLSTLRYLRLNNNSLSGAFPSSLAKIPQLSFLDLSYNN 177

Query: 642 LTGSI---PVSDGNTPGLDMLVGTKHFHFGXNKFSGE 743
           LTG +   P    N  G  M+ G+       N  + E
Sbjct: 178 LTGPVPHFPTRTFNVVGNPMICGSSSGSHAGNANAAE 214



>gb:AP004764_1844638 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0708B04.
          Length = 493

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 69/217 (31%), Positives = 101/217 (46%), Gaps = 11/217 (5%)
 Frame = +3

Query: 126 MIPRIQLLLVPLFIQFLGIVAFTD---NNDYVAIKALRDGWKN---VPPSWAEGS-DPCG 284
           M   + LLL  L + +   +AF+    N +  A+ A+R G  +   V  +W E S DPC 
Sbjct: 1   MASNLFLLLFFLVVSYAPFLAFSSEPLNPEVEALIAIRQGLVDPHGVLNNWDEDSVDPCS 60

Query: 285 DHWEGVGCNGSR-VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNL 461
             W  V C+    V+ L   S  L+G LSG I  L+ L+ + L  N ++TG LP E+G L
Sbjct: 61  --WAMVTCSAHNLVIGLGAPSQGLSGTLSGRIANLTNLEQV-LLQNNNITGRLPPELGAL 117

Query: 462 KKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQ 641
            +L  L L    F G +PD++G                G  P SL ++ +L +LDL+ N 
Sbjct: 118 PRLQTLDLSNNRFSGRVPDTLGRLSTLRYLRLNNNSLSGAFPSSLAKIPQLSFLDLSYNN 177

Query: 642 LTGSI---PVSDGNTPGLDMLVGTKHFHFGXNKFSGE 743
           LTG +   P    N  G  M+ G+       N  + E
Sbjct: 178 LTGPVPHFPTRTFNVVGNPMICGSSSGSHAGNANAAE 214



>pir|T10636|T10636 hypothetical protein T13K14.100 - Arabidopsis
           thaliana>gb:ATCHRIV54_1545932 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           54.>gb:ATT13K14_1554427 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T13K14 (ESSA project).
          Length = 1143

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 59/187 (31%), Positives = 84/187 (44%), Gaps = 33/187 (17%)
 Frame = +3

Query: 198 NNDYVAIKALRDGWKNVPP-----SWAEGS---DPCGDHWEGVGCNGSRV---------- 323
           + D +A+   + G K+ P      SW + S   + C   W G+ CNG  V          
Sbjct: 6   SQDIMALLEFKKGIKHDPTGFVLNSWNDESIDFNGCPSSWNGIVCNGGNVAGVVLDNLGL 65

Query: 324 ---------------VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGN 458
                          V L++S+  L+G L  D+     LQ LDLS N   + SLP+EIG 
Sbjct: 66  TADADFSLFSNLTKLVKLSMSNNSLSGVLPNDLGSFKSLQFLDLSDNL-FSSSLPKEIGR 124

Query: 459 LKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADN 638
              L NL L G  F G IP+S+G                GP+P SL +L++L +L+L+ N
Sbjct: 125 SVSLRNLSLSGNNFSGEIPESMGGLISLQSLDMSSNSLSGPLPKSLTRLNDLLYLNLSSN 184

Query: 639 QLTGSIP 659
             TG +P
Sbjct: 185 GFTGKMP 191



 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 38/123 (30%), Positives = 56/123 (45%), Gaps = 2/123 (1%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS   L G L+   +    L++LDLSYN  L+G LP     +  L  L L    F G 
Sbjct: 252 LNLSHNQLEGSLTSGFQLFQNLKVLDLSYNM-LSGELP-GFNYVYDLEVLKLSNNRFSGS 309

Query: 510 IPDSI--GXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG 683
           +P+++  G                GP+   +   + L+ LDL+ N LTG +P+  G    
Sbjct: 310 LPNNLLKGDSLLLTTLDLSGNNLSGPVSSIMS--TTLHTLDLSSNSLTGELPLLTGGCVL 367

Query: 684 LDM 692
           LD+
Sbjct: 368 LDL 370



 Score = 42.0 bits (97), Expect = 0.012
 Identities = 34/124 (27%), Positives = 57/124 (45%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           +GSR+  L LS     G+L G    L+ LQ+L+L+ N +L+GSLP  + ++  L +L   
Sbjct: 481 SGSRIRLLDLSHNRFDGDLPGVFGSLTNLQVLNLAAN-NLSGSLPSSMNDIVSLSSL--- 536

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                                      F GP+P +L   S +   +++ N L+G++P + 
Sbjct: 537 ---------------------DVSQNHFTGPLPSNLS--SNIMAFNVSYNDLSGTVPENL 573

Query: 669 GNTP 680
            N P
Sbjct: 574 KNFP 577



 Score = 36.2 bits (82), Expect = 0.66
 Identities = 48/181 (26%), Positives = 71/181 (39%), Gaps = 39/181 (21%)
 Frame = +3

Query: 327 SLTLSSMDLTGEL-----------------SGDIEELSE---LQILDLSYNKDLTGSLPR 446
           +L LSS  LTGEL                  G++   S+   ++ LDLS N   TGS P 
Sbjct: 346 TLDLSSNSLTGELPLLTGGCVLLDLSNNQFEGNLTRWSKWENIEYLDLSQNH-FTGSFPD 404

Query: 447 EIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFI-GPIPPSLGQLSELYWL 623
               L +  +L L      G +P+ I                + GPIP +L  +  L  +
Sbjct: 405 ATPQLLRANHLNLSYNKLTGSLPERIPTHYPKLRVLDISSNSLEGPIPGALLSMPTLEEI 464

Query: 624 DLADNQLTGSI---PVS--------------DGNTPGL-DMLVGTKHFHFGXNKFSGEIP 749
            L +N +TG+I   P S              DG+ PG+   L   +  +   N  SG +P
Sbjct: 465 HLQNNGMTGNIGPLPSSGSRIRLLDLSHNRFDGDLPGVFGSLTNLQVLNLAANNLSGSLP 524

Query: 750 A 752
           +
Sbjct: 525 S 525



 Score = 33.9 bits (76), Expect = 3.3
 Identities = 36/144 (25%), Positives = 54/144 (37%), Gaps = 4/144 (2%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LSS   TG++    E +S L++LDL +   + G+L    G    L N   V      L
Sbjct: 179 LNLSSNGFTGKMPRGFELISSLEVLDL-HGNSIDGNLD---GEFFLLTNASYVDISGNRL 234

Query: 510 IPDS----IGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
           +  S     G                G +         L  LDL+ N L+G +       
Sbjct: 235 VTTSGKLLPGVSESIKHLNLSHNQLEGSLTSGFQLFQNLKVLDLSYNMLSGEL------- 287

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIP 749
           PG + +   +      N+FSG +P
Sbjct: 288 PGFNYVYDLEVLKLSNNRFSGSLP 311



>pir|E84527|E84527 hypothetical protein At2g15320 [imported] -
           Arabidopsis thaliana>gb:AC007267_1535747 Arabidopsis
           thaliana chromosome 2 clone F27O10 map mi398, complete
           sequence.>gb:AY050836_1562335 Arabidopsis thaliana
           putative leucine-rich repeat disease resistance protein
           (At2g15320) mRNA, complete cds.>gb:AY091163_1574373
           Arabidopsis thaliana putative leucine-rich repeat
           disease resistance protein (At2g15320) mRNA, complete
           cds.
          Length = 382

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 69/202 (34%), Positives = 96/202 (47%), Gaps = 15/202 (7%)
 Frame = +3

Query: 144 LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWK--NVPP-----SWA-EGSDPCGD---- 287
           LLL+ L + F    + T  +D  A+KA +   K  ++PP     SW    SDPC      
Sbjct: 4   LLLLLLLLLFSSADSLTSPSDVSALKAFKATVKPNSIPPWSCLASWDFTVSDPCASPRRT 63

Query: 288 HWE-GVGCNG--SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGN 458
           H+  G+ C+   +RV  LTL     TG L+  I  L+EL  LDL+ N +  G +P  I +
Sbjct: 64  HFTCGITCSSDSTRVTQLTLDPAGYTGRLTPLISGLTELLTLDLAEN-NFYGLIPSSISS 122

Query: 459 LKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADN 638
           L  L  LIL    F G +PDS+                 GP+P ++  LS L  LDL+ N
Sbjct: 123 LTSLKTLILRSNSFSGSLPDSVTRLNSLESIDISHNSLTGPLPKTMNSLSNLRQLDLSYN 182

Query: 639 QLTGSIPVSDGNTPGLDMLVGT 704
           +LTG+IP    N   L +   T
Sbjct: 183 KLTGAIPKLPKNLIDLALKANT 204



>gb:ZMA400869_1731517 Zea mays serk2 gene for somatic embryogenesis
           receptor-like kinase 2, exons 1-11.
          Length = 626

 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 55/162 (33%), Positives = 84/162 (51%), Gaps = 2/162 (1%)
 Frame = +3

Query: 180 IVAFTDNNDYVAIKALRDGWKNVPPSWAEGS-DPCGDHWEGVGCNGSR-VVSLTLSSMDL 353
           +VA T+ +   +++       NV  SW     +PC   W  V CN    V+ + L +  L
Sbjct: 26  VVANTEGDALYSLRQSLKDANNVLQSWDPTLVNPCT--WFHVTCNNDNSVIRVDLGNAQL 83

Query: 354 TGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXX 533
           +G L   + +L  LQ L+L Y+ +++G++P E+GNL  L +L L    F G IPDS+G  
Sbjct: 84  SGVLVPQLGQLKNLQYLEL-YSNNISGTIPPELGNLTNLVSLDLYMNNFSGNIPDSLGNL 142

Query: 534 XXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
                        +GPIP SL  +S L  LDL++N L+G +P
Sbjct: 143 VKLRFLRLNNNSLVGPIPVSLTNISTLQVLDLSNNNLSGQVP 184



>gb:ZMA277703_1731488 Zea mays mRNA for SERK2 protein.
          Length = 626

 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 55/162 (33%), Positives = 84/162 (51%), Gaps = 2/162 (1%)
 Frame = +3

Query: 180 IVAFTDNNDYVAIKALRDGWKNVPPSWAEGS-DPCGDHWEGVGCNGSR-VVSLTLSSMDL 353
           +VA T+ +   +++       NV  SW     +PC   W  V CN    V+ + L +  L
Sbjct: 26  VVANTEGDALYSLRQSLKDANNVLQSWDPTLVNPCT--WFHVTCNNDNSVIRVDLGNAQL 83

Query: 354 TGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXX 533
           +G L   + +L  LQ L+L Y+ +++G++P E+GNL  L +L L    F G IPDS+G  
Sbjct: 84  SGVLVPQLGQLKNLQYLEL-YSNNISGTIPPELGNLTNLVSLDLYMNNFSGNIPDSLGNL 142

Query: 534 XXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
                        +GPIP SL  +S L  LDL++N L+G +P
Sbjct: 143 VKLRFLRLNNNSLVGPIPVSLTNISTLQVLDLSNNNLSGQVP 184



>gb:AF053996_1764490 Lycopersicon pimpinellifolium Hcr2-2A (Hcr2-2A)
           gene, complete cds.
          Length = 802

 Score = 83.2 bits (204), Expect = 5e-15
 Identities = 68/228 (29%), Positives = 100/228 (43%), Gaps = 31/228 (13%)
 Frame = +3

Query: 162 FIQFLGI--VAFTDNNDYVAIKALRDGWKN----VPPSWAEGSDPCGDHWEGVGCNGSRV 323
           FI  L +  V F  + +  A+      +KN    +  SW + S+ C D W GV C   RV
Sbjct: 14  FIALLNLFTVTFASSEEATALLKWIATFKNQDDSLLASWTQSSNACRD-WYGVICFNGRV 72

Query: 324 VSLT-------------------------LSSMDLTGELSGDIEELSELQILDLSYNKDL 428
            +L                          LS+ +++G +  +I  L+ L  LDL+ N  +
Sbjct: 73  KTLNITNCGVIGTLYAFPFSSLPFLENLNLSNNNISGTIPPEIGNLTNLVYLDLN-NNQI 131

Query: 429 TGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLS 608
           +G++P + G+L KL  L + G    G IP+ IG                G IP SLG+L+
Sbjct: 132 SGTIPPQTGSLSKLQILRIFGNHLKGSIPEEIGYLRSLTDLSLSTNFLNGSIPASLGKLN 191

Query: 609 ELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            L +L L DNQL+GSIP        +D L      +   N  +G IPA
Sbjct: 192 NLSFLSLYDNQLSGSIP------DEIDYLTSLTDLYLNNNFLNGSIPA 233



 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 48/140 (34%), Positives = 63/140 (45%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L+L    L+G +  +I  L  L  L L+ N  L GS+PREIG L+ L NL L      G 
Sbjct: 244 LSLRENQLSGYIPQEIGYLRSLTYLRLN-NNFLNGSIPREIGYLRSLTNLHLNNNFLNGS 302

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP  IG                G IP SLG L  +  + L +N LT  IP+S  N   L 
Sbjct: 303 IPPEIGNLRSLSIIDLSINSLKGSIPASLGNLRNVQSMFLDENNLTEEIPLSVCNLTSLK 362

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
           +L      +   N   G++P
Sbjct: 363 IL------YLRRNNLKGKVP 376



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 47/141 (33%), Positives = 60/141 (42%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L+L    L+G +  +I+ L+ L  L L+ N  L GS+P  + NLK L  L L      G 
Sbjct: 196 LSLYDNQLSGSIPDEIDYLTSLTDLYLN-NNFLNGSIPASLWNLKNLSFLSLRENQLSGY 254

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP  IG                G IP  +G L  L  L L +N L GSIP   GN   L 
Sbjct: 255 IPQEIGYLRSLTYLRLNNNFLNGSIPREIGYLRSLTNLHLNNNFLNGSIPPEIGNLRSLS 314

Query: 690 MLVGTKHFHFGXNKFSGEIPA 752
           ++          N   G IPA
Sbjct: 315 II------DLSINSLKGSIPA 329



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 47/147 (31%), Positives = 59/147 (40%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S++  L +    L G +  +I  L  L  L LS N  L GS+P  +G L  L  L L   
Sbjct: 143 SKLQILRIFGNHLKGSIPEEIGYLRSLTDLSLSTNF-LNGSIPASLGKLNNLSFLSLYDN 201

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G IPD I                 G IP SL  L  L +L L +NQL+G IP   G 
Sbjct: 202 QLSGSIPDEIDYLTSLTDLYLNNNFLNGSIPASLWNLKNLSFLSLRENQLSGYIPQEIGY 261

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
              L  L          N  +G IP +
Sbjct: 262 LRSLTYL------RLNNNFLNGSIPRE 282



 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 43/144 (29%), Positives = 62/144 (43%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +  LT+S  +L+GE+   I  L  LQILDL  N  L G++P+  GN+  L    + 
Sbjct: 381 NISGLQVLTMSPNNLSGEIPSSISNLRSLQILDLGRN-SLEGAIPQCFGNINTLQVFDVQ 439

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G +  +                  G IP SL    +L  LDL +N L  + P+  
Sbjct: 440 NNKLSGTLSTNFSIGSSLISLNLHGNELEGEIPRSLANCKKLQVLDLGNNHLNDTFPMWL 499

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSG 740
           G    L +L  T +   G  + SG
Sbjct: 500 GTLLELRVLRLTSNKLHGPIRSSG 523



 Score = 52.4 bits (124), Expect = 9e-06
 Identities = 46/166 (27%), Positives = 65/166 (39%), Gaps = 24/166 (14%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG--- 491
           + +L L++  L G +  +I  L  L I+DLS N  L GS+P  +GNL+ + ++ L     
Sbjct: 289 LTNLHLNNNFLNGSIPPEIGNLRSLSIIDLSINS-LKGSIPASLGNLRNVQSMFLDENNL 347

Query: 492 --------CGFFGL-------------IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLS 608
                   C    L             +P  +G                G IP S+  L 
Sbjct: 348 TEEIPLSVCNLTSLKILYLRRNNLKGKVPQCLGNISGLQVLTMSPNNLSGEIPSSISNLR 407

Query: 609 ELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEI 746
            L  LDL  N L G+IP   GN   L +      F    NK SG +
Sbjct: 408 SLQILDLGRNSLEGAIPQCFGNINTLQV------FDVQNNKLSGTL 447



 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 41/138 (29%), Positives = 61/138 (44%), Gaps = 1/138 (0%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           CN + +  L L   +L G++   +  +S LQ+L +S N +L+G +P  I NL+ L  L L
Sbjct: 356 CNLTSLKILYLRRNNLKGKVPQCLGNISGLQVLTMSPN-NLSGEIPSSISNLRSLQILDL 414

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                 G IP   G                G +  +    S L  L+L  N+L G IP S
Sbjct: 415 GRNSLEGAIPQCFGNINTLQVFDVQNNKLSGTLSTNFSIGSSLISLNLHGNELEGEIPRS 474

Query: 666 DGNTPGLDML-VGTKHFH 716
             N   L +L +G  H +
Sbjct: 475 LANCKKLQVLDLGNNHLN 492



 Score = 42.7 bits (99), Expect = 0.007
 Identities = 29/75 (38%), Positives = 36/75 (48%), Gaps = 1/75 (1%)
 Frame = +3

Query: 438 LPREIGNLKKLYNLI-LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSEL 614
           L  E+  +  LY +I L    F G IP  +G                G IPPSLG LS +
Sbjct: 585 LKLEVVRILSLYTVIDLSNNKFEGHIPSVLGDFIALRVLNMSHNGLKGQIPPSLGSLSVV 644

Query: 615 YWLDLADNQLTGSIP 659
             LDL+ NQL+G IP
Sbjct: 645 ESLDLSFNQLSGEIP 659



 Score = 33.1 bits (74), Expect = 5.6
 Identities = 21/62 (33%), Positives = 35/62 (56%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L +S   L G++   +  LS ++ LDLS+N+ L+G +P+++ +L  L  L L      G 
Sbjct: 623 LNMSHNGLKGQIPPSLGSLSVVESLDLSFNQ-LSGEIPQQLASLTSLGFLNLSHNYLQGC 681

Query: 510 IP 515
           IP
Sbjct: 682 IP 683



>gb:AY086058_1571119 Arabidopsis thaliana clone 20900 mRNA, complete
           sequence.
          Length = 384

 Score = 83.2 bits (204), Expect = 5e-15
 Identities = 69/202 (34%), Positives = 95/202 (47%), Gaps = 15/202 (7%)
 Frame = +3

Query: 144 LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWK--NVPP-----SWA-EGSDPCGD---- 287
           LLL+ L   F    + T  +D  A+KA +   K  ++PP     SW    SDPC      
Sbjct: 6   LLLLLLLFLFSSADSLTSPSDVSALKAFKATVKPNSIPPWSCLASWDFTVSDPCASPRRT 65

Query: 288 HWE-GVGCNG--SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGN 458
           H+  G+ C+   +RV  LTL     TG L+  I  L+EL  LDL+ N +  G +P  I +
Sbjct: 66  HFTCGITCSSDSTRVTQLTLDPAGYTGRLTPLISGLTELLTLDLAEN-NFYGLIPSSISS 124

Query: 459 LKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADN 638
           L  L  LIL    F G +PDS+                 GP+P ++  LS L  LDL+ N
Sbjct: 125 LTSLKTLILRSNSFSGSLPDSVTRLNSLESIDISHNSLTGPLPKTMNSLSNLRQLDLSYN 184

Query: 639 QLTGSIPVSDGNTPGLDMLVGT 704
           +LTG+IP    N   L +   T
Sbjct: 185 KLTGAIPKLPKNLIDLALKANT 206



>gb:AY072083_1566979 Arabidopsis thaliana putative receptor protein
           kinase (At5g56040) mRNA, complete cds.
          Length = 953

 Score = 83.2 bits (204), Expect = 5e-15
 Identities = 60/171 (35%), Positives = 79/171 (46%), Gaps = 18/171 (10%)
 Frame = +3

Query: 291 WEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKL 470
           WE   C    +V+L L+   L+G L   I  L ++Q + L Y   L+G +P EIGN  +L
Sbjct: 211 WEIGNCES--LVTLGLAETSLSGRLPASIGNLKKVQTIAL-YTSLLSGPIPDEIGNCTEL 267

Query: 471 YNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTG 650
            NL L      G IP S+G               +G IP  LG   EL+ +DL++N LTG
Sbjct: 268 QNLYLYQNSISGSIPVSMGRLKKLQSLLLWQNNLVGKIPTELGTCPELFLVDLSENLLTG 327

Query: 651 SIPVSDGNTPGL-------DMLVGT-----------KHFHFGXNKFSGEIP 749
           +IP S GN P L       + L GT            H     N+ SGEIP
Sbjct: 328 NIPRSFGNLPNLQELQLSVNQLSGTIPEELANCTKLTHLEIDNNQISGEIP 378



 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 52/145 (35%), Positives = 66/145 (45%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           ++ LTL    L GE+   I EL  L+I     NK+L G LP EIGN + L  L L     
Sbjct: 170 LIELTLFDNKLAGEIPRTIGELKNLEIFRAGGNKNLRGELPWEIGNCESLVTLGLAETSL 229

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G +P SIG                GPIP  +G  +EL  L L  N ++GSIPVS G   
Sbjct: 230 SGRLPASIGNLKKVQTIALYTSLLSGPIPDEIGNCTELQNLYLYQNSISGSIPVSMGRLK 289

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L  L+         N   G+IP +
Sbjct: 290 KLQSLL------LWQNNLVGKIPTE 308



 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 53/174 (30%), Positives = 71/174 (40%), Gaps = 39/174 (22%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNK-----------------------DLTGSLPREIGNL 461
           LTG +   + +  ELQ +DLSYN                         L+G +P +IGN 
Sbjct: 397 LTGIIPESLSQCQELQAIDLSYNNLSGSIPNGIFEIRNLTKLLLLSNYLSGFIPPDIGNC 456

Query: 462 KKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQ 641
             LY L L G    G IP  IG               IG IPP +   + L ++DL  N 
Sbjct: 457 TNLYRLRLNGNRLAGNIPAEIGNLKNLNFIDISENRLIGNIPPEISGCTSLEFVDLHSNG 516

Query: 642 LTGSIP-----------VSD----GNTP-GLDMLVGTKHFHFGXNKFSGEIPAQ 755
           LTG +P           +SD    G+ P G+  L      +   N+FSGEIP +
Sbjct: 517 LTGGLPGTLPKSLQFIDLSDNSLTGSLPTGIGSLTELTKLNLAKNRFSGEIPRE 570



 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 58/194 (29%), Positives = 82/194 (42%), Gaps = 28/194 (14%)
 Frame = +3

Query: 255 SW-AEGSDPCGDHWEGVGCNGSRVVS--------------------------LTLSSMDL 353
           SW A  S+PC   W G+ CN    VS                          L+L+S++L
Sbjct: 51  SWKASESNPC--QWVGIKCNERGQVSEIQLQVMDFQGPLPATNLRQIKSLTLLSLTSVNL 108

Query: 354 TGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXX 533
           TG +  ++ +LSEL++LDL+ N  L+G +P +I  LKKL  L L      G+IP  +G  
Sbjct: 109 TGSIPKELGDLSELEVLDLADNS-LSGEIPVDIFKLKKLKILSLNTNNLEGVIPSELGNL 167

Query: 534 XXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQ-LTGSIPVSDGNTPGLDMLVGTKH 710
                         G IP ++G+L  L       N+ L G +P   GN   L  L     
Sbjct: 168 VNLIELTLFDNKLAGEIPRTIGELKNLEIFRAGGNKNLRGELPWEIGNCESLVTL----- 222

Query: 711 FHFGXNKFSGEIPA 752
                   SG +PA
Sbjct: 223 -GLAETSLSGRLPA 235



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 46/144 (31%), Positives = 63/144 (43%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           ++ SL L   +L G++  ++    EL ++DLS N  LTG++PR  GNL  L  L L    
Sbjct: 290 KLQSLLLWQNNLVGKIPTELGTCPELFLVDLSENL-LTGNIPRSFGNLPNLQELQLSVNQ 348

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
             G IP+ +                 G IPP +G+L+ L       NQLTG IP S    
Sbjct: 349 LSGTIPEELANCTKLTHLEIDNNQISGEIPPLIGKLTSLTMFFAWQNQLTGIIPES---- 404

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIP 749
             L      +      N  SG IP
Sbjct: 405 --LSQCQELQAIDLSYNNLSGSIP 426



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 44/143 (30%), Positives = 59/143 (41%), Gaps = 1/143 (0%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI-LVGCGFFG 506
           + +S   L G +  +I   + L+ +DL  N  LTG LP   G L K    I L      G
Sbjct: 486 IDISENRLIGNIPPEISGCTSLEFVDLHSN-GLTGGLP---GTLPKSLQFIDLSDNSLTG 541

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
            +P  IG              F G IP  +     L  L+L DN  TG IP   G  P L
Sbjct: 542 SLPTGIGSLTELTKLNLAKNRFSGEIPREISSCRSLQLLNLGDNGFTGEIPNELGRIPSL 601

Query: 687 DMLVGTKHFHFGXNKFSGEIPAQ 755
            +       +   N F+GEIP++
Sbjct: 602 AI-----SLNLSCNHFTGEIPSR 619



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 38/149 (25%), Positives = 65/149 (43%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N +++  L + +  ++GE+   I +L+ L +   ++   LTG +P  +   ++L  + L 
Sbjct: 359 NCTKLTHLEIDNNQISGEIPPLIGKLTSLTMF-FAWQNQLTGIIPESLSQCQELQAIDLS 417

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP+ I                 G IPP +G  + LY L L  N+L G+IP   
Sbjct: 418 YNNLSGSIPNGIFEIRNLTKLLLLSNYLSGFIPPDIGNCTNLYRLRLNGNRLAGNIPAEI 477

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           GN   L+ +          N+  G IP +
Sbjct: 478 GNLKNLNFI------DISENRLIGNIPPE 500



 Score = 35.4 bits (80), Expect = 1.1
 Identities = 24/70 (34%), Positives = 39/70 (55%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S  +SL LS    TGE+      L+ L  LD+S+NK L G+L   + +L+ L +L +   
Sbjct: 600 SLAISLNLSCNHFTGEIPSRFSSLTNLGTLDVSHNK-LAGNL-NVLADLQNLVSLNISFN 657

Query: 495 GFFGLIPDSI 524
            F G +P+++
Sbjct: 658 EFSGELPNTL 667



>gb:AB011476_1511391 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MDA7.
          Length = 1015

 Score = 83.2 bits (204), Expect = 5e-15
 Identities = 60/171 (35%), Positives = 79/171 (46%), Gaps = 18/171 (10%)
 Frame = +3

Query: 291 WEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKL 470
           WE   C    +V+L L+   L+G L   I  L ++Q + L Y   L+G +P EIGN  +L
Sbjct: 211 WEIGNCES--LVTLGLAETSLSGRLPASIGNLKKVQTIAL-YTSLLSGPIPDEIGNCTEL 267

Query: 471 YNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTG 650
            NL L      G IP S+G               +G IP  LG   EL+ +DL++N LTG
Sbjct: 268 QNLYLYQNSISGSIPVSMGRLKKLQSLLLWQNNLVGKIPTELGTCPELFLVDLSENLLTG 327

Query: 651 SIPVSDGNTPGL-------DMLVGT-----------KHFHFGXNKFSGEIP 749
           +IP S GN P L       + L GT            H     N+ SGEIP
Sbjct: 328 NIPRSFGNLPNLQELQLSVNQLSGTIPEELANCTKLTHLEIDNNQISGEIP 378



 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 52/145 (35%), Positives = 66/145 (45%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           ++ LTL    L GE+   I EL  L+I     NK+L G LP EIGN + L  L L     
Sbjct: 170 LIELTLFDNKLAGEIPRTIGELKNLEIFRAGGNKNLRGELPWEIGNCESLVTLGLAETSL 229

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G +P SIG                GPIP  +G  +EL  L L  N ++GSIPVS G   
Sbjct: 230 SGRLPASIGNLKKVQTIALYTSLLSGPIPDEIGNCTELQNLYLYQNSISGSIPVSMGRLK 289

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L  L+         N   G+IP +
Sbjct: 290 KLQSLL------LWQNNLVGKIPTE 308



 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 58/194 (29%), Positives = 82/194 (42%), Gaps = 28/194 (14%)
 Frame = +3

Query: 255 SW-AEGSDPCGDHWEGVGCNGSRVVS--------------------------LTLSSMDL 353
           SW A  S+PC   W G+ CN    VS                          L+L+S++L
Sbjct: 51  SWKASESNPC--QWVGIKCNERGQVSEIQLQVMDFQGPLPATNLRQIKSLTLLSLTSVNL 108

Query: 354 TGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXX 533
           TG +  ++ +LSEL++LDL+ N  L+G +P +I  LKKL  L L      G+IP  +G  
Sbjct: 109 TGSIPKELGDLSELEVLDLADNS-LSGEIPVDIFKLKKLKILSLNTNNLEGVIPSELGNL 167

Query: 534 XXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQ-LTGSIPVSDGNTPGLDMLVGTKH 710
                         G IP ++G+L  L       N+ L G +P   GN   L  L     
Sbjct: 168 VNLIELTLFDNKLAGEIPRTIGELKNLEIFRAGGNKNLRGELPWEIGNCESLVTL----- 222

Query: 711 FHFGXNKFSGEIPA 752
                   SG +PA
Sbjct: 223 -GLAETSLSGRLPA 235



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 46/144 (31%), Positives = 63/144 (43%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           ++ SL L   +L G++  ++    EL ++DLS N  LTG++PR  GNL  L  L L    
Sbjct: 290 KLQSLLLWQNNLVGKIPTELGTCPELFLVDLSENL-LTGNIPRSFGNLPNLQELQLSVNQ 348

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
             G IP+ +                 G IPP +G+L+ L       NQLTG IP S    
Sbjct: 349 LSGTIPEELANCTKLTHLEIDNNQISGEIPPLIGKLTSLTMFFAWQNQLTGIIPES---- 404

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIP 749
             L      +      N  SG IP
Sbjct: 405 --LSQCQELQAIDLSYNNLSGSIP 426



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 46/154 (29%), Positives = 62/154 (40%), Gaps = 19/154 (12%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNL-------------------KKLY 473
           LTG +   + +  ELQ +DLSYN +L+GS+P  I  L                   K L 
Sbjct: 397 LTGIIPESLSQCQELQAIDLSYN-NLSGSIPNGIFGLEFVDLHSNGLTGGLPGTLPKSLQ 455

Query: 474 NLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGS 653
            + L      G +P  IG              F G IP  +     L  L+L DN  TG 
Sbjct: 456 FIDLSDNSLTGSLPTGIGSLTELTKLNLAKNRFSGEIPREISSCRSLQLLNLGDNGFTGE 515

Query: 654 IPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           IP   G  P L +       +   N F+GEIP++
Sbjct: 516 IPNELGRIPSLAI-----SLNLSCNHFTGEIPSR 544



 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 41/150 (27%), Positives = 69/150 (46%), Gaps = 1/150 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N +++  L + +  ++GE+   I +L+ L +   ++   LTG +P  +   ++L  + L 
Sbjct: 359 NCTKLTHLEIDNNQISGEIPPLIGKLTSLTMF-FAWQNQLTGIIPESLSQCQELQAIDLS 417

Query: 489 GCGFFGLIPDSI-GXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                G IP+ I G                G +P S      L ++DL+DN LTGS+P  
Sbjct: 418 YNNLSGSIPNGIFGLEFVDLHSNGLTGGLPGTLPKS------LQFIDLSDNSLTGSLPTG 471

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            G+   L  L      +   N+FSGEIP +
Sbjct: 472 IGSLTELTKL------NLAKNRFSGEIPRE 495



 Score = 35.4 bits (80), Expect = 1.1
 Identities = 24/70 (34%), Positives = 39/70 (55%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S  +SL LS    TGE+      L+ L  LD+S+NK L G+L   + +L+ L +L +   
Sbjct: 525 SLAISLNLSCNHFTGEIPSRFSSLTNLGTLDVSHNK-LAGNL-NVLADLQNLVSLNISFN 582

Query: 495 GFFGLIPDSI 524
            F G +P+++
Sbjct: 583 EFSGELPNTL 592



>gb:AP005849_1859071 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBb0031B09.
          Length = 718

 Score = 82.8 bits (203), Expect = 6e-15
 Identities = 62/215 (28%), Positives = 89/215 (41%), Gaps = 25/215 (11%)
 Frame = +3

Query: 186 AFTDNNDYVAIKALRDGWKNVPP--SWAEGS--DPCGDHWEGVGCNGSRVVSLTLSSMDL 353
           A TD +D  A+  L   W +      W+ G   DPCG  W+G+ C+G+ V  + L+ + L
Sbjct: 22  ATTDASDAAALGNLYSSWNSPSQLAGWSAGGGGDPCGAGWQGISCSGAGVTEIRLAGVGL 81

Query: 354 TGELSGDIEELSELQILDLSYN---------------------KDLTGSLPREIGNLKKL 470
            G L  ++  L  L+ LDLS N                      +L+G+LP  I N+  L
Sbjct: 82  DGSLGYELSSLFSLKTLDLSNNNLHGSIPYQLPPNLTYLNLATNNLSGNLPYSISNMVSL 141

Query: 471 YNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTG 650
             L +        I D  G                G +P SLG LS L  L + +NQLTG
Sbjct: 142 EYLNVSHNSLSQQIGDLFGSLNSLSELDVSFNKLTGDLPNSLGSLSNLSSLYMQNNQLTG 201

Query: 651 SIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           S+ V  G        +     +   N F+G IP +
Sbjct: 202 SVNVLSG--------LSLTTLNIANNNFNGWIPQE 228



>gb:AP003962_1835750 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1705_C03.>gb:AP004397_1841167 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0436B06.
          Length = 977

 Score = 82.4 bits (202), Expect = 8e-15
 Identities = 53/162 (32%), Positives = 77/162 (47%)
 Frame = +3

Query: 267 GSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPR 446
           G+   G+     G     +++L+L+  +L+GEL   +  +S L+ L L+YN+     LP 
Sbjct: 128 GNGFSGEVPRSYGAGFPSLLTLSLAGNELSGELPAFLANVSALEELLLAYNQFAPSPLPE 187

Query: 447 EIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLD 626
               +++L  L L GC   G IP SIG                G IP S+G L  +  L+
Sbjct: 188 TFTGIRRLQVLWLAGCNLVGDIPPSIGSLKSLVNLDLSTNNLTGEIPSSIGGLESVVQLE 247

Query: 627 LADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           L  NQLTGS+P       G+  L   + F    N+ SGEIPA
Sbjct: 248 LYSNQLTGSLP------EGMSALKKLRFFDAAMNQLSGEIPA 283



 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 55/198 (27%), Positives = 86/198 (43%), Gaps = 24/198 (12%)
 Frame = +3

Query: 234 GWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLS 413
           G + +   W  G +  GD    +G   S +V+L LS+ +LTGE+   I  L  +  L+L 
Sbjct: 191 GIRRLQVLWLAGCNLVGDIPPSIGSLKS-LVNLDLSTNNLTGEIPSSIGGLESVVQLEL- 248

Query: 414 YNKDLTGSLPREIGNLKKLY------------------------NLILVGCGFFGLIPDS 521
           Y+  LTGSLP  +  LKKL                         +L L      G +P +
Sbjct: 249 YSNQLTGSLPEGMSALKKLRFFDAAMNQLSGEIPADLFLAPRLESLHLYQNELTGRVPAT 308

Query: 522 IGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVG 701
           +                +G +PP  G+ S L +LDL+DN+++G IP +  +   L+ L+ 
Sbjct: 309 VADAAALNDLRLFTNRLVGELPPEFGKKSPLEFLDLSDNRISGEIPATLCSAGKLEQLLM 368

Query: 702 TKHFHFGXNKFSGEIPAQ 755
                   N+  G IPA+
Sbjct: 369 LN------NELVGPIPAE 380



 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 56/199 (28%), Positives = 77/199 (38%), Gaps = 32/199 (16%)
 Frame = +3

Query: 252 PSWAEGSDPCGDHWEGVGCNG------SRVVSLTLSSMDLTGELSGDIEELSELQILDLS 413
           P  +    PC   W  + C+       + + ++ LS++ L GE    + EL  L +LDLS
Sbjct: 46  PGLSPSLSPC--RWPHLLCSNPSSSSSAAIAAVLLSNLSLAGEFPAPLCELRSLALLDLS 103

Query: 414 YNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXX-XXXXXXXXXXXFIGPIPP 590
           YN DLTG LP  +  +  L +L L G GF G +P S G                 G +P 
Sbjct: 104 YN-DLTGPLPGCLAAMPSLRHLDLAGNGFSGEVPRSYGAGFPSLLTLSLAGNELSGELPA 162

Query: 591 SLGQLSELYWLDLADNQ-------------------------LTGSIPVSDGNTPGLDML 695
            L  +S L  L LA NQ                         L G IP      P +  L
Sbjct: 163 FLANVSALEELLLAYNQFAPSPLPETFTGIRRLQVLWLAGCNLVGDIP------PSIGSL 216

Query: 696 VGTKHFHFGXNKFSGEIPA 752
               +     N  +GEIP+
Sbjct: 217 KSLVNLDLSTNNLTGEIPS 235



 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 43/142 (30%), Positives = 66/142 (46%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L+   L+G ++  I     L  L +S N+   G+LP E+G+L  L+ L      F G 
Sbjct: 414 LELAGNALSGAVAPAIATARNLSQLLISDNR-FAGALPPELGSLPNLFELSASNNVFSGP 472

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           +P S+                 G +P  + +  +L  LDLADN+LTG+IP   G+ P L+
Sbjct: 473 LPASLTVVTTLGRLDLRNNSLSGELPRGVRRWQKLTQLDLADNRLTGNIPAELGDLPVLN 532

Query: 690 MLVGTKHFHFGXNKFSGEIPAQ 755
            L          N+ +G +P Q
Sbjct: 533 SL------DLSNNELTGGVPVQ 548



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 39/126 (30%), Positives = 56/126 (44%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           R+ SL L   +LTG +   + + + L  L L  N+ L G LP E G    L  L L    
Sbjct: 290 RLESLHLYQNELTGRVPATVADAAALNDLRLFTNR-LVGELPPEFGKKSPLEFLDLSDNR 348

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
             G IP ++                +GPIP  LGQ   L  + L +N+L+G++P      
Sbjct: 349 ISGEIPATLCSAGKLEQLLMLNNELVGPIPAELGQCRTLTRVRLPNNRLSGAVPPDMWGL 408

Query: 678 PGLDML 695
           P L +L
Sbjct: 409 PHLYLL 414



 Score = 36.2 bits (82), Expect = 0.66
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 1/55 (1%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLK-KLYNL 479
           ++  L L+   LTG +  ++ +L  L  LDLS N +LTG +P ++ NLK  L NL
Sbjct: 506 KLTQLDLADNRLTGNIPAELGDLPVLNSLDLS-NNELTGGVPVQLENLKLSLLNL 559



>gb:AK117901_1815909 Arabidopsis thaliana At5g49660 mRNA for
           putative receptor protein kinase, complete cds, clone:
           RAFL19-08-G15.
          Length = 966

 Score = 82.4 bits (202), Expect = 8e-15
 Identities = 56/148 (37%), Positives = 74/148 (50%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + +V L LS   L+GE+  +I  LS L+ L+L YN  LTGS+P EIGNLK L ++ + 
Sbjct: 217 NLTSLVDLELSGNFLSGEIPKEIGNLSNLRQLELYYNYHLTGSIPEEIGNLKNLTDIDIS 276

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IPDSI                 G IP SLG    L  L L DN LTG +P + 
Sbjct: 277 VSRLTGSIPDSICSLPNLRVLQLYNNSLTGEIPKSLGNSKTLKILSLYDNYLTGELPPNL 336

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           G++  +  L          N+ SG +PA
Sbjct: 337 GSSSPMIAL------DVSENRLSGPLPA 358



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 42/147 (28%), Positives = 64/147 (43%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N   +  + +S   LTG +   I  L  L++L L YN  LTG +P+ +GN K L  L L 
Sbjct: 266 NLKNLTDIDISVSRLTGSIPDSICSLPNLRVLQL-YNNSLTGEIPKSLGNSKTLKILSLY 324

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G +P ++G                GP+P  + +  +L +  +  N+ TGSIP + 
Sbjct: 325 DNYLTGELPPNLGSSSPMIALDVSENRLSGPLPAHVCKSGKLLYFLVLQNRFTGSIPETY 384

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           G+   L        F    N+  G IP
Sbjct: 385 GSCKTL------IRFRVASNRLVGTIP 405



 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 42/143 (29%), Positives = 62/143 (43%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           ++   ++S  L G +   +  L  + I+DL+YN  L+G +P  IGN   L  L +     
Sbjct: 390 LIRFRVASNRLVGTIPQGVMSLPHVSIIDLAYNS-LSGPIPNAIGNAWNLSELFMQSNRI 448

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G+IP  +                 GPIP  +G+L +L  L L  N L  SIP S  N  
Sbjct: 449 SGVIPHELSHSTNLVKLDLSNNQLSGPIPSEVGRLRKLNLLVLQGNHLDSSIPDSLSNLK 508

Query: 681 GLDMLVGTKHFHFGXNKFSGEIP 749
            L++L          N  +G IP
Sbjct: 509 SLNVL------DLSSNLLTGRIP 525



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 45/147 (30%), Positives = 66/147 (44%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N   +  L+L    LTGEL  ++   S +  LD+S N+ L+G LP  +    KL   +++
Sbjct: 314 NSKTLKILSLYDNYLTGELPPNLGSSSPMIALDVSENR-LSGPLPAHVCKSGKLLYFLVL 372

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
              F G IP++ G               +G IP  +  L  +  +DLA N L+G IP + 
Sbjct: 373 QNRFTGSIPETYGSCKTLIRFRVASNRLVGTIPQGVMSLPHVSIIDLAYNSLSGPIPNAI 432

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           GN   L  L          N+ SG IP
Sbjct: 433 GNAWNLSEL------FMQSNRISGVIP 453



 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 41/121 (33%), Positives = 57/121 (47%), Gaps = 2/121 (1%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLT-GSLPREIGNLKKLYNLILVGCGFFG 506
           + +S    TG     I  L++L+ L+ + N +L   +LP  +  L KL +++L+ C   G
Sbjct: 150 IDMSWNHFTGSFPLSIFNLTDLEYLNFNENPELDLWTLPDSVSKLTKLTHMLLMTCMLHG 209

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADN-QLTGSIPVSDGNTPG 683
            IP SIG                G IP  +G LS L  L+L  N  LTGSIP   GN   
Sbjct: 210 NIPRSIGNLTSLVDLELSGNFLSGEIPKEIGNLSNLRQLELYYNYHLTGSIPEEIGNLKN 269

Query: 684 L 686
           L
Sbjct: 270 L 270



 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 48/151 (31%), Positives = 69/151 (45%), Gaps = 2/151 (1%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +  L +SS+ L G L  D  ++  L+++D+S+N   TGS P  I NL  L  L   
Sbjct: 120 NCSLLRDLNMSSVYLKGTLP-DFSQMKSLRVIDMSWNH-FTGSFPLSIFNLTDLEYLNFN 177

Query: 489 GCGFFGL--IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPV 662
                 L  +PDS+                 G IP S+G L+ L  L+L+ N L+G IP 
Sbjct: 178 ENPELDLWTLPDSVSKLTKLTHMLLMTCMLHGNIPRSIGNLTSLVDLELSGNFLSGEIPK 237

Query: 663 SDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
             GN   L  L    ++H      +G IP +
Sbjct: 238 EIGNLSNLRQLELYYNYH-----LTGSIPEE 263



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 37/119 (31%), Positives = 58/119 (48%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N   +  L + S  ++G +  ++   + L  LDLS N  L+G +P E+G L+KL  L+L 
Sbjct: 434 NAWNLSELFMQSNRISGVIPHELSHSTNLVKLDLS-NNQLSGPIPSEVGRLRKLNLLVLQ 492

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
           G      IPDS+                 G IP +L +L     ++ + N+L+G IPVS
Sbjct: 493 GNHLDSSIPDSLSNLKSLNVLDLSSNLLTGRIPENLSELLPTS-INFSSNRLSGPIPVS 550



>gb:AC091787_1735101 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0087G11 map MAP_LOC, complete
           sequence.
          Length = 753

 Score = 82.4 bits (202), Expect = 8e-15
 Identities = 61/195 (31%), Positives = 88/195 (45%), Gaps = 3/195 (1%)
 Frame = +3

Query: 171 FLGIVAFTDNNDYVAIKALRDGWKNVPP--SW-AEGSDPCGDHWEGVGCNGSRVVSLTLS 341
           FLG+ A T ++D  A+        +     +W A+  DPCG  W G+ C+GSRV+++ L 
Sbjct: 35  FLGVTADTSSDDVTALNTFYTSLNSPSQLTNWVAQNGDPCGQSWLGITCSGSRVITIKLP 94

Query: 342 SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS 521
            M L G L  ++  ++ L  LD S N    G +P  +     L  L L    F G +P S
Sbjct: 95  GMGLKGTLGYNMNVMTALVELDASNNNLGGGDIPYNLP--PNLERLNLENNSFTGTLPYS 152

Query: 522 IGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVG 701
           I                +  I     QL+ L  LDL+DN  +G++P S  N   L ML  
Sbjct: 153 ISQMASLKYLNLGHNQ-LSSINVMFNQLTNLATLDLSDNTFSGTLPDSFSNLTSLTML-- 209

Query: 702 TKHFHFGXNKFSGEI 746
               H   N+F+G I
Sbjct: 210 ----HLQDNRFTGTI 220



>gb:AY102147_1577752 Arabidopsis thaliana At1g68400/T2E12_5 mRNA,
           complete cds.>gb:AF378890_1793475 Arabidopsis thaliana
           At1g68400/T2E12_5 mRNA, complete cds.
          Length = 671

 Score = 82.4 bits (202), Expect = 8e-15
 Identities = 64/201 (31%), Positives = 92/201 (45%)
 Frame = +3

Query: 147 LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVV 326
           LL+ L    L   + TD+   +  K   D    +  SW   ++PC   W GV CN +RV 
Sbjct: 15  LLILLQSCLLSSSSSTDSETLLNFKLTADSTGKLN-SWNTTTNPC--QWTGVSCNRNRVT 71

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
            L L  ++LTG +S  +  L+ L++L L +N +L+G +P  + NL  L  L L    F G
Sbjct: 72  RLVLEDINLTGSIS-SLTSLTSLRVLSLKHN-NLSGPIP-NLSNLTALKLLFLSNNQFSG 128

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
             P SI               F G IPP L  L+ L  L L  N+ +G IP  +      
Sbjct: 129 NFPTSITSLTRLYRLDLSFNNFSGQIPPDLTDLTHLLTLRLESNRFSGQIPNIN------ 182

Query: 687 DMLVGTKHFHFGXNKFSGEIP 749
             L   + F+   N F+G+IP
Sbjct: 183 --LSDLQDFNVSGNNFNGQIP 201



>gb:AC016163_1538126 Arabidopsis thaliana chromosome 1 BAC F26A9
           genomic sequence, complete sequence.
          Length = 846

 Score = 82.4 bits (202), Expect = 8e-15
 Identities = 56/147 (38%), Positives = 69/147 (46%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +  + L      GE+   I  L++L+ L L+ N  LTG +P  +GNL +L NL L 
Sbjct: 131 NLSHLTLVNLYFNKFVGEIPASIGNLNQLRHLILA-NNVLTGEIPSSLGNLSRLVNLELF 189

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IPDSIG               IG IP SLG LS L  L L  NQL G +P S 
Sbjct: 190 SNRLVGKIPDSIGDLKQLRNLSLASNNLIGEIPSSLGNLSNLVHLVLTHNQLVGEVPASI 249

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           GN      L+  +   F  N  SG IP
Sbjct: 250 GN------LIELRVMSFENNSLSGNIP 270



 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 51/165 (30%), Positives = 75/165 (45%), Gaps = 18/165 (10%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N +++  L L++  LTGE+   +  LS L  L+L  N+ L G +P  IG+LK+L NL L 
Sbjct: 155 NLNQLRHLILANNVLTGEIPSSLGNLSRLVNLELFSNR-LVGKIPDSIGDLKQLRNLSLA 213

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP S+G               +G +P S+G L EL  +   +N L+G+IP+S 
Sbjct: 214 SNNLIGEIPSSLGNLSNLVHLVLTHNQLVGEVPASIGNLIELRVMSFENNSLSGNIPISF 273

Query: 669 GNTPGLDMLV------------------GTKHFHFGXNKFSGEIP 749
            N   L + V                    ++F    N FSG  P
Sbjct: 274 ANLTKLSIFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNSFSGPFP 318



 Score = 72.8 bits (177), Expect = 6e-12
 Identities = 58/169 (34%), Positives = 79/169 (46%), Gaps = 4/169 (2%)
 Frame = +3

Query: 258 WAEGSDPCGDHWEGVGCN--GSRVVSLTLSSMDLTGEL--SGDIEELSELQILDLSYNKD 425
           W + +D C   W GV CN    +V+SL + +  L   L  +  + +L  L+ LDL+ N +
Sbjct: 64  WNKSTDCC--LWNGVTCNDKSGQVISLDIPNTFLNNYLKTNSSLFKLQYLRHLDLT-NCN 120

Query: 426 LTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQL 605
           L G +P  +GNL  L  + L    F G IP SIG                G IP SLG L
Sbjct: 121 LYGEIPSSLGNLSHLTLVNLYFNKFVGEIPASIGNLNQLRHLILANNVLTGEIPSSLGNL 180

Query: 606 SELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           S L  L+L  N+L G IP S G+   L      ++     N   GEIP+
Sbjct: 181 SRLVNLELFSNRLVGKIPDSIGDLKQL------RNLSLASNNLIGEIPS 223



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 44/147 (29%), Positives = 61/147 (41%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +V L L+   L GE+   I  L EL+++    N  L+G++P    NL KL   +L 
Sbjct: 227 NLSNLVHLVLTHNQLVGEVPASIGNLIELRVMSFE-NNSLSGNIPISFANLTKLSIFVLS 285

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
              F    P  +               F GP P SL  +  L  + L +NQ TG  P+  
Sbjct: 286 SNNFTSTFPFDMSIFHNLEYFDVSYNSFSGPFPKSLLLIPSLESIYLQENQFTG--PIEF 343

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            NT     L   +    G N+  G IP
Sbjct: 344 ANTSSSTKL---QDLILGRNRLHGPIP 367



 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 43/140 (30%), Positives = 63/140 (45%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L +S  + TG +   I +L  L  LDLS N +L G +P  +  L    N +++    F  
Sbjct: 379 LDISHNNFTGAIPPTISKLVNLLHLDLSKN-NLEGEVPACLWRL----NTMVLSHNSFSS 433

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
             ++                F GPIP  + +LS L +LDL++N  +GSIP    N  G  
Sbjct: 434 FENTSQEEALIEELDLNSNSFQGPIPYMICKLSSLGFLDLSNNLFSGSIPSCIRNFSG-- 491

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
                K  + G N FSG +P
Sbjct: 492 ---SIKELNLGDNNFSGTLP 508



 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 37/142 (26%), Positives = 55/142 (38%), Gaps = 25/142 (17%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREI------------ 452
           N +++    LSS + T     D+     L+  D+SYN   +G  P+ +            
Sbjct: 275 NLTKLSIFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNS-FSGPFPKSLLLIPSLESIYLQ 333

Query: 453 -------------GNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPS 593
                         +  KL +LIL      G IP+SI               F G IPP+
Sbjct: 334 ENQFTGPIEFANTSSSTKLQDLILGRNRLHGPIPESISRLLNLEELDISHNNFTGAIPPT 393

Query: 594 LGQLSELYWLDLADNQLTGSIP 659
           + +L  L  LDL+ N L G +P
Sbjct: 394 ISKLVNLLHLDLSKNNLEGEVP 415



 Score = 36.6 bits (83), Expect = 0.50
 Identities = 24/82 (29%), Positives = 35/82 (42%)
 Frame = +3

Query: 504 GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG 683
           G IP+S+G              F   IP  L  L++L  LD++ N+L+G IP        
Sbjct: 671 GNIPESLGYLKELRVLNLSGNAFTSVIPRFLANLTKLETLDISRNKLSGQIP------QD 724

Query: 684 LDMLVGTKHFHFGXNKFSGEIP 749
           L  L    + +F  N   G +P
Sbjct: 725 LAALSFLSYMNFSHNLLQGPVP 746



>gb:AB103395_1526454 Oryza sativa (japonica cultivar-group) MSP1
           mRNA for putative leucin-rich repeat protein kinase,
           complete cds.>gb:AP003451_1829652 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0413C03.
          Length = 1294

 Score = 82.4 bits (202), Expect = 8e-15
 Identities = 68/245 (27%), Positives = 95/245 (38%), Gaps = 46/245 (18%)
 Frame = +3

Query: 159 LFIQFLGIVAFTDNNDYVAIKALRDG---WKNVPPSWAEG-SDPCGDHWEGVGCNGSRVV 326
           L + F+ I A+ ++ D   +  LRD     K    +W +  + PC   W G+ C G  VV
Sbjct: 11  LLVSFIPISAWAESRDISTLFTLRDSITEGKGFLRNWFDSETPPCS--WSGITCIGHNVV 68

Query: 327 SLTLSSMDL------------------------TGELSGDIEELSELQILDLSYNKDLTG 434
           ++ LSS+ L                        +GEL   +  L  LQ LDLS N +LTG
Sbjct: 69  AIDLSSVPLYAPFPLCIGAFQSLVRLNFSGCGFSGELPEALGNLQNLQYLDLS-NNELTG 127

Query: 435 SLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSEL 614
            +P  + NLK L  ++L      G +  +I                 G +PP LG L  L
Sbjct: 128 PIPISLYNLKMLKEMVLDYNSLSGQLSPAIAQLQHLTKLSISMNSISGSLPPDLGSLKNL 187

Query: 615 YWLDLADNQLTGSIPVSDGNT------------------PGLDMLVGTKHFHFGXNKFSG 740
             LD+  N   GSIP + GN                   PG+  L          N F G
Sbjct: 188 ELLDIKMNTFNGSIPATFGNLSCLLHFDASQNNLTGSIFPGITSLTNLLTLDLSSNSFEG 247

Query: 741 EIPAQ 755
            IP +
Sbjct: 248 TIPRE 252



 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 48/147 (32%), Positives = 72/147 (48%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           + +++L LSS    G +  +I +L  L++L L  N DLTG +P+EIG+LK+L  L L  C
Sbjct: 233 TNLLTLDLSSNSFEGTIPREIGQLENLELLILGKN-DLTGRIPQEIGSLKQLKLLHLEEC 291

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
            F G IP SI               F   +P S+G+L  L  L   +  L+G++P   GN
Sbjct: 292 QFTGKIPWSISGLSSLTELDISDNNFDAELPSSMGELGNLTQLIAKNAGLSGNMPKELGN 351

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
              L ++      +   N   G IP +
Sbjct: 352 CKKLTVI------NLSFNALIGPIPEE 372



 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 45/142 (31%), Positives = 66/142 (46%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           + L    L+G+LS  I +L  L  L +S N  ++GSLP ++G+LK L  L +    F G 
Sbjct: 142 MVLDYNSLSGQLSPAIAQLQHLTKLSISMNS-ISGSLPPDLGSLKNLELLDIKMNTFNGS 200

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP + G                G I P +  L+ L  LDL+ N   G+IP   G    L+
Sbjct: 201 IPATFGNLSCLLHFDASQNNLTGSIFPGITSLTNLLTLDLSSNSFEGTIPREIGQLENLE 260

Query: 690 MLVGTKHFHFGXNKFSGEIPAQ 755
           +L+       G N  +G IP +
Sbjct: 261 LLI------LGKNDLTGRIPQE 276



 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 47/145 (32%), Positives = 66/145 (45%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +V+L LS     G L  ++ E   L  + LS N ++TG +P  IG L  L  L +     
Sbjct: 496 LVTLELSQNKFAGMLPAELWESKTLLEISLS-NNEITGPIPESIGKLSVLQRLHIDNNLL 554

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IP S+G                G IP +L    +L  LDL+ N LTG+IP +  +  
Sbjct: 555 EGPIPQSVGDLRNLTNLSLRGNRLSGIIPLALFNCRKLATLDLSYNNLTGNIPSAISHLT 614

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
            LD L+         N+ SG IPA+
Sbjct: 615 LLDSLI------LSSNQLSGSIPAE 633



 Score = 59.3 bits (142), Expect = 7e-08
 Identities = 45/127 (35%), Positives = 58/127 (45%), Gaps = 12/127 (9%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDI------------EELSELQILDLSYNKDLTGSLPREIGNLKKL 470
           SL LSS  L+G +  +I            E L    +LDLSYN+ LTG +P  I N   +
Sbjct: 618 SLILSSNQLSGSIPAEICVGFENEAHPDSEFLQHHGLLDLSYNQ-LTGQIPTSIKNCAMV 676

Query: 471 YNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTG 650
             L L G    G IP  +G              F+GP+ P  G L +L  L L++N L G
Sbjct: 677 MVLNLQGNLLNGTIPVELGELTNLTSINLSFNEFVGPMLPWSGPLVQLQGLILSNNHLDG 736

Query: 651 SIPVSDG 671
           SIP   G
Sbjct: 737 SIPAKIG 743



 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 38/145 (26%), Positives = 59/145 (40%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S +  L +S  +   EL   + EL  L  L ++ N  L+G++P+E+GN KK   L ++  
Sbjct: 305 SSLTELDISDNNFDAELPSSMGELGNLTQL-IAKNAGLSGNMPKELGNCKK---LTVINL 360

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
            F  L                     IGPIP     L  +    +  N+L+G +P     
Sbjct: 361 SFNAL---------------------IGPIPEEFADLEAIVSFFVEGNKLSGRVP----- 394

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIP 749
              +      +    G NKFSG +P
Sbjct: 395 -DWIQKWKNARSIRLGQNKFSGPLP 418



 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 46/181 (25%), Positives = 73/181 (40%), Gaps = 36/181 (19%)
 Frame = +3

Query: 321  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
            ++ ++LS+ ++TG +   I +LS LQ L +  N  L G +P+ +G+L+ L NL L G   
Sbjct: 520  LLEISLSNNEITGPIPESIGKLSVLQRLHIDNNL-LEGPIPQSVGDLRNLTNLSLRGNRL 578

Query: 501  FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELY--------------------- 617
             G+IP ++                 G IP ++  L+ L                      
Sbjct: 579  SGIIPLALFNCRKLATLDLSYNNLTGNIPSAISHLTLLDSLILSSNQLSGSIPAEICVGF 638

Query: 618  ---------------WLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
                            LDL+ NQLTG IP S  N   + +L      +   N  +G IP 
Sbjct: 639  ENEAHPDSEFLQHHGLLDLSYNQLTGQIPTSIKNCAMVMVL------NLQGNLLNGTIPV 692

Query: 753  Q 755
            +
Sbjct: 693  E 693



 Score = 43.5 bits (101), Expect = 0.004
 Identities = 38/127 (29%), Positives = 56/127 (44%), Gaps = 4/127 (3%)
 Frame = +3

Query: 318  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV--- 488
            ++  L LSS  LTG L   +   + L  LD+S N  L+G +     + K+  + +L    
Sbjct: 748  KIAVLDLSSNALTGTLPQSLLCNNYLNHLDVS-NNHLSGHIQFSCPDGKEYSSTLLFFNS 806

Query: 489  -GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                F G + +SI                 G +P +L  LS L +LDL+ N L G+IP  
Sbjct: 807  SSNHFSGSLDESISNFTQLSTLDIHNNSLTGRLPSALSDLSSLNYLDLSSNNLYGAIPCG 866

Query: 666  DGNTPGL 686
              N  GL
Sbjct: 867  ICNIFGL 873



 Score = 41.6 bits (96), Expect = 0.016
 Identities = 40/145 (27%), Positives = 59/145 (40%), Gaps = 5/145 (3%)
 Frame = +3

Query: 330  LTLSSMDLTGELSGDIEE-LSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
            L LS+  L G +   I + L ++ +LDLS N  LTG+LP+ +     L +L +      G
Sbjct: 727  LILSNNHLDGSIPAKIGQILPKIAVLDLSSNA-LTGTLPQSLLCNNYLNHLDVSNNHLSG 785

Query: 507  LI----PDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
             I    PD                 F G +  S+   ++L  LD+ +N LTG +P     
Sbjct: 786  HIQFSCPDGKEYSSTLLFFNSSSNHFSGSLDESISNFTQLSTLDIHNNSLTGRLP----- 840

Query: 675  TPGLDMLVGTKHFHFGXNKFSGEIP 749
               L  L    +     N   G IP
Sbjct: 841  -SALSDLSSLNYLDLSSNNLYGAIP 864



 Score = 32.3 bits (72), Expect = 9.5
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNL 461
           N +++ +L + +  LTG L   + +LS L  LDLS N +L G++P  I N+
Sbjct: 821 NFTQLSTLDIHNNSLTGRLPSALSDLSSLNYLDLSSN-NLYGAIPCGICNI 870



>pir|T07079|T07079 leucine-rich repeat protein LRP -
           tomato>gb:LELRPGENE_1684365 L.esculentum LRP gene.
          Length = 221

 Score = 82.4 bits (202), Expect = 8e-15
 Identities = 58/166 (34%), Positives = 85/166 (51%), Gaps = 5/166 (3%)
 Frame = +3

Query: 183 VAFTDNNDYVAIKALRDGWK---NVPPSWAEGS-DPCGDHWEGVGCNG-SRVVSLTLSSM 347
           VA   N++  A+ ALR       NV  SW     +PC   W  V CNG ++V  + L + 
Sbjct: 26  VAVKGNSEGDALYALRRSLSDPGNVLQSWDPNLVNPCT--WFHVTCNGDNQVTRVDLGNS 83

Query: 348 DLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG 527
            L+G L  ++ +L  LQ L+L Y  ++ G++P+E+GNLK L +L L      G IP S+G
Sbjct: 84  KLSGHLVPELGKLEHLQYLEL-YKNNIQGTIPKELGNLKSLISLDLYNNNISGTIPTSLG 142

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                           GPIP  L  +S L  +D+++N L G+IP S
Sbjct: 143 NLKNLVFLRLNDNKLTGPIPRELTSISSLKVVDVSNNDLCGTIPTS 188



>pir|H96707|H96707 probable receptor kinase T2E12.5 [imported] -
           Arabidopsis thaliana>gb:AE005173_894461 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC015986_1538060 Arabidopsis thaliana
           chromosome 1 BAC T2E12 genomic sequence, complete
           sequence.
          Length = 670

 Score = 82.4 bits (202), Expect = 8e-15
 Identities = 64/201 (31%), Positives = 92/201 (45%)
 Frame = +3

Query: 147 LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVV 326
           LL+ L    L   + TD+   +  K   D    +  SW   ++PC   W GV CN +RV 
Sbjct: 15  LLILLQSCLLSSSSSTDSETLLNFKLTADSTGKLN-SWNTTTNPC--QWTGVSCNRNRVT 71

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
            L L  ++LTG +S  +  L+ L++L L +N +L+G +P  + NL  L  L L    F G
Sbjct: 72  RLVLEDINLTGSIS-SLTSLTSLRVLSLKHN-NLSGPIP-NLSNLTALKLLFLSNNQFSG 128

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
             P SI               F G IPP L  L+ L  L L  N+ +G IP  +      
Sbjct: 129 NFPTSITSLTRLYRLDLSFNNFSGQIPPDLTDLTHLLTLRLESNRFSGQIPNIN------ 182

Query: 687 DMLVGTKHFHFGXNKFSGEIP 749
             L   + F+   N F+G+IP
Sbjct: 183 --LSDLQDFNVSGNNFNGQIP 201



>gb:AP005966_1860372 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:B1047H05.
          Length = 837

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 72/225 (32%), Positives = 103/225 (45%), Gaps = 18/225 (8%)
 Frame = +3

Query: 129 IPRIQLLLVPLFIQFLGIVAFT-----------DNNDYVAIKALR---DGWKNVPPSWA- 263
           IP +  +L+  F  FL I AF+           D  D+ A+  L+   +    V  SW  
Sbjct: 9   IPVLVTILLACFSFFL-ITAFSLVPTAPLHDASDTTDFQALLCLKLHLNDNAGVMASWRN 67

Query: 264 EGSDPCGDHWEGVGCNGS---RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTG 434
           + S  C   W GV C+ S   RV  L L S +L G++   I  L+ L I+ L +N+ LTG
Sbjct: 68  DSSQYC--QWPGVTCSKSHTSRVTELNLESSNLHGQIPPCIGNLTFLTIIHLPFNQ-LTG 124

Query: 435 SLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSEL 614
           ++P EIG+L++L  L L   G  G IP+++                 G IP S+ + S L
Sbjct: 125 NIPPEIGHLRRLTYLNLTSNGLTGTIPEALSSCSNLQIIDISNNSIDGEIPSSMNKCSNL 184

Query: 615 YWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
             + L DN+L G IP   G    L +L      +   N  SG IP
Sbjct: 185 QAICLFDNKLQGVIPEGLGTLSNLSVL------YLSNNNLSGNIP 223



 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 56/149 (37%), Positives = 71/149 (47%), Gaps = 4/149 (2%)
 Frame = +3

Query: 318 RVVSLTLSSMD---LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           ++ SLTL  M+   LTG L   +  L  L IL LS NK ++G +P   GNL  L  L L 
Sbjct: 520 KLTSLTLLYMEKNLLTGNLPDSLGNLLNLFILSLSQNK-ISGQIPTSFGNLSHLSELYLQ 578

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELY-WLDLADNQLTGSIPVS 665
                G IP S+G              F   IP  L  LS L  WLDL+ NQL G IP  
Sbjct: 579 ENNLSGPIPSSLGSCKNLEALNLSCNSFDSSIPEELVTLSSLSEWLDLSHNQLDGEIPSE 638

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            G +  LD+L      +   N+ SG+IP+
Sbjct: 639 IGGSINLDIL------NISNNRLSGQIPS 661



 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 46/148 (31%), Positives = 68/148 (45%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           C+  +++ ++ +S+D  GE+   + + S LQ + L  NK L G +P  +G L  L  L L
Sbjct: 157 CSNLQIIDISNNSID--GEIPSSMNKCSNLQAICLFDNK-LQGVIPEGLGTLSNLSVLYL 213

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                 G IP S+G                G IPP L   S L  LDL +N+L G IP +
Sbjct: 214 SNNNLSGNIPFSLGSNSFLNVVILTNNSLTGGIPPLLANSSSLILLDLTNNRLGGEIPFA 273

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
             N+  L+++          N F G IP
Sbjct: 274 LFNSSSLNLI------SLAVNNFVGSIP 295



 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 49/147 (33%), Positives = 69/147 (46%), Gaps = 1/147 (0%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELS-ELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           ++V L L    L G L   I +LS  LQ+L L+ N +++G++P+EI  L  L  L +   
Sbjct: 474 QLVQLCLDKNILKGTLPSSIAKLSTSLQVLLLTGN-EISGTIPQEIEKLTSLTLLYMEKN 532

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G +PDS+G                G IP S G LS L  L L +N L+G IP S G+
Sbjct: 533 LLTGNLPDSLGNLLNLFILSLSQNKISGQIPTSFGNLSHLSELYLQENNLSGPIPSSLGS 592

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
              L+ L      +   N F   IP +
Sbjct: 593 CKNLEAL------NLSCNSFDSSIPEE 613



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 48/153 (31%), Positives = 71/153 (46%)
 Frame = +3

Query: 294 EGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLY 473
           EG+G   +  V L LS+ +L+G +   +   S L ++ L+ N  LTG +P  + N   L 
Sbjct: 200 EGLGTLSNLSV-LYLSNNNLSGNIPFSLGSNSFLNVVILT-NNSLTGGIPPLLANSSSLI 257

Query: 474 NLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGS 653
            L L      G IP ++               F+G IPP     S L++L L+ N L+GS
Sbjct: 258 LLDLTNNRLGGEIPFALFNSSSLNLISLAVNNFVGSIPPISNISSPLWYLSLSQNNLSGS 317

Query: 654 IPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           IP S  N   L++L      +   N F G IP+
Sbjct: 318 IPSSIENLSSLEIL------YLSQNNFQGTIPS 344



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 46/130 (35%), Positives = 63/130 (48%), Gaps = 4/130 (3%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +  L LS  +  G +   +  +  LQ LDL+YN +L+G++P  + N+    NL+ +
Sbjct: 324 NLSSLEILYLSQNNFQGTIPSSLSRIPNLQELDLTYN-NLSGTVPASLYNMS---NLVYL 379

Query: 489 GCG---FFGLIPDSIGXXX-XXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSI 656
           G G     G IPD+IG               F G IP SLG    L  ++L DN   G I
Sbjct: 380 GMGTNKLIGEIPDNIGYTLPNIKTLILQGNQFQGQIPTSLGIAKNLQVINLRDNAFHGII 439

Query: 657 PVSDGNTPGL 686
           P S GN P L
Sbjct: 440 P-SFGNLPDL 448



>gb:AP002540_1822585 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0434B04.
          Length = 1020

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 50/152 (32%), Positives = 71/152 (46%)
 Frame = +3

Query: 300 VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL 479
           +G   + +  L L + +++G +  DI  L  L  LDL +N  L+G +P  IG L  L  +
Sbjct: 329 IGNLSTTLQMLNLDNNNISGSIPEDIGNLVGLSFLDLGFNSILSGVIPESIGKLTNLVEI 388

Query: 480 ILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
            L      GLIP S+G                GPIPPSLG L +L+ LDL+ N L GSIP
Sbjct: 389 SLYNTSLSGLIPASVGNLTNLNRIYAFYCNLEGPIPPSLGDLKKLFVLDLSYNHLNGSIP 448

Query: 660 VSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
                   L   +   +     N  SG +P++
Sbjct: 449 KEIFELQSLSWFLDLSY-----NSLSGPLPSE 475



 Score = 75.9 bits (185), Expect = 8e-13
 Identities = 57/142 (40%), Positives = 67/142 (47%), Gaps = 1/142 (0%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQ-ILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           L LS   L G +  +I EL  L   LDLSYN  L+G LP E+G+L  L  + L G    G
Sbjct: 436 LDLSYNHLNGSIPKEIFELQSLSWFLDLSYNS-LSGPLPSEVGSLVNLNGMDLSGNQLSG 494

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
            IPDSIG              F G IP SL  L  L  L+L  N+L+G IP +    P L
Sbjct: 495 QIPDSIGNCEVMEALYLEENSFEGGIPQSLSNLKGLTILNLTMNKLSGRIPNTIARIPNL 554

Query: 687 DMLVGTKHFHFGXNKFSGEIPA 752
             L          N FSG IPA
Sbjct: 555 QQL------FLAHNNFSGPIPA 570



 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 51/155 (32%), Positives = 67/155 (43%), Gaps = 5/155 (3%)
 Frame = +3

Query: 300 VGCNGSRVVSLTLSSMDLTGELSGDI-----EELSELQILDLSYNKDLTGSLPREIGNLK 464
           +  N S  +SLT+  +    +L G I       L  L+ L L  N  LTG +P  + NL 
Sbjct: 132 IPANLSSCISLTILRIQSNPQLGGRIPPELGNTLPRLKKLQLRKNS-LTGKIPASLANLS 190

Query: 465 KLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQL 644
            L +L L      GLIP  +G                G +P SL  LS L  L + +N L
Sbjct: 191 SLQHLSLSYNKLEGLIPPGLGDIAGLRYLFLNANNLSGELPLSLYNLSSLMMLQVGNNML 250

Query: 645 TGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            GSIP   G      ML G + F    N+F+G IP
Sbjct: 251 HGSIPSDIGR-----MLPGIQVFGLDVNRFTGVIP 280



 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 37/115 (32%), Positives = 61/115 (53%), Gaps = 4/115 (3%)
 Frame = +3

Query: 330 LTLSSMDLTG-ELSGDI-EELSELQILDLSYNKD--LTGSLPREIGNLKKLYNLILVGCG 497
           + L+ MDL+G +LSG I + +   ++++  Y ++    G +P+ + NLK L  L L    
Sbjct: 480 VNLNGMDLSGNQLSGQIPDSIGNCEVMEALYLEENSFEGGIPQSLSNLKGLTILNLTMNK 539

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPV 662
             G IP++I               F GPIP +L  L+ L+ LD++ N+L G +PV
Sbjct: 540 LSGRIPNTIARIPNLQQLFLAHNNFSGPIPATLQNLTTLWQLDVSFNKLQGEVPV 594



 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 47/144 (32%), Positives = 69/144 (47%), Gaps = 4/144 (2%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG---F 500
           L L++ +L+GEL   +  LS L +L +  N  L GS+P +IG +  L  + + G     F
Sbjct: 219 LFLNANNLSGELPLSLYNLSSLMMLQVGNNM-LHGSIPSDIGRM--LPGIQVFGLDVNRF 275

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN-T 677
            G+IP S+               F G +PP+LG  S+L    LA+N  +G +P   GN +
Sbjct: 276 TGVIPHSLSNLSTLTDLYLSDNKFTGFVPPNLG--SQLQEFVLANNSFSGQLPRPIGNLS 333

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIP 749
             L ML      +   N  SG IP
Sbjct: 334 TTLQML------NLDNNNISGSIP 351



 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 62/214 (28%), Positives = 83/214 (38%), Gaps = 6/214 (2%)
 Frame = +3

Query: 129 IPRIQLLLVPLFIQF-LGIVAFTDNNDYVAIKA-LRDGWKNVPPSWAEGSDPCGDHWEGV 302
           I R++L L  L +   +G    +D    +A+KA L     +   SW   +  CG  WEGV
Sbjct: 3   IRRMRLALSLLCVLMTIGTGTASDEPALLALKAGLSGSSSSALASWNTSASFCG--WEGV 60

Query: 303 GCNG---SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLY 473
            C+    +RV +L L S                          +LTG+LP  +GNL  L 
Sbjct: 61  TCSHRWPTRVAALDLPS-------------------------SNLTGTLPPAVGNLTFLR 95

Query: 474 NLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADN-QLTG 650
            L L      G IP ++G                G IP +L     L  L +  N QL G
Sbjct: 96  RLNLSSNQLHGEIPPAVGRLRRLLVLDMDHNSISGVIPANLSSCISLTILRIQSNPQLGG 155

Query: 651 SIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            IP   GNT     L   K      N  +G+IPA
Sbjct: 156 RIPPELGNT-----LPRLKKLQLRKNSLTGKIPA 184



>gb:AF053994_1764488 Lycopersicon esculentum Hcr2-0A (Hcr2-0A) gene,
           complete cds.
          Length = 826

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 66/219 (30%), Positives = 95/219 (43%), Gaps = 29/219 (13%)
 Frame = +3

Query: 183 VAFTDNNDYVAIKALRDGWKN----VPPSWAEGSDPCGDHWEGVGCNGSRVVSLT----- 335
           V F    +  A+   +  +KN    +  SW + S+ C D W GV C   RV +L      
Sbjct: 23  VTFASTEEATALLKWKATFKNQDNSLLASWTQSSNACRD-WYGVICFNGRVKTLNITNCG 81

Query: 336 --------------------LSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIG 455
                               LS+ +++G +  +I  L+ L  LDL+ N  ++G++P + G
Sbjct: 82  VIGTLYAFPFSSLPFLENLNLSNNNISGTIPPEIGNLTNLVYLDLN-NNQISGTIPPQTG 140

Query: 456 NLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLAD 635
           +L KL  L + G    G IP+ IG                G IP SLG L+ L +L L D
Sbjct: 141 SLSKLQILRIFGNHLKGSIPEEIGYLRSLTDLSLSTNFLNGSIPASLGNLNNLSFLSLYD 200

Query: 636 NQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           NQL+GSIP   G    L  L      +   N  +G IPA
Sbjct: 201 NQLSGSIPEEIGYLRSLTDL------YLSTNFLNGSIPA 233



 Score = 66.2 bits (160), Expect = 6e-10
 Identities = 51/142 (35%), Positives = 63/142 (44%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L+L    L+G +  +I  L  L  L LS N  L GS+P  +GNL  L  L L      G 
Sbjct: 196 LSLYDNQLSGSIPEEIGYLRSLTDLYLSTNF-LNGSIPASLGNLNNLSFLSLYDNKLSGS 254

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IPD IG                G IP SL  L  L +L L++NQL+GSIP   G    L 
Sbjct: 255 IPDEIGYLTSLTDLYLNNNFLNGSIPASLWNLKNLSFLSLSENQLSGSIPQEIGYLRSLT 314

Query: 690 MLVGTKHFHFGXNKFSGEIPAQ 755
            L      H   N  +G IP +
Sbjct: 315 NL------HLNNNFLNGSIPPE 330



 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 50/146 (34%), Positives = 64/146 (43%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S++  L +    L G +  +I  L  L  L LS N  L GS+P  +GNL  L  L L   
Sbjct: 143 SKLQILRIFGNHLKGSIPEEIGYLRSLTDLSLSTNF-LNGSIPASLGNLNNLSFLSLYDN 201

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G IP+ IG                G IP SLG L+ L +L L DN+L+GSIP   G 
Sbjct: 202 QLSGSIPEEIGYLRSLTDLYLSTNFLNGSIPASLGNLNNLSFLSLYDNKLSGSIPDEIG- 260

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIPA 752
                 L      +   N  +G IPA
Sbjct: 261 -----YLTSLTDLYLNNNFLNGSIPA 281



 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 47/143 (32%), Positives = 65/143 (45%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +  L L++  L G +   +  L  L  L LS N+ L+GS+P+EIG L+ L NL L     
Sbjct: 265 LTDLYLNNNFLNGSIPASLWNLKNLSFLSLSENQ-LSGSIPQEIGYLRSLTNLHLNNNFL 323

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IP  IG                G IP SLG L  +  + L +N LT  IP+S  N  
Sbjct: 324 NGSIPPEIGNLWSLSIIDLSINSLKGSIPASLGNLRNVQSMFLDENNLTEEIPLSVCNLT 383

Query: 681 GLDMLVGTKHFHFGXNKFSGEIP 749
            L +L      +   N   G++P
Sbjct: 384 SLKIL------YLRRNNLKGKVP 400



 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 48/140 (34%), Positives = 61/140 (43%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L+L    L+G +  +I  L+ L  L L+ N  L GS+P  + NLK L  L L      G 
Sbjct: 244 LSLYDNKLSGSIPDEIGYLTSLTDLYLN-NNFLNGSIPASLWNLKNLSFLSLSENQLSGS 302

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP  IG                G IPP +G L  L  +DL+ N L GSIP S GN     
Sbjct: 303 IPQEIGYLRSLTNLHLNNNFLNGSIPPEIGNLWSLSIIDLSINSLKGSIPASLGN----- 357

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
            L   +      N  + EIP
Sbjct: 358 -LRNVQSMFLDENNLTEEIP 376



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 42/144 (29%), Positives = 62/144 (43%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +  LT+S  +L+G +   I  L  LQILDL  N  L G++P+  GN+  L    + 
Sbjct: 405 NISGLQVLTMSRNNLSGVIPSSISNLRSLQILDLGRN-SLEGAIPQCFGNINTLQVFDVQ 463

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G +  +                  G IP SL    +L  LDL +N L  + P+  
Sbjct: 464 NNKLSGTLSTNFSIGSSLISLNLHGNELEGEIPRSLANCKKLQVLDLGNNHLNDTFPMWL 523

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSG 740
           G    L +L  T +  +G  + SG
Sbjct: 524 GTLLELRVLRLTSNKLYGPIRSSG 547



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 46/166 (27%), Positives = 65/166 (39%), Gaps = 24/166 (14%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG--- 491
           + +L L++  L G +  +I  L  L I+DLS N  L GS+P  +GNL+ + ++ L     
Sbjct: 313 LTNLHLNNNFLNGSIPPEIGNLWSLSIIDLSINS-LKGSIPASLGNLRNVQSMFLDENNL 371

Query: 492 --------CGFFGL-------------IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLS 608
                   C    L             +P  +G                G IP S+  L 
Sbjct: 372 TEEIPLSVCNLTSLKILYLRRNNLKGKVPQCLGNISGLQVLTMSRNNLSGVIPSSISNLR 431

Query: 609 ELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEI 746
            L  LDL  N L G+IP   GN   L +      F    NK SG +
Sbjct: 432 SLQILDLGRNSLEGAIPQCFGNINTLQV------FDVQNNKLSGTL 471



 Score = 49.3 bits (116), Expect = 8e-05
 Identities = 41/138 (29%), Positives = 61/138 (44%), Gaps = 1/138 (0%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           CN + +  L L   +L G++   +  +S LQ+L +S N +L+G +P  I NL+ L  L L
Sbjct: 380 CNLTSLKILYLRRNNLKGKVPQCLGNISGLQVLTMSRN-NLSGVIPSSISNLRSLQILDL 438

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                 G IP   G                G +  +    S L  L+L  N+L G IP S
Sbjct: 439 GRNSLEGAIPQCFGNINTLQVFDVQNNKLSGTLSTNFSIGSSLISLNLHGNELEGEIPRS 498

Query: 666 DGNTPGLDML-VGTKHFH 716
             N   L +L +G  H +
Sbjct: 499 LANCKKLQVLDLGNNHLN 516



 Score = 42.4 bits (98), Expect = 0.009
 Identities = 29/75 (38%), Positives = 36/75 (48%), Gaps = 1/75 (1%)
 Frame = +3

Query: 438 LPREIGNLKKLYNLI-LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSEL 614
           L  E+  +  LY +I L    F G IP  +G                G IPPSLG LS +
Sbjct: 609 LKLEVVRILSLYTVIDLSNNKFEGHIPSVLGDLIALRVLNMSHNGLKGHIPPSLGSLSVV 668

Query: 615 YWLDLADNQLTGSIP 659
             LDL+ NQL+G IP
Sbjct: 669 ESLDLSFNQLSGEIP 683



 Score = 32.3 bits (72), Expect = 9.5
 Identities = 21/62 (33%), Positives = 34/62 (54%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L +S   L G +   +  LS ++ LDLS+N+ L+G +P+++ +L  L  L L      G 
Sbjct: 647 LNMSHNGLKGHIPPSLGSLSVVESLDLSFNQ-LSGEIPQQLASLTSLGFLNLSHNYLQGC 705

Query: 510 IP 515
           IP
Sbjct: 706 IP 707



>gb:ZMA400870_1731518 Zea mays partial mRNA for somatic
           embryogenesis receptor-like kinase 3, (serk3 gene).
          Length = 541

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 62/188 (32%), Positives = 90/188 (47%), Gaps = 12/188 (6%)
 Frame = +3

Query: 180 IVAFTDNNDYVAIKALRDGWKNVPPSWAEGS-DPCGDHWEGVGCNGSR-VVSLTLSSMDL 353
           +VA T+ +   +++       NV  SW     +PC   W  V CN    V+ + L +  L
Sbjct: 2   VVANTEGDALYSLRQSLIDTNNVLQSWDSTLVNPCT--WFHVTCNSDNSVIRVDLGNAQL 59

Query: 354 TGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXX 533
           +G L   + +L  LQ L+L  NK ++G++P E+GNL  L +L L    F G IPDS+G  
Sbjct: 60  SGVLVPQLGQLKNLQYLELYSNK-ISGAIPPELGNLTNLVSLDLYMDNFSGNIPDSLGNL 118

Query: 534 XXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSI----------PVSDGNTPG 683
                        +GPIP +L  +S L  LDL+ N L+G +          P+S  N P 
Sbjct: 119 LKLRFLRLNNNSLVGPIPVALTNISTLQVLDLSSNNLSGPVSSNGSFSLFTPISFNNNPN 178

Query: 684 LDMLVGTK 707
           L   V TK
Sbjct: 179 LCGPVTTK 186



>gb:AB120627_1527973 Populus nigra PnLRK1 mRNA for leucine-rich
           repeat receptor-like protein kinase 1, complete cds.
          Length = 856

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 55/159 (34%), Positives = 80/159 (50%), Gaps = 4/159 (2%)
 Frame = +3

Query: 291 WEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKL 470
           W+  G N   + SL LS+ ++TGE+  +I + + LQ++DLS N  L G++P+E+G LK L
Sbjct: 256 WKWGGFNN--LTSLKLSNNNITGEIPSEIAKATGLQMIDLSSNL-LKGTIPKELGKLKAL 312

Query: 471 YNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTG 650
           YNL L     FG++P  I                 G IP  LG+ S L  L+L+ N+  G
Sbjct: 313 YNLTLHNNHLFGVVPFEIQMLSQLRALNLASNNLGGSIPKQLGECSNLLQLNLSHNKFIG 372

Query: 651 SIPVSDGNTPGLDMLVGTKHF----HFGXNKFSGEIPAQ 755
           SIP            +G  HF        N  +GEIP++
Sbjct: 373 SIPSE----------IGFLHFLGDLDLSGNLLAGEIPSE 401



 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 47/141 (33%), Positives = 70/141 (49%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           +LTL +  L G +  +I+ LS+L+ L+L+ N +L GS+P+++G    L  L L    F G
Sbjct: 314 NLTLHNNHLFGVVPFEIQMLSQLRALNLASN-NLGGSIPKQLGECSNLLQLNLSHNKFIG 372

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
            IP  IG                G IP  +GQL +L  ++L+ N+L+G IP     T  +
Sbjct: 373 SIPSEIGFLHFLGDLDLSGNLLAGEIPSEIGQLKQLETMNLSHNKLSGLIP-----TAFV 427

Query: 687 DMLVGTKHFHFGXNKFSGEIP 749
           D LV         N+  G IP
Sbjct: 428 D-LVSLTTVDISYNELEGPIP 447



 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 58/216 (26%), Positives = 85/216 (39%), Gaps = 44/216 (20%)
 Frame = +3

Query: 240 KNVPPSWAEGSDPCGDHWEGVGCNGS--------------------------RVVSLTLS 341
           ++V  SW  GS PC   W G+ C+ S                           +++  L 
Sbjct: 70  QSVLSSWV-GSSPC--KWLGITCDNSGSVANFSLPHFGLRGTLHSFNFSSFPNLLTPNLR 126

Query: 342 SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS 521
           +  L G +   I  L+++  L+L +N    GSLP E+ NL  L  L L    F G +P  
Sbjct: 127 NNSLYGTIPSHISNLTKITNLNLCHNH-FNGSLPPEMNNLTHLMVLHLFSNNFTGHLPRD 185

Query: 522 IGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM--- 692
           +               F GPIP SL   + L+ + L  NQLTG+I    G  P L+    
Sbjct: 186 LCLGGLLVNFTASYNHFSGPIPKSLRNCTSLFRVRLDWNQLTGNISEDFGLYPNLNYVDL 245

Query: 693 ----LVGTKHFHFG-----------XNKFSGEIPAQ 755
               L G   + +G            N  +GEIP++
Sbjct: 246 SHNNLYGELTWKWGGFNNLTSLKLSNNNITGEIPSE 281



 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 42/119 (35%), Positives = 59/119 (49%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S++ +L L+S +L G +   + E S L  L+LS+NK + GS+P EIG L  L +L L G 
Sbjct: 334 SQLRALNLASNNLGGSIPKQLGECSNLLQLNLSHNKFI-GSIPSEIGFLHFLGDLDLSGN 392

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG 671
              G IP  IG                G IP +   L  L  +D++ N+L G IP   G
Sbjct: 393 LLAGEIPSEIGQLKQLETMNLSHNKLSGLIPTAFVDLVSLTTVDISYNELEGPIPKIKG 451



>gb:AB010073_1510938 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MFB13.>gb:AY128350_1580649 Arabidopsis thaliana
           Cf-5 disease resistance protein-like (At5g61240) mRNA,
           complete cds.>gb:BT000004_1634282 Arabidopsis thaliana
           Cf-5 disease resistance protein-like (At5g61240) mRNA,
           complete cds.
          Length = 326

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 79/242 (32%), Positives = 107/242 (44%), Gaps = 32/242 (13%)
 Frame = +3

Query: 126 MIPRIQLLLVPLFIQFLGIV-AFTDNNDYVAIKALRD--GWKNVPPSWAEGSDPCGDH-- 290
           M  R +LLL+ +F   +    + T   D  A+  ++   GW+ V  SW  G DPCGD   
Sbjct: 1   MASRCELLLICVFSLLIAFAHSKTLKRDVKALNEIKASLGWR-VVYSWV-GDDPCGDGDL 58

Query: 291 --WEGVGCNGS---RVVS-LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREI 452
             W GV C+     RVV+ L + ++ + G     +  L +L  LDL  NK LTG +P +I
Sbjct: 59  PPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNLLDLTRLDLHNNK-LTGPIPPQI 117

Query: 453 GNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLA 632
           G LK+L  L L       +IP  IG              F G IP  L  L EL +L L 
Sbjct: 118 GRLKRLKVLNLRWNKLQDVIPPEIGELKRLTHLYLSFNSFKGEIPKELAALPELRYLYLQ 177

Query: 633 DNQLTGSIPVSDGNTPGL-------DMLVGT--------------KHFHFGXNKFSGEIP 749
           +N+L G IP   G    L       + LVGT              ++ +   N  SG IP
Sbjct: 178 ENRLIGRIPAELGTLQNLRHLDVGNNHLVGTIRELIRFDGSFPALRNLYLNNNYLSGGIP 237

Query: 750 AQ 755
           AQ
Sbjct: 238 AQ 239



>gb:AP006064_1860783 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OSJNBa0023I13.
          Length = 768

 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 50/148 (33%), Positives = 76/148 (51%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           CN +++  L L+   LTGE+  +I  L+ LQ L+L+ N  LTG +P  +GNL  L  + L
Sbjct: 233 CNTTKLKYLRLAKNKLTGEIPAEIGRLASLQALELADNF-LTGPIPNSVGNLTDLLVMDL 291

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
              GF G+IP  I                 G +P S+  L  LY LDL++N+ +G+IP  
Sbjct: 292 FSNGFTGVIPPEIFNLTALRTIDVGTNRLEGEVPASISSLRNLYGLDLSNNRFSGTIPSD 351

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            G+   + +++ +       N FSGE P
Sbjct: 352 FGSRQFVTIVLAS-------NSFSGEFP 372



 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 48/151 (31%), Positives = 69/151 (45%), Gaps = 3/151 (1%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N   +    + +  +TG +   I   ++L+ L L+ NK LTG +P EIG L  L  L L 
Sbjct: 210 NWVELTQFRVQNNSITGSIPPTICNTTKLKYLRLAKNK-LTGEIPAEIGRLASLQALELA 268

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP+S+G              F G IPP +  L+ L  +D+  N+L G +P S 
Sbjct: 269 DNFLTGPIPNSVGNLTDLLVMDLFSNGFTGVIPPEIFNLTALRTIDVGTNRLEGEVPASI 328

Query: 669 G---NTPGLDMLVGTKHFHFGXNKFSGEIPA 752
               N  GLD+           N+FSG IP+
Sbjct: 329 SSLRNLYGLDL---------SNNRFSGTIPS 350



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 51/148 (34%), Positives = 59/148 (39%), Gaps = 25/148 (16%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNK--------------------- 422
           C    +  L LS+  L GE+   +  L +L  +DLSYN                      
Sbjct: 376 CQLDSLEILDLSNNHLHGEIPSCLWHLQDLVFMDLSYNSFSGEVPPMSAYPNSSLESVHL 435

Query: 423 ---DLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXX-XXXXXXXXXXXFIGPIPP 590
              +LTG  P  +   K L  L L G  F G IP  IG               F G IP 
Sbjct: 436 ANNNLTGGYPMVLKGCKWLIILDLGGNHFTGTIPSWIGTCNPLLRFLILRSNVFNGSIPK 495

Query: 591 SLGQLSELYWLDLADNQLTGSIPVSDGN 674
            L QLS L  LDLA N L GSIP S GN
Sbjct: 496 ELSQLSHLQLLDLAMNNLVGSIPRSFGN 523



 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 51/194 (26%), Positives = 75/194 (38%), Gaps = 29/194 (14%)
 Frame = +3

Query: 258  WAEGSDPCGDHWEG-----VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNK 422
            W    D  G+H+ G     +G     +  L L S    G +  ++ +LS LQ+LDL+ N 
Sbjct: 453  WLIILDLGGNHFTGTIPSWIGTCNPLLRFLILRSNVFNGSIPKELSQLSHLQLLDLAMN- 511

Query: 423  DLTGSLPREIGNLK-------------KLYNLIL-----------VGCGFFGLIPDSIGX 530
            +L GS+PR  GN               K+ + IL           +G  +        G 
Sbjct: 512  NLVGSIPRSFGNFTSMIQPKTELNLPWKVQHHILDGRVDYTYTDRIGINWKRQNQTFQGT 571

Query: 531  XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH 710
                             IP  L  L  + +L+L+ N L+G IP   GN   L+ L     
Sbjct: 572  VALMAGIDLSSNYLSNEIPSELCNLESMRFLNLSRNHLSGIIPKEIGNLKILESL----- 626

Query: 711  FHFGXNKFSGEIPA 752
              F  N+ SG IP+
Sbjct: 627  -DFSWNELSGSIPS 639



 Score = 44.7 bits (104), Expect = 0.002
 Identities = 34/113 (30%), Positives = 52/113 (46%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +  + LSS  L+ E+  ++  L  ++ L+LS N  L+G +P+EIGNLK L +L       
Sbjct: 575 MAGIDLSSNYLSNEIPSELCNLESMRFLNLSRNH-LSGIIPKEIGNLKILESL------- 626

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
                                    G IP S+  L  L  L+L++N L+G IP
Sbjct: 627 -----------------DFSWNELSGSIPSSISNLMSLSSLNLSNNHLSGEIP 662



 Score = 43.5 bits (101), Expect = 0.004
 Identities = 55/197 (27%), Positives = 73/197 (37%), Gaps = 32/197 (16%)
 Frame = +3

Query: 261 AEGSDPCGDHWEGVGCNGS-RVVSLTLSSMDLTGELSG-DIEELSELQILDLSYNKDLTG 434
           A  S  C   W GV C+ +  V  L+L    L GEL   D+     L  LDL  N    G
Sbjct: 66  ATSSSACSS-WRGVTCDAAGHVAELSLPGAGLHGELRALDLAAFPALAKLDLRRNNITAG 124

Query: 435 SLPREIGN-LKKLYNLILVGCGFFG----LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLG 599
            +   +      L  L L    F G    ++P S                  GPI  SL 
Sbjct: 125 VVAANVSTRASNLTYLDLSDNAFAGHILDVLPLSPATLQQLSYLNLSSNGLYGPILRSLS 184

Query: 600 QL------------------SELY--WLDLA-----DNQLTGSIPVSDGNTPGLDMLVGT 704
            +                  SEL+  W++L      +N +TGSIP +  NT  L      
Sbjct: 185 AMGKMTVFDVSRNRLNSDIPSELFTNWVELTQFRVQNNSITGSIPPTICNTTKL------ 238

Query: 705 KHFHFGXNKFSGEIPAQ 755
           K+     NK +GEIPA+
Sbjct: 239 KYLRLAKNKLTGEIPAE 255



 Score = 37.7 bits (86), Expect = 0.23
 Identities = 24/59 (40%), Positives = 30/59 (50%)
 Frame = +3

Query: 576 GPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           G IP  +G L  L  LD + N+L+GSIP S  N   L  L      +   N  SGEIP+
Sbjct: 611 GIIPKEIGNLKILESLDFSWNELSGSIPSSISNLMSLSSL------NLSNNHLSGEIPS 663



>gb:U42445_1726335 Lycopersicon pimpinellifolium leucine rich repeat
           protein Cf-2.2 gene, complete cds.
          Length = 1112

 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 66/157 (42%), Positives = 76/157 (48%), Gaps = 9/157 (5%)
 Frame = +3

Query: 309 NGSRVVSL----TLSSMDLTG-ELSGDIEE----LSELQILDLSYNKDLTGSLPREIGNL 461
           NGS   SL     LS + L G +LSG I E    L  L  LDLS N  L GS+P  +GNL
Sbjct: 228 NGSIPASLGNMNNLSFLFLYGNQLSGSIPEEICYLRSLTYLDLSENA-LNGSIPASLGNL 286

Query: 462 KKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQ 641
             L  L L G    G IP+ IG                G IP SLG L  L  L+L +NQ
Sbjct: 287 NNLSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQ 346

Query: 642 LTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           L+GSIP S GN   L ML      +   N+ SG IPA
Sbjct: 347 LSGSIPASLGNLNNLSML------YLYNNQLSGSIPA 377



 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 55/142 (38%), Positives = 68/142 (47%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L    L+G +  +I  L  L +L LS N  L GS+P  +GNLK L  L LV     G 
Sbjct: 292 LFLYGNQLSGSIPEEIGYLRSLNVLGLSENA-LNGSIPASLGNLKNLSRLNLVNNQLSGS 350

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S+G                G IP SLG L+ L  L L +NQL+GSIP S GN   L 
Sbjct: 351 IPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLS 410

Query: 690 MLVGTKHFHFGXNKFSGEIPAQ 755
            L      +   N+ SG IP +
Sbjct: 411 RL------YLYNNQLSGSIPEE 426



 Score = 73.2 bits (178), Expect = 5e-12
 Identities = 55/150 (36%), Positives = 77/150 (51%), Gaps = 1/150 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + +V L L++  ++G +   I  L++LQI+ + +N+ L G +P+EIG L+ L  L L 
Sbjct: 117 NLTNLVYLDLNNNQISGTIPPQIGLLAKLQIIRIFHNQ-LNGFIPKEIGYLRSLTKLSL- 174

Query: 489 GCGFF-GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
           G  F  G IP S+G                G IP  +  L  L  LDL+DN L GSIP S
Sbjct: 175 GINFLSGSIPASVGNLNNLSFLYLYNNQLSGSIPEEISYLRSLTELDLSDNALNGSIPAS 234

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            GN   L  L     F +G N+ SG IP +
Sbjct: 235 LGNMNNLSFL-----FLYG-NQLSGSIPEE 258



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 44/122 (36%), Positives = 59/122 (48%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L +  L+G +   +  L+ L +L L YN  L+GS+P  +GNL  L  L L      G 
Sbjct: 340 LNLVNNQLSGSIPASLGNLNNLSMLYL-YNNQLSGSIPASLGNLNNLSMLYLYNNQLSGS 398

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S+G                G IP  +G LS L +LDL++N + G IP S GN   L 
Sbjct: 399 IPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNNSINGFIPASFGNMSNLA 458

Query: 690 ML 695
            L
Sbjct: 459 FL 460



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 51/145 (35%), Positives = 68/145 (46%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +  L+L    L+G +   +  L+ L  L L YN  L+GS+P EI  L+ L  L L     
Sbjct: 169 LTKLSLGINFLSGSIPASVGNLNNLSFLYL-YNNQLSGSIPEEISYLRSLTELDLSDNAL 227

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IP S+G                G IP  +  L  L +LDL++N L GSIP S GN  
Sbjct: 228 NGSIPASLGNMNNLSFLFLYGNQLSGSIPEEICYLRSLTYLDLSENALNGSIPASLGNLN 287

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L  L     F +G N+ SG IP +
Sbjct: 288 NLSFL-----FLYG-NQLSGSIPEE 306



 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 50/141 (35%), Positives = 63/141 (44%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS   L G +      L+ L  L+L  N  L+GS+P EIG L+ L +L L      G 
Sbjct: 532 LDLSENALNGSIPASFGNLNNLSRLNL-VNNQLSGSIPEEIGYLRSLNDLGLSENALNGS 590

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S+G                G IP  +G LS L +L L +N L G IP S GN   L 
Sbjct: 591 IPASLGNLNNLSMLYLYNNQLSGSIPEEIGYLSSLTYLSLGNNSLNGLIPASFGNMRNLQ 650

Query: 690 MLVGTKHFHFGXNKFSGEIPA 752
            L+         N   GEIP+
Sbjct: 651 ALI------LNDNNLIGEIPS 665



 Score = 69.3 bits (168), Expect = 7e-11
 Identities = 50/141 (35%), Positives = 63/141 (44%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS   L G +   +  L+ L +L L YN  L+GS+P EIG L  L  L L      GL
Sbjct: 580 LGLSENALNGSIPASLGNLNNLSMLYL-YNNQLSGSIPEEIGYLSSLTYLSLGNNSLNGL 638

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S G               IG IP S+  L+ L  L +  N L G +P   GN   L 
Sbjct: 639 IPASFGNMRNLQALILNDNNLIGEIPSSVCNLTSLEVLYMPRNNLKGKVPQCLGNISNLQ 698

Query: 690 MLVGTKHFHFGXNKFSGEIPA 752
           +L          N FSGE+P+
Sbjct: 699 VL------SMSSNSFSGELPS 713



 Score = 69.3 bits (168), Expect = 7e-11
 Identities = 50/149 (33%), Positives = 66/149 (44%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + +  L L +  L+G +   +  L+ L  L L YN  L+GS+P EIG L  L  L L 
Sbjct: 381 NLNNLSMLYLYNNQLSGSIPASLGNLNNLSRLYL-YNNQLSGSIPEEIGYLSSLTYLDLS 439

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP S G                  +P  +G L  L  LDL++N L GSIP S 
Sbjct: 440 NNSINGFIPASFGNMSNLAFLFLYENQLASSVPEEIGYLRSLNVLDLSENALNGSIPASF 499

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           GN   L  L      +   N+ SG IP +
Sbjct: 500 GNLNNLSRL------NLVNNQLSGSIPEE 522



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 51/142 (35%), Positives = 63/142 (44%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS   L G +      L+ L  L+L  N  L+GS+P EIG L+ L  L L      G 
Sbjct: 484 LDLSENALNGSIPASFGNLNNLSRLNL-VNNQLSGSIPEEIGYLRSLNVLDLSENALNGS 542

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S G                G IP  +G L  L  L L++N L GSIP S GN   L 
Sbjct: 543 IPASFGNLNNLSRLNLVNNQLSGSIPEEIGYLRSLNDLGLSENALNGSIPASLGNLNNLS 602

Query: 690 MLVGTKHFHFGXNKFSGEIPAQ 755
           ML      +   N+ SG IP +
Sbjct: 603 ML------YLYNNQLSGSIPEE 618



 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 50/147 (34%), Positives = 63/147 (42%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S +  L LS+  + G +      +S L  L L Y   L  S+P EIG L+ L  L L   
Sbjct: 431 SSLTYLDLSNNSINGFIPASFGNMSNLAFLFL-YENQLASSVPEEIGYLRSLNVLDLSEN 489

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G IP S G                G IP  +G L  L  LDL++N L GSIP S GN
Sbjct: 490 ALNGSIPASFGNLNNLSRLNLVNNQLSGSIPEEIGYLRSLNVLDLSENALNGSIPASFGN 549

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
              L  L      +   N+ SG IP +
Sbjct: 550 LNNLSRL------NLVNNQLSGSIPEE 570



 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 61/199 (30%), Positives = 82/199 (41%), Gaps = 5/199 (2%)
 Frame = +3

Query: 171 FLGIVAFTDNNDYVAIKALRDGWKNVP----PSWAEGSDPCGDHWEGVGCNGSRVVSLTL 338
           +L  VAF    +  A+   +  +KN       SW   S+ C D W GV C   RV +L +
Sbjct: 19  YLFTVAFASTEEATALLKWKATFKNQNNSFLASWIPSSNACKD-WYGVVCFNGRVNTLNI 77

Query: 339 SSMDLTGELSG-DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIP 515
           ++  + G L       L  L+ LDLS N ++ G++P EIGNL  L  L L          
Sbjct: 78  TNASVIGTLYAFPFSSLPSLENLDLSKN-NIYGTIPPEIGNLTNLVYLDL---------- 126

Query: 516 DSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDML 695
                               G IPP +G L++L  + +  NQL G IP   G    L  L
Sbjct: 127 --------------NNNQISGTIPPQIGLLAKLQIIRIFHNQLNGFIPKEIGYLRSLTKL 172

Query: 696 VGTKHFHFGXNKFSGEIPA 752
                   G N  SG IPA
Sbjct: 173 ------SLGINFLSGSIPA 185



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 41/129 (31%), Positives = 58/129 (44%)
 Frame = +3

Query: 309  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
            N S +  L++SS   +GEL   I  L+ LQILD   N +L G++P+  GN+  L    + 
Sbjct: 693  NISNLQVLSMSSNSFSGELPSSISNLTSLQILDFGRN-NLEGAIPQCFGNISSLEVFDMQ 751

Query: 489  GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                 G +P +                    IP SL    +L  LDL DNQL  + P+  
Sbjct: 752  NNKLSGTLPTNFSIGCSLISLNLHGNELEDEIPRSLDNCKKLQVLDLGDNQLNDTFPMWL 811

Query: 669  GNTPGLDML 695
            G  P L +L
Sbjct: 812  GTLPELRVL 820



 Score = 43.5 bits (101), Expect = 0.004
 Identities = 36/130 (27%), Positives = 52/130 (40%)
 Frame = +3

Query: 306  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
            CN + +  L +   +L G++   +  +S LQ+L +S N   +G LP  I NL  L  L  
Sbjct: 668  CNLTSLEVLYMPRNNLKGKVPQCLGNISNLQVLSMSSN-SFSGELPSSISNLTSLQILDF 726

Query: 486  VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                  G IP   G                G +P +      L  L+L  N+L   IP S
Sbjct: 727  GRNNLEGAIPQCFGNISSLEVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELEDEIPRS 786

Query: 666  DGNTPGLDML 695
              N   L +L
Sbjct: 787  LDNCKKLQVL 796



 Score = 42.0 bits (97), Expect = 0.012
 Identities = 31/79 (39%), Positives = 37/79 (46%), Gaps = 1/79 (1%)
 Frame = +3

Query: 426  LTGSLPREIGNLKKLYNLI-LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQ 602
            +T  L  EI  +  LY +I L    F G IP  +G                G IP SLG 
Sbjct: 891  VTKGLELEIVRILSLYTVIDLSSNKFEGHIPSVLGDLIAIRILNVSHNALQGYIPSSLGS 950

Query: 603  LSELYWLDLADNQLTGSIP 659
            LS L  LDL+ NQL+G IP
Sbjct: 951  LSILESLDLSFNQLSGEIP 969



>gb:AY059776_1564626 Arabidopsis thaliana putative disease
           resistance Cf-2 (At4g13920) mRNA, complete
           cds.>gb:AY091445_1574645 Arabidopsis thaliana putative
           disease resistance Cf-2 protein (At4g13920) mRNA,
           complete cds.
          Length = 891

 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 63/175 (36%), Positives = 77/175 (44%), Gaps = 29/175 (16%)
 Frame = +3

Query: 258 WAEGSDPCGDHWEGVGCNGSR--VVSLTLSSMDLTGEL--SGDIEELSELQILDLSYNKD 425
           W   +D C   W G+ C+     VV L L + DL G L  +  +  L  LQ LDLSYN D
Sbjct: 60  WRNNTDCCS--WGGISCDPKTGVVVELDLGNSDLNGRLRSNSSLFRLQHLQSLDLSYN-D 116

Query: 426 LTGSLPREIGNLKKLYNLILVGCGFFGLIP-------------------------DSIGX 530
           L+ +LP   GN K L  L L+GC  FG IP                         DS+G 
Sbjct: 117 LSCTLPDSSGNFKYLRVLNLLGCNLFGEIPTSLRSLSYLTDLDLSYNDDLTGEILDSMGN 176

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDML 695
                        F G IP SLG L+ L  LDL+ N  TG +P S GN   L +L
Sbjct: 177 LKHLRVLSLTSCKFTGKIPSSLGNLTYLTDLDLSWNYFTGELPDSMGNLKSLRVL 231



 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 53/140 (37%), Positives = 66/140 (47%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L   +L GE+   +  LS L  LDLSYN DLTG +   +GNLK L  L L  C F G 
Sbjct: 134 LNLLGCNLFGEIPTSLRSLSYLTDLDLSYNDDLTGEILDSMGNLKHLRVLSLTSCKFTGK 193

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S+G              F G +P S+G L  L  L+L      G IP S G+   L 
Sbjct: 194 IPSSLGNLTYLTDLDLSWNYFTGELPDSMGNLKSLRVLNLHRCNFFGKIPTSLGSLSNLT 253

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
            L  +K      N+F+ E P
Sbjct: 254 DLDISK------NEFTSEGP 267



 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 52/154 (33%), Positives = 67/154 (43%), Gaps = 13/154 (8%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L+L+S   TG++   +  L+ L  LDLS+N   TG LP  +GNLK L  L L  C FFG 
Sbjct: 183 LSLTSCKFTGKIPSSLGNLTYLTDLDLSWNY-FTGELPDSMGNLKSLRVLNLHRCNFFGK 241

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLG-------------QLSELYWLDLADNQLTG 650
           IP S+G              F    P S+               LS L  +DL+ NQ   
Sbjct: 242 IPTSLGSLSNLTDLDISKNEFTSEGPDSMSSLNRLTDFQLMLLNLSSLTNVDLSSNQFKA 301

Query: 651 SIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            +P    N   L  L   + F    N FSG IP+
Sbjct: 302 MLP---SNMSSLSKL---EAFDISGNSFSGTIPS 329



 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 41/106 (38%), Positives = 54/106 (50%)
 Frame = +3

Query: 348 DLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG 527
           DLTGE+   +  L  L++L L+  K  TG +P  +GNL  L +L L    F G +PDS+G
Sbjct: 165 DLTGEILDSMGNLKHLRVLSLTSCK-FTGKIPSSLGNLTYLTDLDLSWNYFTGELPDSMG 223

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                         F G IP SLG LS L  LD++ N+ T   P S
Sbjct: 224 NLKSLRVLNLHRCNFFGKIPTSLGSLSNLTDLDISKNEFTSEGPDS 269



 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 38/105 (36%), Positives = 44/105 (41%), Gaps = 13/105 (12%)
 Frame = +3

Query: 474  NLILVGCGFF-------------GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSEL 614
            N+ LVG GF              G IP+SIG              F G IPPSL  LS L
Sbjct: 704  NMELVGSGFEIYKTIDVSGNRLEGDIPESIGILKELIVLNMSNNAFTGHIPPSLSNLSNL 763

Query: 615  YWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
              LDL+ N+L+GSIP   G       L      +F  N   G IP
Sbjct: 764  QSLDLSQNRLSGSIPGELGE------LTFLARMNFSYNMLEGPIP 802



>pir|T10504|T10504 disease resistance protein Cf-2.1 - currant
           tomato>gb:A57130_1449791 Sequence 1 from Patent
           WO9531564.>gb:U42444_1726334 Lycopersicon
           pimpinellifolium leucine rich repeat protein Cf-2.1
           gene, complete cds.
          Length = 1112

 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 66/157 (42%), Positives = 76/157 (48%), Gaps = 9/157 (5%)
 Frame = +3

Query: 309 NGSRVVSL----TLSSMDLTG-ELSGDIEE----LSELQILDLSYNKDLTGSLPREIGNL 461
           NGS   SL     LS + L G +LSG I E    L  L  LDLS N  L GS+P  +GNL
Sbjct: 228 NGSIPASLGNMNNLSFLFLYGNQLSGSIPEEICYLRSLTYLDLSENA-LNGSIPASLGNL 286

Query: 462 KKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQ 641
             L  L L G    G IP+ IG                G IP SLG L  L  L+L +NQ
Sbjct: 287 NNLSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQ 346

Query: 642 LTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           L+GSIP S GN   L ML      +   N+ SG IPA
Sbjct: 347 LSGSIPASLGNLNNLSML------YLYNNQLSGSIPA 377



 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 55/142 (38%), Positives = 68/142 (47%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L    L+G +  +I  L  L +L LS N  L GS+P  +GNLK L  L LV     G 
Sbjct: 292 LFLYGNQLSGSIPEEIGYLRSLNVLGLSENA-LNGSIPASLGNLKNLSRLNLVNNQLSGS 350

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S+G                G IP SLG L+ L  L L +NQL+GSIP S GN   L 
Sbjct: 351 IPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLS 410

Query: 690 MLVGTKHFHFGXNKFSGEIPAQ 755
            L      +   N+ SG IP +
Sbjct: 411 RL------YLYNNQLSGSIPEE 426



 Score = 73.2 bits (178), Expect = 5e-12
 Identities = 55/150 (36%), Positives = 77/150 (51%), Gaps = 1/150 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + +V L L++  ++G +   I  L++LQI+ + +N+ L G +P+EIG L+ L  L L 
Sbjct: 117 NLTNLVYLDLNNNQISGTIPPQIGLLAKLQIIRIFHNQ-LNGFIPKEIGYLRSLTKLSL- 174

Query: 489 GCGFF-GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
           G  F  G IP S+G                G IP  +  L  L  LDL+DN L GSIP S
Sbjct: 175 GINFLSGSIPASVGNLNNLSFLYLYNNQLSGSIPEEISYLRSLTELDLSDNALNGSIPAS 234

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            GN   L  L     F +G N+ SG IP +
Sbjct: 235 LGNMNNLSFL-----FLYG-NQLSGSIPEE 258



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 44/122 (36%), Positives = 59/122 (48%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L +  L+G +   +  L+ L +L L YN  L+GS+P  +GNL  L  L L      G 
Sbjct: 340 LNLVNNQLSGSIPASLGNLNNLSMLYL-YNNQLSGSIPASLGNLNNLSMLYLYNNQLSGS 398

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S+G                G IP  +G LS L +LDL++N + G IP S GN   L 
Sbjct: 399 IPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNNSINGFIPASFGNMSNLA 458

Query: 690 ML 695
            L
Sbjct: 459 FL 460



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 51/145 (35%), Positives = 68/145 (46%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +  L+L    L+G +   +  L+ L  L L YN  L+GS+P EI  L+ L  L L     
Sbjct: 169 LTKLSLGINFLSGSIPASVGNLNNLSFLYL-YNNQLSGSIPEEISYLRSLTELDLSDNAL 227

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IP S+G                G IP  +  L  L +LDL++N L GSIP S GN  
Sbjct: 228 NGSIPASLGNMNNLSFLFLYGNQLSGSIPEEICYLRSLTYLDLSENALNGSIPASLGNLN 287

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L  L     F +G N+ SG IP +
Sbjct: 288 NLSFL-----FLYG-NQLSGSIPEE 306



 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 50/141 (35%), Positives = 63/141 (44%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS   L G +      L+ L  L+L  N  L+GS+P EIG L+ L +L L      G 
Sbjct: 532 LDLSENALNGSIPASFGNLNNLSRLNL-VNNQLSGSIPEEIGYLRSLNDLGLSENALNGS 590

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S+G                G IP  +G LS L +L L +N L G IP S GN   L 
Sbjct: 591 IPASLGNLNNLSMLYLYNNQLSGSIPEEIGYLSSLTYLSLGNNSLNGLIPASFGNMRNLQ 650

Query: 690 MLVGTKHFHFGXNKFSGEIPA 752
            L+         N   GEIP+
Sbjct: 651 ALI------LNDNNLIGEIPS 665



 Score = 69.3 bits (168), Expect = 7e-11
 Identities = 50/141 (35%), Positives = 63/141 (44%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS   L G +   +  L+ L +L L YN  L+GS+P EIG L  L  L L      GL
Sbjct: 580 LGLSENALNGSIPASLGNLNNLSMLYL-YNNQLSGSIPEEIGYLSSLTYLSLGNNSLNGL 638

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S G               IG IP S+  L+ L  L +  N L G +P   GN   L 
Sbjct: 639 IPASFGNMRNLQALILNDNNLIGEIPSSVCNLTSLEVLYMPRNNLKGKVPQCLGNISNLQ 698

Query: 690 MLVGTKHFHFGXNKFSGEIPA 752
           +L          N FSGE+P+
Sbjct: 699 VL------SMSSNSFSGELPS 713



 Score = 69.3 bits (168), Expect = 7e-11
 Identities = 50/149 (33%), Positives = 66/149 (44%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + +  L L +  L+G +   +  L+ L  L L YN  L+GS+P EIG L  L  L L 
Sbjct: 381 NLNNLSMLYLYNNQLSGSIPASLGNLNNLSRLYL-YNNQLSGSIPEEIGYLSSLTYLDLS 439

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP S G                  +P  +G L  L  LDL++N L GSIP S 
Sbjct: 440 NNSINGFIPASFGNMSNLAFLFLYENQLASSVPEEIGYLRSLNVLDLSENALNGSIPASF 499

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           GN   L  L      +   N+ SG IP +
Sbjct: 500 GNLNNLSRL------NLVNNQLSGSIPEE 522



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 51/142 (35%), Positives = 63/142 (44%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS   L G +      L+ L  L+L  N  L+GS+P EIG L+ L  L L      G 
Sbjct: 484 LDLSENALNGSIPASFGNLNNLSRLNL-VNNQLSGSIPEEIGYLRSLNVLDLSENALNGS 542

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S G                G IP  +G L  L  L L++N L GSIP S GN   L 
Sbjct: 543 IPASFGNLNNLSRLNLVNNQLSGSIPEEIGYLRSLNDLGLSENALNGSIPASLGNLNNLS 602

Query: 690 MLVGTKHFHFGXNKFSGEIPAQ 755
           ML      +   N+ SG IP +
Sbjct: 603 ML------YLYNNQLSGSIPEE 618



 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 50/147 (34%), Positives = 63/147 (42%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S +  L LS+  + G +      +S L  L L Y   L  S+P EIG L+ L  L L   
Sbjct: 431 SSLTYLDLSNNSINGFIPASFGNMSNLAFLFL-YENQLASSVPEEIGYLRSLNVLDLSEN 489

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G IP S G                G IP  +G L  L  LDL++N L GSIP S GN
Sbjct: 490 ALNGSIPASFGNLNNLSRLNLVNNQLSGSIPEEIGYLRSLNVLDLSENALNGSIPASFGN 549

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
              L  L      +   N+ SG IP +
Sbjct: 550 LNNLSRL------NLVNNQLSGSIPEE 570



 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 61/199 (30%), Positives = 82/199 (41%), Gaps = 5/199 (2%)
 Frame = +3

Query: 171 FLGIVAFTDNNDYVAIKALRDGWKNVP----PSWAEGSDPCGDHWEGVGCNGSRVVSLTL 338
           +L  VAF    +  A+   +  +KN       SW   S+ C D W GV C   RV +L +
Sbjct: 19  YLFTVAFASTEEATALLKWKATFKNQNNSFLASWIPSSNACKD-WYGVVCFNGRVNTLNI 77

Query: 339 SSMDLTGELSG-DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIP 515
           ++  + G L       L  L+ LDLS N ++ G++P EIGNL  L  L L          
Sbjct: 78  TNASVIGTLYAFPFSSLPSLENLDLSKN-NIYGTIPPEIGNLTNLVYLDL---------- 126

Query: 516 DSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDML 695
                               G IPP +G L++L  + +  NQL G IP   G    L  L
Sbjct: 127 --------------NNNQISGTIPPQIGLLAKLQIIRIFHNQLNGFIPKEIGYLRSLTKL 172

Query: 696 VGTKHFHFGXNKFSGEIPA 752
                   G N  SG IPA
Sbjct: 173 ------SLGINFLSGSIPA 185



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 41/129 (31%), Positives = 58/129 (44%)
 Frame = +3

Query: 309  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
            N S +  L++SS   +GEL   I  L+ LQILD   N +L G++P+  GN+  L    + 
Sbjct: 693  NISNLQVLSMSSNSFSGELPSSISNLTSLQILDFGRN-NLEGAIPQCFGNISSLEVFDMQ 751

Query: 489  GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                 G +P +                    IP SL    +L  LDL DNQL  + P+  
Sbjct: 752  NNKLSGTLPTNFSIGCSLISLNLHGNELEDEIPRSLDNCKKLQVLDLGDNQLNDTFPMWL 811

Query: 669  GNTPGLDML 695
            G  P L +L
Sbjct: 812  GTLPELRVL 820



 Score = 43.5 bits (101), Expect = 0.004
 Identities = 36/130 (27%), Positives = 52/130 (40%)
 Frame = +3

Query: 306  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
            CN + +  L +   +L G++   +  +S LQ+L +S N   +G LP  I NL  L  L  
Sbjct: 668  CNLTSLEVLYMPRNNLKGKVPQCLGNISNLQVLSMSSN-SFSGELPSSISNLTSLQILDF 726

Query: 486  VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                  G IP   G                G +P +      L  L+L  N+L   IP S
Sbjct: 727  GRNNLEGAIPQCFGNISSLEVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELEDEIPRS 786

Query: 666  DGNTPGLDML 695
              N   L +L
Sbjct: 787  LDNCKKLQVL 796



 Score = 42.0 bits (97), Expect = 0.012
 Identities = 31/79 (39%), Positives = 37/79 (46%), Gaps = 1/79 (1%)
 Frame = +3

Query: 426  LTGSLPREIGNLKKLYNLI-LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQ 602
            +T  L  EI  +  LY +I L    F G IP  +G                G IP SLG 
Sbjct: 891  VTKGLELEIVRILSLYTVIDLSSNKFEGHIPSVLGDLIAIRILNVSHNALQGYIPSSLGS 950

Query: 603  LSELYWLDLADNQLTGSIP 659
            LS L  LDL+ NQL+G IP
Sbjct: 951  LSILESLDLSFNQLSGEIP 969



>pir|A71400|A71400 probable disease resistance protein - Arabidopsis
           thaliana>gb:ATCHRIV37_1545156 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 37.>gb:ATFCA0_1551442
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 0.
          Length = 869

 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 63/175 (36%), Positives = 77/175 (44%), Gaps = 29/175 (16%)
 Frame = +3

Query: 258 WAEGSDPCGDHWEGVGCNGSR--VVSLTLSSMDLTGEL--SGDIEELSELQILDLSYNKD 425
           W   +D C   W G+ C+     VV L L + DL G L  +  +  L  LQ LDLSYN D
Sbjct: 60  WRNNTDCCS--WGGISCDPKTGVVVELDLGNSDLNGRLRSNSSLFRLQHLQSLDLSYN-D 116

Query: 426 LTGSLPREIGNLKKLYNLILVGCGFFGLIP-------------------------DSIGX 530
           L+ +LP   GN K L  L L+GC  FG IP                         DS+G 
Sbjct: 117 LSCTLPDSSGNFKYLRVLNLLGCNLFGEIPTSLRSLSYLTDLDLSYNDDLTGEILDSMGN 176

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDML 695
                        F G IP SLG L+ L  LDL+ N  TG +P S GN   L +L
Sbjct: 177 LKHLRVLSLTSCKFTGKIPSSLGNLTYLTDLDLSWNYFTGELPDSMGNLKSLRVL 231



 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 53/140 (37%), Positives = 66/140 (47%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L   +L GE+   +  LS L  LDLSYN DLTG +   +GNLK L  L L  C F G 
Sbjct: 134 LNLLGCNLFGEIPTSLRSLSYLTDLDLSYNDDLTGEILDSMGNLKHLRVLSLTSCKFTGK 193

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S+G              F G +P S+G L  L  L+L      G IP S G+   L 
Sbjct: 194 IPSSLGNLTYLTDLDLSWNYFTGELPDSMGNLKSLRVLNLHRCNFFGKIPTSLGSLSNLT 253

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
            L  +K      N+F+ E P
Sbjct: 254 DLDISK------NEFTSEGP 267



 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 52/154 (33%), Positives = 67/154 (43%), Gaps = 13/154 (8%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L+L+S   TG++   +  L+ L  LDLS+N   TG LP  +GNLK L  L L  C FFG 
Sbjct: 183 LSLTSCKFTGKIPSSLGNLTYLTDLDLSWNY-FTGELPDSMGNLKSLRVLNLHRCNFFGK 241

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLG-------------QLSELYWLDLADNQLTG 650
           IP S+G              F    P S+               LS L  +DL+ NQ   
Sbjct: 242 IPTSLGSLSNLTDLDISKNEFTSEGPDSMSSLNRLTDFQLMLLNLSSLTNVDLSSNQFKA 301

Query: 651 SIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            +P    N   L  L   + F    N FSG IP+
Sbjct: 302 MLP---SNMSSLSKL---EAFDISGNSFSGTIPS 329



 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 41/106 (38%), Positives = 54/106 (50%)
 Frame = +3

Query: 348 DLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG 527
           DLTGE+   +  L  L++L L+  K  TG +P  +GNL  L +L L    F G +PDS+G
Sbjct: 165 DLTGEILDSMGNLKHLRVLSLTSCK-FTGKIPSSLGNLTYLTDLDLSWNYFTGELPDSMG 223

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                         F G IP SLG LS L  LD++ N+ T   P S
Sbjct: 224 NLKSLRVLNLHRCNFFGKIPTSLGSLSNLTDLDISKNEFTSEGPDS 269



 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 38/105 (36%), Positives = 44/105 (41%), Gaps = 13/105 (12%)
 Frame = +3

Query: 474 NLILVGCGFF-------------GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSEL 614
           N+ LVG GF              G IP+SIG              F G IPPSL  LS L
Sbjct: 682 NMELVGSGFEIYKTIDVSGNRLEGDIPESIGILKELIVLNMSNNAFTGHIPPSLSNLSNL 741

Query: 615 YWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
             LDL+ N+L+GSIP   G       L      +F  N   G IP
Sbjct: 742 QSLDLSQNRLSGSIPGELGE------LTFLARMNFSYNMLEGPIP 780



 Score = 38.1 bits (87), Expect = 0.17
 Identities = 45/166 (27%), Positives = 62/166 (37%), Gaps = 23/166 (13%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELS-GDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           ++ L L + D +G L  G+I   S LQ L +  N ++ G +PR I  L  L  L L    
Sbjct: 337 LIKLDLGTNDFSGPLKIGNISSPSNLQELYIGEN-NINGPIPRSILKLVGLSALSLSFWD 395

Query: 498 FFGLIPDSI-------------GXXXXXXXXXXXXXXF---------IGPIPPSLGQLSE 611
             G++  SI             G                        I   P  L   + 
Sbjct: 396 TGGIVDFSIFLQLKSLRSLDLSGINLNISSSHHLPSHMMHLILSSCNISQFPKFLENQTS 455

Query: 612 LYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           LY LD++ NQ+ G +P      P L  +          NKFSGEIP
Sbjct: 456 LYHLDISANQIEGQVPEWLWRLPTLSFIA-------SDNKFSGEIP 494



>gb:AP002522_1822349 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0009G03.>gb:AP003045_1824367 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0030H07.
          Length = 1050

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 51/149 (34%), Positives = 76/149 (51%), Gaps = 5/149 (3%)
 Frame = +3

Query: 324 VSLTLSSMDL-----TGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           +S+TL  +DL     +G +  DI  L  L++LDL +N  ++G +P  IG L  L +L L 
Sbjct: 365 LSMTLQMLDLENNSFSGTIPHDISNLIGLRLLDLGFNP-ISGVIPESIGKLTNLVDLALY 423

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
             G  GLIP +IG                GPIP ++G+L  L+ LDL+ N+L GSIP   
Sbjct: 424 NTGLSGLIPSTIGNLTKLNRLLAFHTNLEGPIPATIGRLKNLFNLDLSFNRLNGSIPREI 483

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
              P L  ++   +     N  SG +P++
Sbjct: 484 LELPSLAWILDLSY-----NSLSGHLPSE 507



 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 58/143 (40%), Positives = 69/143 (48%), Gaps = 1/143 (0%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQ-ILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF 503
           +L LS   L G +  +I EL  L  ILDLSYN  L+G LP E+G L  L  LIL G    
Sbjct: 467 NLDLSFNRLNGSIPREILELPSLAWILDLSYNS-LSGHLPSEVGTLANLNQLILSGNQLS 525

Query: 504 GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG 683
           G IP+SIG              F G +P SL  L  L  L+L  N+L+G IP +  N   
Sbjct: 526 GQIPNSIGNCEVLEFLLLDNNSFGGDMPQSLTNLKGLNVLNLTVNKLSGRIPNAISNIGN 585

Query: 684 LDMLVGTKHFHFGXNKFSGEIPA 752
           L  L          N FSG IPA
Sbjct: 586 LQYLC------LAHNNFSGPIPA 602



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 76/238 (31%), Positives = 103/238 (43%), Gaps = 30/238 (12%)
 Frame = +3

Query: 126 MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKA-LRDGWKNVPPSW-AEGSDPCGDHWEG 299
           ++ R+ L L+P+ +  +   + +D    +A KA L     +   SW + G+  C  +WEG
Sbjct: 5   LMRRLGLPLLPVLLT-IAAASSSDEASLLAFKAGLTGSNSSALASWNSSGASFC--NWEG 61

Query: 300 VGCNG---SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKL 470
           V C+    +RV SL+L S +L G LS  I  L+  + L+LS N  L G +P  IG L++L
Sbjct: 62  VTCSRRRPTRVASLSLPSSNLAGTLSPAIGNLTFPRRLNLSSN-GLYGEIPTSIGRLRRL 120

Query: 471 ------YNLI-------LVGC-----------GFFGLIPDSIGXXXXXXXXXXXXX-XFI 575
                 YN         L  C              G+IP  +G                I
Sbjct: 121 QWLNLSYNSFSGAFPVNLTSCISLKILDLDYNQLGGIIPVELGNTLTQLQMLLLTNNSII 180

Query: 576 GPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           GPIPPSL  LS L  L L  N L G IP   GN P L  L          N  +GE P
Sbjct: 181 GPIPPSLANLSLLQDLYLDYNHLEGLIPPCLGNFPVLHEL------SLEANMLTGEFP 232



 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 36/111 (32%), Positives = 50/111 (45%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS   L+G++   I     L+ L L  N    G +P+ + NLK L  L L      G 
Sbjct: 517 LILSGNQLSGQIPNSIGNCEVLEFLLLD-NNSFGGDMPQSLTNLKGLNVLNLTVNKLSGR 575

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPV 662
           IP++I               F GPIP +L   + L  LD++ N L G +PV
Sbjct: 576 IPNAISNIGNLQYLCLAHNNFSGPIPAALQNFTLLKQLDVSFNNLQGEVPV 626



 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 45/160 (28%), Positives = 65/160 (40%), Gaps = 5/160 (3%)
 Frame = +3

Query: 285 DHWEGV--GCNGSRVV--SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREI 452
           +H EG+   C G+  V   L+L +  LTGE    +  LS L+++ +  N  L GS+P  I
Sbjct: 201 NHLEGLIPPCLGNFPVLHELSLEANMLTGEFPHSLWNLSALRVIGVGLNM-LQGSIPANI 259

Query: 453 GNLKKLYNLI-LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDL 629
           G+         L    F G IP S+               F G +PP+LG L  L +L +
Sbjct: 260 GDKFPAMRFFGLHENRFHGAIPSSLSNLSRLTDLYLADNNFTGFVPPTLGMLHSLKYLYI 319

Query: 630 ADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
             NQL             L      +      N F G++P
Sbjct: 320 GTNQLEADNGKGSEFVTSLANCSQLQELMLSHNFFGGQLP 359



>gb:AY364476_1602838 Oryza sativa (indica cultivar-group) bacterial
           blight resistance protein (Xa26) gene, complete cds.
          Length = 1103

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 71/193 (36%), Positives = 91/193 (47%), Gaps = 7/193 (3%)
 Frame = +3

Query: 192 TDNNDYVAIKA-LRDGWKNVPPSWAEGSDPCGDHWEGVGCNG-----SRVVSLTLSSMDL 353
           TD    +A KA L D    +  +W  G+  C   W GV C+       RV +L L ++ L
Sbjct: 41  TDLAALLAFKAQLSDPNNILAGNWTTGTPFC--RWVGVSCSSHRRRRQRVTALELPNVPL 98

Query: 354 TGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXX 533
            GELS  +  +S L IL+L+ N  LTGS+P +IG L++L  L L      G IP +IG  
Sbjct: 99  QGELSSHLGNISFLFILNLT-NTGLTGSVPNKIGRLRRLELLDLGHNAMSGGIPAAIGNL 157

Query: 534 XXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS-DGNTPGLDMLVGTKH 710
                         GPIP  L  L  L  ++L  N LTGSIP     NTP L  L     
Sbjct: 158 TRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPLLTYL----- 212

Query: 711 FHFGXNKFSGEIP 749
            + G N  SG IP
Sbjct: 213 -NVGNNSLSGLIP 224



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 47/147 (31%), Positives = 69/147 (46%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + +  L LS   LT  +   +  L ++  LDLS N  L+G+LP ++G LK++  + L 
Sbjct: 570 NLTNLEHLLLSDNKLTSTIPPSLFHLDKIVRLDLSRNF-LSGALPVDVGYLKQITIMDLS 628

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
              F G IP SIG              F   +P S G L+ L  LD++ N ++G+IP   
Sbjct: 629 DNHFSGRIPYSIGQLQMLTHLNLSANGFYDSVPDSFGNLTGLQTLDISHNSISGTIPNYL 688

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            N   L  L      +   NK  G+IP
Sbjct: 689 ANFTTLVSL------NLSFNKLHGQIP 709



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 47/150 (31%), Positives = 67/150 (44%)
 Frame = +3

Query: 300 VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL 479
           VG   S++   TLS+  LTG L   I  L+ L+++DLS+N+ L  ++P  I  ++ L  L
Sbjct: 471 VGNLSSQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQ-LRNAIPESIMTIENLQWL 529

Query: 480 ILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
            L G    G IP +                  G IP  +  L+ L  L L+DN+LT +IP
Sbjct: 530 DLSGNSLSGFIPSNTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNKLTSTIP 589

Query: 660 VSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
                 P L  L          N  SG +P
Sbjct: 590 ------PSLFHLDKIVRLDLSRNFLSGALP 613



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 48/149 (32%), Positives = 70/149 (46%), Gaps = 2/149 (1%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N +R+  L L    L G +  +++ L  L  ++L +N  LTGS+P ++ N   L   + V
Sbjct: 156 NLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNY-LTGSIPDDLFNNTPLLTYLNV 214

Query: 489 GCGFF-GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
           G     GLIP  IG                G +PP++  +S+L  + L  N LTG IP  
Sbjct: 215 GNNSLSGLIPGCIGSLPILQHLNFQANNLTGAVPPAIFNMSKLSTISLISNGLTGPIP-- 272

Query: 666 DGNTP-GLDMLVGTKHFHFGXNKFSGEIP 749
            GNT   L +L   + F    N F G+IP
Sbjct: 273 -GNTSFSLPVL---RWFAISKNNFFGQIP 297



 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 40/122 (32%), Positives = 55/122 (45%), Gaps = 1/122 (0%)
 Frame = +3

Query: 336 LSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF-FGLI 512
           +S  +  G++   +     LQ++ + YN    G LP  +G L  L  + L G  F  G I
Sbjct: 287 ISKNNFFGQIPLGLAACPYLQVIAMPYNL-FEGVLPPWLGRLTNLDAISLGGNNFDAGPI 345

Query: 513 PDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM 692
           P  +                 G IP  +G L +L WL LA NQLTG IP S GN   L +
Sbjct: 346 PTELSNLTMLTVLDLTTCNLTGNIPADIGHLGQLSWLHLAMNQLTGPIPASLGNLSSLAI 405

Query: 693 LV 698
           L+
Sbjct: 406 LL 407



 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 37/101 (36%), Positives = 43/101 (42%)
 Frame = +3

Query: 357 GELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXX 536
           G L   +  L+ L  + L  N    G +P E+ NL  L  L L  C   G IP  IG   
Sbjct: 318 GVLPPWLGRLTNLDAISLGGNNFDAGPIPTELSNLTMLTVLDLTTCNLTGNIPADIGHLG 377

Query: 537 XXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
                        GPIP SLG LS L  L L  N L GS+P
Sbjct: 378 QLSWLHLAMNQLTGPIPASLGNLSSLAILLLKGNLLDGSLP 418



 Score = 44.7 bits (104), Expect = 0.002
 Identities = 31/111 (27%), Positives = 56/111 (50%)
 Frame = +3

Query: 324 VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF 503
           +SL  ++ D  G +  ++  L+ L +LDL+   +LTG++P +IG+L +L  L L      
Sbjct: 333 ISLGGNNFD-AGPIPTELSNLTMLTVLDLT-TCNLTGNIPADIGHLGQLSWLHLAMNQLT 390

Query: 504 GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSI 656
           G IP S+G                G +P ++  ++ L  +D+ +N L G +
Sbjct: 391 GPIPASLGNLSSLAILLLKGNLLDGSLPSTVDSMNSLTAVDVTENNLHGDL 441



>gb:AC129718_1740646 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0088I06, complete sequence.
          Length = 216

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 58/185 (31%), Positives = 89/185 (48%), Gaps = 5/185 (2%)
 Frame = +3

Query: 126 MIPRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGS----DPCGDHW 293
           + P   +L+V + +      A  D +   A+   R G  +   + A       +PC   W
Sbjct: 9   LAPATAILVVVVAVVLAAAAASQDGD---ALTEFRKGMSDPDGALASWDPDLVNPCT--W 63

Query: 294 EGVGCNG-SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKL 470
             V CN  +RV+ L L  M+L+G LS D+  L +LQ ++++ N ++ G +P E GNL+ L
Sbjct: 64  FRVTCNADNRVIRLDLEEMNLSGHLSADLARLDQLQFMEIASN-NIEGPIPPEFGNLENL 122

Query: 471 YNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTG 650
            +L L      G IP S+G                GPIP  L  LS L  L++++N L G
Sbjct: 123 ISLDLCNNTISGPIPPSLGKLKSLKFMRIDHNLLTGPIPNELAGLSNLMILNVSNNDLCG 182

Query: 651 SIPVS 665
           +IP S
Sbjct: 183 TIPTS 187



>gb:OSJN00297_1698139 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: B1292H11, complete sequence.
          Length = 977

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 60/168 (35%), Positives = 79/168 (47%), Gaps = 1/168 (0%)
 Frame = +3

Query: 255 SWAEGSDPCGDHWEGVGCNGS-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLT 431
           SW +GS  C   W GV CN   RV  L + +++L G++S DI  LS LQ + L  N+ + 
Sbjct: 6   SWNQGSSVCS--WAGVRCNRQGRVSMLDVQNLNLAGQISPDIGNLSALQSIYLQKNRFI- 62

Query: 432 GSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSE 611
           G++P ++G L  L  L      F G IP  +                 G IP SL  L  
Sbjct: 63  GNIPDQLGRLSLLETLNGSSNHFSGSIPSGLTNCTHLVTMDLSANSITGMIPISLHSLQN 122

Query: 612 LYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           L  L L  NQLTG+IP S GN   L  L  +       N  +GEIP +
Sbjct: 123 LKILKLGQNQLTGAIPPSLGNMSLLTTLDAS------TNTIAGEIPEE 164



 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 47/147 (31%), Positives = 66/147 (44%), Gaps = 1/147 (0%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQ-ILDLSYNKDLTGSLPREIGNLKKLYNLILVG 491
           S ++SL  S   L G +   I  L+ L  IL++SYN  LTG +P  IG L  + ++ L  
Sbjct: 413 SHILSLDFSCNKLNGSIPDTIFSLTSLSSILNMSYNA-LTGVIPESIGRLGNIVSIDLSY 471

Query: 492 CGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG 671
               G IP S+G                G IP  +  L  L  LDL++NQL G IP    
Sbjct: 472 NLLDGSIPTSVGKCQSVQSLSVCGNAISGVIPREIENLKGLQILDLSNNQLVGGIP---- 527

Query: 672 NTPGLDMLVGTKHFHFGXNKFSGEIPA 752
              GL+ L   +  +   N   G +P+
Sbjct: 528 --EGLEKLQALQKLNLSFNNLKGLVPS 552



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 46/151 (30%), Positives = 73/151 (48%), Gaps = 2/151 (1%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDL-TGSLPREIGNLKKLYNLIL 485
           N +++ S+ +S   LTG++   ++ LS+L   ++ +N+ + T S+  ++ N  KL  L +
Sbjct: 240 NITKIHSIRISHNFLTGKVPPGLQRLSKLVWYNIGFNQIVHTTSILDDLTNSTKLEYLGI 299

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFI-GPIPPSLGQLSELYWLDLADNQLTGSIPV 662
                 G IPDSIG               I G IPP +G+L+ L  L++ DN L G IP+
Sbjct: 300 YENQIVGKIPDSIGNLSSSLENLYIGGNRITGHIPPMIGRLTRLTLLNMTDNLLDGEIPL 359

Query: 663 SDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
                  L++L          N  SG IP Q
Sbjct: 360 EISYLKDLNVL------GLSGNNLSGPIPTQ 384



 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 46/174 (26%), Positives = 73/174 (41%), Gaps = 27/174 (15%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGN---------- 458
           N S + +L  S+  + GE+  ++  L  LQ  DLS N +LTG++PR++ N          
Sbjct: 143 NMSLLTTLDASTNTIAGEIPEELGHLRHLQYFDLSIN-NLTGTVPRQLYNISNLAFFAVA 201

Query: 459 ---------------LKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPS 593
                          L KL+  I+      G IP S+                 G +PP 
Sbjct: 202 MNKLHGEIPNDISLGLPKLHIFIVCYNKLTGQIPPSLHNITKIHSIRISHNFLTGKVPPG 261

Query: 594 LGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFG--XNKFSGEIP 749
           L +LS+L W ++  NQ+  +  + D      D+   TK  + G   N+  G+IP
Sbjct: 262 LQRLSKLVWYNIGFNQIVHTTSILD------DLTNSTKLEYLGIYENQIVGKIP 309



 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 43/148 (29%), Positives = 64/148 (43%), Gaps = 1/148 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSE-LQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           N +++  L +    + G++   I  LS  L+ L +  N+ +TG +P  IG L +L  L +
Sbjct: 290 NSTKLEYLGIYENQIVGKIPDSIGNLSSSLENLYIGGNR-ITGHIPPMIGRLTRLTLLNM 348

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                 G IP  I                 GPIP   G L+ L  LD++ N+L  SIP  
Sbjct: 349 TDNLLDGEIPLEISYLKDLNVLGLSGNNLSGPIPTQFGNLTALTMLDISKNRLVSSIPKE 408

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            G+   +  L       F  NK +G IP
Sbjct: 409 LGHLSHILSL------DFSCNKLNGSIP 430



>gb:F15P11_1677567 Arabidopsis thaliana BAC F15P11.
          Length = 957

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 65/170 (38%), Positives = 77/170 (45%), Gaps = 4/170 (2%)
 Frame = +3

Query: 255 SWAEGSDPCGDHWEGVGCNGS--RVVSLTLSSMDLTGEL--SGDIEELSELQILDLSYNK 422
           SW   SD C  +WEGV CN     V+ L LS   L G    +  I  L  L  LDLS+N 
Sbjct: 75  SWGNNSDCC--NWEGVTCNAKSGEVIELDLSCSSLHGRFHSNSSIRNLHFLTTLDLSFN- 131

Query: 423 DLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQ 602
           D  G +   I NL  L  L L    F G I +SIG              F G  P S+  
Sbjct: 132 DFKGQITSSIENLSHLTYLDLSSNHFSGQILNSIGNLSRLTYLNLFDNQFSGQAPSSICN 191

Query: 603 LSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           LS L +LDL+ N+  G  P S G   GL  L     F    NKFSG+IP+
Sbjct: 192 LSHLTFLDLSYNRFFGQFPSSIG---GLSHLTTLSLF---SNKFSGQIPS 235



 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 53/148 (35%), Positives = 67/148 (45%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           CN S +  L LS     G+    I  LS L  L L  NK  +G +P  IGNL  L  L L
Sbjct: 190 CNLSHLTFLDLSYNRFFGQFPSSIGGLSHLTTLSLFSNK-FSGQIPSSIGNLSNLTTLDL 248

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
               F G IP  IG              F+G IP S G L++L  L + DN+L+G+ P  
Sbjct: 249 SNNNFSGQIPSFIGNLSQLTFLGLFSNNFVGEIPSSFGNLNQLTRLYVDDNKLSGNFPNV 308

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
             N  GL +L          NKF+G +P
Sbjct: 309 LLNLTGLSLL------SLSNNKFTGTLP 330



 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 46/167 (27%), Positives = 69/167 (41%), Gaps = 19/167 (11%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S + +L LS+ + +G++   I  LS+L  L L ++ +  G +P   GNL +L  L + 
Sbjct: 239 NLSNLTTLDLSNNNFSGQIPSFIGNLSQLTFLGL-FSNNFVGEIPSSFGNLNQLTRLYVD 297

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G  P+ +               F G +PP++  LS L   D +DN  TG+ P   
Sbjct: 298 DNKLSGNFPNVLLNLTGLSLLSLSNNKFTGTLPPNITSLSNLMDFDASDNAFTGTFPSFL 357

Query: 669 GNTPGL-------DMLVGTKHF------------HFGXNKFSGEIPA 752
              P L       + L GT  F              G N F G IP+
Sbjct: 358 FTIPSLTYIRLNGNQLKGTLEFGNISSPSNLYELDIGNNNFIGPIPS 404



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 29/87 (33%), Positives = 41/87 (47%)
 Frame = +3

Query: 489  GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
            G  F G IP SIG              F G +P S+G L+ L  LD++ N+LTG IP   
Sbjct: 775  GNRFEGEIPKSIGLLKELLVLSLSNNAFSGHMPSSMGNLTALESLDVSKNKLTGEIPQEL 834

Query: 669  GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            G+   L       + +F  N+ +G +P
Sbjct: 835  GDLSFL------AYMNFSHNQLAGLVP 855



 Score = 41.6 bits (96), Expect = 0.016
 Identities = 34/113 (30%), Positives = 50/113 (44%), Gaps = 1/113 (0%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L+LS+   TG L  +I  LS L   D S N   TG+ P  +  +  L  + L G    G 
Sbjct: 318 LSLSNNKFTGTLPPNITSLSNLMDFDASDNA-FTGTFPSFLFTIPSLTYIRLNGNQLKGT 376

Query: 510 IP-DSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
           +   +I               FIGPIP S+ +L +L+ LD++     G +  S
Sbjct: 377 LEFGNISSPSNLYELDIGNNNFIGPIPSSISKLVKLFRLDISHLNTQGPVDFS 429



 Score = 40.0 bits (92), Expect = 0.046
 Identities = 43/145 (29%), Positives = 58/145 (40%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           + SL LS   +T E    +    EL  LD+S NK + G +P  +  L  LY + L     
Sbjct: 489 IQSLYLSGCGIT-EFPEFVRTQHELGFLDISNNK-IKGQVPDWLWRLPILYYVNLSNNTL 546

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G    S                FIG IP  +  L  L  LDL+DN   GSIP   G+  
Sbjct: 547 IGFQRPS-KPEPSLLYLLGSNNNFIGKIPSFICGLRSLNTLDLSDNNFNGSIPRCMGHLK 605

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
               ++  +      N  SG +P Q
Sbjct: 606 STLSVLNLRQ-----NHLSGGLPKQ 625



 Score = 37.4 bits (85), Expect = 0.30
 Identities = 22/62 (35%), Positives = 36/62 (58%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L+LS+   +G +   +  L+ L+ LD+S NK LTG +P+E+G+L  L  +        GL
Sbjct: 795 LSLSNNAFSGHMPSSMGNLTALESLDVSKNK-LTGEIPQELGDLSFLAYMNFSHNQLAGL 853

Query: 510 IP 515
           +P
Sbjct: 854 VP 855



>gb:AY091019_1574250 Arabidopsis thaliana unknown protein
           (At1g11135) mRNA, complete cds.>gb:AY117318_1579359
           Arabidopsis thaliana unknown protein (At1g11130) mRNA,
           complete cds.>gb:AF399923_1796019 Arabidopsis thaliana
           LRR receptor kinase (SUB) mRNA, complete cds.
          Length = 768

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 50/162 (30%), Positives = 80/162 (49%)
 Frame = +3

Query: 261 AEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSL 440
           A G DPCG+ W+GV C+ S +  + +  M + G LS  + + S +Q++D S N  ++G++
Sbjct: 51  AFGGDPCGEKWQGVVCDSSNITEIRIPGMKVGGGLSDTLADFSSIQVMDFSSN-HISGTI 109

Query: 441 PREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYW 620
           P+ + +   + NL L    F G IP ++                 G IP    QLS+L  
Sbjct: 110 PQALPS--SIRNLSLSSNRFTGNIPFTLSFLSDLSELSLGSNLLSGEIPDYFQQLSKLTK 167

Query: 621 LDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEI 746
           LDL+ N L G +P S G+   L +L      +   NK +G +
Sbjct: 168 LDLSSNILEGHLPSSMGDLASLKIL------YLQDNKLTGTL 203



>pir|D86245|D86245 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_890123 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC007259_1535697 Arabidopsis thaliana
           chromosome I BAC T28P6 genomic sequence, complete
           sequence.
          Length = 750

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 50/162 (30%), Positives = 80/162 (49%)
 Frame = +3

Query: 261 AEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSL 440
           A G DPCG+ W+GV C+ S +  + +  M + G LS  + + S +Q++D S N  ++G++
Sbjct: 33  AFGGDPCGEKWQGVVCDSSNITEIRIPGMKVGGGLSDTLADFSSIQVMDFSSN-HISGTI 91

Query: 441 PREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYW 620
           P+ + +   + NL L    F G IP ++                 G IP    QLS+L  
Sbjct: 92  PQALPS--SIRNLSLSSNRFTGNIPFTLSFLSDLSELSLGSNLLSGEIPDYFQQLSKLTK 149

Query: 621 LDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEI 746
           LDL+ N L G +P S G+   L +L      +   NK +G +
Sbjct: 150 LDLSSNILEGHLPSSMGDLASLKIL------YLQDNKLTGTL 185



>gb:AP005966_1860351 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:B1047H05.>gb:AP007273_1863459 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBb0035K09.
          Length = 605

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 49/149 (32%), Positives = 74/149 (49%), Gaps = 1/149 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S ++ L L   +  G +        ++  LDL +N  LTG++P  +GNL  L  L L+
Sbjct: 244 NSSSLIFLDLQQNNFVGSIPPVTAISPKMYYLDLRFNH-LTGTIPSSLGNLSSLTYLCLI 302

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
           G    G IPD++G                GP+PPS+  ++ L +L +A+N LTG +P + 
Sbjct: 303 GNNLVGSIPDTLGHVPTLETLAVNVNNLSGPVPPSIFNVTSLTYLGMANNSLTGRLPSNI 362

Query: 669 GNT-PGLDMLVGTKHFHFGXNKFSGEIPA 752
           G T P +  L+         NKFSG IP+
Sbjct: 363 GYTLPNIQQLI------LPNNKFSGSIPS 385



 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 46/140 (32%), Positives = 62/140 (44%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L +S   L G +  ++    +LQ +DLS NK L GS+P   G+L +L  LIL      G 
Sbjct: 131 LNISMNSLEGNIPSELTSCFKLQKIDLSNNK-LQGSIPSAFGDLTELRTLILTSNRLSGD 189

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S+G                G IP SL   + L +L L  N L+G +P +  N+  L 
Sbjct: 190 IPQSLGSNLSLTYVDLGRNALAGRIPQSLASSTSLQFLILTSNTLSGELPKALLNSSSLI 249

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
            L          N F G IP
Sbjct: 250 FL------DLQQNNFVGSIP 263



 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 61/213 (28%), Positives = 87/213 (40%), Gaps = 9/213 (4%)
 Frame = +3

Query: 138 IQLLLVPLFIQFLGIV-----AFTDNNDYVAIKALRDGWKNVPPSWAEGS-DPCGDHWEG 299
           +QLL +  F   L +V       +D    + +K+   G   V  SW+  S + C   W G
Sbjct: 12  LQLLYILKFFCLLPLVIGSNETESDRQALLCLKSQLTGSAEVLSSWSNASMEFCS--WHG 69

Query: 300 VGCNGS---RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKL 470
           V C+     RV +L LSS  +TG +S  I  L+ L  L LS N                 
Sbjct: 70  VTCSTQYPRRVTALDLSSEGITGSISPCIANLTYLTKLQLSNNS---------------- 113

Query: 471 YNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTG 650
                    F+G IP  +G                G IP  L    +L  +DL++N+L G
Sbjct: 114 ---------FYGSIPSELGFLTQLSILNISMNSLEGNIPSELTSCFKLQKIDLSNNKLQG 164

Query: 651 SIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           SIP + G+   L  L+ T       N+ SG+IP
Sbjct: 165 SIPSAFGDLTELRTLILT------SNRLSGDIP 191



 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 38/123 (30%), Positives = 57/123 (46%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           +L L+S  L+G++   +     L  +DL  N  L G +P+ + +   L  LIL      G
Sbjct: 178 TLILTSNRLSGDIPQSLGSNLSLTYVDLGRNA-LAGRIPQSLASSTSLQFLILTSNTLSG 236

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
            +P ++               F+G IPP      ++Y+LDL  N LTG+IP S GN   L
Sbjct: 237 ELPKALLNSSSLIFLDLQQNNFVGSIPPVTAISPKMYYLDLRFNHLTGTIPSSLGNLSSL 296

Query: 687 DML 695
             L
Sbjct: 297 TYL 299



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 51/174 (29%), Positives = 69/174 (39%), Gaps = 27/174 (15%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYN----------------------- 419
           N S +  L L++   TG +      L  L+ILD++YN                       
Sbjct: 389 NASHLQRLFLTNNSFTGHIPF-FGSLQNLEILDMAYNMLEAGDWSFVSSLTNCSKLTQLL 447

Query: 420 ---KDLTGSLPREIGNLKK-LYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIP 587
               +L G+LP  IGNL   L +L L      GLIP  IG                G IP
Sbjct: 448 LDGNNLQGNLPSCIGNLSSSLEHLWLRNNMISGLIPPGIGNLKSLNTLYMDDNYLTGNIP 507

Query: 588 PSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           P++G L  +  L +  N LTG+IP      P +  L       F  N+ SG+IP
Sbjct: 508 PTIGYLHNMNKLYMDYNYLTGNIP------PTIGYLHSMVFLSFSHNRLSGQIP 555



>gb:AC097367_1736630 Oryza sativa chromosome 3 BAC OSJNBa0051C19
           genomic sequence, complete sequence.
          Length = 218

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 63/188 (33%), Positives = 91/188 (48%), Gaps = 9/188 (4%)
 Frame = +3

Query: 126 MIPRIQLL----LVPLFIQFLGIVAFTDNNDYVAIKALRDGWKN---VPPSWAEGS-DPC 281
           M PR+ LL    +    +  L   A   N++  A+ ALR    +   V  SW     +PC
Sbjct: 1   MAPRVSLLAAGAVAVAVVLLLAAPARASNDEGDALYALRTRLSDPNGVLQSWDPTLVNPC 60

Query: 282 GDHWEGVGCN-GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGN 458
              W  V C+  SRVV L L + +++G +  ++  L  LQ L+L Y  +L G +P+E+GN
Sbjct: 61  T--WFHVTCDHASRVVRLDLGNSNISGSIGPELGRLVNLQYLEL-YRNNLNGEIPKELGN 117

Query: 459 LKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADN 638
           LK L +L L      G IP S+                 G IP  L +LS L  +DL++N
Sbjct: 118 LKNLISLDLYANKLTGTIPKSLSKLGSLRFMRLNNNKLAGSIPRELAKLSNLKVIDLSNN 177

Query: 639 QLTGSIPV 662
            L G+IPV
Sbjct: 178 DLCGTIPV 185



>gb:AY128385_1580684 Arabidopsis thaliana putative disease
           resistance protein (At2g15080) mRNA, complete cds.
          Length = 983

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 62/180 (34%), Positives = 81/180 (45%), Gaps = 10/180 (5%)
 Frame = +3

Query: 243 NVP---PSWAEGSDPCGDHWEGVGCNGS--RVVSLTLSSMDLTGELSGD-----IEELSE 392
           N+P    SW   SD C  +W+G+ C+     V+ L LS   L G+L+ +     + +L  
Sbjct: 56  NIPLKTESWTNNSDCC--YWDGIKCDAKFGDVIELDLSFSCLRGQLNSNSSLFRLPQLRF 113

Query: 393 LQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXF 572
           L  LDLS N D  G +P  +  L  L  L L    F G IP SIG              F
Sbjct: 114 LTTLDLS-NNDFIGQIPSSLETLSNLTTLDLSRNHFSGRIPSSIGNLSHLIFVDFSHNNF 172

Query: 573 IGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            G IP SLG LS L   +L+ N  +G +P S GN   L  L          N F GE+P+
Sbjct: 173 SGQIPSSLGYLSHLTSFNLSYNNFSGRVPSSIGNLSYLTTL------RLSRNSFFGELPS 226



 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 52/148 (35%), Positives = 69/148 (46%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S ++ +  S  + +G++   +  LS L   +LSYN + +G +P  IGNL  L  L L 
Sbjct: 158 NLSHLIFVDFSHNNFSGQIPSSLGYLSHLTSFNLSYN-NFSGRVPSSIGNLSYLTTLRLS 216

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
              FFG +P S+G              F+G IP SLG LS L  +DL  N   G IP S 
Sbjct: 217 RNSFFGELPSSLGSLFHLTDLILDTNHFVGKIPSSLGNLSHLTSIDLHKNNFVGEIPFSL 276

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           GN   L        F    N   GEIP+
Sbjct: 277 GNLSCL------TSFILSDNNIVGEIPS 298



 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 55/145 (37%), Positives = 68/145 (46%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S + S  LS  + +G +   I  LS L  L LS N    G LP  +G+L  L +LIL   
Sbjct: 184 SHLTSFNLSYNNFSGRVPSSIGNLSYLTTLRLSRNS-FFGELPSSLGSLFHLTDLILDTN 242

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
            F G IP S+G              F+G IP SLG LS L    L+DN + G IP S GN
Sbjct: 243 HFVGKIPSSLGNLSHLTSIDLHKNNFVGEIPFSLGNLSCLTSFILSDNNIVGEIPSSFGN 302

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIP 749
              LD+L      +   NK SG  P
Sbjct: 303 LNQLDIL------NVKSNKLSGSFP 321



 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 48/166 (28%), Positives = 69/166 (41%), Gaps = 18/166 (10%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S + +L LS     GEL   +  L  L  L L  N    G +P  +GNL  L ++ L 
Sbjct: 206 NLSYLTTLRLSRNSFFGELPSSLGSLFHLTDLILDTNH-FVGKIPSSLGNLSHLTSIDLH 264

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
              F G IP S+G               +G IP S G L++L  L++  N+L+GS P++ 
Sbjct: 265 KNNFVGEIPFSLGNLSCLTSFILSDNNIVGEIPSSFGNLNQLDILNVKSNKLSGSFPIAL 324

Query: 669 GN------------------TPGLDMLVGTKHFHFGXNKFSGEIPA 752
            N                  T  +  L   K F    N F+G +P+
Sbjct: 325 LNLRKLSTLSLFNNRLTGTLTSNMSSLSNLKLFDATENHFTGPLPS 370



 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 45/146 (30%), Positives = 65/146 (44%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S + S  LS  ++ GE+      L++L IL++  NK L+GS P  + NL+KL  L L 
Sbjct: 278 NLSCLTSFILSDNNIVGEIPSSFGNLNQLDILNVKSNK-LSGSFPIALLNLRKLSTLSLF 336

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G +  ++               F GP+P SL  +  L  + L +NQL GS+    
Sbjct: 337 NNRLTGTLTSNMSSLSNLKLFDATENHFTGPLPSSLFNIPSLKTITLENNQLNGSL--GF 394

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEI 746
           GN      L   +    G N F G I
Sbjct: 395 GNISSYSNLTVLR---LGNNNFRGPI 417



 Score = 39.7 bits (91), Expect = 0.060
 Identities = 32/117 (27%), Positives = 53/117 (45%), Gaps = 1/117 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N  ++ +L+L +  LTG L+ ++  LS L++ D + N   TG LP  + N+  L  + L 
Sbjct: 326 NLRKLSTLSLFNNRLTGTLTSNMSSLSNLKLFDATENH-FTGPLPSSLFNIPSLKTITLE 384

Query: 489 GCGFFGLIP-DSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSI 656
                G +   +I               F GPI  S+ +L  L  LDL++    G +
Sbjct: 385 NNQLNGSLGFGNISSYSNLTVLRLGNNNFRGPIHRSISKLVNLKELDLSNYNTQGLV 441



 Score = 38.5 bits (88), Expect = 0.13
 Identities = 30/102 (29%), Positives = 44/102 (43%), Gaps = 1/102 (0%)
 Frame = +3

Query: 447  EIGNLKKLYNLI-LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWL 623
            E+  + K++ +I   G  F G IP SIG                G I  S+G L  L  L
Sbjct: 788  ELERVLKVFTVIDFSGNKFEGEIPKSIGLLKELHVLNLSNNALSGHIASSMGNLMALESL 847

Query: 624  DLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            D++ N+L+G IP        L  L    + +F  N+  G +P
Sbjct: 848  DVSQNKLSGEIPQE------LGKLTYLAYMNFSHNQLVGLLP 883



 Score = 37.0 bits (84), Expect = 0.39
 Identities = 22/62 (35%), Positives = 35/62 (56%)
 Frame = +3

Query: 330  LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
            L LS+  L+G ++  +  L  L+ LD+S NK L+G +P+E+G L  L  +        GL
Sbjct: 823  LNLSNNALSGHIASSMGNLMALESLDVSQNK-LSGEIPQELGKLTYLAYMNFSHNQLVGL 881

Query: 510  IP 515
            +P
Sbjct: 882  LP 883



>gb:AB016874_1512940 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K23L20.
          Length = 1236

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 61/220 (27%), Positives = 82/220 (37%), Gaps = 48/220 (21%)
 Frame = +3

Query: 240 KNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYN 419
           ++V   W  GS P   +W GV C G  ++ L LS + LTG +S  I   + L  +DLS N
Sbjct: 47  EDVLRDWNSGS-PSYCNWTGVTCGGREIIGLNLSGLGLTGSISPSIGRFNNLIHIDLSSN 105

Query: 420 K------------------------------------------------DLTGSLPREIG 455
           +                                                +L G++P   G
Sbjct: 106 RLVGPIPTTLSNLSSSLESLHLFSNLLSGDIPSQLGSLVNLKSLKLGDNELNGTIPETFG 165

Query: 456 NLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLAD 635
           NL  L  L L  C   GLIP   G                GPIP  +G  + L     A 
Sbjct: 166 NLVNLQMLALASCRLTGLIPSRFGRLVQLQTLILQDNELEGPIPAEIGNCTSLALFAAAF 225

Query: 636 NQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           N+L GS+P        L+ L   +  + G N FSGEIP+Q
Sbjct: 226 NRLNGSLPAE------LNRLKNLQTLNLGDNSFSGEIPSQ 259



 Score = 73.2 bits (178), Expect = 5e-12
 Identities = 55/166 (33%), Positives = 77/166 (46%), Gaps = 20/166 (12%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + +   TL   +L G++  +I  L +L+I+ L Y    +G +P EIGN  +L  +   
Sbjct: 407 NLTNLQEFTLYHNNLEGKVPKEIGFLGKLEIMYL-YENRFSGEMPVEIGNCTRLQEIDWY 465

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS- 665
           G    G IP SIG               +G IP SLG   ++  +DLADNQL+GSIP S 
Sbjct: 466 GNRLSGEIPSSIGRLKDLTRLHLRENELVGNIPASLGNCHQMTVIDLADNQLSGSIPSSF 525

Query: 666 ----------------DGNTPGLDMLVGTKH---FHFGXNKFSGEI 746
                            GN P  D L+  K+    +F  NKF+G I
Sbjct: 526 GFLTALELFMIYNNSLQGNLP--DSLINLKNLTRINFSSNKFNGSI 569



 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 48/145 (33%), Positives = 70/145 (48%)
 Frame = +3

Query: 318  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
            ++  + L++  L+G +   + +L  L  L LS NK   GSLP EI +L  +  L L G  
Sbjct: 649  KLTHIDLNNNYLSGVIPTWLGKLPLLGELKLSSNK-FVGSLPTEIFSLTNILTLFLDGNS 707

Query: 498  FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
              G IP  IG                GP+P ++G+LS+L+ L L+ N LTG IPV  G  
Sbjct: 708  LNGSIPQEIGNLQALNALNLEENQLSGPLPSTIGKLSKLFELRLSRNALTGEIPVEIGQL 767

Query: 678  PGLDMLVGTKHFHFGXNKFSGEIPA 752
              L   +   +     N F+G IP+
Sbjct: 768  QDLQSALDLSY-----NNFTGRIPS 787



 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 45/148 (30%), Positives = 68/148 (45%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + +  L LS   L+GE+  +I     L++LDLS N  LTG +P  +  L +L NL L 
Sbjct: 335 NNTSLKQLFLSETQLSGEIPAEISNCQSLKLLDLS-NNTLTGQIPDSLFQLVELTNLYLN 393

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G +  SI                 G +P  +G L +L  + L +N+ +G +PV  
Sbjct: 394 NNSLEGTLSSSISNLTNLQEFTLYHNNLEGKVPKEIGFLGKLEIMYLYENRFSGEMPVEI 453

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           GN   L      +   +  N+ SGEIP+
Sbjct: 454 GNCTRL------QEIDWYGNRLSGEIPS 475



 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 44/141 (31%), Positives = 66/141 (46%)
 Frame = +3

Query: 330  LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
            L L     TG +     ++SEL +LD+S N  L+G +P E+G  KKL ++ L      G+
Sbjct: 605  LRLGKNQFTGRIPRTFGKISELSLLDISRNS-LSGIIPVELGLCKKLTHIDLNNNYLSGV 663

Query: 510  IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
            IP  +G              F+G +P  +  L+ +  L L  N L GSIP   GN   L+
Sbjct: 664  IPTWLGKLPLLGELKLSSNKFVGSLPTEIFSLTNILTLFLDGNSLNGSIPQEIGNLQALN 723

Query: 690  MLVGTKHFHFGXNKFSGEIPA 752
             L      +   N+ SG +P+
Sbjct: 724  AL------NLEENQLSGPLPS 738



 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 46/148 (31%), Positives = 65/148 (43%), Gaps = 1/148 (0%)
 Frame = +3

Query: 315  SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
            + +++L L    L G +  +I  L  L  L+L  N+ L+G LP  IG L KL+ L L   
Sbjct: 696  TNILTLFLDGNSLNGSIPQEIGNLQALNALNLEENQ-LSGPLPSTIGKLSKLFELRLSRN 754

Query: 495  GFFGLIPDSIGXXXXXXXXXXXXXX-FIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG 671
               G IP  IG               F G IP ++  L +L  LDL+ NQL G +P   G
Sbjct: 755  ALTGEIPVEIGQLQDLQSALDLSYNNFTGRIPSTISTLPKLESLDLSHNQLVGEVPGQIG 814

Query: 672  NTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            +   L  L      +   N   G++  Q
Sbjct: 815  DMKSLGYL------NLSYNNLEGKLKKQ 836



 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 40/137 (29%), Positives = 62/137 (45%), Gaps = 2/137 (1%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           L G L  ++  L  LQ L+L  N   +G +P ++G+L  +  L L+G    GLIP  +  
Sbjct: 228 LNGSLPAELNRLKNLQTLNLGDNS-FSGEIPSQLGDLVSIQYLNLIGNQLQGLIPKRLTE 286

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP--VSDGNTPGLDMLVGT 704
                          G I     ++++L +L LA N+L+GS+P  +   NT         
Sbjct: 287 LANLQTLDLSSNNLTGVIHEEFWRMNQLEFLVLAKNRLSGSLPKTICSNNT-------SL 339

Query: 705 KHFHFGXNKFSGEIPAQ 755
           K       + SGEIPA+
Sbjct: 340 KQLFLSETQLSGEIPAE 356



 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 40/140 (28%), Positives = 62/140 (44%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L   +L G +   +    ++ ++DL+ N+ L+GS+P   G L  L   ++      G 
Sbjct: 486 LHLRENELVGNIPASLGNCHQMTVIDLADNQ-LSGSIPSSFGFLTALELFMIYNNSLQGN 544

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           +PDS+               F G I P  G  S L + D+ +N   G IP+  G +  LD
Sbjct: 545 LPDSLINLKNLTRINFSSNKFNGSISPLCGSSSYLSF-DVTENGFEGDIPLELGKSTNLD 603

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
            L        G N+F+G IP
Sbjct: 604 RL------RLGKNQFTGRIP 617



 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 46/144 (31%), Positives = 65/144 (45%), Gaps = 1/144 (0%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREI-GNLKKLYNLILVGCGFF 503
           +L LSS +LTG +  +   +++L+ L L+ N+ L+GSLP+ I  N   L  L L      
Sbjct: 292 TLDLSSNNLTGVIHEEFWRMNQLEFLVLAKNR-LSGSLPKTICSNNTSLKQLFLSETQLS 350

Query: 504 GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG 683
           G IP  I                 G IP SL QL EL  L L +N L G++  S  N   
Sbjct: 351 GEIPAEISNCQSLKLLDLSNNTLTGQIPDSLFQLVELTNLYLNNNSLEGTLSSSISN--- 407

Query: 684 LDMLVGTKHFHFGXNKFSGEIPAQ 755
              L   + F    N   G++P +
Sbjct: 408 ---LTNLQEFTLYHNNLEGKVPKE 428



 Score = 52.4 bits (124), Expect = 9e-06
 Identities = 47/170 (27%), Positives = 68/170 (40%), Gaps = 23/170 (13%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI-- 482
           N  ++  + L+   L+G +      L+ L++  + YN  L G+LP  + NLK L  +   
Sbjct: 503 NCHQMTVIDLADNQLSGSIPSSFGFLTALELF-MIYNNSLQGNLPDSLINLKNLTRINFS 561

Query: 483 ----------LVGC-----------GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLG 599
                     L G            GF G IP  +G              F G IP + G
Sbjct: 562 SNKFNGSISPLCGSSSYLSFDVTENGFEGDIPLELGKSTNLDRLRLGKNQFTGRIPRTFG 621

Query: 600 QLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           ++SEL  LD++ N L+G IPV       L +     H     N  SG IP
Sbjct: 622 KISELSLLDISRNSLSGIIPVE------LGLCKKLTHIDLNNNYLSGVIP 665



>pir|G84524|G84524 probable disease resistance protein [imported] -
           Arabidopsis thaliana>gb:AC005957_1533258 Arabidopsis
           thaliana chromosome 2 clone T15J14 map mi398, complete
           sequence.
          Length = 983

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 62/180 (34%), Positives = 81/180 (45%), Gaps = 10/180 (5%)
 Frame = +3

Query: 243 NVP---PSWAEGSDPCGDHWEGVGCNGS--RVVSLTLSSMDLTGELSGD-----IEELSE 392
           N+P    SW   SD C  +W+G+ C+     V+ L LS   L G+L+ +     + +L  
Sbjct: 56  NIPLKTESWTNNSDCC--YWDGIKCDAKFGDVIELDLSFSCLRGQLNSNSSLFRLPQLRF 113

Query: 393 LQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXF 572
           L  LDLS N D  G +P  +  L  L  L L    F G IP SIG              F
Sbjct: 114 LTTLDLS-NNDFIGQIPSSLETLSNLTTLDLSRNHFSGRIPSSIGNLSHLIFVDFSHNNF 172

Query: 573 IGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            G IP SLG LS L   +L+ N  +G +P S GN   L  L          N F GE+P+
Sbjct: 173 SGQIPSSLGYLSHLTSFNLSYNNFSGRVPSSIGNLSYLTTL------RLSRNSFFGELPS 226



 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 52/148 (35%), Positives = 69/148 (46%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S ++ +  S  + +G++   +  LS L   +LSYN + +G +P  IGNL  L  L L 
Sbjct: 158 NLSHLIFVDFSHNNFSGQIPSSLGYLSHLTSFNLSYN-NFSGRVPSSIGNLSYLTTLRLS 216

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
              FFG +P S+G              F+G IP SLG LS L  +DL  N   G IP S 
Sbjct: 217 RNSFFGELPSSLGSLFHLTDLILDTNHFVGKIPSSLGNLSHLTSIDLHKNNFVGEIPFSL 276

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           GN   L        F    N   GEIP+
Sbjct: 277 GNLSCL------TSFILSDNNIVGEIPS 298



 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 55/145 (37%), Positives = 68/145 (46%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S + S  LS  + +G +   I  LS L  L LS N    G LP  +G+L  L +LIL   
Sbjct: 184 SHLTSFNLSYNNFSGRVPSSIGNLSYLTTLRLSRNS-FFGELPSSLGSLFHLTDLILDTN 242

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
            F G IP S+G              F+G IP SLG LS L    L+DN + G IP S GN
Sbjct: 243 HFVGKIPSSLGNLSHLTSIDLHKNNFVGEIPFSLGNLSCLTSFILSDNNIVGEIPSSFGN 302

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIP 749
              LD+L      +   NK SG  P
Sbjct: 303 LNQLDIL------NVKSNKLSGSFP 321



 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 46/146 (31%), Positives = 66/146 (45%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S + S  LS  ++ GE+      L++L IL++  NK L+GS P  + NL+KL  L L 
Sbjct: 278 NLSCLTSFILSDNNIVGEIPSSFGNLNQLDILNVKSNK-LSGSFPIALLNLRKLSTLSLF 336

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G +P ++               F GP+P SL  +  L  + L +NQL GS+    
Sbjct: 337 NNRLTGTLPSNMSSLSNLKLFDATENHFTGPLPSSLFNIPSLKTITLENNQLNGSL--GF 394

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEI 746
           GN      L   +    G N F G I
Sbjct: 395 GNISSYSNLTVLR---LGNNNFRGPI 417



 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 45/148 (30%), Positives = 66/148 (44%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S + +L LS     GEL   +  L  L  L L  N    G +P  +GNL  L ++ L 
Sbjct: 206 NLSYLTTLRLSRNSFFGELPSSLGSLFHLTDLILDTNH-FVGKIPSSLGNLSHLTSIDLH 264

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
              F G IP S+G               +G IP S G L++L  L++  N+L+GS P++ 
Sbjct: 265 KNNFVGEIPFSLGNLSCLTSFILSDNNIVGEIPSSFGNLNQLDILNVKSNKLSGSFPIAL 324

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            N   L  L          N+ +G +P+
Sbjct: 325 LNLRKLSTL------SLFNNRLTGTLPS 346



 Score = 38.9 bits (89), Expect = 0.10
 Identities = 32/117 (27%), Positives = 52/117 (44%), Gaps = 1/117 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N  ++ +L+L +  LTG L  ++  LS L++ D + N   TG LP  + N+  L  + L 
Sbjct: 326 NLRKLSTLSLFNNRLTGTLPSNMSSLSNLKLFDATENH-FTGPLPSSLFNIPSLKTITLE 384

Query: 489 GCGFFGLIP-DSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSI 656
                G +   +I               F GPI  S+ +L  L  LDL++    G +
Sbjct: 385 NNQLNGSLGFGNISSYSNLTVLRLGNNNFRGPIHRSISKLVNLKELDLSNYNTQGLV 441



 Score = 38.5 bits (88), Expect = 0.13
 Identities = 30/102 (29%), Positives = 44/102 (43%), Gaps = 1/102 (0%)
 Frame = +3

Query: 447  EIGNLKKLYNLI-LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWL 623
            E+  + K++ +I   G  F G IP SIG                G I  S+G L  L  L
Sbjct: 788  ELERVLKVFTVIDFSGNKFEGEIPKSIGLLKELHVLNLSNNALSGHIASSMGNLMALESL 847

Query: 624  DLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            D++ N+L+G IP        L  L    + +F  N+  G +P
Sbjct: 848  DVSQNKLSGEIPQE------LGKLTYLAYMNFSHNQLVGLLP 883



 Score = 37.0 bits (84), Expect = 0.39
 Identities = 22/62 (35%), Positives = 35/62 (56%)
 Frame = +3

Query: 330  LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
            L LS+  L+G ++  +  L  L+ LD+S NK L+G +P+E+G L  L  +        GL
Sbjct: 823  LNLSNNALSGHIASSMGNLMALESLDVSQNK-LSGEIPQELGKLTYLAYMNFSHNQLVGL 881

Query: 510  IP 515
            +P
Sbjct: 882  LP 883



>gb:AP005966_1860381 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:B1047H05.
          Length = 1137

 Score = 80.1 bits (196), Expect = 4e-14
 Identities = 67/203 (33%), Positives = 91/203 (44%), Gaps = 6/203 (2%)
 Frame = +3

Query: 159 LFIQFLGIV--AFTDNNDYVAIKALRDGWKNVPPSWAEGSD-PCGDHWEGVGCNGS---R 320
           LF Q L I     TD +  +  K+   G   V  SW   S  PC  +W GV C+     R
Sbjct: 20  LFFQPLAISDETETDRDALLCFKSQLSGPTGVLASWNNASLLPC--NWHGVTCSRRAPRR 77

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           V+++ L S  + G +S  I  ++ L  L LS N    G +P E+G L +L NL L     
Sbjct: 78  VIAIDLPSEGIIGSISPCIANITSLTRLQLS-NNSFHGGIPSELGFLNELQNLDLSMNSL 136

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IP  +                 G IPPSL Q   L  + L +N+L GSIP + G+ P
Sbjct: 137 EGNIPSELSSCSQLQILDLQNNSLQGEIPPSLSQCVHLQQILLGNNKLQGSIPSAFGDLP 196

Query: 681 GLDMLVGTKHFHFGXNKFSGEIP 749
            L +L          N+ SG+IP
Sbjct: 197 KLSVL------FLANNRLSGDIP 213



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 57/172 (33%), Positives = 77/172 (44%), Gaps = 25/172 (14%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGEL--------------------SGDIEELS----ELQILDLSY 416
           N S +  L L+S  L+GEL                    SG I  +     ++Q LDL  
Sbjct: 242 NSSSLQQLILNSNSLSGELPKALLNTLSLNGIYLNQNNFSGSIPPVKTVSPQVQYLDLGE 301

Query: 417 NKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSL 596
           N  LTG++P  +GNL  L  L L      G IP+S+G              F G IPP L
Sbjct: 302 NC-LTGTIPSSLGNLSSLLYLRLSQNCLDGSIPESLGHIPTLQTLMLTLNNFSGTIPPPL 360

Query: 597 GQLSELYWLDLADNQLTGSIPVSDGNT-PGLDMLVGTKHFHFGXNKFSGEIP 749
             +S L +L +A+N LTG +P+  G T P ++ L+         NKF G IP
Sbjct: 361 FNMSSLTFLTVANNSLTGRLPLEIGYTLPNIEGLI------LLANKFKGSIP 406



 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 45/141 (31%), Positives = 61/141 (43%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           +L LS   L G +  ++   S+LQILDL  N  L G +P  +     L  ++L      G
Sbjct: 128 NLDLSMNSLEGNIPSELSSCSQLQILDLQ-NNSLQGEIPPSLSQCVHLQQILLGNNKLQG 186

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
            IP + G                G IPPSLG    L +++L  N LTG IP    N+  L
Sbjct: 187 SIPSAFGDLPKLSVLFLANNRLSGDIPPSLGSSLTLTYVNLGKNALTGGIPKPMLNSSSL 246

Query: 687 DMLVGTKHFHFGXNKFSGEIP 749
             L+         N  SGE+P
Sbjct: 247 QQLI------LNSNSLSGELP 261



 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 51/148 (34%), Positives = 73/148 (49%), Gaps = 1/148 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSE-LQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           N +R+  L L   +L G L   +  LS  LQ L L  NK ++G +P+EIGNLK L  L +
Sbjct: 461 NCTRLTKLMLDGNNLQGNLPSSVGNLSSSLQRLWLRNNK-ISGPIPQEIGNLKSLTELYM 519

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                 G I  +IG                G IP ++G+L +L +L+L  N L+GSIP+S
Sbjct: 520 DYNQLTGNISLTIGNLHKLGILSFAQNRLSGQIPDNIGKLVQLNYLNLDRNNLSGSIPLS 579

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            G    L++L      +   N  +G IP
Sbjct: 580 IGYCTQLEIL------NLAHNSLNGTIP 601



 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 50/161 (31%), Positives = 74/161 (45%)
 Frame = +3

Query: 264 EGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLP 443
           +G++  G+    VG   S +  L L +  ++G +  +I  L  L  L + YN+ LTG++ 
Sbjct: 471 DGNNLQGNLPSSVGNLSSSLQRLWLRNNKISGPIPQEIGNLKSLTELYMDYNQ-LTGNIS 529

Query: 444 REIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWL 623
             IGNL KL  L        G IPD+IG                G IP S+G  ++L  L
Sbjct: 530 LTIGNLHKLGILSFAQNRLSGQIPDNIGKLVQLNYLNLDRNNLSGSIPLSIGYCTQLEIL 589

Query: 624 DLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEI 746
           +LA N L G+IP +      L M++   +     N  SG I
Sbjct: 590 NLAHNSLNGTIPETIFKISSLSMVLDLSY-----NYLSGSI 625



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 46/145 (31%), Positives = 63/145 (43%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S++  L L +  L GE+   + +   LQ + L  NK L GS+P   G+L KL  L L   
Sbjct: 148 SQLQILDLQNNSLQGEIPPSLSQCVHLQQILLGNNK-LQGSIPSAFGDLPKLSVLFLANN 206

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G IP S+G                G IP  +   S L  L L  N L+G +P +  N
Sbjct: 207 RLSGDIPPSLGSSLTLTYVNLGKNALTGGIPKPMLNSSSLQQLILNSNSLSGELPKALLN 266

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIP 749
           T  L+ +      +   N FSG IP
Sbjct: 267 TLSLNGI------YLNQNNFSGSIP 285



 Score = 56.2 bits (134), Expect = 6e-07
 Identities = 42/142 (29%), Positives = 66/142 (46%), Gaps = 1/142 (0%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQ-ILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           L L+   L G +   I ++S L  +LDLSYN  L+GS+  E+GNL  L  LI+      G
Sbjct: 589 LNLAHNSLNGTIPETIFKISSLSMVLDLSYNY-LSGSISDEVGNLVNLNKLIISYNRLSG 647

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
            IP ++               F+G IP +   +  +  +D++ N L+G IP        L
Sbjct: 648 DIPSTLSQCVVLEYLEMQSNFFVGSIPQTFVNMLGIKVMDISHNNLSGEIP------QFL 701

Query: 687 DMLVGTKHFHFGXNKFSGEIPA 752
            +L   +  +   N F G +P+
Sbjct: 702 TLLRSLQVLNLSFNNFHGVVPS 723



 Score = 44.7 bits (104), Expect = 0.002
 Identities = 40/130 (30%), Positives = 60/130 (46%), Gaps = 1/130 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S ++ L LS   L G +   +  +  LQ L L+ N + +G++P  + N+  L  L + 
Sbjct: 314 NLSSLLYLRLSQNCLDGSIPESLGHIPTLQTLMLTLN-NFSGTIPPPLFNMSSLTFLTVA 372

Query: 489 GCGFFGLIPDSIGXXX-XXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                G +P  IG               F G IP SL   + L  L LA+N+LTG +P S
Sbjct: 373 NNSLTGRLPLEIGYTLPNIEGLILLANKFKGSIPTSLLNSTHLQMLYLAENKLTGIMP-S 431

Query: 666 DGNTPGLDML 695
            G+   L+ L
Sbjct: 432 FGSLTNLEDL 441



>gb:AP004006_1836240 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1197_D06.
          Length = 1274

 Score = 80.1 bits (196), Expect = 4e-14
 Identities = 54/144 (37%), Positives = 75/144 (52%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +  L L++  L+GEL  ++  L+EL++L L Y+  LTG LP  +G L  L  L L    F
Sbjct: 400 LTDLLLNNNTLSGELPPELFNLTELKVLAL-YHNGLTGRLPDAVGRLVNLEVLFLYENDF 458

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IP++IG              F G +P S+G+LSEL +L L  N+L+G IP   G+  
Sbjct: 459 SGEIPETIGECSSLQMVDFFGNRFNGSLPASIGKLSELAFLHLRQNELSGRIPPELGDCV 518

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPA 752
            L +L          N  SGEIPA
Sbjct: 519 NLAVL------DLADNALSGEIPA 536



 Score = 80.1 bits (196), Expect = 4e-14
 Identities = 50/146 (34%), Positives = 67/146 (45%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           R+ +L L S  L GEL   +  L+ L++L +  N  L+G +P  +G L  L  L    C 
Sbjct: 127 RLTALLLYSNRLAGELPPSLGALAALRVLRVGDNPALSGPIPAALGVLANLTVLAAASCN 186

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
             G IP S+G                GPIPP LG ++ L  L LADNQLTG IP      
Sbjct: 187 LTGAIPRSLGRLAALTALNLQENSLSGPIPPELGGIAGLEVLSLADNQLTGVIP------ 240

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           P L  L   +  +   N   G +P +
Sbjct: 241 PELGRLAALQKLNLANNTLEGAVPPE 266



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 51/143 (35%), Positives = 70/143 (48%), Gaps = 1/143 (0%)
 Frame = +3

Query: 330  LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
            L LS  +LTG +   +   S+L  L L  N+ + G++P EIG+L  L  L L G    G 
Sbjct: 690  LALSGNELTGPVPVQLSNCSKLIKLSLDGNQ-INGTVPSEIGSLVSLNVLNLAGNQLSGE 748

Query: 510  IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELY-WLDLADNQLTGSIPVSDGNTPGL 686
            IP ++                 GPIPP +GQL EL   LDL+ N L+GSIP S G+   L
Sbjct: 749  IPATLAKLINLYELNLSRNLLSGPIPPDIGQLQELQSLLDLSSNDLSGSIPASLGSLSKL 808

Query: 687  DMLVGTKHFHFGXNKFSGEIPAQ 755
            + L      +   N  +G +P Q
Sbjct: 809  ESL------NLSHNALAGAVPPQ 825



 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 53/184 (28%), Positives = 75/184 (40%), Gaps = 23/184 (12%)
 Frame = +3

Query: 273 DPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLS------------- 413
           D CG    G G   + +  L LS+ + +GE+ G +     L  LDL+             
Sbjct: 338 DLCGGG--GGGAESTSLEHLMLSTNNFSGEIPGGLSRCRALTQLDLANNSLTGVIPAALG 395

Query: 414 ----------YNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXX 563
                      N  L+G LP E+ NL +L  L L   G  G +PD++G            
Sbjct: 396 ELGNLTDLLLNNNTLSGELPPELFNLTELKVLALYHNGLTGRLPDAVGRLVNLEVLFLYE 455

Query: 564 XXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGE 743
             F G IP ++G+ S L  +D   N+  GS+P S G    L  L      H   N+ SG 
Sbjct: 456 NDFSGEIPETIGECSSLQMVDFFGNRFNGSLPASIGKLSELAFL------HLRQNELSGR 509

Query: 744 IPAQ 755
           IP +
Sbjct: 510 IPPE 513



 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 43/142 (30%), Positives = 67/142 (47%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L  +S +LTG +   +  L+ L  L+L  N  L+G +P E+G +  L  L L      G+
Sbjct: 180 LAAASCNLTGAIPRSLGRLAALTALNLQENS-LSGPIPPELGGIAGLEVLSLADNQLTGV 238

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP  +G                G +PP LG+L EL +L+L +N+L+G +P        L 
Sbjct: 239 IPPELGRLAALQKLNLANNTLEGAVPPELGKLGELAYLNLMNNRLSGRVPRE------LA 292

Query: 690 MLVGTKHFHFGXNKFSGEIPAQ 755
            L   +      N  +GE+PA+
Sbjct: 293 ALSRARTIDLSGNLLTGELPAE 314



 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 45/168 (26%), Positives = 66/168 (39%), Gaps = 25/168 (14%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           + +L L    L+G +  ++  ++ L++L L+ N+ LTG +P E+G L  L  L L     
Sbjct: 201 LTALNLQENSLSGPIPPELGGIAGLEVLSLADNQ-LTGVIPPELGRLAALQKLNLANNTL 259

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G +P  +G                G +P  L  LS    +DL+ N LTG +P   G  P
Sbjct: 260 EGAVPPELGKLGELAYLNLMNNRLSGRVPRELAALSRARTIDLSGNLLTGELPAEVGQLP 319

Query: 681 GLDML-------------------------VGTKHFHFGXNKFSGEIP 749
            L  L                            +H     N FSGEIP
Sbjct: 320 ELSFLALSGNHLTGRIPGDLCGGGGGGAESTSLEHLMLSTNNFSGEIP 367



 Score = 59.3 bits (142), Expect = 7e-08
 Identities = 46/167 (27%), Positives = 68/167 (40%), Gaps = 18/167 (10%)
 Frame = +3

Query: 306  CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
            C  +R++S   ++   +G +   +     LQ +    N  L+G +P  +GN   L  L  
Sbjct: 586  CGSARLLSFDATNNSFSGGIPAQLGRSRSLQRVRFGSNA-LSGPIPAALGNAAALTMLDA 644

Query: 486  VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
             G    G IPD++                 GP+P  +G L EL  L L+ N+LTG +PV 
Sbjct: 645  SGNALTGGIPDALARCARLSHIALSGNRLSGPVPAWVGALPELGELALSGNELTGPVPVQ 704

Query: 666  ------------DGN------TPGLDMLVGTKHFHFGXNKFSGEIPA 752
                        DGN         +  LV     +   N+ SGEIPA
Sbjct: 705  LSNCSKLIKLSLDGNQINGTVPSEIGSLVSLNVLNLAGNQLSGEIPA 751



 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 47/147 (31%), Positives = 65/147 (44%), Gaps = 7/147 (4%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDI-------EELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           L LS   LTG + GD+        E + L+ L LS N + +G +P  +   + L  L L 
Sbjct: 324 LALSGNHLTGRIPGDLCGGGGGGAESTSLEHLMLSTN-NFSGEIPGGLSRCRALTQLDLA 382

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G+IP ++G                G +PP L  L+EL  L L  N LTG +P + 
Sbjct: 383 NNSLTGVIPAALGELGNLTDLLLNNNTLSGELPPELFNLTELKVLALYHNGLTGRLPDAV 442

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           G    L++L          N FSGEIP
Sbjct: 443 GRLVNLEVL------FLYENDFSGEIP 463



 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 46/139 (33%), Positives = 64/139 (46%), Gaps = 4/139 (2%)
 Frame = +3

Query: 291 WEGVGCN--GSRVVSLTLSSMDLTGELSGD-IEELSELQILDLSYNKDLTGSLPREIGNL 461
           W GV C+  G+RV  L LS   L GE+ G  +  L  L+++DLS N+ L G +P  +G L
Sbjct: 67  WAGVECDAAGARVTGLNLSGAGLAGEVPGAALARLDRLEVVDLSSNR-LAGPVPAALGAL 125

Query: 462 KKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADN- 638
            +L  L+L                              G +PPSLG L+ L  L + DN 
Sbjct: 126 GRLTALLLYS------------------------NRLAGELPPSLGALAALRVLRVGDNP 161

Query: 639 QLTGSIPVSDGNTPGLDML 695
            L+G IP + G    L +L
Sbjct: 162 ALSGPIPAALGVLANLTVL 180



 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 40/110 (36%), Positives = 53/110 (48%), Gaps = 1/110 (0%)
 Frame = +3

Query: 330  LTLSSMDLTGELSGDIEELSELQ-ILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
            L LS   L+G +  DI +L ELQ +LDLS N DL+GS+P  +G+L KL +L L       
Sbjct: 762  LNLSRNLLSGPIPPDIGQLQELQSLLDLSSN-DLSGSIPASLGSLSKLESLNL------- 813

Query: 507  LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSI 656
                                   G +PP L  +S L  LDL+ NQL G +
Sbjct: 814  -----------------SHNALAGAVPPQLAGMSSLVQLDLSSNQLQGRL 846



>gb:BT003880_1637007 Arabidopsis thaliana clone RAFL15-22-I19
           (R20597) putative leucine-rich repeat transmembrane
           protein kinase (At5g46330) mRNA, complete cds.
          Length = 1173

 Score = 80.1 bits (196), Expect = 4e-14
 Identities = 54/148 (36%), Positives = 74/148 (50%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S + +L+++  +LTG L   I +L +L+IL +SYN  LTG +PREIGNLK L  L L 
Sbjct: 453 NCSNLETLSVADNNLTGTLKPLIGKLQKLRILQVSYNS-LTGPIPREIGNLKDLNILYLH 511

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
             GF G IP  +                 GPIP  +  +  L  LDL++N+ +G IP   
Sbjct: 512 SNGFTGRIPREMSNLTLLQGLRMYSNDLEGPIPEEMFDMKLLSVLDLSNNKFSGQIPAL- 570

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
                   L    +     NKF+G IPA
Sbjct: 571 -----FSKLESLTYLSLQGNKFNGSIPA 593



 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 70/232 (30%), Positives = 93/232 (40%), Gaps = 31/232 (13%)
 Frame = +3

Query: 147 LLVPLFIQFLGIVAFTDN--NDYVAIKALRDGWKNVP----PSWAEGSDPCGDHWEGVGC 308
           L++ L   F GI     +   +  A+K+ ++G  N P      W         +W G+ C
Sbjct: 9   LILTLTFFFFGIALAKQSFEPEIEALKSFKNGISNDPLGVLSDWTIIGSLRHCNWTGITC 68

Query: 309 NGS-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           + +  VVS++L    L G LS  I  L+ LQ+LDL+ N   TG +P EIG L +L  LIL
Sbjct: 69  DSTGHVVSVSLLEKQLEGVLSPAIANLTYLQVLDLTSNS-FTGKIPAEIGKLTELNQLIL 127

Query: 486 VGCGFFGLIP------------------------DSIGXXXXXXXXXXXXXXFIGPIPPS 593
               F G IP                        + I                 G IP  
Sbjct: 128 YLNYFSGSIPSGIWELKNIFYLDLRNNLLSGDVPEEICKTSSLVLIGFDYNNLTGKIPEC 187

Query: 594 LGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           LG L  L     A N LTGSIPVS G    L  L          N+ +G+IP
Sbjct: 188 LGDLVHLQMFVAAGNHLTGSIPVSIGTLANLTDL------DLSGNQLTGKIP 233



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 50/149 (33%), Positives = 66/149 (44%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           C  S +V +     +LTG++   + +L  LQ+   + N  LTGS+P  IG L  L +L L
Sbjct: 165 CKTSSLVLIGFDYNNLTGKIPECLGDLVHLQMFVAAGNH-LTGSIPVSIGTLANLTDLDL 223

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
            G    G IP   G                G IP  +G  S L  L+L DNQLTG IP  
Sbjct: 224 SGNQLTGKIPRDFGNLLNLQSLVLTENLLEGDIPAEIGNCSSLVQLELYDNQLTGKIPAE 283

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            GN      LV  +      NK +  IP+
Sbjct: 284 LGN------LVQLQALRIYKNKLTSSIPS 306



 Score = 66.2 bits (160), Expect = 6e-10
 Identities = 46/145 (31%), Positives = 65/145 (44%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           +++  L LS   L G +S +I  L  L++L L  N + TG  P+ I NL+ L  L +   
Sbjct: 312 TQLTHLGLSENHLVGPISEEIGFLESLEVLTLHSN-NFTGEFPQSITNLRNLTVLTVGFN 370

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G +P  +G                GPIP S+   + L  LDL+ NQ+TG IP   G 
Sbjct: 371 NISGELPADLGLLTNLRNLSAHDNLLTGPIPSSISNCTGLKLLDLSHNQMTGEIPRGFGR 430

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIP 749
                  +       G N F+GEIP
Sbjct: 431 -------MNLTFISIGRNHFTGEIP 448



 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 47/142 (33%), Positives = 62/142 (43%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           SL L+   L G++  +I   S L  L+L Y+  LTG +P E+GNL +L  L +       
Sbjct: 244 SLVLTENLLEGDIPAEIGNCSSLVQLEL-YDNQLTGKIPAELGNLVQLQALRIYKNKLTS 302

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
            IP S+                +GPI   +G L  L  L L  N  TG  P S  N   L
Sbjct: 303 SIPSSLFRLTQLTHLGLSENHLVGPISEEIGFLESLEVLTLHSNNFTGEFPQSITNLRNL 362

Query: 687 DMLVGTKHFHFGXNKFSGEIPA 752
            +L        G N  SGE+PA
Sbjct: 363 TVLT------VGFNNISGELPA 378



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 44/141 (31%), Positives = 62/141 (43%), Gaps = 1/141 (0%)
 Frame = +3

Query: 330  LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
            L  S+  LTG +  ++ +L  ++ +DLS N   +GS+PR +   K ++ L        G 
Sbjct: 630  LNFSNNLLTGTIPKELGKLEMVKEIDLSNNL-FSGSIPRSLQACKNVFTLDFSQNNLSGH 688

Query: 510  IPDSI-GXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
            IPD +                F G IP S G ++ L  LDL+ N LTG IP S  N   L
Sbjct: 689  IPDEVFQGMDMIISLNLSRNSFSGEIPQSFGNMTHLVSLDLSSNNLTGEIPESLANLSTL 748

Query: 687  DMLVGTKHFHFGXNKFSGEIP 749
                  KH     N   G +P
Sbjct: 749  ------KHLKLASNNLKGHVP 763



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 42/105 (40%), Positives = 52/105 (49%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           LTG +   I  L+ L  LDLS N+ LTG +PR+ GNL  L +L+L      G IP  IG 
Sbjct: 204 LTGSIPVSIGTLANLTDLDLSGNQ-LTGKIPRDFGNLLNLQSLVLTENLLEGDIPAEIGN 262

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                          G IP  LG L +L  L +  N+LT SIP S
Sbjct: 263 CSSLVQLELYDNQLTGKIPAELGNLVQLQALRIYKNKLTSSIPSS 307



 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 45/165 (27%), Positives = 62/165 (37%), Gaps = 23/165 (13%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           LTL S + TGE    I  L  L +L + +N +++G LP ++G L  L NL        G 
Sbjct: 341 LTLHSNNFTGEFPQSITNLRNLTVLTVGFN-NISGELPADLGLLTNLRNLSAHDNLLTGP 399

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQL-----------------------SELYW 620
           IP SI                 G IP   G++                       S L  
Sbjct: 400 IPSSISNCTGLKLLDLSHNQMTGEIPRGFGRMNLTFISIGRNHFTGEIPDDIFNCSNLET 459

Query: 621 LDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           L +ADN LTG++    G    L +L          N  +G IP +
Sbjct: 460 LSVADNNLTGTLKPLIGKLQKLRIL------QVSYNSLTGPIPRE 498



 Score = 37.4 bits (85), Expect = 0.30
 Identities = 33/116 (28%), Positives = 49/116 (42%), Gaps = 1/116 (0%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQI-LDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           V +L  S  +L+G +  ++ +  ++ I L+LS N   +G +P+  GN+  L +L L    
Sbjct: 675 VFTLDFSQNNLSGHIPDEVFQGMDMIISLNLSRNS-FSGEIPQSFGNMTHLVSLDL---- 729

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                                     G IP SL  LS L  L LA N L G +P S
Sbjct: 730 --------------------SSNNLTGEIPESLANLSTLKHLKLASNNLKGHVPES 765



 Score = 33.9 bits (76), Expect = 3.3
 Identities = 25/61 (40%), Positives = 36/61 (59%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + +VSL LSS +LTGE+   +  LS L+ L L+ N +L G +P E G  K +    L+
Sbjct: 720 NMTHLVSLDLSSNNLTGEIPESLANLSTLKHLKLASN-NLKGHVP-ESGVFKNINASDLM 777

Query: 489 G 491
           G
Sbjct: 778 G 778



>gb:AB010698_1511224 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MPL12.
          Length = 1173

 Score = 80.1 bits (196), Expect = 4e-14
 Identities = 54/148 (36%), Positives = 74/148 (50%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S + +L+++  +LTG L   I +L +L+IL +SYN  LTG +PREIGNLK L  L L 
Sbjct: 453 NCSNLETLSVADNNLTGTLKPLIGKLQKLRILQVSYNS-LTGPIPREIGNLKDLNILYLH 511

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
             GF G IP  +                 GPIP  +  +  L  LDL++N+ +G IP   
Sbjct: 512 SNGFTGRIPREMSNLTLLQGLRMYSNDLEGPIPEEMFDMKLLSVLDLSNNKFSGQIPAL- 570

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
                   L    +     NKF+G IPA
Sbjct: 571 -----FSKLESLTYLSLQGNKFNGSIPA 593



 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 70/232 (30%), Positives = 93/232 (40%), Gaps = 31/232 (13%)
 Frame = +3

Query: 147 LLVPLFIQFLGIVAFTDN--NDYVAIKALRDGWKNVP----PSWAEGSDPCGDHWEGVGC 308
           L++ L   F GI     +   +  A+K+ ++G  N P      W         +W G+ C
Sbjct: 9   LILTLTFFFFGIALAKQSFEPEIEALKSFKNGISNDPLGVLSDWTIIGSLRHCNWTGITC 68

Query: 309 NGS-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           + +  VVS++L    L G LS  I  L+ LQ+LDL+ N   TG +P EIG L +L  LIL
Sbjct: 69  DSTGHVVSVSLLEKQLEGVLSPAIANLTYLQVLDLTSNS-FTGKIPAEIGKLTELNQLIL 127

Query: 486 VGCGFFGLIP------------------------DSIGXXXXXXXXXXXXXXFIGPIPPS 593
               F G IP                        + I                 G IP  
Sbjct: 128 YLNYFSGSIPSGIWELKNIFYLDLRNNLLSGDVPEEICKTSSLVLIGFDYNNLTGKIPEC 187

Query: 594 LGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           LG L  L     A N LTGSIPVS G    L  L          N+ +G+IP
Sbjct: 188 LGDLVHLQMFVAAGNHLTGSIPVSIGTLANLTDL------DLSGNQLTGKIP 233



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 50/149 (33%), Positives = 66/149 (44%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           C  S +V +     +LTG++   + +L  LQ+   + N  LTGS+P  IG L  L +L L
Sbjct: 165 CKTSSLVLIGFDYNNLTGKIPECLGDLVHLQMFVAAGNH-LTGSIPVSIGTLANLTDLDL 223

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
            G    G IP   G                G IP  +G  S L  L+L DNQLTG IP  
Sbjct: 224 SGNQLTGKIPRDFGNLLNLQSLVLTENLLEGDIPAEIGNCSSLVQLELYDNQLTGKIPAE 283

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            GN      LV  +      NK +  IP+
Sbjct: 284 LGN------LVQLQALRIYKNKLTSSIPS 306



 Score = 66.2 bits (160), Expect = 6e-10
 Identities = 46/145 (31%), Positives = 65/145 (44%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           +++  L LS   L G +S +I  L  L++L L  N + TG  P+ I NL+ L  L +   
Sbjct: 312 TQLTHLGLSENHLVGPISEEIGFLESLEVLTLHSN-NFTGEFPQSITNLRNLTVLTVGFN 370

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G +P  +G                GPIP S+   + L  LDL+ NQ+TG IP   G 
Sbjct: 371 NISGELPADLGLLTNLRNLSAHDNLLTGPIPSSISNCTGLKLLDLSHNQMTGEIPRGFGR 430

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIP 749
                  +       G N F+GEIP
Sbjct: 431 -------MNLTFISIGRNHFTGEIP 448



 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 47/142 (33%), Positives = 62/142 (43%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           SL L+   L G++  +I   S L  L+L Y+  LTG +P E+GNL +L  L +       
Sbjct: 244 SLVLTENLLEGDIPAEIGNCSSLVQLEL-YDNQLTGKIPAELGNLVQLQALRIYKNKLTS 302

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
            IP S+                +GPI   +G L  L  L L  N  TG  P S  N   L
Sbjct: 303 SIPSSLFRLTQLTHLGLSENHLVGPISEEIGFLESLEVLTLHSNNFTGEFPQSITNLRNL 362

Query: 687 DMLVGTKHFHFGXNKFSGEIPA 752
            +L        G N  SGE+PA
Sbjct: 363 TVLT------VGFNNISGELPA 378



 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 45/141 (31%), Positives = 62/141 (43%), Gaps = 1/141 (0%)
 Frame = +3

Query: 330  LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
            L  S+  LTG +  ++ +L  +Q +DLS N   +GS+PR +   K ++ L        G 
Sbjct: 630  LNFSNNLLTGTIPKELGKLEMVQEIDLSNNL-FSGSIPRSLQACKNVFTLDFSQNNLSGH 688

Query: 510  IPDSI-GXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
            IPD +                F G IP S G ++ L  LDL+ N LTG IP S  N   L
Sbjct: 689  IPDEVFQGMDMIISLNLSRNSFSGEIPQSFGNMTHLVSLDLSSNNLTGEIPESLANLSTL 748

Query: 687  DMLVGTKHFHFGXNKFSGEIP 749
                  KH     N   G +P
Sbjct: 749  ------KHLKLASNNLKGHVP 763



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 42/105 (40%), Positives = 52/105 (49%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           LTG +   I  L+ L  LDLS N+ LTG +PR+ GNL  L +L+L      G IP  IG 
Sbjct: 204 LTGSIPVSIGTLANLTDLDLSGNQ-LTGKIPRDFGNLLNLQSLVLTENLLEGDIPAEIGN 262

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                          G IP  LG L +L  L +  N+LT SIP S
Sbjct: 263 CSSLVQLELYDNQLTGKIPAELGNLVQLQALRIYKNKLTSSIPSS 307



 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 45/165 (27%), Positives = 62/165 (37%), Gaps = 23/165 (13%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           LTL S + TGE    I  L  L +L + +N +++G LP ++G L  L NL        G 
Sbjct: 341 LTLHSNNFTGEFPQSITNLRNLTVLTVGFN-NISGELPADLGLLTNLRNLSAHDNLLTGP 399

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQL-----------------------SELYW 620
           IP SI                 G IP   G++                       S L  
Sbjct: 400 IPSSISNCTGLKLLDLSHNQMTGEIPRGFGRMNLTFISIGRNHFTGEIPDDIFNCSNLET 459

Query: 621 LDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           L +ADN LTG++    G    L +L          N  +G IP +
Sbjct: 460 LSVADNNLTGTLKPLIGKLQKLRIL------QVSYNSLTGPIPRE 498



 Score = 37.4 bits (85), Expect = 0.30
 Identities = 33/116 (28%), Positives = 49/116 (42%), Gaps = 1/116 (0%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQI-LDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           V +L  S  +L+G +  ++ +  ++ I L+LS N   +G +P+  GN+  L +L L    
Sbjct: 675 VFTLDFSQNNLSGHIPDEVFQGMDMIISLNLSRNS-FSGEIPQSFGNMTHLVSLDL---- 729

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                                     G IP SL  LS L  L LA N L G +P S
Sbjct: 730 --------------------SSNNLTGEIPESLANLSTLKHLKLASNNLKGHVPES 765



 Score = 33.9 bits (76), Expect = 3.3
 Identities = 25/61 (40%), Positives = 36/61 (59%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + +VSL LSS +LTGE+   +  LS L+ L L+ N +L G +P E G  K +    L+
Sbjct: 720 NMTHLVSLDLSSNNLTGEIPESLANLSTLKHLKLASN-NLKGHVP-ESGVFKNINASDLM 777

Query: 489 G 491
           G
Sbjct: 778 G 778



>gb:AX093382_1461111 Sequence 1 from Patent WO0118061.
          Length = 330

 Score = 80.1 bits (196), Expect = 4e-14
 Identities = 72/217 (33%), Positives = 94/217 (43%), Gaps = 37/217 (17%)
 Frame = +3

Query: 216 IKALRD-----GWKNVPPSWAEGSDPCGDH----WEGVGCNGS---RVVS---------- 329
           +KAL +     GW+ V  SW  G DPCG      W GV C+     RVV+          
Sbjct: 33  VKALNEIKSSLGWR-VVYSWV-GDDPCGHGDLPPWSGVTCSQQGDYRVVTELEVYAVSIV 90

Query: 330 ---------------LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLK 464
                          L L +  LTG +   I  L  L+IL+L +NK L   LP EIG LK
Sbjct: 91  GPFPTAVTNLLDLRRLDLHNNKLTGPIPPQIGRLKHLRILNLRWNK-LQDVLPPEIGELK 149

Query: 465 KLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQL 644
           KL +L L    F G IP  +               F G IPP LG L  L  LD+ +N L
Sbjct: 150 KLTHLYLSFNNFKGEIPVELANLPELRYLYLHENRFTGRIPPELGTLKNLRHLDVGNNHL 209

Query: 645 TGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           TG++    GN  G   L   ++ +   N+ +G +P Q
Sbjct: 210 TGTLRDFIGNGNGFPSL---RNLYLNNNELTGVLPDQ 243



 Score = 39.7 bits (91), Expect = 0.060
 Identities = 24/66 (36%), Positives = 39/66 (59%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           +L L++ +LTG L   I  L+ L+IL LS NK + GS+  ++ ++ +L  L L    F G
Sbjct: 228 NLYLNNNELTGVLPDQIANLTNLEILHLSNNK-MIGSISPKLVHIPRLIYLYLDNNNFIG 286

Query: 507 LIPDSI 524
            IP+ +
Sbjct: 287 RIPEGL 292



>pir|G84652|G84652 probable receptor-like protein kinase [imported]
           - Arabidopsis thaliana>gb:AC005395_1532623 Arabidopsis
           thaliana chromosome 2 clone F17H15 map B68, complete
           sequence.
          Length = 960

 Score = 80.1 bits (196), Expect = 4e-14
 Identities = 75/232 (32%), Positives = 100/232 (43%), Gaps = 29/232 (12%)
 Frame = +3

Query: 147 LLVPLFIQFLGIVAFTDNNDYVAIK---ALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG- 314
           L+  LF  FL       N   + +    +++D  K++  SW+  S      W GV CN  
Sbjct: 13  LITTLFFLFLNFSCLHANELELLLSFKSSIQDPLKHLS-SWSYSSTNDVCLWSGVVCNNI 71

Query: 315 SRVVSLTLSSMDLTGE-LSGDIEELSELQILDLSYNKDLTGSLPREI------------- 452
           SRVVSL LS  +++G+ L+     L  LQ ++LS N +L+G +P +I             
Sbjct: 72  SRVVSLDLSGKNMSGQILTAATFRLPFLQTINLS-NNNLSGPIPHDIFTTSSPSLRYLNL 130

Query: 453 -----------GNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLG 599
                      G L  LY L L    F G I + IG                G +P  LG
Sbjct: 131 SNNNFSGSIPRGFLPNLYTLDLSNNMFTGEIYNDIGVFSNLRVLDLGGNVLTGHVPGYLG 190

Query: 600 QLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            LS L +L LA NQLTG +PV  G    L      K  + G N  SGEIP Q
Sbjct: 191 NLSRLEFLTLASNQLTGGVPVELGKMKNL------KWIYLGYNNLSGEIPYQ 236



 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 54/161 (33%), Positives = 77/161 (47%)
 Frame = +3

Query: 267 GSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPR 446
           G +    H  G   N SR+  LTL+S  LTG +  ++ ++  L+ + L YN +L+G +P 
Sbjct: 177 GGNVLTGHVPGYLGNLSRLEFLTLASNQLTGGVPVELGKMKNLKWIYLGYN-NLSGEIPY 235

Query: 447 EIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLD 626
           +IG L  L +L LV     G IP S+G                G IPPS+  L  L  LD
Sbjct: 236 QIGGLSSLNHLDLVYNNLSGPIPPSLGDLKKLEYMFLYQNKLSGQIPPSIFSLQNLISLD 295

Query: 627 LADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            +DN L+G IP        L++L      H   N  +G+IP
Sbjct: 296 FSDNSLSGEIPELVAQMQSLEIL------HLFSNNLTGKIP 330



 Score = 73.6 bits (179), Expect = 4e-12
 Identities = 51/140 (36%), Positives = 66/140 (47%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L    LTG + G +  LS L+ L L+ N+ LTG +P E+G +K L  + L      G 
Sbjct: 174 LDLGGNVLTGHVPGYLGNLSRLEFLTLASNQ-LTGGVPVELGKMKNLKWIYLGYNNLSGE 232

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP  IG                GPIPPSLG L +L ++ L  N+L+G IP      P + 
Sbjct: 233 IPYQIGGLSSLNHLDLVYNNLSGPIPPSLGDLKKLEYMFLYQNKLSGQIP------PSIF 286

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
            L       F  N  SGEIP
Sbjct: 287 SLQNLISLDFSDNSLSGEIP 306



 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 37/114 (32%), Positives = 55/114 (48%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           R+  L LS   ++G +   +    E+  LDLS N ++TG +PRE+ + K L NL L    
Sbjct: 479 RLKKLDLSRNKISGVVPQGLMTFPEIMDLDLSEN-EITGVIPRELSSCKNLVNLDLSHNN 537

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
           F G IP S                  G IP +LG +  L  ++++ N L GS+P
Sbjct: 538 FTGEIPSSFAEFQVLSDLDLSCNQLSGEIPKNLGNIESLVQVNISHNLLHGSLP 591



 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 46/144 (31%), Positives = 67/144 (46%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           R+  L L S   +G +  ++ + + L +LDLS N +LTG LP  + +   L  LIL    
Sbjct: 338 RLKVLQLWSNRFSGGIPANLGKHNNLTVLDLSTN-NLTGKLPDTLCDSGHLTKLILFSNS 396

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
               IP S+G              F G +P    +L  + +LDL++N L G+I   D   
Sbjct: 397 LDSQIPPSLGMCQSLERVRLQNNGFSGKLPRGFTKLQLVNFLDLSNNNLQGNINTWD--M 454

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIP 749
           P L+ML          NKF GE+P
Sbjct: 455 PQLEML------DLSVNKFFGELP 472



>gb:AP000366_1819745 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0437H03.
          Length = 1413

 Score = 79.7 bits (195), Expect = 5e-14
 Identities = 56/145 (38%), Positives = 71/145 (48%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +V L LSS  L G +  ++ +L  LQ L LS N +LTGS+P EIGNLK+L  L L+ C  
Sbjct: 332 LVKLDLSSNGLVGAIPKELCQLKNLQSLILSDN-ELTGSIPEEIGNLKQLEVLNLLKCNL 390

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
              +P SIG              F G +P S+G+L  L  L       TGSIP   GN  
Sbjct: 391 MDTVPLSIGNLEILEGLYISFNSFSGELPASVGELRNLRQLMAKSAGFTGSIPKELGNCK 450

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L  LV         N F+G IP +
Sbjct: 451 KLTTLV------LSGNNFTGTIPEE 469



 Score = 73.6 bits (179), Expect = 4e-12
 Identities = 71/248 (28%), Positives = 98/248 (39%), Gaps = 46/248 (18%)
 Frame = +3

Query: 150 LVPLFIQFLGIVAFTDN---NDYVAIKALRDGWKNVPPSWAE-GSDPCGDHWEGVGCNGS 317
           L  L + F+ I A  ++   N +   KA+  G K    +W E  + PC  +W G+ C G 
Sbjct: 106 LFTLLLCFIPITALAESDIKNLFALRKAIAVG-KGFLHNWFELETPPC--NWSGISCVGL 162

Query: 318 RVVSLTLSSMDL------------------------TGELSGDIEELSELQILDLSYNKD 425
            VV++ LSS  L                        +GEL   +  L  LQ LDLS N+ 
Sbjct: 163 TVVAIDLSSTPLYVDFPSQIIAFQSLVRLNVSGCGFSGELPEAMVNLQHLQHLDLSDNQ- 221

Query: 426 LTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQL 605
           L G LP  + +LK L  ++L    F G +  +I               F G +PP LG L
Sbjct: 222 LGGPLPASLFDLKMLKVMVLDNNMFSGQLSPAIAHLQQLTVLSISTNSFSGGLPPELGSL 281

Query: 606 SELYWLDLADNQLTGSIPVSDGNT------------------PGLDMLVGTKHFHFGXNK 731
             L +LD+  N  +GSIP S  N                   PG+  LV         N 
Sbjct: 282 KNLEYLDIHTNAFSGSIPASFSNLSRLLYLDANNNNLTGSIFPGIRALVNLVKLDLSSNG 341

Query: 732 FSGEIPAQ 755
             G IP +
Sbjct: 342 LVGAIPKE 349



 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 45/142 (31%), Positives = 66/142 (46%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L +S    +GEL   + EL  L+ L ++ +   TGS+P+E+GN KKL  L+L G  F G 
Sbjct: 407 LYISFNSFSGELPASVGELRNLRQL-MAKSAGFTGSIPKELGNCKKLTTLVLSGNNFTGT 465

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP+ +                 G IP  +   S +  + LA N         DG  PGL 
Sbjct: 466 IPEELADLVAVVLFDVEGNRLSGHIPDWIQNWSNVSSISLAQNMF-------DGPLPGLP 518

Query: 690 MLVGTKHFHFGXNKFSGEIPAQ 755
           + + +  F    N+ SG IPA+
Sbjct: 519 LHLVS--FSAESNRLSGSIPAK 538



 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 58/195 (29%), Positives = 82/195 (42%)
 Frame = +3

Query: 171  FLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMD 350
            FL I+   DNN   +I     G KN+       +   G+  E +      +VSL LS  +
Sbjct: 544  FLQILRLNDNNLTGSIDETFKGCKNLTELSLLDNHLHGEIPEYLAL--LPLVSLDLSHNN 601

Query: 351  LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
             TG +   + E S +  + LS N+ LTG +   IG L  L +L +      G +P SIG 
Sbjct: 602  FTGMIPDRLWESSTILDISLSDNQ-LTGMITESIGKLLSLQSLSIDRNYLQGPLPRSIGA 660

Query: 531  XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH 710
                             IP  L     L  LDL+ N LTG IP +  +   L+ LV    
Sbjct: 661  LRNLTALSLSGNMLSEDIPIQLFNCRNLVTLDLSCNNLTGHIPKAISHLTKLNTLV---- 716

Query: 711  FHFGXNKFSGEIPAQ 755
                 N+ SG IP++
Sbjct: 717  --LSRNRLSGAIPSE 729



 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 44/149 (29%), Positives = 62/149 (41%), Gaps = 19/149 (12%)
 Frame = +3

Query: 360  ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXX 539
            E   ++E +  + ++DLS N+ LTG +PR I N   L  L L      G IP  +     
Sbjct: 737  ESHSELEYVQHIGLIDLSRNR-LTGHIPRAINNCSILVELHLQDNLLSGTIPVELAELRN 795

Query: 540  XXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN--------------- 674
                       +GP+ P    L+ L  L L++N+L+GSIP   GN               
Sbjct: 796  ITTIDLSSNALVGPVLPWPVPLASLQGLLLSNNRLSGSIPSGIGNILPQITMLDLSGNAL 855

Query: 675  --TPGLDMLV--GTKHFHFGXNKFSGEIP 749
              T  LD+L      H     N  SG+IP
Sbjct: 856  TGTLPLDLLCKESLNHLDVSDNNISGQIP 884



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 40/152 (26%), Positives = 66/152 (43%), Gaps = 4/152 (2%)
 Frame = +3

Query: 297  GVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKL-Y 473
            G+G    ++  L LS   LTG L  D+     L  LD+S N +++G +P      K+   
Sbjct: 837  GIGNILPQITMLDLSGNALTGTLPLDLLCKESLNHLDVSDN-NISGQIPFSCHEDKESPI 895

Query: 474  NLILVGCG---FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQL 644
             LI        F G + +SI                 G +P ++ +++ LY+LDL+ N  
Sbjct: 896  PLIFFNASSNHFSGSLDESISNFTKLTYLDLHNNSLTGRLPSAIARVTSLYYLDLSSNDF 955

Query: 645  TGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSG 740
            +G+IP       G+  + G    +F  N+  G
Sbjct: 956  SGTIPC------GICGMFGLTFANFSGNRDGG 981



>gb:PSA495759_1701999 Pisum sativum sym29 gene for serine-threonine
           protein kinase, exons 1-2.
          Length = 976

 Score = 79.7 bits (195), Expect = 5e-14
 Identities = 49/141 (34%), Positives = 68/141 (48%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L++++  L+G++   + +L  L+ L L YN    G +P E G+LK L  L +  C   G 
Sbjct: 196 LSINANSLSGKIPKSLSKLKTLKELRLGYNNAYDGGVPPEFGSLKSLRYLEVSNCNLTGE 255

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S G                G IPP L  +  L  LDL++N L+G IP S  N   L 
Sbjct: 256 IPPSFGNLENLDSLFLQMNNLTGIIPPELSSMKSLMSLDLSNNALSGEIPESFSNLKSLT 315

Query: 690 MLVGTKHFHFGXNKFSGEIPA 752
           +L      +F  NKF G IPA
Sbjct: 316 LL------NFFQNKFRGSIPA 330



 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 72/284 (25%), Positives = 105/284 (36%), Gaps = 81/284 (28%)
 Frame = +3

Query: 147 LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPS----W---AEGSDPCGDHWEGVG 305
           LLV   + F    + TD +  + +K    G K+  P     W   A GS  C   + GV 
Sbjct: 8   LLVFFCVLFTPCFSITDLDALLKLKESMKGEKSKHPDSLGDWKFSASGSAHCS--FSGVT 65

Query: 306 CN-GSRVVSLTLSSM------------------------DLTGELSGDIEELSELQILDL 410
           C+  +RV++L ++ +                        +LTGEL  +I  L+ L+IL++
Sbjct: 66  CDQDNRVITLNVTQVPLFGRISKEIGVLDKLERLIITMDNLTGELPFEISNLTSLKILNI 125

Query: 411 SYN------------------------KDLTGSLPREIGNLKKLYNLILVGCGFFGLIPD 518
           S+N                           TG LP EI +LK+L  L L G  F G IP+
Sbjct: 126 SHNTFSGNFPGNITLRMTKLEVLDAYDNSFTGHLPEEIVSLKELTILCLAGNYFTGTIPE 185

Query: 519 SIGXXXXXXXXXXXX-------------------------XXFIGPIPPSLGQLSELYWL 623
           S                                         + G +PP  G L  L +L
Sbjct: 186 SYSEFQKLEILSINANSLSGKIPKSLSKLKTLKELRLGYNNAYDGGVPPEFGSLKSLRYL 245

Query: 624 DLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           ++++  LTG IP S GN   LD L          N  +G IP +
Sbjct: 246 EVSNCNLTGEIPPSFGNLENLDSL------FLQMNNLTGIIPPE 283



 Score = 56.2 bits (134), Expect = 6e-07
 Identities = 54/185 (29%), Positives = 75/185 (40%), Gaps = 16/185 (8%)
 Frame = +3

Query: 216 IKALRDGWKN-----VPPSWAEGSDPCGDHWEGVGCNGSRVV-----------SLTLSSM 347
           +K LR G+ N     VPP +  GS     + E   CN +  +           SL L   
Sbjct: 217 LKELRLGYNNAYDGGVPPEF--GSLKSLRYLEVSNCNLTGEIPPSFGNLENLDSLFLQMN 274

Query: 348 DLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG 527
           +LTG +  ++  +  L  LDLS N  L+G +P    NLK L  L      F G IP  IG
Sbjct: 275 NLTGIIPPELSSMKSLMSLDLS-NNALSGEIPESFSNLKSLTLLNFFQNKFRGSIPAFIG 333

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTK 707
                         F   +P +LG   +  + D+  N LTG IP     +  L   + T 
Sbjct: 334 DLPNLETLQVWENNFSFVLPQNLGSNGKFIFFDVTKNHLTGLIPPDLCKSKKLQTFIVTD 393

Query: 708 HFHFG 722
           +F  G
Sbjct: 394 NFFHG 398



 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 43/163 (26%), Positives = 68/163 (41%), Gaps = 18/163 (11%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           ++SL LS+  L+GE+      L  L +L+   NK   GS+P  IG+L  L  L +    F
Sbjct: 290 LMSLDLSNNALSGEIPESFSNLKSLTLLNFFQNK-FRGSIPAFIGDLPNLETLQVWENNF 348

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS----- 665
             ++P ++G                G IPP L +  +L    + DN   G IP       
Sbjct: 349 SFVLPQNLGSNGKFIFFDVTKNHLTGLIPPDLCKSKKLQTFIVTDNFFHGPIPKGIGACK 408

Query: 666 ------------DGNTP-GLDMLVGTKHFHFGXNKFSGEIPAQ 755
                       DG  P G+  +        G N+F+G++P++
Sbjct: 409 SLLKIRVANNYLDGPVPQGIFQMPSVTIIELGNNRFNGQLPSE 451



 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 34/147 (23%), Positives = 60/147 (40%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           +G  +  LT+S+   TG +   ++ L  LQ L L  N+   G +P+E+ +L  L    + 
Sbjct: 453 SGVNLGILTISNNLFTGRIPASMKNLISLQTLWLDANQ-FVGEIPKEVFDLPVLTKFNIS 511

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
           G    G+IP ++                 G +P  +  L  L   +L+ N ++G IP   
Sbjct: 512 GNNLTGVIPTTVSQCRSLTAVDFSRNMITGEVPRGMKNLKVLSIFNLSHNNISGLIP--- 568

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
                +  +          N F+G +P
Sbjct: 569 ---DEIRFMTSLTTLDLSYNNFTGIVP 592



 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 30/109 (27%), Positives = 48/109 (44%)
 Frame = +3

Query: 426 LTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQL 605
           LTG +P ++   KKL   I+    F G IP  IG                GP+P  + Q+
Sbjct: 372 LTGLIPPDLCKSKKLQTFIVTDNFFHGPIPKGIGACKSLLKIRVANNYLDGPVPQGIFQM 431

Query: 606 SELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
             +  ++L +N+  G +P       G+++ + T       N F+G IPA
Sbjct: 432 PSVTIIELGNNRFNGQLP---SEVSGVNLGILT----ISNNLFTGRIPA 473



>gb:BT010407_1640353 Arabidopsis thaliana At3g43740 mRNA, complete
           cds.>gb:AK175133_1817121 Arabidopsis thaliana mRNA,
           complete cds, clone: RAFL21-55-C11.>gb:AK175524_1817512
           Arabidopsis thaliana mRNA, complete cds, clone:
           RAFL21-94-I24.>gb:AK176628_1818616 Arabidopsis thaliana
           mRNA, complete cds, clone:
           RAFL25-16-M13.>gb:AK176756_1818744 Arabidopsis thaliana
           mRNA, complete cds, clone: RAFL25-29-M07.
          Length = 218

 Score = 79.7 bits (195), Expect = 5e-14
 Identities = 61/178 (34%), Positives = 88/178 (49%), Gaps = 6/178 (3%)
 Frame = +3

Query: 147 LLVPLFIQFLGIVAFTD-NNDYVAIKALRDGWK---NVPPSWAEGS-DPCGDHWEGVGCN 311
           LL    I  L ++  T+ N++  A+ ALR       NV  SW     +PC   W  V CN
Sbjct: 10  LLAASLILTLALIRLTEANSEGDALHALRRSLSDPDNVVQSWDPTLVNPCT--WFHVTCN 67

Query: 312 GS-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
              +V  L L + +L+G L  ++ +L  LQ L+L Y  ++ G++P E+GNLK L +L L 
Sbjct: 68  QHHQVTRLDLGNSNLSGHLVPELGKLEHLQYLEL-YKNEIQGTIPSELGNLKSLISLDLY 126

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPV 662
                G IP S+G                GPIP  L  +S L  +D++ N L G+IPV
Sbjct: 127 NNNLTGKIPSSLGKLKSLVFLRLNENRLTGPIPRELTVISSLKVVDVSGNDLCGTIPV 184



>gb:AY664415_1620622 Zea mays cultivar B73 locus 9009, complete
           sequence.>gb:AY664419_1620660 Zea mays cultivar Mo17
           locus 9009, complete sequence.
          Length = 693

 Score = 79.7 bits (195), Expect = 5e-14
 Identities = 56/169 (33%), Positives = 79/169 (46%), Gaps = 7/169 (4%)
 Frame = +3

Query: 177 GIVAFTDNNDYVAIKALRDGWKNVPP--SW-AEGSDPCGDHWEGVGCNGSRVVSLTLSSM 347
           G  A TD+ND  A+        + P   +W ++  DPCG  W GV C+GSRV ++ LS M
Sbjct: 20  GANANTDSNDVNALNVFYTTMNSPPQLTNWVSQNGDPCGQSWLGVTCSGSRVTAIKLSGM 79

Query: 348 DLTGELSGDIEELSELQILDLSYN----KDLTGSLPREIGNLKKLYNLILVGCGFFGLIP 515
            L G L  ++ +L+ L  LD+S N     D+  +LP  + +L    N       F G +P
Sbjct: 80  RLNGTLGYNMNQLTALVQLDMSNNNLGGSDIPYNLPPNLQSLNLAVN------NFTGTVP 133

Query: 516 DSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPV 662
            SI               F G IP S   L+ L  L L +N+  G+I V
Sbjct: 134 YSISQMVALRDLDLSYNTFSGDIPHSFNSLTSLKTLYLQNNKFNGTIDV 182



>gb:AY162176_1585779 Medicago truncatula somatic embryogenesis
           receptor kinase 1 (SERK1) mRNA, complete
           cds.>gb:AY162177_1585780 Medicago truncatula somatic
           embryogenesis receptor kinase 1 (SERK1) gene, complete
           cds.
          Length = 627

 Score = 79.7 bits (195), Expect = 5e-14
 Identities = 53/141 (37%), Positives = 75/141 (53%), Gaps = 2/141 (1%)
 Frame = +3

Query: 243 NVPPSWAEGS-DPCGDHWEGVGCNGSR-VVSLTLSSMDLTGELSGDIEELSELQILDLSY 416
           NV  SW     +PC   W  V CN    V+ + L +  L+G L   + +L  LQ L+L Y
Sbjct: 47  NVLQSWDPTLVNPCT--WFHVTCNNDNSVIRVDLGNAALSGTLVPQLGQLKNLQYLEL-Y 103

Query: 417 NKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSL 596
           + ++TG +P ++GNL  L +L L    F G IPDS+G               +GPIP SL
Sbjct: 104 SNNITGPIPSDLGNLTNLVSLDLYLNRFNGPIPDSLGKLSKLRFLRLNNNSLMGPIPMSL 163

Query: 597 GQLSELYWLDLADNQLTGSIP 659
             +S L  LDL++NQL+G +P
Sbjct: 164 TNISALQVLDLSNNQLSGVVP 184



>gb:AB018110_1513754 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K19M13.>gb:AY093083_1575037 Arabidopsis
           thaliana unknown protein (At5g23400) mRNA, complete
           cds.>gb:BT003360_1636783 Arabidopsis thaliana unknown
           protein (At5g23400) mRNA, complete cds.
          Length = 589

 Score = 79.7 bits (195), Expect = 5e-14
 Identities = 63/197 (31%), Positives = 82/197 (41%), Gaps = 32/197 (16%)
 Frame = +3

Query: 255 SWAEGSDPCGDHWEGVGCNGS--RVVSLTLSS------MDLTGELSGDIEELSELQILDL 410
           SW  G D C   WEGV CN +  +V  L L S      + + G LS  +  L  L++L +
Sbjct: 56  SWV-GKDCCNGDWEGVQCNPATGKVTGLVLQSAVNEPTLYMKGTLSPSLGNLRSLELLLI 114

Query: 411 SYNKDLTGSLPREIGNLKKLYNLI------------------------LVGCGFFGLIPD 518
           + NK +TGS+P    NL  L  LI                        L G  F GL+P 
Sbjct: 115 TGNKFITGSIPNSFSNLTSLRQLILDDNSLQGNVLSSLGHLPLLEILSLAGNRFSGLVPA 174

Query: 519 SIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLV 698
           S G              F GPIP +   L +L  LDL+ N L+G IP   G    L  L 
Sbjct: 175 SFGSLRRLTTMNLARNSFSGPIPVTFKNLLKLENLDLSSNLLSGPIPDFIGQFQNLTNL- 233

Query: 699 GTKHFHFGXNKFSGEIP 749
                +   N+FSG +P
Sbjct: 234 -----YLSSNRFSGVLP 245



 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 47/144 (32%), Positives = 66/144 (45%), Gaps = 1/144 (0%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSY-NKDLTGSLPREIGNLKKLYNLILVGCG 497
           V S+ LSS  +TG LS  I   +   + ++   N  ++G +P + G    L  L +    
Sbjct: 421 VASIDLSSNLVTGSLSSLINNKTSSFLEEIHLTNNQISGRIP-DFGESLNLKVLNIGSNK 479

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
             G IP SI                 G IP ++GQL++L WLDL+ N LTG IP S  N 
Sbjct: 480 ISGQIPSSISNLVELVRLDISRNHITGGIPQAIGQLAQLKWLDLSINALTGRIPDSLLNI 539

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIP 749
             +      KH  F  N+  G+IP
Sbjct: 540 KTI------KHASFRANRLCGQIP 557



 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 35/115 (30%), Positives = 54/115 (46%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           ++ +L LSS  L+G +   I +   L  L LS N+  +G LP  + +L+KL  + L   G
Sbjct: 205 KLENLDLSSNLLSGPIPDFIGQFQNLTNLYLSSNR-FSGVLPVSVYSLRKLQTMSLERNG 263

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPV 662
             G + D                 FIG IP S+  L  L+ L+L+ N  +  +PV
Sbjct: 264 LTGPLSDRFSYLKSLTSLQLSGNKFIGHIPASITGLQNLWSLNLSRNLFSDPLPV 318



>gb:AC087553_1734109 Oryza sativa (japonica cultivar-group) chromosome
            5 clone P0685E10, complete sequence.
          Length = 1007

 Score = 79.3 bits (194), Expect = 7e-14
 Identities = 56/148 (37%), Positives = 69/148 (46%)
 Frame = +3

Query: 309  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
            N SR+  L L    LTG +   +  L  L  LDLS N  LTG +P E+G    L  L L 
Sbjct: 673  NCSRLTHLNLDGNSLTGAVPPWLGGLRSLGELDLSSNA-LTGGIPVELGGCSGLLKLSLS 731

Query: 489  GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
            G    G IP  IG              F G IPP L + ++LY L L++N L G IP   
Sbjct: 732  GNRLSGSIPPEIGKLTSLNVLNLQKNGFTGVIPPELRRCNKLYELRLSENSLEGPIPAEL 791

Query: 669  GNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            G  P L +++         NK SGEIPA
Sbjct: 792  GQLPELQVIL-----DLSRNKLSGEIPA 814



 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 53/143 (37%), Positives = 66/143 (46%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +V+L L +    G L   I  LS L++L L Y+  LTG +P EIG L++L  L L     
Sbjct: 414 LVNLALHNNSFAGVLPPQIGNLSNLEVLSL-YHNGLTGGIPPEIGRLQRLKLLFLYENEM 472

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IPD +               F GPIP S+G L  L  L L  N LTG IP S G   
Sbjct: 473 TGAIPDEMTNCSSLEEVDFFGNHFHGPIPASIGNLKNLAVLQLRQNDLTGPIPASLGECR 532

Query: 681 GLDMLVGTKHFHFGXNKFSGEIP 749
            L  L          N+ SGE+P
Sbjct: 533 SLQALA------LADNRLSGELP 549



 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 46/142 (32%), Positives = 72/142 (50%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L + +  L GE+  ++ + SEL+ + ++Y + L G++P +IGNLK+L  L L      G 
Sbjct: 170 LRIGNNPLRGEIPPELGDCSELETIGMAYCQ-LIGAIPHQIGNLKQLQQLALDNNTLTGG 228

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           +P+ +                 G IP S+G LS L  L+LA+NQ +G IP   GN  GL 
Sbjct: 229 LPEQLAGCANLRVLSVADNKLDGVIPSSIGGLSSLQSLNLANNQFSGVIPPEIGNLSGLT 288

Query: 690 MLVGTKHFHFGXNKFSGEIPAQ 755
            L      +   N+ +G IP +
Sbjct: 289 YL------NLLGNRLTGGIPEE 304



 Score = 70.1 bits (170), Expect = 4e-11
 Identities = 54/164 (32%), Positives = 76/164 (46%), Gaps = 1/164 (0%)
 Frame = +3

Query: 264 EGSDPCG-DHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSL 440
           EG+ P G  + +G G   S + +L L+  DL G +   +   + L+ +D+S N  LTG +
Sbjct: 347 EGTIPEGLCNGDGNGNGNSSLENLFLAGNDLGGSIDA-LLSCTSLKSIDVS-NNSLTGEI 404

Query: 441 PREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYW 620
           P  I  L  L NL L    F G++P  IG                G IPP +G+L  L  
Sbjct: 405 PPAIDRLPGLVNLALHNNSFAGVLPPQIGNLSNLEVLSLYHNGLTGGIPPEIGRLQRLKL 464

Query: 621 LDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           L L +N++TG+IP    N   L+         F  N F G IPA
Sbjct: 465 LFLYENEMTGAIPDEMTNCSSLE------EVDFFGNHFHGPIPA 502



 Score = 69.7 bits (169), Expect = 5e-11
 Identities = 46/129 (35%), Positives = 64/129 (49%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +  L+L    LTG +  +I  L  L++L L Y  ++TG++P E+ N   L  +   
Sbjct: 434 NLSNLEVLSLYHNGLTGGIPPEIGRLQRLKLLFL-YENEMTGAIPDEMTNCSSLEEVDFF 492

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
           G  F G IP SIG                GPIP SLG+   L  L LADN+L+G +P S 
Sbjct: 493 GNHFHGPIPASIGNLKNLAVLQLRQNDLTGPIPASLGECRSLQALALADNRLSGELPESF 552

Query: 669 GNTPGLDML 695
           G    L ++
Sbjct: 553 GRLAELSVV 561



 Score = 66.2 bits (160), Expect = 6e-10
 Identities = 70/255 (27%), Positives = 101/255 (39%), Gaps = 49/255 (19%)
 Frame = +3

Query: 138 IQLLLVPLFIQFL---GIVAFTDNNDYVAIKALRDGWKN---VPPSWAEGSDPCGDHWEG 299
           I L L+PLF   L      A T +     +  ++ G+ +   V   W+  +D C   W G
Sbjct: 28  IVLALLPLFCGILLAPSCEAATVDTTSATLLQVKSGFTDPNGVLSGWSPEADVCS--WHG 85

Query: 300 VGC-NGSRVVS-LTLSSMDLTGELSGDIEELSELQILDLSYNKD---------------- 425
           V C  G  +V+ L LS   L+G +S  I  L  ++ +DLS N                  
Sbjct: 86  VTCLTGEGIVTGLNLSGYGLSGTISPAIAGLVSVESIDLSSNSLTGAIPPELGTMKSLKT 145

Query: 426 -------LTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPI 584
                  LTG++P E+G LK L  L +      G IP  +G               IG I
Sbjct: 146 LLLHSNLLTGAIPPELGGLKNLKLLRIGNNPLRGEIPPELGDCSELETIGMAYCQLIGAI 205

Query: 585 PPSLGQLSELYWLDLADNQLTGSIP-------------VSDGNTPG-----LDMLVGTKH 710
           P  +G L +L  L L +N LTG +P             V+D    G     +  L   + 
Sbjct: 206 PHQIGNLKQLQQLALDNNTLTGGLPEQLAGCANLRVLSVADNKLDGVIPSSIGGLSSLQS 265

Query: 711 FHFGXNKFSGEIPAQ 755
            +   N+FSG IP +
Sbjct: 266 LNLANNQFSGVIPPE 280



 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 51/150 (34%), Positives = 70/150 (46%), Gaps = 1/150 (0%)
 Frame = +3

Query: 303  GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI 482
            GC+G  ++ L+LS   L+G +  +I +L+ L +L+L  N   TG +P E+    KLY L 
Sbjct: 721  GCSG--LLKLSLSGNRLSGSIPPEIGKLTSLNVLNLQKN-GFTGVIPPELRRCNKLYELR 777

Query: 483  LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFI-GPIPPSLGQLSELYWLDLADNQLTGSIP 659
            L      G IP  +G               + G IP SLG L +L  L+L+ NQL G IP
Sbjct: 778  LSENSLEGPIPAELGQLPELQVILDLSRNKLSGEIPASLGDLVKLERLNLSSNQLHGQIP 837

Query: 660  VSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
                  P L  L      +   N  SG IP
Sbjct: 838  ------PSLLQLTSLHLLNLSDNLLSGGIP 861



 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 48/145 (33%), Positives = 66/145 (45%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +V L L+   L G +  ++ +L+EL+ILDLS N + +G +P E+ N  +L +L L G   
Sbjct: 629 MVRLQLAGNRLAGAIPAELGDLTELKILDLS-NNNFSGDIPPELSNCSRLTHLNLDG--- 684

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
                                    G +PP LG L  L  LDL+ N LTG IPV  G   
Sbjct: 685 ---------------------NSLTGAVPPWLGGLRSLGELDLSSNALTGGIPVELGGCS 723

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
           GL  L          N+ SG IP +
Sbjct: 724 GLLKL------SLSGNRLSGSIPPE 742



 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 41/143 (28%), Positives = 65/143 (45%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           R+  L L   ++TG +  ++   S L+ +D  +     G +P  IGNLK L  L L    
Sbjct: 461 RLKLLFLYENEMTGAIPDEMTNCSSLEEVDF-FGNHFHGPIPASIGNLKNLAVLQLRQND 519

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
             G IP S+G                G +P S G+L+EL  + L +N L G++P S    
Sbjct: 520 LTGPIPASLGECRSLQALALADNRLSGELPESFGRLAELSVVTLYNNSLEGALPESMFEL 579

Query: 678 PGLDMLVGTKHFHFGXNKFSGEI 746
             L ++      +F  N+F+G +
Sbjct: 580 KNLTVI------NFSHNRFTGAV 596



 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 51/155 (32%), Positives = 69/155 (44%), Gaps = 5/155 (3%)
 Frame = +3

Query: 303 GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI 482
           GC   RV+S+  + +D  G +   I  LS LQ L+L+ N   +G +P EIGNL  L  L 
Sbjct: 235 GCANLRVLSVADNKLD--GVIPSSIGGLSSLQSLNLA-NNQFSGVIPPEIGNLSGLTYLN 291

Query: 483 LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPP-SLGQLSELYWLDLADNQLTGSIP 659
           L+G    G IP+ +                 G I   S  QL  L +L L++N L G+IP
Sbjct: 292 LLGNRLTGGIPEELNRLSQLQVVDLSKNNLSGEISAISASQLKNLKYLVLSENLLEGTIP 351

Query: 660 V----SDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
                 DGN  G   L   ++     N   G I A
Sbjct: 352 EGLCNGDGNGNGNSSL---ENLFLAGNDLGGSIDA 383



>gb:AC084817_1733844 Oryza sativa (japonica cultivar-group) chromosome
            5 clone P0419C04, complete sequence.
          Length = 1117

 Score = 79.3 bits (194), Expect = 7e-14
 Identities = 56/148 (37%), Positives = 69/148 (46%)
 Frame = +3

Query: 309  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
            N SR+  L L    LTG +   +  L  L  LDLS N  LTG +P E+G    L  L L 
Sbjct: 783  NCSRLTHLNLDGNSLTGAVPPWLGGLRSLGELDLSSNA-LTGGIPVELGGCSGLLKLSLS 841

Query: 489  GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
            G    G IP  IG              F G IPP L + ++LY L L++N L G IP   
Sbjct: 842  GNRLSGSIPPEIGKLTSLNVLNLQKNGFTGVIPPELRRCNKLYELRLSENSLEGPIPAEL 901

Query: 669  GNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            G  P L +++         NK SGEIPA
Sbjct: 902  GQLPELQVIL-----DLSRNKLSGEIPA 924



 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 53/143 (37%), Positives = 66/143 (46%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +V+L L +    G L   I  LS L++L L Y+  LTG +P EIG L++L  L L     
Sbjct: 524 LVNLALHNNSFAGVLPPQIGNLSNLEVLSL-YHNGLTGGIPPEIGRLQRLKLLFLYENEM 582

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IPD +               F GPIP S+G L  L  L L  N LTG IP S G   
Sbjct: 583 TGAIPDEMTNCSSLEEVDFFGNHFHGPIPASIGNLKNLAVLQLRQNDLTGPIPASLGECR 642

Query: 681 GLDMLVGTKHFHFGXNKFSGEIP 749
            L  L          N+ SGE+P
Sbjct: 643 SLQALA------LADNRLSGELP 659



 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 46/142 (32%), Positives = 72/142 (50%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L + +  L GE+  ++ + SEL+ + ++Y + L G++P +IGNLK+L  L L      G 
Sbjct: 280 LRIGNNPLRGEIPPELGDCSELETIGMAYCQ-LIGAIPHQIGNLKQLQQLALDNNTLTGG 338

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           +P+ +                 G IP S+G LS L  L+LA+NQ +G IP   GN  GL 
Sbjct: 339 LPEQLAGCANLRVLSVADNKLDGVIPSSIGGLSSLQSLNLANNQFSGVIPPEIGNLSGLT 398

Query: 690 MLVGTKHFHFGXNKFSGEIPAQ 755
            L      +   N+ +G IP +
Sbjct: 399 YL------NLLGNRLTGGIPEE 414



 Score = 70.1 bits (170), Expect = 4e-11
 Identities = 54/164 (32%), Positives = 76/164 (46%), Gaps = 1/164 (0%)
 Frame = +3

Query: 264 EGSDPCG-DHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSL 440
           EG+ P G  + +G G   S + +L L+  DL G +   +   + L+ +D+S N  LTG +
Sbjct: 457 EGTIPEGLCNGDGNGNGNSSLENLFLAGNDLGGSIDA-LLSCTSLKSIDVS-NNSLTGEI 514

Query: 441 PREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYW 620
           P  I  L  L NL L    F G++P  IG                G IPP +G+L  L  
Sbjct: 515 PPAIDRLPGLVNLALHNNSFAGVLPPQIGNLSNLEVLSLYHNGLTGGIPPEIGRLQRLKL 574

Query: 621 LDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           L L +N++TG+IP    N   L+         F  N F G IPA
Sbjct: 575 LFLYENEMTGAIPDEMTNCSSLE------EVDFFGNHFHGPIPA 612



 Score = 69.7 bits (169), Expect = 5e-11
 Identities = 46/129 (35%), Positives = 64/129 (49%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +  L+L    LTG +  +I  L  L++L L Y  ++TG++P E+ N   L  +   
Sbjct: 544 NLSNLEVLSLYHNGLTGGIPPEIGRLQRLKLLFL-YENEMTGAIPDEMTNCSSLEEVDFF 602

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
           G  F G IP SIG                GPIP SLG+   L  L LADN+L+G +P S 
Sbjct: 603 GNHFHGPIPASIGNLKNLAVLQLRQNDLTGPIPASLGECRSLQALALADNRLSGELPESF 662

Query: 669 GNTPGLDML 695
           G    L ++
Sbjct: 663 GRLAELSVV 671



 Score = 66.2 bits (160), Expect = 6e-10
 Identities = 70/255 (27%), Positives = 101/255 (39%), Gaps = 49/255 (19%)
 Frame = +3

Query: 138 IQLLLVPLFIQFL---GIVAFTDNNDYVAIKALRDGWKN---VPPSWAEGSDPCGDHWEG 299
           I L L+PLF   L      A T +     +  ++ G+ +   V   W+  +D C   W G
Sbjct: 138 IVLALLPLFCGILLAPSCEAATVDTTSATLLQVKSGFTDPNGVLSGWSPEADVCS--WHG 195

Query: 300 VGC-NGSRVVS-LTLSSMDLTGELSGDIEELSELQILDLSYNKD---------------- 425
           V C  G  +V+ L LS   L+G +S  I  L  ++ +DLS N                  
Sbjct: 196 VTCLTGEGIVTGLNLSGYGLSGTISPAIAGLVSVESIDLSSNSLTGAIPPELGTMKSLKT 255

Query: 426 -------LTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPI 584
                  LTG++P E+G LK L  L +      G IP  +G               IG I
Sbjct: 256 LLLHSNLLTGAIPPELGGLKNLKLLRIGNNPLRGEIPPELGDCSELETIGMAYCQLIGAI 315

Query: 585 PPSLGQLSELYWLDLADNQLTGSIP-------------VSDGNTPG-----LDMLVGTKH 710
           P  +G L +L  L L +N LTG +P             V+D    G     +  L   + 
Sbjct: 316 PHQIGNLKQLQQLALDNNTLTGGLPEQLAGCANLRVLSVADNKLDGVIPSSIGGLSSLQS 375

Query: 711 FHFGXNKFSGEIPAQ 755
            +   N+FSG IP +
Sbjct: 376 LNLANNQFSGVIPPE 390



 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 51/150 (34%), Positives = 70/150 (46%), Gaps = 1/150 (0%)
 Frame = +3

Query: 303  GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI 482
            GC+G  ++ L+LS   L+G +  +I +L+ L +L+L  N   TG +P E+    KLY L 
Sbjct: 831  GCSG--LLKLSLSGNRLSGSIPPEIGKLTSLNVLNLQKN-GFTGVIPPELRRCNKLYELR 887

Query: 483  LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFI-GPIPPSLGQLSELYWLDLADNQLTGSIP 659
            L      G IP  +G               + G IP SLG L +L  L+L+ NQL G IP
Sbjct: 888  LSENSLEGPIPAELGQLPELQVILDLSRNKLSGEIPASLGDLVKLERLNLSSNQLHGQIP 947

Query: 660  VSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
                  P L  L      +   N  SG IP
Sbjct: 948  ------PSLLQLTSLHLLNLSDNLLSGGIP 971



 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 48/145 (33%), Positives = 66/145 (45%)
 Frame = +3

Query: 321  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
            +V L L+   L G +  ++ +L+EL+ILDLS N + +G +P E+ N  +L +L L G   
Sbjct: 739  MVRLQLAGNRLAGAIPAELGDLTELKILDLS-NNNFSGDIPPELSNCSRLTHLNLDG--- 794

Query: 501  FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
                                     G +PP LG L  L  LDL+ N LTG IPV  G   
Sbjct: 795  ---------------------NSLTGAVPPWLGGLRSLGELDLSSNALTGGIPVELGGCS 833

Query: 681  GLDMLVGTKHFHFGXNKFSGEIPAQ 755
            GL  L          N+ SG IP +
Sbjct: 834  GLLKL------SLSGNRLSGSIPPE 852



 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 41/143 (28%), Positives = 65/143 (45%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           R+  L L   ++TG +  ++   S L+ +D  +     G +P  IGNLK L  L L    
Sbjct: 571 RLKLLFLYENEMTGAIPDEMTNCSSLEEVDF-FGNHFHGPIPASIGNLKNLAVLQLRQND 629

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
             G IP S+G                G +P S G+L+EL  + L +N L G++P S    
Sbjct: 630 LTGPIPASLGECRSLQALALADNRLSGELPESFGRLAELSVVTLYNNSLEGALPESMFEL 689

Query: 678 PGLDMLVGTKHFHFGXNKFSGEI 746
             L ++      +F  N+F+G +
Sbjct: 690 KNLTVI------NFSHNRFTGAV 706



 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 51/155 (32%), Positives = 69/155 (44%), Gaps = 5/155 (3%)
 Frame = +3

Query: 303 GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI 482
           GC   RV+S+  + +D  G +   I  LS LQ L+L+ N   +G +P EIGNL  L  L 
Sbjct: 345 GCANLRVLSVADNKLD--GVIPSSIGGLSSLQSLNLA-NNQFSGVIPPEIGNLSGLTYLN 401

Query: 483 LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPP-SLGQLSELYWLDLADNQLTGSIP 659
           L+G    G IP+ +                 G I   S  QL  L +L L++N L G+IP
Sbjct: 402 LLGNRLTGGIPEELNRLSQLQVVDLSKNNLSGEISAISASQLKNLKYLVLSENLLEGTIP 461

Query: 660 V----SDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
                 DGN  G   L   ++     N   G I A
Sbjct: 462 EGLCNGDGNGNGNSSL---ENLFLAGNDLGGSIDA 493



>gb:AP003513_1830178 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0690H04.
          Length = 616

 Score = 79.0 bits (193), Expect = 9e-14
 Identities = 59/179 (32%), Positives = 83/179 (46%), Gaps = 2/179 (1%)
 Frame = +3

Query: 135 RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSW-AEGSDPCGDHWEGVGCN 311
           R+ LLLV L  +   ++  ++        A   G      SW A   +PC   W  V C 
Sbjct: 6   RLLLLLVLLLCRLAAVLPTSEVEALQGFMAGFAGGNAAFQSWDASAPNPCT--WFHVTCG 63

Query: 312 -GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
            G++V+ L L +  L+GEL  DI +L  LQ L+L Y   ++G +P E+G L  L  L L 
Sbjct: 64  PGNQVIRLDLGNQSLSGELKPDIWQLQALQSLEL-YGNSISGKIPSELGRLASLQTLDLY 122

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
              F G IP+ +G                G IP SL  +  L  LDL+ N L+G IP +
Sbjct: 123 LNNFTGEIPNELGNLSKLSNLRLNNNSLSGAIPMSLTTIQNLEVLDLSHNNLSGIIPTN 181



>gb:ZMA277702_1731487 Zea mays mRNA for SERK1
           protein.>gb:ZMA400868_1731516 Zea mays serk1 gene for
           somatic embryogenesis receptor-like kinase 1, exons
           1-11.
          Length = 622

 Score = 79.0 bits (193), Expect = 9e-14
 Identities = 56/174 (32%), Positives = 88/174 (50%), Gaps = 5/174 (2%)
 Frame = +3

Query: 159 LFIQFLGIVAFTDNNDYVAIKALRDGWK---NVPPSWAEGS-DPCGDHWEGVGCN-GSRV 323
           +F   +G++    N +  A+ +LR   K   NV  SW     +PC   W  V CN  + V
Sbjct: 13  VFSVVVGVIPVVANTEGDALYSLRQSLKDNNNVLQSWDPTLVNPCT--WFHVTCNPDNSV 70

Query: 324 VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF 503
           + L L +  L+G L   + +L  +Q L+L Y+ +++G +P E+GNL  L +L L    F 
Sbjct: 71  IRLDLGNAQLSGPLVPQLGQLKNMQYLEL-YSNNISGPIPPELGNLTNLVSLDLYLNNFT 129

Query: 504 GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
           G IPD++G                G IP +L  ++ L  LDL++N L+G +P S
Sbjct: 130 GGIPDTLGQLSKLRFLRLNNNSLSGQIPKTLTNINTLQVLDLSNNNLSGGVPSS 183



>gb:AY518293_1610795 Arabidopsis thaliana strubbelig receptor family
           8 (SRF8) mRNA, complete cds.
          Length = 703

 Score = 79.0 bits (193), Expect = 9e-14
 Identities = 64/236 (27%), Positives = 97/236 (41%), Gaps = 30/236 (12%)
 Frame = +3

Query: 138 IQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDG---------WKNVPPSWAEGSDPCGDH 290
           + LL +     F  +   TD +D  A++ L            WKN       G DPCG+ 
Sbjct: 11  VLLLFIASISGFSVVRCVTDPSDVQALQVLYTSLNSPSQLTNWKN------GGGDPCGES 64

Query: 291 WEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYN----------------- 419
           W+G+ C GS VV++ +S + ++G L   + +L  L+ LD+S N                 
Sbjct: 65  WKGITCEGSAVVTIDISDLGVSGTLGYLLSDLKSLRKLDVSGNSIHDTLPYQLPPNLTSL 124

Query: 420 ----KDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIP 587
                +L+G+LP  I  +  L  + + G      I D                 F G +P
Sbjct: 125 NLARNNLSGNLPYSISAMGSLSYMNVSGNSLTMSIGDIFADHKSLATLDLSHNNFSGDLP 184

Query: 588 PSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            SL  +S L  L + +NQLTGSI V  G        +  K  +   N F+G IP +
Sbjct: 185 SSLSTVSTLSVLYVQNNQLTGSIDVLSG--------LPLKTLNVANNHFNGSIPKE 232



>gb:AY075690_1567829 Arabidopsis thaliana AT5g20480/F7C8_70 mRNA,
           complete cds.>gb:BT005820_1638742 Arabidopsis thaliana
           At5g20480/F7C8_70 gene, complete cds.
          Length = 1031

 Score = 79.0 bits (193), Expect = 9e-14
 Identities = 67/209 (32%), Positives = 94/209 (44%), Gaps = 7/209 (3%)
 Frame = +3

Query: 144 LLLVPLFIQFLGIVAFTDNNDYVAIKALR-----DGWKNVPPSWAEGSDPCGDHWEGVGC 308
           LL V +F Q      F++  D  A+   +     +  + V  SW   S  C  +W GV C
Sbjct: 15  LLQVCIFAQ----ARFSNETDMQALLEFKSQVSENNKREVLASWNHSSPFC--NWIGVTC 68

Query: 309 NG--SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI 482
                RV+SL L    LTG +S  I  LS L++L+L+ N     ++P+++G L +L  L 
Sbjct: 69  GRRRERVISLNLGGFKLTGVISPSIGNLSFLRLLNLADN-SFGSTIPQKVGRLFRLQYLN 127

Query: 483 LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPV 662
           +      G IP S+                   +P  LG LS+L  LDL+ N LTG+ P 
Sbjct: 128 MSYNLLEGRIPSSLSNCSRLSTVDLSSNHLGHGVPSELGSLSKLAILDLSKNNLTGNFPA 187

Query: 663 SDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           S GN   L  L       F  N+  GEIP
Sbjct: 188 SLGNLTSLQKL------DFAYNQMRGEIP 210



 Score = 72.4 bits (176), Expect = 8e-12
 Identities = 50/147 (34%), Positives = 70/147 (47%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N SR+ ++ LSS  L   +  ++  LS+L ILDLS N +LTG+ P  +GNL  L  L   
Sbjct: 143 NCSRLSTVDLSSNHLGHGVPSELGSLSKLAILDLSKN-NLTGNFPASLGNLTSLQKLDFA 201

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IPD +               F G  PP+L  +S L  L LADN  +G++    
Sbjct: 202 YNQMRGEIPDEVARLTQMVFFQIALNSFSGGFPPALYNISSLESLSLADNSFSGNLRADF 261

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           G      +L   +    G N+F+G IP
Sbjct: 262 GY-----LLPNLRRLLLGTNQFTGAIP 283



 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 61/219 (27%), Positives = 85/219 (38%), Gaps = 24/219 (10%)
 Frame = +3

Query: 165 IQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSS 344
           ++F+G VA     +Y+ +   R G + +P S A  S              + + SL L  
Sbjct: 334 LEFIGAVANCTQLEYLDVGYNRLGGE-LPASIANLS--------------TTLTSLFLGQ 378

Query: 345 MDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSI 524
             ++G +  DI  L  LQ L L  N  L+G LP   G L  L  + L      G IP   
Sbjct: 379 NLISGTIPHDIGNLVSLQELSLETNM-LSGELPVSFGKLLNLQVVDLYSNAISGEIPSYF 437

Query: 525 GXXXXXXXXXXXXXXFIGPIPPSLG------------------------QLSELYWLDLA 632
           G              F G IP SLG                        Q+  L ++DL+
Sbjct: 438 GNMTRLQKLHLNSNSFHGRIPQSLGRCRYLLDLWMDTNRLNGTIPQEILQIPSLAYIDLS 497

Query: 633 DNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           +N LTG  P   G    L++LVG        NK SG++P
Sbjct: 498 NNFLTGHFPEEVGK---LELLVG---LGASYNKLSGKMP 530



>pir|B86479|B86479 hypothetical protein F14D7.1 - Arabidopsis
           thaliana>gb:AE005172_892360 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F14D7_1677431 Sequence of BAC F14D7 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 1120

 Score = 79.0 bits (193), Expect = 9e-14
 Identities = 52/149 (34%), Positives = 71/149 (47%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N   +  L LS   LTG +   +  L  L +L L Y   LTG +P EIGN++ + NL L 
Sbjct: 220 NMESMTDLALSQNKLTGSIPSTLGNLKNLMVLYL-YENYLTGVIPPEIGNMESMTNLALS 278

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP S+G                G IPP LG +  +  L+L++N+LTGSIP S 
Sbjct: 279 QNKLTGSIPSSLGNLKNLTLLSLFQNYLTGGIPPKLGNIESMIDLELSNNKLTGSIPSSL 338

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           GN   L +L      +   N  +G IP +
Sbjct: 339 GNLKNLTIL------YLYENYLTGVIPPE 361



 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 51/147 (34%), Positives = 69/147 (46%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N   ++ L LS+  LTG +   +  L  L IL L Y   LTG +P E+GN++ + +L L 
Sbjct: 316 NIESMIDLELSNNKLTGSIPSSLGNLKNLTILYL-YENYLTGVIPPELGNMESMIDLQLN 374

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP S G                G IP  LG +  +  LDL+ N+LTGS+P S 
Sbjct: 375 NNKLTGSIPSSFGNLKNLTYLYLYLNYLTGVIPQELGNMESMINLDLSQNKLTGSVPDSF 434

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           GN   L+ L      +   N  SG IP
Sbjct: 435 GNFTKLESL------YLRVNHLSGAIP 455



 Score = 73.2 bits (178), Expect = 5e-12
 Identities = 49/149 (32%), Positives = 69/149 (46%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N   + +L LS   LTG +   +  L  L +L L  N  LTG +P ++GN++ + +L L 
Sbjct: 268 NMESMTNLALSQNKLTGSIPSSLGNLKNLTLLSLFQNY-LTGGIPPKLGNIESMIDLELS 326

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP S+G                G IPP LG +  +  L L +N+LTGSIP S 
Sbjct: 327 NNKLTGSIPSSLGNLKNLTILYLYENYLTGVIPPELGNMESMIDLQLNNNKLTGSIPSSF 386

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           GN   L  L      +   N  +G IP +
Sbjct: 387 GNLKNLTYL------YLYLNYLTGVIPQE 409



 Score = 72.8 bits (177), Expect = 6e-12
 Identities = 50/149 (33%), Positives = 73/149 (48%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S+++   LS+  LTGE+S  +  L  L +L L  N  LT  +P E+GN++ + +L L 
Sbjct: 124 NLSKLIYFDLSTNHLTGEISPSLGNLKNLTVLYLHQNY-LTSVIPSELGNMESMTDLALS 182

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP S+G                G IPP LG +  +  L L+ N+LTGSIP + 
Sbjct: 183 QNKLTGSIPSSLGNLKNLMVLYLYENYLTGVIPPELGNMESMTDLALSQNKLTGSIPSTL 242

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           GN   L +L      +   N  +G IP +
Sbjct: 243 GNLKNLMVL------YLYENYLTGVIPPE 265



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 44/129 (34%), Positives = 62/129 (48%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N   +  L LS   LTG +   +  L  L +L L Y   LTG +P E+GN++ + +L L 
Sbjct: 172 NMESMTDLALSQNKLTGSIPSSLGNLKNLMVLYL-YENYLTGVIPPELGNMESMTDLALS 230

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP ++G                G IPP +G +  +  L L+ N+LTGSIP S 
Sbjct: 231 QNKLTGSIPSTLGNLKNLMVLYLYENYLTGVIPPEIGNMESMTNLALSQNKLTGSIPSSL 290

Query: 669 GNTPGLDML 695
           GN   L +L
Sbjct: 291 GNLKNLTLL 299



 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 55/196 (28%), Positives = 85/196 (43%), Gaps = 17/196 (8%)
 Frame = +3

Query: 219  KALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQ 398
            K+LRD  K++  +   G+   GD +E  G     +  +  S     GE+S + E+  +L 
Sbjct: 504  KSLRD-CKSLIRARFLGNKFTGDIFEAFGIYPD-LNFIDFSHNKFHGEISSNWEKSPKLG 561

Query: 399  ILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIG 578
             L +S N ++TG++P EI N+ +L  L L     FG +P++IG                G
Sbjct: 562  ALIMS-NNNITGAIPTEIWNMTQLVELDLSTNNLFGELPEAIGNLTNLSRLRLNGNQLSG 620

Query: 579  PIPPSLGQLSELYWLDLADNQLTGSIPVS-----------------DGNTPGLDMLVGTK 707
             +P  L  L+ L  LDL+ N  +  IP +                 DG+ P L  L    
Sbjct: 621  RVPAGLSFLTNLESLDLSSNNFSSEIPQTFDSFLKLHDMNLSRNKFDGSIPRLSKLTQLT 680

Query: 708  HFHFGXNKFSGEIPAQ 755
                  N+  GEIP+Q
Sbjct: 681  QLDLSHNQLDGEIPSQ 696



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 50/157 (31%), Positives = 68/157 (43%), Gaps = 2/157 (1%)
 Frame = +3

Query: 291 WEGVGCNG-SRVVSLTLSSMDLTGELSG-DIEELSELQILDLSYNKDLTGSLPREIGNLK 464
           W GV CN    +  L L++  + G         LS L  +DLS N  L+G++P + GNL 
Sbjct: 68  WYGVSCNSRGSIEELNLTNTGIEGTFQDFPFISLSNLAYVDLSMNL-LSGTIPPQFGNLS 126

Query: 465 KLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQL 644
           KL    L      G I  S+G                  IP  LG +  +  L L+ N+L
Sbjct: 127 KLIYFDLSTNHLTGEISPSLGNLKNLTVLYLHQNYLTSVIPSELGNMESMTDLALSQNKL 186

Query: 645 TGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           TGSIP S GN   L +L      +   N  +G IP +
Sbjct: 187 TGSIPSSLGNLKNLMVL------YLYENYLTGVIPPE 217



 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 42/133 (31%), Positives = 59/133 (44%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           LTG +  ++  +  +  L L+ NK LTGS+P   GNLK L  L L      G+IP  +G 
Sbjct: 354 LTGVIPPELGNMESMIDLQLNNNK-LTGSIPSSFGNLKNLTYLYLYLNYLTGVIPQELGN 412

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH 710
                          G +P S G  ++L  L L  N L+G+IP    N+  L  L+    
Sbjct: 413 MESMINLDLSQNKLTGSVPDSFGNFTKLESLYLRVNHLSGAIPPGVANSSHLTTLI---- 468

Query: 711 FHFGXNKFSGEIP 749
                N F+G  P
Sbjct: 469 --LDTNNFTGFFP 479



 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 51/177 (28%), Positives = 72/177 (40%), Gaps = 23/177 (12%)
 Frame = +3

Query: 288  HWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKK 467
            +WE       ++ +L +S+ ++TG +  +I  +++L  LDLS N +L G LP  IGNL  
Sbjct: 553  NWE----KSPKLGALIMSNNNITGAIPTEIWNMTQLVELDLSTN-NLFGELPEAIGNLTN 607

Query: 468  LYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIP-------------------- 587
            L  L L G    G +P  +               F   IP                    
Sbjct: 608  LSRLRLNGNQLSGRVPAGLSFLTNLESLDLSSNNFSSEIPQTFDSFLKLHDMNLSRNKFD 667

Query: 588  ---PSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
               P L +L++L  LDL+ NQL G IP    +   LD L          N  SG IP
Sbjct: 668  GSIPRLSKLTQLTQLDLSHNQLDGEIPSQLSSLQSLDKL------DLSHNNLSGLIP 718



 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 41/132 (31%), Positives = 57/132 (43%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           LTG +  ++  +  +  LDLS NK LTGS+P   GN  KL +L L      G IP  +  
Sbjct: 402 LTGVIPQELGNMESMINLDLSQNK-LTGSVPDSFGNFTKLESLYLRVNHLSGAIPPGVAN 460

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH 710
                        F G  P ++ +  +L  + L  N L G IP S  +   L        
Sbjct: 461 SSHLTTLILDTNNFTGFFPETVCKGRKLQNISLDYNHLEGPIPKSLRDCKSL------IR 514

Query: 711 FHFGXNKFSGEI 746
             F  NKF+G+I
Sbjct: 515 ARFLGNKFTGDI 526



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 38/147 (25%), Positives = 62/147 (42%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S + +L L + + TG     + +  +LQ + L YN  L G +P+ + + K L     +
Sbjct: 460 NSSHLTTLILDTNNFTGFFPETVCKGRKLQNISLDYNH-LEGPIPKSLRDCKSLIRARFL 518

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
           G  F G I ++ G              F G I  +  +  +L  L +++N +TG+IP   
Sbjct: 519 GNKFTGDIFEAFGIYPDLNFIDFSHNKFHGEISSNWEKSPKLGALIMSNNNITGAIPTEI 578

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            N   L  L          N   GE+P
Sbjct: 579 WNMTQLVEL------DLSTNNLFGELP 599



>gb:AF244890_1780447 Glycine max receptor-like protein kinase 3
           (RLK3) mRNA, complete cds.
          Length = 1012

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 48/146 (32%), Positives = 69/146 (47%), Gaps = 1/146 (0%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           R+  L +S  +L G +  +I  LS L+ L + Y    TG +P EIGNL +L  L    CG
Sbjct: 188 RLQYLAVSGNELEGTIPPEIGNLSSLRELYIGYYNTYTGGIPPEIGNLSELVRLDAAYCG 247

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
             G IP ++G                G + P LG L  L  +DL++N L+G IP   G  
Sbjct: 248 LSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNMLSGEIPARFGEL 307

Query: 678 PGLDML-VGTKHFHFGXNKFSGEIPA 752
             + +L +     H    +F GE+PA
Sbjct: 308 KNITLLNLFRNKLHGAIPEFIGELPA 333



 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 66/239 (27%), Positives = 102/239 (42%), Gaps = 33/239 (13%)
 Frame = +3

Query: 138 IQLLLVPLFIQFLGI----VAFTDNNDYVAIKALRDGWKNVPP----SWAEGSDPCGDHW 293
           +++L + LF QFL            ++Y A+ +LR    +  P    SW   +  C   W
Sbjct: 1   MRVLFLFLFFQFLHFHFPKTLSAPISEYRALLSLRSAITDATPPLLTSWNSSTPYCS--W 58

Query: 294 EGVGCNGSR-VVSLTLSSMDLTGELSGDIEELSELQILDLSYNK----------DLTG-- 434
            GV C+  R V SL L+ +DL+G LS D+  L  L  L L+ NK           L+G  
Sbjct: 59  LGVTCDNRRHVTSLDLTGLDLSGPLSADVAHLPFLSNLSLASNKFSGPIPPSLSALSGLR 118

Query: 435 -----------SLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGP 581
                      + P E+  L+ L  L L      G++P ++               F G 
Sbjct: 119 FLNLSNNVFNETFPSELSRLQNLEVLDLYNNNMTGVLPLAVAQMQNLRHLHLGGNFFSGQ 178

Query: 582 IPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL-DMLVGTKHFHFGXNKFSGEIPAQ 755
           IPP  G+   L +L ++ N+L G+IP   GN   L ++ +G        N ++G IP +
Sbjct: 179 IPPEYGRWQRLQYLAVSGNELEGTIPPEIGNLSSLRELYIGY------YNTYTGGIPPE 231



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 45/134 (33%), Positives = 62/134 (46%), Gaps = 4/134 (2%)
 Frame = +3

Query: 363 LSGDIEELSELQI----LDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           LSG+  E+  + +    + LS N  L+G LP  IGN   +  LIL G  F G IP  IG 
Sbjct: 440 LSGEFPEVGSVAVNLGQITLS-NNQLSGVLPPSIGNFSSVQKLILDGNMFTGRIPPQIGR 498

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH 710
                        F GPI P + Q   L +LDL+ N+L+G IP       G+ +L    +
Sbjct: 499 LQQLSKIDFSGNKFSGPIVPEISQCKLLTFLDLSRNELSGDIP---NEITGMRIL---NY 552

Query: 711 FHFGXNKFSGEIPA 752
            +   N   G IP+
Sbjct: 553 LNLSRNHLVGGIPS 566



 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 41/132 (31%), Positives = 59/132 (44%)
 Frame = +3

Query: 354 TGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXX 533
           TG +  +I  LSEL  LD +Y   L+G +P  +G L+KL  L L      G +   +G  
Sbjct: 225 TGGIPPEIGNLSELVRLDAAYC-GLSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNL 283

Query: 534 XXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHF 713
                         G IP   G+L  +  L+L  N+L G+IP   G  P L+++      
Sbjct: 284 KSLKSMDLSNNMLSGEIPARFGELKNITLLNLFRNKLHGAIPEFIGELPALEVV------ 337

Query: 714 HFGXNKFSGEIP 749
               N F+G IP
Sbjct: 338 QLWENNFTGSIP 349



 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 40/134 (29%), Positives = 59/134 (44%)
 Frame = +3

Query: 348 DLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG 527
           + TG +   + +   L ++DLS NK LTG+LP  + +   L  LI +G   FG IP+S+G
Sbjct: 343 NFTGSIPEGLGKNGRLNLVDLSSNK-LTGTLPTYLCSGNTLQTLITLGNFLFGPIPESLG 401

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTK 707
                           G IP  L  L +L  ++L DN L+G  P        L  +    
Sbjct: 402 SCESLTRIRMGENFLNGSIPRGLFGLPKLTQVELQDNYLSGEFPEVGSVAVNLGQIT--- 458

Query: 708 HFHFGXNKFSGEIP 749
                 N+ SG +P
Sbjct: 459 ---LSNNQLSGVLP 469



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 47/165 (28%), Positives = 62/165 (37%), Gaps = 24/165 (14%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           S+ LS+  L+GE+     EL  + +L+L  NK L G++P  IG L  L  + L    F G
Sbjct: 288 SMDLSNNMLSGEIPARFGELKNITLLNLFRNK-LHGAIPEFIGELPALEVVQLWENNFTG 346

Query: 507 LIPDSIG------------------------XXXXXXXXXXXXXXFIGPIPPSLGQLSEL 614
            IP+ +G                                        GPIP SLG    L
Sbjct: 347 SIPEGLGKNGRLNLVDLSSNKLTGTLPTYLCSGNTLQTLITLGNFLFGPIPESLGSCESL 406

Query: 615 YWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
             + + +N L GSIP       GL  L          N  SGE P
Sbjct: 407 TRIRMGENFLNGSIP------RGLFGLPKLTQVELQDNYLSGEFP 445



>pir|T14818|T14818 leucine-rich repeat protein LRP -
           sorghum>gb:SBU62279_1704937 Sorghum bicolor leucine-rich
           repeat-containing extracellular glycoprotein mRNA,
           complete cds.
          Length = 247

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 56/163 (34%), Positives = 78/163 (47%), Gaps = 9/163 (5%)
 Frame = +3

Query: 243 NVPPSWAEG-SDPCGDHWEGVGCNGSR-VVSLTLSSMDLTGELSGDIEELSELQILDLSY 416
           NV  SW    ++PC   W  V CN +  V+ + L +  ++G L  D+ E+  LQ ++L Y
Sbjct: 42  NVLQSWNSTLANPCT--WFHVTCNNNNFVIRVDLGNAGISGPLLPDLAEIQNLQYIEL-Y 98

Query: 417 NKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSL 596
              L GS+P  +GNL  L +L L      G IP ++G                GPIP S 
Sbjct: 99  GNGLNGSIPETLGNLTNLISLDLWDNLLTGEIPTTLGSVSTLRYLRLYQNNLTGPIPSSF 158

Query: 597 GQLSELYWLDLADNQLTGSIPVSDGNTPGL-------DMLVGT 704
           G L+ L    L +N L+G+IP S GN   L       +ML GT
Sbjct: 159 GNLTSLLESKLQENSLSGAIPASLGNIKALQFSRLNDNMLTGT 201



 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 40/130 (30%), Positives = 52/130 (40%), Gaps = 9/130 (6%)
 Frame = +3

Query: 297 GVGCNGS---------RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPRE 449
           G G NGS          ++SL L    LTGE+   +  +S L+ L L Y  +LTG +P  
Sbjct: 99  GNGLNGSIPETLGNLTNLISLDLWDNLLTGEIPTTLGSVSTLRYLRL-YQNNLTGPIPSS 157

Query: 450 IGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDL 629
            GNL  L    L                              G IP SLG +  L +  L
Sbjct: 158 FGNLTSLLESKL------------------------QENSLSGAIPASLGNIKALQFSRL 193

Query: 630 ADNQLTGSIP 659
            DN LTG++P
Sbjct: 194 NDNMLTGTVP 203



>gb:AP005473_1852497 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBa0077B15.
          Length = 1065

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 64/234 (27%), Positives = 97/234 (41%), Gaps = 33/234 (14%)
 Frame = +3

Query: 144 LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPP-----SWAEGS---DPCGDHWEG 299
           LL  P F Q         + D +A+ A + G  + P      SW + S   + C   W G
Sbjct: 12  LLAAPAFGQL-------PSQDILALLAFKKGITHDPAGFITDSWNDESIDFNGCPASWNG 64

Query: 300 VGCNGSRV-------------------------VSLTLSSMDLTGELSGDIEELSELQIL 404
           + CNG+ V                         V L++++ +L+G L  ++  L  L+ +
Sbjct: 65  IVCNGANVAGVVLDGHGISGVADLSVFVNLTMLVKLSMANNNLSGSLPSNVGSLKSLKFM 124

Query: 405 DLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPI 584
           D+S N+  +G +P  IGNL+ L NL L    F G +PDSI                 GP+
Sbjct: 125 DISNNR-FSGPIPDNIGNLRSLQNLSLARNNFSGPLPDSIDGLASLQSLDVSGNSLSGPL 183

Query: 585 PPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEI 746
           P SL  L  +  L+L+ N  T  IP       GL +LV  +      N+  G +
Sbjct: 184 PSSLKGLRSMVALNLSYNAFTKGIP------SGLGLLVNLQSLDLSWNQLEGGV 231



 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 44/146 (30%), Positives = 62/146 (42%), Gaps = 2/146 (1%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTG-SLPREIGNLKKLYNLILVGC 494
           ++  L LSS    G +  ++   S LQ L +  N    G S P        L  L + G 
Sbjct: 458 KLTVLDLSSNQFRGPIPANLLTSSMLQELYIHDNMLSGGLSFPGSSSKNLSLQVLDISGN 517

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
            F G +PD I               F GP+P S+ +L+ L  LD++ NQ TGS+P     
Sbjct: 518 HFNGSLPDEIASLSSLQALDISTNNFSGPLPASITKLAALTALDISINQFTGSLP----- 572

Query: 675 TPGLDMLVGT-KHFHFGXNKFSGEIP 749
               D L  T + F+   N  SG +P
Sbjct: 573 ----DALPDTLQSFNASYNDLSGVVP 594



 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 39/140 (27%), Positives = 61/140 (43%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS+    G LS   +  ++L+ +DLS N +LTG++P       +L  L L        
Sbjct: 390 LDLSNNKFKGNLSVIAKWSNDLEYVDLSQN-NLTGTIPDVSSQFLRLNYLNLSHNSLADT 448

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP+++               F GPIP +L   S L  L + DN L+G +     ++  L 
Sbjct: 449 IPEAVVQYPKLTVLDLSSNQFRGPIPANLLTSSMLQELYIHDNMLSGGLSFPGSSSKNLS 508

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
           + V         N F+G +P
Sbjct: 509 LQV----LDISGNHFNGSLP 524



>gb:AP003044_1824341 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0038C05.>gb:AP005813_1858325 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0676F10.
          Length = 640

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 56/158 (35%), Positives = 76/158 (48%), Gaps = 2/158 (1%)
 Frame = +3

Query: 210 VAIKALRDGWKNVPPSWAEGS-DPCGDHWEGVGCNGSRVVS-LTLSSMDLTGELSGDIEE 383
           + IK L      V  SW + S DPC   W  + C+   +V+ L   S  L+G LS  I  
Sbjct: 37  IVIKNLLKDPHGVLKSWDQNSVDPCS--WAMITCSPDFLVTGLEAPSQHLSGLLSPSIGN 94

Query: 384 LSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXX 563
           L+ L+ + L  N ++TG +P EIG L+ L  L L    F+G IP S+G            
Sbjct: 95  LTNLETV-LLQNNNITGPIPAEIGRLENLKTLDLSSNSFYGEIPSSVGHLESLQYLRLNN 153

Query: 564 XXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
               GP P +   LS L +LDL+ N L+G IP S   T
Sbjct: 154 NTLSGPFPSASANLSHLVFLDLSYNNLSGPIPESLART 191



 Score = 42.4 bits (98), Expect = 0.009
 Identities = 26/83 (31%), Positives = 34/83 (40%)
 Frame = +3

Query: 504 GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG 683
           GL+  SIG                GPIP  +G+L  L  LDL+ N   G IP S G+   
Sbjct: 86  GLLSPSIGNLTNLETVLLQNNNITGPIPAEIGRLENLKTLDLSSNSFYGEIPSSVGHLES 145

Query: 684 LDMLVGTKHFHFGXNKFSGEIPA 752
           L      ++     N  SG  P+
Sbjct: 146 L------QYLRLNNNTLSGPFPS 162



>gb:AP000386_1819927 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone:MLD15.
          Length = 711

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 65/216 (30%), Positives = 77/216 (35%), Gaps = 51/216 (23%)
 Frame = +3

Query: 255 SWAEGSDPCGDHWEGVGCNGSR----------------------------VVSLTLSSMD 350
           SW   +  C + WEGV CN                               + +L LS  D
Sbjct: 74  SWGNNNSDCCN-WEGVTCNAKSGEVIELDLSCSYLHGRFHSNSSIRNLHFLTTLDLSFND 132

Query: 351 LTGELSGDIEELSELQILDLSYN-----------------------KDLTGSLPREIGNL 461
             G++   IE LS L  LDLS+N                          +G +P  IGNL
Sbjct: 133 FKGQIMSSIENLSHLTYLDLSFNHFSGQVPSSIGNLSHLTFLDLYCNQFSGQVPSSIGNL 192

Query: 462 KKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQ 641
             L  L L    FFG  P SIG              F+G IP S+G LS L  L L  N 
Sbjct: 193 SHLTTLELSFNRFFGQFPSSIGGLSHLTTLNLFVNNFLGQIPSSIGNLSNLTSLYLCKNN 252

Query: 642 LTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            +G IP   GN   L  L          N F GEIP
Sbjct: 253 FSGQIPSFIGNLSQLTRL------DLSSNNFFGEIP 282



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 47/168 (27%), Positives = 64/168 (38%), Gaps = 23/168 (13%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S + +L L   +  G++   I  LS L  L L  N + +G +P  IGNL +L  L L   
Sbjct: 217 SHLTTLNLFVNNFLGQIPSSIGNLSNLTSLYLCKN-NFSGQIPSFIGNLSQLTRLDLSSN 275

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIG-----------------------PIPPSLGQL 605
            FFG IP  +               FIG                        IP  + +L
Sbjct: 276 NFFGEIPGWLWTLPNLFYVNLSYNTFIGFQRPNKPEPSMGHLLGSNNNFTGKIPSFICEL 335

Query: 606 SELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
             L  LDL+DN  +G IP   GN     +     H +   N  SG +P
Sbjct: 336 RSLETLDLSDNNFSGLIPRCMGN-----LKSNLSHLNLRQNNLSGGLP 378



 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 30/87 (34%), Positives = 41/87 (47%)
 Frame = +3

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
           G  F G IP SIG              F G IP S+G+L+ L  LD++ N+L G IP   
Sbjct: 529 GNKFEGEIPKSIGLLKELLVLNLSNNAFTGHIPSSMGKLTALESLDVSQNKLYGEIPQEI 588

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           GN   L  +      +F  N+ +G +P
Sbjct: 589 GNLSFLSCM------NFSHNQLAGLVP 609



 Score = 38.9 bits (89), Expect = 0.10
 Identities = 24/62 (38%), Positives = 35/62 (56%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS+   TG +   + +L+ L+ LD+S NK L G +P+EIGNL  L  +        GL
Sbjct: 549 LNLSNNAFTGHIPSSMGKLTALESLDVSQNK-LYGEIPQEIGNLSFLSCMNFSHNQLAGL 607

Query: 510 IP 515
           +P
Sbjct: 608 VP 609



>gb:AE016959_1022362 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079936_1733087
           Genomic Sequence For Oryza sativa, Nipponbare Strain,
           Chromosome X, Clone OSJNBb0061I18, complete
           sequence.>gb:AE017089_1752181 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 43 of 77 of the
           complete sequence.
          Length = 736

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 66/204 (32%), Positives = 91/204 (44%), Gaps = 14/204 (6%)
 Frame = +3

Query: 180 IVAFTDNNDYVAIKALRD---------GWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSL 332
           + A TD ND   + AL           GW+        G DPCG  W+G+ C+GS V ++
Sbjct: 25  VAATTDANDVTVLNALFTSLNSPGQLRGWQ------VNGGDPCGASWQGITCSGSSVTAI 78

Query: 333 TLSSMDLTGELSGDIEELSELQILDLSYN-----KDLTGSLPREIGNLKKLYNLILVGCG 497
            L S+ L+G L+ ++  +  L  LD+S N     +++  +LP      KKL  L L G  
Sbjct: 79  KLPSLGLSGNLAYNMNTMESLVELDMSQNNLGGGQNIQYNLPN-----KKLERLNLAGNQ 133

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
           F G +P SI                 G +      L  L  L L +NQ TGSI V   N 
Sbjct: 134 FAGNVPYSISTMPKLKYLNLNHNQLQGNMTDVFSNLPSLSTLYLQNNQFTGSINVL-ANL 192

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIP 749
           P LD L      + G N+F+G IP
Sbjct: 193 P-LDNL------NVGNNRFTGWIP 209



>pir|T04313|T04313 protein kinase Xa21 (EC 2.7.1.-), receptor type -
           rice>gb:OSU72724_1698502 Oryza sativa receptor
           kinase-like protein gene, family member E, complete cds.
          Length = 813

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 60/161 (37%), Positives = 77/161 (47%), Gaps = 5/161 (3%)
 Frame = +3

Query: 282 GDH--WEGVGC---NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPR 446
           G H  W GV C   +  RVV L L S +L G +S  +  LS L+ L LS N  L+G +P+
Sbjct: 62  GQHCTWVGVVCGRRHPHRVVKLRLRSSNLAGIISPSLGNLSFLRTLQLSDNH-LSGKIPQ 120

Query: 447 EIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLD 626
           E+  L +L  L+L      G IP ++G                G IP SLG+L+ L  L 
Sbjct: 121 ELSRLSRLQQLVLNFNSLSGEIPAALGNLTSLSVLELTNNTLSGAIPSSLGKLTGLTDLA 180

Query: 627 LADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           LA+N L+GSIP S G    L  L          N  SG IP
Sbjct: 181 LAENTLSGSIPSSFGQLRRLSFL------SLAFNNLSGAIP 215



 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 52/165 (31%), Positives = 72/165 (43%), Gaps = 19/165 (11%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S +VSL++    ++G L  DI  L  LQ L L+ N  LTGSLP     LK L  L +   
Sbjct: 350 SSLVSLSIRDNKISGSLPRDIGNLVNLQYLSLA-NNSLTGSLPSSFSKLKNLRRLTVDNN 408

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G +P +IG              F G IP +LG L++L+ ++L  N   G IP+   +
Sbjct: 409 KLIGSLPLTIGNLTQLTNMEVQFNAFGGTIPSTLGNLTKLFQINLGHNNFIGQIPIEIFS 468

Query: 675 TPGLDMLVGTKH-------------------FHFGXNKFSGEIPA 752
            P L  ++   H                   FH   NK SGE P+
Sbjct: 469 IPALSEILDVSHNNLEGSIPKEIGKLKNIVEFHADSNKLSGENPS 513



 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 48/148 (32%), Positives = 72/148 (48%), Gaps = 1/148 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSEL-QILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           N +++  + L   +  G++  +I  +  L +ILD+S+N +L GS+P+EIG LK +     
Sbjct: 444 NLTKLFQINLGHNNFIGQIPIEIFSIPALSEILDVSHN-NLEGSIPKEIGKLKNIVEFHA 502

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                 G  P +IG                G IP +L QL  L  LDL+ N L+G IP+S
Sbjct: 503 DSNKLSGENPSTIGECQLLQHLFLQNNFLNGSIPIALTQLKGLDTLDLSGNNLSGQIPMS 562

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            G+ P L  L      +   N F GE+P
Sbjct: 563 LGDMPLLHSL------NLSFNSFHGEVP 584



 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 45/150 (30%), Positives = 67/150 (44%), Gaps = 1/150 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSE-LQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           N S +  + L      G L   +  LS  L  L +  NK ++GSLPR+IGNL  L  L L
Sbjct: 323 NCSNLQEVELGGCKFGGVLPDSVSNLSSSLVSLSIRDNK-ISGSLPRDIGNLVNLQYLSL 381

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                 G +P S                 IG +P ++G L++L  +++  N   G+IP +
Sbjct: 382 ANNSLTGSLPSSFSKLKNLRRLTVDNNKLIGSLPLTIGNLTQLTNMEVQFNAFGGTIPST 441

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            GN   L  +      + G N F G+IP +
Sbjct: 442 LGNLTKLFQI------NLGHNNFIGQIPIE 465



 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 47/174 (27%), Positives = 68/174 (39%), Gaps = 27/174 (15%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYN-----------------------KD 425
           SR+  L L+   L+GE+   +  L+ L +L+L+ N                         
Sbjct: 126 SRLQQLVLNFNSLSGEIPAALGNLTSLSVLELTNNTLSGAIPSSLGKLTGLTDLALAENT 185

Query: 426 LTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIP----PS 593
           L+GS+P   G L++L  L L      G IPD I                 G +P     +
Sbjct: 186 LSGSIPSSFGQLRRLSFLSLAFNNLSGAIPDPIWNISSLTIFEVISNKLSGTLPTNAFSN 245

Query: 594 LGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           L  L E+Y   +  NQ  G IP S GN   + +      F  G N FSG +P +
Sbjct: 246 LPSLQEVY---MYYNQFHGRIPASIGNASNISI------FTIGLNSFSGVVPPE 290



 Score = 49.3 bits (116), Expect = 8e-05
 Identities = 41/146 (28%), Positives = 65/146 (44%), Gaps = 2/146 (1%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPRE-IGNLKKLYNLILVGC 494
           R+  L+L+  +L+G +   I  +S L I ++  NK L+G+LP     NL  L  + +   
Sbjct: 199 RLSFLSLAFNNLSGAIPDPIWNISSLTIFEVISNK-LSGTLPTNAFSNLPSLQEVYMYYN 257

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
            F G IP SIG              F G +PP +G++  L  L+L +  L+ +   +D  
Sbjct: 258 QFHGRIPASIGNASNISIFTIGLNSFSGVVPPEIGRMRNLQRLELPET-LSEAEETNDWK 316

Query: 675 -TPGLDMLVGTKHFHFGXNKFSGEIP 749
               L      +    G  KF G +P
Sbjct: 317 FMTALTNCSNLQEVELGGCKFGGVLP 342



>pir|D84889|D84889 probable receptor-like protein kinase [imported]
           - Arabidopsis thaliana>gb:AC002387_1530588 Arabidopsis
           thaliana chromosome 2 clone F4L23 map CIC02E07, complete
           sequence.
          Length = 691

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 69/237 (29%), Positives = 100/237 (42%), Gaps = 28/237 (11%)
 Frame = +3

Query: 126 MIPRIQLLLVPLFIQFLGIVAFTDNNDY---VAIKALRDGWKNVPPSWAEGSDPCGD-HW 293
           M+  + L L+ LF  FL     + +++    + IK+  D  K    SW   +DPC    +
Sbjct: 1   MVSPLTLFLI-LFFFFLSSALSSSSSELDILLDIKSSLDPEKRFLTSWTPDADPCSSGSF 59

Query: 294 EGVGCNGSR-VVSLTLSSMDLTGELSGDIEELSELQILDLSYNK---------------- 422
           +GV C+G+R V +++L  M LTG +   I  L+ L  L L +N                 
Sbjct: 60  DGVACDGNRRVANISLQGMGLTGTIPPSIGLLTSLTGLYLHFNSLTGHIPKDISNLPLLT 119

Query: 423 -------DLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGP 581
                  +L+G +P  IGNL  L  + L      G IP   G                G 
Sbjct: 120 DLYLNVNNLSGEIPPLIGNLDNLQVIQLCYNKLSGSIPTQFGSLKKITVLALQYNQLSGA 179

Query: 582 IPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           IP SLG +  L  LDL+ N L G +PV     P L++L          N FSG +P+
Sbjct: 180 IPASLGDIDTLTRLDLSFNNLFGPVPVKLAGAPLLEVL------DIRNNSFSGFVPS 230



>gb:AP004769_1844738 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0017C12.
          Length = 1131

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 56/158 (35%), Positives = 74/158 (46%), Gaps = 4/158 (2%)
 Frame = +3

Query: 288 HWEGVGCNGS----RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIG 455
           +W+GV CN +    RV+ L +SS  L+G +   I  LS +  LDLS N  L G +P E+G
Sbjct: 65  NWQGVSCNNTQTQLRVMVLNVSSKGLSGSIPPCIGNLSSIASLDLSRNAFL-GKIPSELG 123

Query: 456 NLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLAD 635
            L ++  L L      G IPD +               F G IPPSL Q + L  + L +
Sbjct: 124 RLGQISYLNLSINSLEGRIPDELSSCSNLQVLGLSNNSFEGEIPPSLTQCTRLQQVILYN 183

Query: 636 NQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           N+L GSIP   G  P L      K      N   G+IP
Sbjct: 184 NKLEGSIPTRFGTLPEL------KTLDLSNNALRGDIP 215



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 53/152 (34%), Positives = 68/152 (44%)
 Frame = +3

Query: 300 VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL 479
           VG   S++  L L    L+G +  +I  L  L +L L  N   +GS+P  IGNL  L  L
Sbjct: 485 VGNLPSQLNWLWLRQNKLSGTIPSEIGNLKSLSVLYLDENM-FSGSIPPTIGNLSNLLVL 543

Query: 480 ILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
            L      GLIPDSIG              F G IP +LGQ  +L  LD + N   GS+P
Sbjct: 544 SLAQNNLSGLIPDSIGNLAQLTEFHLDGNNFNGSIPSNLGQWRQLEKLDFSHNSFGGSLP 603

Query: 660 VSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
               N   L   +   H     N F+G IP +
Sbjct: 604 SEVFNISSLSQSLDLSH-----NLFTGPIPLE 630



 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 50/135 (37%), Positives = 62/135 (45%), Gaps = 6/135 (4%)
 Frame = +3

Query: 366 SGDIEELSEL----QILDLSYNKD-LTGSLPREIGNLKKLYN-LILVGCGFFGLIPDSIG 527
           +GD   LS L    Q+  L+ + + L G+LP  +GNL    N L L      G IP  IG
Sbjct: 452 AGDWSFLSSLANCTQLKKLALDANFLQGTLPSSVGNLPSQLNWLWLRQNKLSGTIPSEIG 511

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTK 707
                         F G IPP++G LS L  L LA N L+G IP S GN      L    
Sbjct: 512 NLKSLSVLYLDENMFSGSIPPTIGNLSNLLVLSLAQNNLSGLIPDSIGN------LAQLT 565

Query: 708 HFHFGXNKFSGEIPA 752
            FH   N F+G IP+
Sbjct: 566 EFHLDGNNFNGSIPS 580



 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 45/140 (32%), Positives = 59/140 (42%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS   L G +  ++   S LQ+L LS N    G +P  +    +L  +IL      G 
Sbjct: 131 LNLSINSLEGRIPDELSSCSNLQVLGLS-NNSFEGEIPPSLTQCTRLQQVILYNNKLEGS 189

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP   G                G IPP LG      ++DL  NQLTG IP    N+  L 
Sbjct: 190 IPTRFGTLPELKTLDLSNNALRGDIPPLLGSSPSFVYVDLGGNQLTGGIPEFLVNSSSLQ 249

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
           +L  T+      N  +GEIP
Sbjct: 250 VLRLTQ------NSLTGEIP 263



 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 42/149 (28%), Positives = 66/149 (44%), Gaps = 1/149 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S + ++ L   +L G +       + +Q L L  NK LTG +P  +GNL  L ++ L 
Sbjct: 268 NSSTLTTIYLDRNNLVGSIPPITAIAAPIQYLSLEQNK-LTGGIPASLGNLSSLVHVSLK 326

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP S+                 G +P ++  +S L +L +A+N L G +P   
Sbjct: 327 ANNLVGSIPKSLSKIPTLERLVLTYNNLTGHVPQAIFNISSLKYLSMANNSLIGQLPPDI 386

Query: 669 GN-TPGLDMLVGTKHFHFGXNKFSGEIPA 752
           GN  P L+ L+          + +G IPA
Sbjct: 387 GNRLPNLEALI------LSTTQLNGPIPA 409



 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 45/144 (31%), Positives = 70/144 (48%), Gaps = 2/144 (1%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +V ++L + +L G +   + ++  L+ L L+YN +LTG +P+ I N+  L  L + 
Sbjct: 316 NLSSLVHVSLKANNLVGSIPKSLSKIPTLERLVLTYN-NLTGHVPQAIFNISSLKYLSMA 374

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFI-GPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                G +P  IG               + GPIP SL  +S+L  + LA   LTG +P S
Sbjct: 375 NNSLIGQLPPDIGNRLPNLEALILSTTQLNGPIPASLRNMSKLEMVYLAAAGLTGIVP-S 433

Query: 666 DGNTPGL-DMLVGTKHFHFGXNKF 734
            G+ P L D+ +G      G   F
Sbjct: 434 FGSLPNLHDLDLGYNQLEAGDWSF 457



 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 43/148 (29%), Positives = 64/148 (43%), Gaps = 1/148 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N +++    L   +  G +  ++ +  +L+ LD S+N    GSLP E+ N+  L   + +
Sbjct: 560 NLAQLTEFHLDGNNFNGSIPSNLGQWRQLEKLDFSHNS-FGGSLPSEVFNISSLSQSLDL 618

Query: 489 GCGFF-GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
               F G IP  IG                G IP +LG+   L +L +  N LTGSIP S
Sbjct: 619 SHNLFTGPIPLEIGNLINLGSISISNNRLTGEIPSTLGKCVLLEYLHMEGNLLTGSIPRS 678

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
             N      L   K      N  SG++P
Sbjct: 679 FMN------LKSIKELDLSCNSLSGKVP 700



 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 40/141 (28%), Positives = 56/141 (39%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           +L LS+  L G++   +        +DL  N+ LTG +P  + N   L  L L      G
Sbjct: 202 TLDLSNNALRGDIPPLLGSSPSFVYVDLGGNQ-LTGGIPEFLVNSSSLQVLRLTQNSLTG 260

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
            IP ++                +G IPP     + + +L L  N+LTG IP S GN   L
Sbjct: 261 EIPPALFNSSTLTTIYLDRNNLVGSIPPITAIAAPIQYLSLEQNKLTGGIPASLGNLSSL 320

Query: 687 DMLVGTKHFHFGXNKFSGEIP 749
                  H     N   G IP
Sbjct: 321 ------VHVSLKANNLVGSIP 335



 Score = 40.8 bits (94), Expect = 0.027
 Identities = 27/87 (31%), Positives = 41/87 (47%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           S+++S+  LTGE+   + +   L+ L +  N  LTGS+PR   NLK +  L L      G
Sbjct: 639 SISISNNRLTGEIPSTLGKCVLLEYLHMEGNL-LTGSIPRSFMNLKSIKELDLSCNSLSG 697

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIP 587
            +P+ +               F GPIP
Sbjct: 698 KVPEFLTLLSSLQKLNLSFNDFEGPIP 724



>gb:AK176791_1818779 Arabidopsis thaliana mRNA, complete cds, clone:
           RAFL25-33-L05.
          Length = 218

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 58/177 (32%), Positives = 88/177 (49%), Gaps = 5/177 (2%)
 Frame = +3

Query: 147 LLVPLFIQFLGIVAFTD-NNDYVAIKALRDGWKNVPPSWAEGSDPCGDH---WEGVGCNG 314
           LL    I  L ++  T+ N++  A+ ALR    + P +  +  DP   +   W  V CN 
Sbjct: 10  LLAASLILTLALIRLTEANSEGDALHALRRSLSD-PDNVVQSRDPTLVNPCTWFHVTCNQ 68

Query: 315 S-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVG 491
             +V  L L + +L+G L  ++ +L  LQ L+L Y  ++ G++P E+GNLK L +L L  
Sbjct: 69  HHQVTRLDLGNSNLSGHLVPELGKLEHLQYLEL-YKNEIQGTIPSELGNLKSLISLDLYN 127

Query: 492 CGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPV 662
               G IP S+G                GPIP  L  +S L  +D++ N L G+IPV
Sbjct: 128 NNLTGKIPSSLGKLKSLVFLRLNENRLTGPIPRELTVISSLKVVDVSGNDLCGTIPV 184



>gb:AC092781_1735750 Oryza sativa chromosome 3 BAC OSJNBb0094O03
           genomic sequence, complete sequence.
          Length = 1029

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 48/144 (33%), Positives = 68/144 (47%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           R+  L +S  +L+G++  ++  L+ L+ L + Y    +G LP E+GNL +L  L    CG
Sbjct: 192 RMQYLAVSGNELSGKIPPELGNLTSLRELYIGYYNSYSGGLPPELGNLTELVRLDAANCG 251

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
             G IP  +G                G IP  LG L  L  LDL++N LTG IP S    
Sbjct: 252 LSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL 311

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIP 749
             L +L      +   NK  G+IP
Sbjct: 312 KNLTLL------NLFRNKLRGDIP 329



 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 52/167 (31%), Positives = 73/167 (43%), Gaps = 25/167 (14%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L   + TG +   +     LQ+LDLS N+ LTG+LP E+    K++ LI +G   FG 
Sbjct: 341 LQLWENNFTGGVPRRLGRNGRLQLLDLSSNR-LTGTLPPELCAGGKMHTLIALGNFLFGA 399

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADN----------------- 638
           IPDS+G                G IP  L +L +L  ++L DN                 
Sbjct: 400 IPDSLGECKSLSRVRLGENYLNGSIPKGLFELPKLTQVELQDNLLTGNFPAVSGAAAPNL 459

Query: 639 --------QLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
                   QLTG++P S GN  G+  L+         N FSG +P +
Sbjct: 460 GEISLSNNQLTGALPASIGNFSGVQKLL------LDRNSFSGVVPPE 500



 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 42/118 (35%), Positives = 57/118 (48%)
 Frame = +3

Query: 402 LDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGP 581
           LD+S   +L+G+LP E+  L+ L  L +    F G IP S+G              F G 
Sbjct: 76  LDVS-GLNLSGALPAELTGLRGLMRLSVGANAFSGPIPASLGRLQFLTYLNLSNNAFNGS 134

Query: 582 IPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            P +L +L  L  LDL +N LT  +P+     P L      +H H G N FSGEIP +
Sbjct: 135 FPAALARLRGLRVLDLYNNNLTSPLPMEVVQMPLL------RHLHLGGNFFSGEIPPE 186



 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 34/111 (30%), Positives = 50/111 (45%)
 Frame = +3

Query: 417 NKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSL 596
           N  LTG+LP  IGN   +  L+L    F G++P  IG                G +PP +
Sbjct: 466 NNQLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEI 525

Query: 597 GQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           G+   L +LDL+ N ++G IP      P +  +    + +   N   GEIP
Sbjct: 526 GKCRLLTYLDLSRNNISGKIP------PAISGMRILNYLNLSRNHLDGEIP 570



 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 43/132 (32%), Positives = 58/132 (43%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           +L L    L G +  ++  L  L  LDLS N  LTG +P     LK L  L L      G
Sbjct: 268 TLFLQVNSLAGGIPSELGYLKSLSSLDLS-NNVLTGEIPASFSELKNLTLLNLFRNKLRG 326

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
            IPD +G              F G +P  LG+   L  LDL+ N+LTG++P        +
Sbjct: 327 DIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNRLTGTLPPELCAGGKM 386

Query: 687 DMLVGTKHFHFG 722
             L+   +F FG
Sbjct: 387 HTLIALGNFLFG 398



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 46/165 (27%), Positives = 60/165 (36%), Gaps = 23/165 (13%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNK-----------------------DLTGS 437
           SL LS+  LTGE+     EL  L +L+L  NK                       + TG 
Sbjct: 292 SLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGG 351

Query: 438 LPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELY 617
           +PR +G   +L  L L      G +P  +                 G IP SLG+   L 
Sbjct: 352 VPRRLGRNGRLQLLDLSSNRLTGTLPPELCAGGKMHTLIALGNFLFGAIPDSLGECKSLS 411

Query: 618 WLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            + L +N L GSIP       GL  L          N  +G  PA
Sbjct: 412 RVRLGENYLNGSIP------KGLFELPKLTQVELQDNLLTGNFPA 450



 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 45/181 (24%), Positives = 71/181 (39%), Gaps = 26/181 (14%)
 Frame = +3

Query: 291 WEGVGCNG-SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKK 467
           W GV C+    VV L +S ++L+G L  ++  L  L  L +  N   +G +P  +G L+ 
Sbjct: 62  WAGVTCSSRGAVVGLDVSGLNLSGALPAELTGLRGLMRLSVGANA-FSGPIPASLGRLQF 120

Query: 468 LYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXX------------------------FI 575
           L  L L    F G  P ++                                       F 
Sbjct: 121 LTYLNLSNNAFNGSFPAALARLRGLRVLDLYNNNLTSPLPMEVVQMPLLRHLHLGGNFFS 180

Query: 576 GPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFG-XNKFSGEIPA 752
           G IPP  G+   + +L ++ N+L+G IP      P L  L   +  + G  N +SG +P 
Sbjct: 181 GEIPPEYGRWGRMQYLAVSGNELSGKIP------PELGNLTSLRELYIGYYNSYSGGLPP 234

Query: 753 Q 755
           +
Sbjct: 235 E 235



>gb:AY224517_1590714 Oryza sativa (japonica cultivar-group) isolate
           20144 putative leucine-rich repeat transmembrane protein
           kinase mRNA, complete cds.
          Length = 719

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 61/203 (30%), Positives = 87/203 (42%), Gaps = 14/203 (6%)
 Frame = +3

Query: 180 IVAFTDNNDYVAIKALRD---------GWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSL 332
           + A TD ND   + AL           GW+        G DPCG  W+G+ C+GS V ++
Sbjct: 25  VAATTDANDVTVLNALFTSLNSPGQLRGWQ------VNGGDPCGASWQGITCSGSSVTAI 78

Query: 333 TLSSMDLTGELSGDIEELSELQILDLSYN-----KDLTGSLPREIGNLKKLYNLILVGCG 497
            L S+ L+G L+ ++  +  L  LD+S N     +++  +LP      KKL  L L G  
Sbjct: 79  KLPSLGLSGNLAYNMNTMESLVELDMSQNNLGGGQNIQYNLPN-----KKLERLNLAGNQ 133

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
           F G +P SI                 G +      L  L  LDL+ N LTG +P S    
Sbjct: 134 FAGNVPYSISTMPKLKYLNLNHNQLQGNMTDVFSNLPSLSTLDLSLNSLTGDLPQS---- 189

Query: 678 PGLDMLVGTKHFHFGXNKFSGEI 746
                L   K  +   N+F+G I
Sbjct: 190 --FTSLSSLKTLYLQNNQFTGSI 210



>gb:AY080729_1568448 Arabidopsis thaliana putative disease
           resistance protein (At4g13820) mRNA, complete
           cds.>gb:BT004941_1637887 Arabidopsis thaliana clone
           U20020 unknown protein (At4g13820) mRNA, complete cds.
          Length = 719

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 56/169 (33%), Positives = 79/169 (46%), Gaps = 4/169 (2%)
 Frame = +3

Query: 258 WAEGSDPCGDHWEGVGCNGS--RVVSLTLSSMDLTGELSGD--IEELSELQILDLSYNKD 425
           W   +D C   W+G+ C+    +VV L L +  L G L  D  +  L  L  LDL  N +
Sbjct: 63  WRNNTDCCS--WDGISCDPKTGKVVELDLMNSFLNGPLRYDSSLFRLQHLHNLDLGSN-N 119

Query: 426 LTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQL 605
            +G LP  IG+LK L  L L  C  FG IP S+G              F G +P S+G L
Sbjct: 120 FSGILPDSIGSLKYLRVLSLGDCNLFGKIPSSLGNLTYLTNLDLSVNDFTGELPDSMGHL 179

Query: 606 SELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           ++L  L L   +L+G+ P    N   L ++        G N+F G +P+
Sbjct: 180 NKLTELHLGSAKLSGNFPSMLLNLSELTLI------DLGSNQFGGMLPS 222



 Score = 40.0 bits (92), Expect = 0.046
 Identities = 35/131 (26%), Positives = 51/131 (38%), Gaps = 25/131 (19%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           +++  L L S  L+G     +  LSEL ++DL  N+   G LP  + +L KL    +   
Sbjct: 180 NKLTELHLGSAKLSGNFPSMLLNLSELTLIDLGSNQ-FGGMLPSNMSSLSKLVYFGIDRN 238

Query: 495 GFFGLIPDS-------------------------IGXXXXXXXXXXXXXXFIGPIPPSLG 599
            F G IP S                         I               F GPIP S+ 
Sbjct: 239 SFSGSIPSSLFMLPSLTSLVLGRNDFNGPLDFGNISSPSNLGVLSLLENNFNGPIPESIS 298

Query: 600 QLSELYWLDLA 632
           +L  L++LDL+
Sbjct: 299 KLVGLFYLDLS 309



>pir|T05322|T05322 hypothetical protein F18F4.240 - Arabidopsis
           thaliana>gb:ATCHRIV52_1545852 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 52.>gb:ATF1C12_1549334
           Arabidopsis thaliana DNA chromosome 4, BAC clone F1C12
           (ESSA project).
          Length = 1232

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 49/123 (39%), Positives = 66/123 (53%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L   +L G+L  +I  L +L++L L Y    +G +P+EIGN   L  + + G  F G 
Sbjct: 413 LVLYHNNLEGKLPKEISALRKLEVLFL-YENRFSGEIPQEIGNCTSLKMIDMFGNHFEGE 471

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP SIG               +G +P SLG   +L  LDLADNQL+GSIP S G   GL+
Sbjct: 472 IPPSIGRLKELNLLHLRQNELVGGLPASLGNCHQLNILDLADNQLSGSIPSSFGFLKGLE 531

Query: 690 MLV 698
            L+
Sbjct: 532 QLM 534



 Score = 72.8 bits (177), Expect = 6e-12
 Identities = 48/130 (36%), Positives = 67/130 (51%), Gaps = 1/130 (0%)
 Frame = +3

Query: 309  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
            N ++++ L+L    L G +  +I  L  L +L+L  N+  +GSLP+ +G L KLY L L 
Sbjct: 693  NCTKLLVLSLDGNSLNGSIPQEIGNLGALNVLNLDKNQ-FSGSLPQAMGKLSKLYELRLS 751

Query: 489  GCGFFGLIPDSIGXXXXXXXXXXXXXX-FIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                 G IP  IG               F G IP ++G LS+L  LDL+ NQLTG +P S
Sbjct: 752  RNSLTGEIPVEIGQLQDLQSALDLSYNNFTGDIPSTIGTLSKLETLDLSHNQLTGEVPGS 811

Query: 666  DGNTPGLDML 695
             G+   L  L
Sbjct: 812  VGDMKSLGYL 821



 Score = 69.3 bits (168), Expect = 7e-11
 Identities = 49/145 (33%), Positives = 72/145 (49%)
 Frame = +3

Query: 318  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
            ++  + L++  L+G +   + +LS+L  L LS N+    SLP E+ N  KL  L L G  
Sbjct: 648  KLTHIDLNNNFLSGPIPPWLGKLSQLGELKLSSNQ-FVESLPTELFNCTKLLVLSLDGNS 706

Query: 498  FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
              G IP  IG              F G +P ++G+LS+LY L L+ N LTG IPV  G  
Sbjct: 707  LNGSIPQEIGNLGALNVLNLDKNQFSGSLPQAMGKLSKLYELRLSRNSLTGEIPVEIGQL 766

Query: 678  PGLDMLVGTKHFHFGXNKFSGEIPA 752
              L   +   +     N F+G+IP+
Sbjct: 767  QDLQSALDLSY-----NNFTGDIPS 786



 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 53/181 (29%), Positives = 75/181 (41%), Gaps = 26/181 (14%)
 Frame = +3

Query: 291 WEGVGCNGS---RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNK------------- 422
           W GV C+ +   RV++L L+ + LTG +S        L  LDLS N              
Sbjct: 60  WTGVTCDNTGLFRVIALNLTGLGLTGSISPWFGRFDNLIHLDLSSNNLVGPIPTALSNLT 119

Query: 423 ----------DLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXF 572
                      LTG +P ++G+L  + +L +      G IP+++G               
Sbjct: 120 SLESLFLFSNQLTGEIPSQLGSLVNIRSLRIGDNELVGDIPETLGNLVNLQMLALASCRL 179

Query: 573 IGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            GPIP  LG+L  +  L L DN L G IP   GN   L +      F    N  +G IPA
Sbjct: 180 TGPIPSQLGRLVRVQSLILQDNYLEGPIPAELGNCSDLTV------FTAAENMLNGTIPA 233

Query: 753 Q 755
           +
Sbjct: 234 E 234



 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 47/150 (31%), Positives = 70/150 (46%), Gaps = 1/150 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +   T +   L G +  ++  L  L+IL+L+ N  LTG +P ++G + +L  L L+
Sbjct: 213 NCSDLTVFTAAENMLNGTIPAELGRLENLEILNLA-NNSLTGEIPSQLGEMSQLQYLSLM 271

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS- 665
                GLIP S+                 G IP     +S+L  L LA+N L+GS+P S 
Sbjct: 272 ANQLQGLIPKSLADLGNLQTLDLSANNLTGEIPEEFWNMSQLLDLVLANNHLSGSLPKSI 331

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
             N   L+ LV          + SGEIP +
Sbjct: 332 CSNNTNLEQLV------LSGTQLSGEIPVE 355



 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 45/147 (30%), Positives = 69/147 (46%)
 Frame = +3

Query: 309  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
            N   +  L L    LTG++   + ++ EL +LD+S N  LTG++P ++   KKL ++ L 
Sbjct: 597  NSQNLDRLRLGKNQLTGKIPWTLGKIRELSLLDMSSNA-LTGTIPLQLVLCKKLTHIDLN 655

Query: 489  GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                 G IP  +G              F+  +P  L   ++L  L L  N L GSIP   
Sbjct: 656  NNFLSGPIPPWLGKLSQLGELKLSSNQFVESLPTELFNCTKLLVLSLDGNSLNGSIPQEI 715

Query: 669  GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            GN   L++L      +   N+FSG +P
Sbjct: 716  GNLGALNVL------NLDKNQFSGSLP 736



 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 51/163 (31%), Positives = 75/163 (46%), Gaps = 4/163 (2%)
 Frame = +3

Query: 273 DPCGDHWEG-VGCNGSRVVSLTLSSM---DLTGELSGDIEELSELQILDLSYNKDLTGSL 440
           D  G+H+EG +  +  R+  L L  +   +L G L   +    +L ILDL+ N+ L+GS+
Sbjct: 462 DMFGNHFEGEIPPSIGRLKELNLLHLRQNELVGGLPASLGNCHQLNILDLADNQ-LSGSI 520

Query: 441 PREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYW 620
           P   G LK L  L+L      G +PDS+                 G I P  G  S L +
Sbjct: 521 PSSFGFLKGLEQLMLYNNSLQGNLPDSLISLRNLTRINLSHNRLNGTIHPLCGSSSYLSF 580

Query: 621 LDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            D+ +N     IP+  GN+  LD L        G N+ +G+IP
Sbjct: 581 -DVTNNGFEDEIPLELGNSQNLDRL------RLGKNQLTGKIP 616



 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 41/123 (33%), Positives = 59/123 (47%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           SL +   +L G++   +  L  LQ+L L+  + LTG +P ++G L ++ +LIL      G
Sbjct: 147 SLRIGDNELVGDIPETLGNLVNLQMLALASCR-LTGPIPSQLGRLVRVQSLILQDNYLEG 205

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
            IP  +G                G IP  LG+L  L  L+LA+N LTG IP   G    L
Sbjct: 206 PIPAELGNCSDLTVFTAAENMLNGTIPAELGRLENLEILNLANNSLTGEIPSQLGEMSQL 265

Query: 687 DML 695
             L
Sbjct: 266 QYL 268



 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 40/116 (34%), Positives = 57/116 (49%), Gaps = 1/116 (0%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S++  L+L +  L G +   + +L  LQ LDLS N +LTG +P E  N+ +L +L+L   
Sbjct: 263 SQLQYLSLMANQLQGLIPKSLADLGNLQTLDLSAN-NLTGEIPEEFWNMSQLLDLVLANN 321

Query: 495 GFFGLIPDSI-GXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
              G +P SI                  G IP  L +   L  LDL++N L GSIP
Sbjct: 322 HLSGSLPKSICSNNTNLEQLVLSGTQLSGEIPVELSKCQSLKQLDLSNNSLAGSIP 377



 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 49/168 (29%), Positives = 68/168 (40%), Gaps = 25/168 (14%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREI-GNLKKLYNLILVGCGFF 503
           +L LS+ +LTGE+  +   +S+L  L L+ N  L+GSLP+ I  N   L  L+L G    
Sbjct: 291 TLDLSANNLTGEIPEEFWNMSQLLDLVLA-NNHLSGSLPKSICSNNTNLEQLVLSGTQLS 349

Query: 504 GLIPDSIGXXXXXXXXXXXXXXFIGPIP------------------------PSLGQLSE 611
           G IP  +                 G IP                        PS+  L+ 
Sbjct: 350 GEIPVELSKCQSLKQLDLSNNSLAGSIPEALFELVELTDLYLHNNTLEGTLSPSISNLTN 409

Query: 612 LYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           L WL L  N L G +P        L++L          N+FSGEIP +
Sbjct: 410 LQWLVLYHNNLEGKLPKEISALRKLEVL------FLYENRFSGEIPQE 451



>gb:AP002862_1823249 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBa0036E02.
          Length = 212

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 55/166 (33%), Positives = 83/166 (50%), Gaps = 5/166 (3%)
 Frame = +3

Query: 183 VAFTDNNDYVAIKALRDGW---KNVPPSWAEGS-DPCGDHWEGVGCN-GSRVVSLTLSSM 347
           VA   N++  A+ ALR      + V  SW     +PC   W  V C+   RV  L L + 
Sbjct: 18  VASASNSEGDALYALRRALADPRGVLQSWDPTLVNPCT--WFHVTCDRAGRVTRLDLGNS 75

Query: 348 DLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG 527
           +L+G L+ ++  L  LQ L+L Y  ++ G++P E+G+LK L +L L      G IP  +G
Sbjct: 76  NLSGHLAPELGHLEHLQYLEL-YKNNIQGTIPAELGSLKNLISLDLYNNNITGTIPKELG 134

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                           GPIP  L ++S L  +D+++N L G+IP S
Sbjct: 135 KLSSLVFLRLNDNSLNGPIPRDLAKISSLKVIDVSNNDLCGTIPTS 180



>gb:AP000815_1820620 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0003H10.
          Length = 214

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 55/166 (33%), Positives = 83/166 (50%), Gaps = 5/166 (3%)
 Frame = +3

Query: 183 VAFTDNNDYVAIKALRDGW---KNVPPSWAEGS-DPCGDHWEGVGCN-GSRVVSLTLSSM 347
           VA   N++  A+ ALR      + V  SW     +PC   W  V C+   RV  L L + 
Sbjct: 20  VASASNSEGDALYALRRALADPRGVLQSWDPTLVNPCT--WFHVTCDRAGRVTRLDLGNS 77

Query: 348 DLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG 527
           +L+G L+ ++  L  LQ L+L Y  ++ G++P E+G+LK L +L L      G IP  +G
Sbjct: 78  NLSGHLAPELGHLEHLQYLEL-YKNNIQGTIPAELGSLKNLISLDLYNNNITGTIPKELG 136

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                           GPIP  L ++S L  +D+++N L G+IP S
Sbjct: 137 KLSSLVFLRLNDNSLNGPIPRDLAKISSLKVIDVSNNDLCGTIPTS 182



>gb:AF196891_1776050 Fragaria vesca isolate Fr_ve_A_6
           polygalacturonase inhibitor protein (PGIP) gene, partial
           cds.>gb:AF196892_1776051 Fragaria vesca isolate
           Fr_ve_A_7 polygalacturonase inhibitor protein (PGIP)
           gene, partial cds.>gb:AF196893_1776052 Fragaria vesca
           isolate Fr_ve_B_5 polygalacturonase inhibitor protein
           (PGIP) gene, partial cds.
          Length = 253

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 60/169 (35%), Positives = 79/169 (46%), Gaps = 4/169 (2%)
 Frame = +3

Query: 255 SWAEGSDPCGDHWEGVGC--NGSRVVSLTLSSMD-LTGELSGDIEELSELQILDLSYNKD 425
           SW   +D C D W  V C  N +R+ SLT+ + D LTG++   + +L  L+ L L    +
Sbjct: 1   SWKSDADCCTD-WYNVECDPNTNRINSLTIFTDDRLTGQIPAQVGDLPYLETLVLRKLPN 59

Query: 426 LTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQL 605
           LTG +   I  LK L  L L   G  G +PD +               F G +P SL +L
Sbjct: 60  LTGPIQPSIAKLKHLKMLRLSWNGLSGSVPDFLSQLKNLTFLELNYNNFTGSVPSSLSKL 119

Query: 606 SELYWLDLADNQLTGSIPVSDGNTPGLDMLVGT-KHFHFGXNKFSGEIP 749
             L  L L  NQLTG+IP S G        VGT        NK +G+IP
Sbjct: 120 PNLLALHLDRNQLTGNIPSSYGK------FVGTVPDLFLSHNKLTGKIP 162



>gb:AB018109_1513744 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K17N15.
          Length = 680

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 71/233 (30%), Positives = 98/233 (42%), Gaps = 29/233 (12%)
 Frame = +3

Query: 138 IQLLLVPLFIQFLGIVAFTDNNDYVA----IKALRDGWKNVPPSWAEGSDPCGDHWEGVG 305
           + LLL+PL           +  D +A    +K   D       SW+   D C D +EGVG
Sbjct: 8   LHLLLLPLLFLHFSNQVMAEITDELATLMEVKTELDPEDKHLASWSVNGDLCKD-FEGVG 66

Query: 306 CNGS-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI 482
           C+   RV +++L    L+G++S +I +L  L  L L YN  L G +PRE+GNL +L +L 
Sbjct: 67  CDWKGRVSNISLQGKGLSGKISPNIGKLKHLTGLFLHYNA-LVGDIPRELGNLSELTDLY 125

Query: 483 LVGCGFFGLIPDSIG------------------------XXXXXXXXXXXXXXFIGPIPP 590
           L      G IP +IG                                        G IP 
Sbjct: 126 LNVNNLSGEIPSNIGKMQGLQVLQLCYNNLTGSIPRELSSLRKLSVLALQSNKLTGAIPA 185

Query: 591 SLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           SLG LS L  LDL+ N L GS+P    + P L +L          N  +G +P
Sbjct: 186 SLGDLSALERLDLSYNHLFGSVPGKLASPPLLRVL------DIRNNSLTGNVP 232



 Score = 45.4 bits (106), Expect = 0.001
 Identities = 29/94 (30%), Positives = 44/94 (46%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L   +LTG +  ++  L +L +L L  NK LTG++P  +G+L  L  L L     FG 
Sbjct: 148 LQLCYNNLTGSIPRELSSLRKLSVLALQSNK-LTGAIPASLGDLSALERLDLSYNHLFGS 206

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSE 611
           +P  +                 G +PP L +L+E
Sbjct: 207 VPGKLASPPLLRVLDIRNNSLTGNVPPVLKRLNE 240



>gb:AB017061_1513313 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K19E20.
          Length = 1110

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 53/147 (36%), Positives = 74/147 (50%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S++ SL++ S  L+GE+  ++   SEL  L L Y+ DL+G+LP+E+G L+ L  ++L   
Sbjct: 251 SKLQSLSVYSTMLSGEIPKELGNCSELINLFL-YDNDLSGTLPKELGKLQNLEKMLLWQN 309

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G IP+ IG              F G IP S G LS L  L L+ N +TGSIP    N
Sbjct: 310 NLHGPIPEEIGFMKSLNAIDLSMNYFSGTIPKSFGNLSNLQELMLSSNNITGSIPSILSN 369

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
              L        F    N+ SG IP +
Sbjct: 370 CTKL------VQFQIDANQISGLIPPE 390



 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 57/211 (27%), Positives = 91/211 (43%), Gaps = 8/211 (3%)
 Frame = +3

Query: 147 LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEG-----SDPCGDHWEGVGCN 311
           + + LF+ F         N+  A+ +      + PPS   G     SDPC   W  + C+
Sbjct: 20  ITLSLFLAFFISSTSASTNEVSALISWLHSSNSPPPSVFSGWNPSDSDPC--QWPYITCS 77

Query: 312 GSR---VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI 482
            S    V  + + S+ L      +I   + LQ L +S N +LTG++  EIG+  +L  + 
Sbjct: 78  SSDNKLVTEINVVSVQLALPFPPNISSFTSLQKLVIS-NTNLTGAISSEIGDCSELIVID 136

Query: 483 LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPV 662
           L      G IP S+G                G IPP LG    L  L++ DN L+ ++P+
Sbjct: 137 LSSNSLVGEIPSSLGKLKNLQELCLNSNGLTGKIPPELGDCVSLKNLEIFDNYLSENLPL 196

Query: 663 SDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
             G    L+ +        G ++ SG+IP +
Sbjct: 197 ELGKISTLESIRAG-----GNSELSGKIPEE 222



 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 44/133 (33%), Positives = 61/133 (45%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           L G +  ++     LQ LDLS N  LTGSLP  +  L+ L  L+L+     G+IP  IG 
Sbjct: 407 LEGNIPDELAGCQNLQALDLSQNY-LTGSLPAGLFQLRNLTKLLLISNAISGVIPLEIGN 465

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH 710
                          G IP  +G L  L +LDL++N L+G +P+   N   L ML     
Sbjct: 466 CTSLVRLRLVNNRITGEIPKGIGFLQNLSFLDLSENNLSGPVPLEISNCRQLQML----- 520

Query: 711 FHFGXNKFSGEIP 749
            +   N   G +P
Sbjct: 521 -NLSNNTLQGYLP 532



 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 47/140 (33%), Positives = 67/140 (47%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS  +L+G +  +I    +LQ+L+LS N  L G LP  + +L KL  L +      G 
Sbjct: 496 LDLSENNLSGPVPLEISNCRQLQMLNLS-NNTLQGYLPLSLSSLTKLQVLDVSSNDLTGK 554

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IPDS+G              F G IP SLG  + L  LDL+ N ++G+IP    +   LD
Sbjct: 555 IPDSLGHLISLNRLILSKNSFNGEIPSSLGHCTNLQLLDLSSNNISGTIPEELFDIQDLD 614

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
           + +     +   N   G IP
Sbjct: 615 IAL-----NLSWNSLDGFIP 629



 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 62/197 (31%), Positives = 82/197 (41%), Gaps = 24/197 (12%)
 Frame = +3

Query: 234 GWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLS 413
           GW+N      EG+ P     E  GC   +  +L LS   LTG L   + +L  L  L L 
Sbjct: 402 GWQNK----LEGNIPD----ELAGCQNLQ--ALDLSQNYLTGSLPAGLFQLRNLTKLLLI 451

Query: 414 YNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPI--- 584
            N  ++G +P EIGN   L  L LV     G IP  IG                GP+   
Sbjct: 452 SNA-ISGVIPLEIGNCTSLVRLRLVNNRITGEIPKGIGFLQNLSFLDLSENNLSGPVPLE 510

Query: 585 ---------------------PPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVG 701
                                P SL  L++L  LD++ N LTG IP S G+   L+ L+ 
Sbjct: 511 ISNCRQLQMLNLSNNTLQGYLPLSLSSLTKLQVLDVSSNDLTGKIPDSLGHLISLNRLIL 570

Query: 702 TKHFHFGXNKFSGEIPA 752
           +K      N F+GEIP+
Sbjct: 571 SK------NSFNGEIPS 581



 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 45/151 (29%), Positives = 64/151 (42%), Gaps = 18/151 (11%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           L+  L  ++ ++S L+ +    N +L+G +P EIGN + L  L L      G +P S+G 
Sbjct: 190 LSENLPLELGKISTLESIRAGGNSELSGKIPEEIGNCRNLKVLGLAATKISGSLPVSLGQ 249

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD-MLVGTK 707
                          G IP  LG  SEL  L L DN L+G++P   G    L+ ML+   
Sbjct: 250 LSKLQSLSVYSTMLSGEIPKELGNCSELINLFLYDNDLSGTLPKELGKLQNLEKMLLWQN 309

Query: 708 HFH-----------------FGXNKFSGEIP 749
           + H                    N FSG IP
Sbjct: 310 NLHGPIPEEIGFMKSLNAIDLSMNYFSGTIP 340



 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 46/143 (32%), Positives = 58/143 (40%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           ++ LS    +G +      LS LQ L LS N ++TGS+P  + N  KL    +      G
Sbjct: 327 AIDLSMNYFSGTIPKSFGNLSNLQELMLSSN-NITGSIPSILSNCTKLVQFQIDANQISG 385

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
           LIP  IG                G IP  L     L  LDL+ N LTGS+P       GL
Sbjct: 386 LIPPEIGLLKELNIFLGWQNKLEGNIPDELAGCQNLQALDLSQNYLTGSLPA------GL 439

Query: 687 DMLVGTKHFHFGXNKFSGEIPAQ 755
             L          N  SG IP +
Sbjct: 440 FQLRNLTKLLLISNAISGVIPLE 462



 Score = 33.1 bits (74), Expect = 5.6
 Identities = 23/66 (34%), Positives = 36/66 (54%)
 Frame = +3

Query: 324 VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF 503
           ++L LS   L G +   I  L+ L +LD+S+N  L+G L   +  L+ L +L +    F 
Sbjct: 615 IALNLSWNSLDGFIPERISALNRLSVLDISHNM-LSGDL-SALSGLENLVSLNISHNRFS 672

Query: 504 GLIPDS 521
           G +PDS
Sbjct: 673 GYLPDS 678



>gb:CQ768545_1451790 Sequence 40 from Patent
           WO2004007712.>gb:AY056294_1563607 Arabidopsis thaliana
           putative receptor kinase (At1g60800) mRNA, complete
           cds.>gb:AY150495_1585060 Arabidopsis thaliana putative
           receptor kinase (At1g60800) mRNA, complete cds.
          Length = 632

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 59/158 (37%), Positives = 77/158 (48%), Gaps = 2/158 (1%)
 Frame = +3

Query: 210 VAIK-ALRDGWKNVPPSWAEGS-DPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEE 383
           VA+K  L D +K V  +W   S DPC   W  V C    V SL L S  L+G LS  I  
Sbjct: 40  VAVKNELNDPYK-VLENWDVNSVDPCS--WRMVSCTDGYVSSLDLPSQSLSGTLSPRIGN 96

Query: 384 LSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXX 563
           L+ LQ + L  N  +TG +P  IG L+KL +L L    F G IP S+G            
Sbjct: 97  LTYLQSVVLQ-NNAITGPIPETIGRLEKLQSLDLSNNSFTGEIPASLGELKNLNYLRLNN 155

Query: 564 XXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
              IG  P SL ++  L  +D++ N L+GS+P     T
Sbjct: 156 NSLIGTCPESLSKIEGLTLVDISYNNLSGSLPKVSART 193



>pir|T10727|T10727 protein kinase Xa21 (EC 2.7.1.-) D, receptor type
           - long-staminate rice>gb:OLRKLP1_1692250 Oryza
           longistaminata receptor kinase-like protein, family
           member D, and retrofit (gag/pol) genes, complete cds.
          Length = 612

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 60/169 (35%), Positives = 79/169 (46%), Gaps = 20/169 (11%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIG-NLKKLYNLI 482
           C  SR+  L LS   + G +   I   ++L  LDLS+N+ L G +PREIG +LK L NL 
Sbjct: 124 CRLSRLQLLELSDNSIQGSIPAAIGACTKLTSLDLSHNQ-LRGMIPREIGASLKHLSNLY 182

Query: 483 LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPV 662
           L   G  G IP ++G                G IP SLGQLS L  ++L  N L+G IP 
Sbjct: 183 LHKNGLSGEIPSALGNLTSLQEFDLSFNRLSGAIPSSLGQLSSLLNMNLGQNNLSGMIPN 242

Query: 663 SDGNTPGLDM----------LVGTKHF---------HFGXNKFSGEIPA 752
           S  N   L            ++ T  F         + G N+F G+IPA
Sbjct: 243 SIWNLSSLRAFCVSENKLGGMIPTNAFKTLHLLEVIYMGTNRFHGKIPA 291



 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 47/147 (31%), Positives = 71/147 (48%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + ++SL LS+ +L+G +  ++  +  L I+      +L GS+P+EIG+LK L      
Sbjct: 470 NLTNLLSLGLSTNNLSGPIPSELFNIQTLSIMINVSKNNLEGSIPQEIGHLKNLVEFHAE 529

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP+++G                G IP +LGQL  L  LDL+ N L+G IP S 
Sbjct: 530 SNRLSGKIPNTLGDCQLLRHLYLQNNLLSGSIPSALGQLKGLETLDLSSNNLSGQIPTSL 589

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            +   L  L      +   N F GE+P
Sbjct: 590 ADITMLHSL------NLSFNSFVGEVP 610



 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 51/150 (34%), Positives = 70/150 (46%), Gaps = 1/150 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELS-ELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           N S++ +L L   +L G L      LS  L  L L  NK +TGS+P++IGNL  L +L L
Sbjct: 349 NCSKLQTLNLGENNLGGVLPNSFSNLSTSLSFLALHLNK-ITGSIPQDIGNLIGLQHLYL 407

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
               F G +P S+G                G IP ++G L+EL  L L  N+ +G IP +
Sbjct: 408 CNNNFRGSLPSSLGRLKNLGILLAYENNLSGSIPLAIGNLTELNILLLGTNKFSGWIPYT 467

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
             N   L  L          N  SG IP++
Sbjct: 468 LSNLTNLLSL------GLSTNNLSGPIPSE 491



 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 47/142 (33%), Positives = 68/142 (47%), Gaps = 2/142 (1%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG-FFG 506
           L L + +  G L   +  L  L IL L+Y  +L+GS+P  IGNL +L N++L+G   F G
Sbjct: 405 LYLCNNNFRGSLPSSLGRLKNLGIL-LAYENNLSGSIPLAIGNLTEL-NILLLGTNKFSG 462

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSEL-YWLDLADNQLTGSIPVSDGNTPG 683
            IP ++                 GPIP  L  +  L   ++++ N L GSIP   G+   
Sbjct: 463 WIPYTLSNLTNLLSLGLSTNNLSGPIPSELFNIQTLSIMINVSKNNLEGSIPQEIGHLKN 522

Query: 684 LDMLVGTKHFHFGXNKFSGEIP 749
           L        FH   N+ SG+IP
Sbjct: 523 L------VEFHAESNRLSGKIP 538



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 30/97 (30%), Positives = 42/97 (43%)
 Frame = +3

Query: 465 KLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQL 644
           ++  L+L      G+I  S+G              F G IPP L +LS L  L+L+DN +
Sbjct: 80  RVVKLLLRSSNLSGIISPSLGNLSFLRELDLGDNYFSGEIPPELCRLSRLQLLELSDNSI 139

Query: 645 TGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            GSIP + G    L  L          N+  G IP +
Sbjct: 140 QGSIPAAIGACTKLTSL------DLSHNQLRGMIPRE 170



>pir|T05050|T05050 protein kinase homolog M3E9.30 - Arabidopsis
           thaliana>gb:ATCHRIV65_1546535 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 65.>gb:ATM3E9_1553616
           Arabidopsis thaliana DNA chromosome 4, P1 clone M3E9
           (ESSA project).
          Length = 1029

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 53/149 (35%), Positives = 68/149 (45%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +V L L    L+GE+   I EL  LQ+L    NK+L G LP EIGN + L  L L 
Sbjct: 163 NLSGLVELMLFDNKLSGEIPRSIGELKNLQVLRAGGNKNLRGELPWEIGNCENLVMLGLA 222

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G +P SIG                GPIP  +G  +EL  L L  N ++GSIP + 
Sbjct: 223 ETSLSGKLPASIGNLKRVQTIAIYTSLLSGPIPDEIGYCTELQNLYLYQNSISGSIPTTI 282

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           G    L  L+         N   G+IP +
Sbjct: 283 GGLKKLQSLL------LWQNNLVGKIPTE 305



 Score = 72.8 bits (177), Expect = 6e-12
 Identities = 51/155 (32%), Positives = 70/155 (45%)
 Frame = +3

Query: 291 WEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKL 470
           WE   C    +V L L+   L+G+L   I  L  +Q + + Y   L+G +P EIG   +L
Sbjct: 208 WEIGNCEN--LVMLGLAETSLSGKLPASIGNLKRVQTIAI-YTSLLSGPIPDEIGYCTEL 264

Query: 471 YNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTG 650
            NL L      G IP +IG               +G IP  LG   EL+ +D ++N LTG
Sbjct: 265 QNLYLYQNSISGSIPTTIGGLKKLQSLLLWQNNLVGKIPTELGNCPELWLIDFSENLLTG 324

Query: 651 SIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           +IP S G    L  L          N+ SG IP +
Sbjct: 325 TIPRSFGKLENLQEL------QLSVNQISGTIPEE 353



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 54/145 (37%), Positives = 71/145 (48%), Gaps = 1/145 (0%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           + SLTLSS++LTG +  +I + +EL++LDLS N  L+G +P EI  LKKL  L L     
Sbjct: 95  LTSLTLSSLNLTGVIPKEIGDFTELELLDLSDN-SLSGDIPVEIFRLKKLKTLSLNTNNL 153

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQ-LTGSIPVSDGNT 677
            G IP  IG                G IP S+G+L  L  L    N+ L G +P   GN 
Sbjct: 154 EGHIPMEIGNLSGLVELMLFDNKLSGEIPRSIGELKNLQVLRAGGNKNLRGELPWEIGNC 213

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIPA 752
             L ML             SG++PA
Sbjct: 214 ENLVML------GLAETSLSGKLPA 232



 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 46/141 (32%), Positives = 64/141 (45%), Gaps = 1/141 (0%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           +  S   L+  L   I  L+EL  L+L+ N+ L+G +PREI   + L  L L    F G 
Sbjct: 455 IDFSDNALSSTLPPGIGLLTELTKLNLAKNR-LSGEIPREISTCRSLQLLNLGENDFSGE 513

Query: 510 IPDSIGXXXXXXXXXXXX-XXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
           IPD +G               F+G IP     L  L  LD++ NQLTG++ V       L
Sbjct: 514 IPDELGQIPSLAISLNLSCNRFVGEIPSRFSDLKNLGVLDVSHNQLTGNLNV-------L 566

Query: 687 DMLVGTKHFHFGXNKFSGEIP 749
             L      +   N FSG++P
Sbjct: 567 TDLQNLVSLNISYNDFSGDLP 587



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 46/147 (31%), Positives = 63/147 (42%), Gaps = 14/147 (9%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           LTG +     +L  LQ L LS N+ ++G++P E+ N  KL +L +      G IP  +  
Sbjct: 322 LTGTIPRSFGKLENLQELQLSVNQ-ISGTIPEELTNCTKLTHLEIDNNLITGEIPSLMSN 380

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM------ 692
                          G IP SL Q  EL  +DL+ N L+GSIP        LD+      
Sbjct: 381 LRSLTMFFAWQNKLTGNIPQSLSQCRELQAIDLSYNSLSGSIPKEIFGLEFLDLHTNSLS 440

Query: 693 --LVGT------KHFHFGXNKFSGEIP 749
             L+GT      K   F  N  S  +P
Sbjct: 441 GSLLGTTLPKSLKFIDFSDNALSSTLP 467



 Score = 34.7 bits (78), Expect = 1.9
 Identities = 26/84 (30%), Positives = 46/84 (54%)
 Frame = +3

Query: 270 SDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPRE 449
           +D  G+  + +G   S  +SL LS     GE+     +L  L +LD+S+N+ LTG+L   
Sbjct: 508 NDFSGEIPDELGQIPSLAISLNLSCNRFVGEIPSRFSDLKNLGVLDVSHNQ-LTGNL-NV 565

Query: 450 IGNLKKLYNLILVGCGFFGLIPDS 521
           + +L+ L +L +    F G +P++
Sbjct: 566 LTDLQNLVSLNISYNDFSGDLPNT 589



>pir|T00712|T00712 protein kinase homolog F22O13.7 - Arabidopsis
           thaliana>gb:AE005172_889864 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC003981_1531272 Genomic sequence for
           Arabidopsis thaliana BAC F22O13 from chromosome I,
           complete sequence.
          Length = 1029

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 55/172 (31%), Positives = 75/172 (43%), Gaps = 1/172 (0%)
 Frame = +3

Query: 237 WKNVPPSWAEGSDPCGDHWEGVGCNGSRVVS-LTLSSMDLTGELSGDIEELSELQILDLS 413
           WK  P +    S+    HW GV C+ +  V+ L LS+M+L+G +S  I+    LQ LDLS
Sbjct: 51  WKR-PENATTFSELVHCHWTGVHCDANGYVAKLLLSNMNLSGNVSDQIQSFPSLQALDLS 109

Query: 414 YNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPS 593
            N     SLP+ + NL  L  + +    FFG  P  +G              F G +P  
Sbjct: 110 -NNAFESSLPKSLSNLTSLKVIDVSVNSFFGTFPYGLGMATGLTHVNASSNNFSGFLPED 168

Query: 594 LGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           LG  + L  LD       GS+P S  N   L      K      N F G++P
Sbjct: 169 LGNATTLEVLDFRGGYFEGSVPSSFKNLKNL------KFLGLSGNNFGGKVP 214



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 47/142 (33%), Positives = 68/142 (47%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS  +  G++   I ELS L+ + L YN    G +P E G L +L  L L      G 
Sbjct: 202 LGLSGNNFGGKVPKVIGELSSLETIILGYN-GFMGEIPEEFGKLTRLQYLDLAVGNLTGQ 260

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S+G                G +P  LG ++ L +LDL+DNQ+TG IP+  G    L 
Sbjct: 261 IPSSLGQLKQLTTVYLYQNRLTGKLPRELGGMTSLVFLDLSDNQITGEIPMEVGELKNLQ 320

Query: 690 MLVGTKHFHFGXNKFSGEIPAQ 755
           +L      +   N+ +G IP++
Sbjct: 321 LL------NLMRNQLTGIIPSK 336



 Score = 70.1 bits (170), Expect = 4e-11
 Identities = 46/135 (34%), Positives = 68/135 (50%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           LTG+L  ++  ++ L  LDLS N+ +TG +P E+G LK L  L L+     G+IP  I  
Sbjct: 281 LTGKLPRELGGMTSLVFLDLSDNQ-ITGEIPMEVGELKNLQLLNLMRNQLTGIIPSKIAE 339

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH 710
                         +G +P  LG+ S L WLD++ N+L+G IP     +  L  L+    
Sbjct: 340 LPNLEVLELWQNSLMGSLPVHLGKNSPLKWLDVSSNKLSGDIPSGLCYSRNLTKLI---- 395

Query: 711 FHFGXNKFSGEIPAQ 755
                N FSG+IP +
Sbjct: 396 --LFNNSFSGQIPEE 408



 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 49/164 (29%), Positives = 73/164 (44%), Gaps = 18/164 (10%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S + ++ L      GE+  +  +L+ LQ LDL+   +LTG +P  +G LK+L  + L   
Sbjct: 221 SSLETIILGYNGFMGEIPEEFGKLTRLQYLDLAVG-NLTGQIPSSLGQLKQLTTVYLYQN 279

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G +P  +G                G IP  +G+L  L  L+L  NQLTG IP     
Sbjct: 280 RLTGKLPRELGGMTSLVFLDLSDNQITGEIPMEVGELKNLQLLNLMRNQLTGIIPSKIAE 339

Query: 675 TPGLDM-------LVGTKHFHFG-----------XNKFSGEIPA 752
            P L++       L+G+   H G            NK SG+IP+
Sbjct: 340 LPNLEVLELWQNSLMGSLPVHLGKNSPLKWLDVSSNKLSGDIPS 383



 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 45/139 (32%), Positives = 64/139 (46%)
 Frame = +3

Query: 339 SSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPD 518
           SS + +G L  D+   + L++LD        GS+P    NLK L  L L G  F G +P 
Sbjct: 157 SSNNFSGFLPEDLGNATTLEVLDFRGGY-FEGSVPSSFKNLKNLKFLGLSGNNFGGKVPK 215

Query: 519 SIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLV 698
            IG              F+G IP   G+L+ L +LDLA   LTG IP S G    L  + 
Sbjct: 216 VIGELSSLETIILGYNGFMGEIPEEFGKLTRLQYLDLAVGNLTGQIPSSLGQLKQLTTV- 274

Query: 699 GTKHFHFGXNKFSGEIPAQ 755
                +   N+ +G++P +
Sbjct: 275 -----YLYQNRLTGKLPRE 288



 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 46/163 (28%), Positives = 69/163 (42%), Gaps = 22/163 (13%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYN----------------------KDLTGSLP 443
           L L+  +LTG++  DI   + L  +D+S+N                       +  G +P
Sbjct: 442 LELAKNNLTGKIPDDIALSTSLSFIDISFNHLSSLSSSIFSSPNLQTFIASHNNFAGKIP 501

Query: 444 REIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWL 623
            +I +   L  L L    F G IP+ I                +G IP +L  +  L  L
Sbjct: 502 NQIQDRPSLSVLDLSFNHFSGGIPERIASFEKLVSLNLKSNQLVGEIPKALAGMHMLAVL 561

Query: 624 DLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           DL++N LTG+IP   G +P L+ML      +   NK  G IP+
Sbjct: 562 DLSNNSLTGNIPADLGASPTLEML------NVSFNKLDGPIPS 598



 Score = 40.0 bits (92), Expect = 0.046
 Identities = 43/172 (25%), Positives = 64/172 (37%), Gaps = 2/172 (1%)
 Frame = +3

Query: 240 KNVPPSWAEGSDP--CGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLS 413
           KN P  W + S     GD   G+ C    +  L L +   +G++  +I     L  + + 
Sbjct: 363 KNSPLKWLDVSSNKLSGDIPSGL-CYSRNLTKLILFNNSFSGQIPEEIFSCPTLVRVRIQ 421

Query: 414 YNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPS 593
            N  ++GS+P   G+L  L +L L      G IPD I                +  +  S
Sbjct: 422 KNH-ISGSIPAGSGDLPMLQHLELAKNNLTGKIPDDI-ALSTSLSFIDISFNHLSSLSSS 479

Query: 594 LGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           +     L     + N   G IP    + P L +L          N FSG IP
Sbjct: 480 IFSSPNLQTFIASHNNFAGKIPNQIQDRPSLSVL------DLSFNHFSGGIP 525



 Score = 36.6 bits (83), Expect = 0.50
 Identities = 19/46 (41%), Positives = 29/46 (63%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIG 455
           ++VSL L S  L GE+   +  +  L +LDLS N  LTG++P ++G
Sbjct: 533 KLVSLNLKSNQLVGEIPKALAGMHMLAVLDLS-NNSLTGNIPADLG 577



>gb:AF244888_1780445 Glycine max receptor-like protein kinase 1
           (RLK1) mRNA, complete cds.
          Length = 1008

 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 46/142 (32%), Positives = 66/142 (46%), Gaps = 1/142 (0%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS  +L G ++ ++  LS L+ L + Y    +G +P EIGNL  L  L    CG  G 
Sbjct: 187 LALSGNELAGTIAPELGNLSSLRELYIGYYNTYSGGIPPEIGNLSNLVRLDAAYCGLSGE 246

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP  +G                G + P LG L  L  +DL++N L+G +P S      L 
Sbjct: 247 IPAELGKLQNLDTLFLQVNALSGSLTPELGSLKSLKSMDLSNNMLSGEVPASFAELKNLT 306

Query: 690 ML-VGTKHFHFGXNKFSGEIPA 752
           +L +     H    +F GE+PA
Sbjct: 307 LLNLFRNKLHGAIPEFVGELPA 328



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 61/207 (29%), Positives = 85/207 (41%), Gaps = 3/207 (1%)
 Frame = +3

Query: 144 LLLVPLFIQFLGIVAFTDNNDYVAIKA--LRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS 317
           L+L  LF+  L     ++    ++ KA  L D   +   SW   +  C   W G+ C+  
Sbjct: 4   LVLFFLFLHSLQAARISEYRALLSFKASSLTDDPTHALSSWNSSTPFCS--WFGLTCDSR 61

Query: 318 R-VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           R V SL L+S+ L+G LS D+  L  L  L L+ NK                        
Sbjct: 62  RHVTSLNLTSLSLSGTLSDDLSHLPFLSHLSLADNK------------------------ 97

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
            F G IP S                F    P  L +L+ L  LDL +N +TG +P+S   
Sbjct: 98  -FSGPIPASFSALSALRFLNLSNNVFNATFPSQLNRLANLEVLDLYNNNMTGELPLSVAA 156

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            P L      +H H G N FSG+IP +
Sbjct: 157 MPLL------RHLHLGGNFFSGQIPPE 177



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 49/162 (30%), Positives = 70/162 (43%), Gaps = 18/162 (11%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           ++  + L    LTG+   D    ++L  + LS N  L+GSLP  IGN   +  L+L G  
Sbjct: 424 KLTQVELQDNLLTGQFPEDGSIATDLGQISLS-NNQLSGSLPSTIGNFTSMQKLLLNGNE 482

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS---- 665
           F G IP  IG              F GPI P + +   L ++DL+ N+L+G IP      
Sbjct: 483 FTGRIPPQIGMLQQLSKIDFSHNKFSGPIAPEISKCKLLTFIDLSGNELSGEIPNKITSM 542

Query: 666 -------------DGNTPG-LDMLVGTKHFHFGXNKFSGEIP 749
                        DG+ PG +  +       F  N FSG +P
Sbjct: 543 RILNYLNLSRNHLDGSIPGNIASMQSLTSVDFSYNNFSGLVP 584



 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 45/165 (27%), Positives = 65/165 (39%), Gaps = 24/165 (14%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNL---------------- 461
           L L    L G +   + EL  L++L L +  + TGS+P+ +GN                 
Sbjct: 308 LNLFRNKLHGAIPEFVGELPALEVLQL-WENNFTGSIPQNLGNNGRLTLVDLSSNKITGT 366

Query: 462 --------KKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELY 617
                    +L  LI +G   FG IPDS+G                G IP  L  L +L 
Sbjct: 367 LPPNMCYGNRLQTLITLGNYLFGPIPDSLGKCKSLNRIRMGENFLNGSIPKGLFGLPKLT 426

Query: 618 WLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            ++L DN LTG  P  DG+     +           N+ SG +P+
Sbjct: 427 QVELQDNLLTGQFP-EDGS-----IATDLGQISLSNNQLSGSLPS 465



>gb:AF053993_1764487 Lycopersicon esculentum disease resistance
           protein (Cf-5) gene, complete cds.
          Length = 968

 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 53/145 (36%), Positives = 69/145 (47%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +  L+L    L+G +   +  L+ L  LDL YN  L+GS+P EIG L+ L  L L     
Sbjct: 265 LTKLSLGINFLSGSIPASLGNLNNLSRLDL-YNNKLSGSIPEEIGYLRSLTYLDLGENAL 323

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IP S+G                G IP  +G L  L +LDL +N L GSIP S GN  
Sbjct: 324 NGSIPSSLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLN 383

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L ML      +   N+ SG IP +
Sbjct: 384 NLFML------YLYNNQLSGSIPEE 402



 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 61/157 (38%), Positives = 72/157 (45%), Gaps = 9/157 (5%)
 Frame = +3

Query: 309 NGSRVVSL----TLSSMDL-TGELSGDIEE----LSELQILDLSYNKDLTGSLPREIGNL 461
           NGS   SL     LS +DL   +LSG I E    L  L  LDL  N  L GS+P  +GNL
Sbjct: 324 NGSIPSSLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENA-LNGSIPASLGNL 382

Query: 462 KKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQ 641
             L+ L L      G IP+ IG                G IP SLG L+ L+ L L +NQ
Sbjct: 383 NNLFMLYLYNNQLSGSIPEEIGYLSSLTELYLGNNSLNGSIPASLGNLNNLFMLYLYNNQ 442

Query: 642 LTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           L+GSIP   G    L  L        G N  +G IPA
Sbjct: 443 LSGSIPEEIGYLSSLTEL------FLGNNSLNGSIPA 473



 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 57/147 (38%), Positives = 70/147 (47%), Gaps = 4/147 (2%)
 Frame = +3

Query: 327 SLTLSSMD---LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           SLT  S+D   L+G +   +  L+ L  L L YN  L+GS+P EIG L+ L  L L G  
Sbjct: 216 SLTKLSLDINFLSGSIPASLGNLNNLSFLYL-YNNQLSGSIPEEIGYLRSLTKLSL-GIN 273

Query: 498 FF-GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
           F  G IP S+G                G IP  +G L  L +LDL +N L GSIP S GN
Sbjct: 274 FLSGSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPSSLGN 333

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
              L  L          NK SG IP +
Sbjct: 334 LNNLSRL------DLYNNKLSGSIPEE 354



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 54/148 (36%), Positives = 68/148 (45%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + +  L L +  L+G +  +I  LS L  L L  N  L GS+P  +GNL  L+ L L 
Sbjct: 381 NLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELYLG-NNSLNGSIPASLGNLNNLFMLYLY 439

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP+ IG                G IP SLG L+ L  L L +NQL+GSIP S 
Sbjct: 440 NNQLSGSIPEEIGYLSSLTELFLGNNSLNGSIPASLGNLNNLSRLYLYNNQLSGSIPASF 499

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           GN   L  L          N   GEIP+
Sbjct: 500 GNMRNLQTL------FLSDNDLIGEIPS 521



 Score = 73.6 bits (179), Expect = 4e-12
 Identities = 53/148 (35%), Positives = 68/148 (45%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + +  L L +  L+G +  +I  L  L  LDL  N  L GS+P  +GNL  L  L L 
Sbjct: 285 NLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENA-LNGSIPSSLGNLNNLSRLDLY 343

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP+ IG                G IP SLG L+ L+ L L +NQL+GSIP   
Sbjct: 344 NNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEI 403

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           G    L  L      + G N  +G IPA
Sbjct: 404 GYLSSLTEL------YLGNNSLNGSIPA 425



 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 47/145 (32%), Positives = 63/145 (43%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S +  L L +  L G +   +  L+ L +L L YN  L+GS+P EIG L  L  L L   
Sbjct: 407 SSLTELYLGNNSLNGSIPASLGNLNNLFMLYL-YNNQLSGSIPEEIGYLSSLTELFLGNN 465

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G IP S+G                G IP S G +  L  L L+DN L G IP    N
Sbjct: 466 SLNGSIPASLGNLNNLSRLYLYNNQLSGSIPASFGNMRNLQTLFLSDNDLIGEIPSFVCN 525

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIP 749
              L++L      +   N   G++P
Sbjct: 526 LTSLEVL------YMSRNNLKGKVP 544



 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 53/171 (30%), Positives = 74/171 (43%), Gaps = 23/171 (13%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQIL-------------DLSYNKDLT------ 431
           N + +V L L++  ++G +   I  L++LQI+             ++ Y + LT      
Sbjct: 117 NLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRSLTKLSLGI 176

Query: 432 ----GSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLG 599
               GS+P  +GN+  L  L L      G IP+ IG                G IP SLG
Sbjct: 177 NFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINFLSGSIPASLG 236

Query: 600 QLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            L+ L +L L +NQL+GSIP   G    L  L        G N  SG IPA
Sbjct: 237 NLNNLSFLYLYNNQLSGSIPEEIGYLRSLTKL------SLGINFLSGSIPA 281



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 48/145 (33%), Positives = 62/145 (42%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +  L+L    L+G +   +  ++ L  L L Y   L+G +P EIG L+ L  L L     
Sbjct: 169 LTKLSLGINFLSGSIPASLGNMTNLSFLFL-YENQLSGFIPEEIGYLRSLTKLSLDINFL 227

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IP S+G                G IP  +G L  L  L L  N L+GSIP S GN  
Sbjct: 228 SGSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTKLSLGINFLSGSIPASLGNLN 287

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L  L          NK SG IP +
Sbjct: 288 NLSRL------DLYNNKLSGSIPEE 306



 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 47/148 (31%), Positives = 63/148 (42%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + +  L L +  L+G +  +I  LS L  L L  N  L GS+P  +GNL  L  L L 
Sbjct: 429 NLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELFLG-NNSLNGSIPASLGNLNNLSRLYLY 487

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP S G               IG IP  +  L+ L  L ++ N L G +P   
Sbjct: 488 NNQLSGSIPASFGNMRNLQTLFLSDNDLIGEIPSFVCNLTSLEVLYMSRNNLKGKVPQCL 547

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           GN   L +L          N F GE+P+
Sbjct: 548 GNISDLHIL------SMSSNSFRGELPS 569



 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 42/137 (30%), Positives = 60/137 (43%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L++SS    GEL   I  L+ L+ILD   N +L G++P+  GN+  L    +      G 
Sbjct: 556 LSMSSNSFRGELPSSISNLTSLKILDFGRN-NLEGAIPQFFGNISSLQVFDMQNNKLSGT 614

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           +P +                    IP SL    +L  LDL DNQL  + P+  G  P L 
Sbjct: 615 LPTNFSIGCSLISLNLHGNELADEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELR 674

Query: 690 MLVGTKHFHFGXNKFSG 740
           +L  T +   G  + SG
Sbjct: 675 VLRLTSNKLHGPIRSSG 691



 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 53/217 (24%), Positives = 76/217 (35%), Gaps = 23/217 (10%)
 Frame = +3

Query: 171 FLGIVAFTDNNDYVAIKALRDGWKNVP----PSWAEGSDPCGDHWEGVGCNGSRVVSLTL 338
           +L  VAF    +  A+   +  +KN       SW   S+ C D W GV C   RV +L +
Sbjct: 19  YLFTVAFASTEEATALLKWKATFKNQNNSFLASWTTSSNACKD-WYGVVCLNGRVNTLNI 77

Query: 339 SSMDLTGELSG-DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIP 515
           ++  + G L       L  L+ LDLS N                                
Sbjct: 78  TNASVIGTLYAFPFSSLPFLENLDLSNNN------------------------------- 106

Query: 516 DSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDML 695
                               G IPP +G L+ L +LDL  NQ++G+IP   G+   L ++
Sbjct: 107 ------------------ISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQII 148

Query: 696 -VGTKHFH-----------------FGXNKFSGEIPA 752
            +   H +                  G N  SG IPA
Sbjct: 149 RIFNNHLNGFIPEEIGYLRSLTKLSLGINFLSGSIPA 185



 Score = 42.7 bits (99), Expect = 0.007
 Identities = 33/91 (36%), Positives = 42/91 (46%), Gaps = 1/91 (1%)
 Frame = +3

Query: 426  LTGSLPREIGNLKKLYNLI-LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQ 602
            +T  L  EI  +  LY +I L    F G IP  +G                G IP SLG 
Sbjct: 747  VTKGLELEIVRILSLYTIIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGS 806

Query: 603  LSELYWLDLADNQLTGSIPVSDGNTPGLDML 695
            LS L  LDL+ NQL+G IP    +   L++L
Sbjct: 807  LSILESLDLSFNQLSGEIPQQLASLTFLEVL 837



 Score = 33.5 bits (75), Expect = 4.3
 Identities = 23/74 (31%), Positives = 37/74 (50%)
 Frame = +3

Query: 300 VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL 479
           +GC+   ++SL L   +L  E+   ++   +LQ+LDL  N+ L  + P  +G L +L  L
Sbjct: 621 IGCS---LISLNLHGNELADEIPRSLDNCKKLQVLDLGDNQ-LNDTFPMWLGTLPELRVL 676

Query: 480 ILVGCGFFGLIPDS 521
            L      G I  S
Sbjct: 677 RLTSNKLHGPIRSS 690



>gb:AY652735_1620180 Oryza sativa (japonica cultivar-group) somatic
           embryogenesis protein kinase 1 mRNA, complete cds.
          Length = 628

 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 55/180 (30%), Positives = 91/180 (50%), Gaps = 5/180 (2%)
 Frame = +3

Query: 135 RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWK---NVPPSWAEGS-DPCGDHWEGV 302
           R+ L +  +++  + +     N +  A+ +LR   K   NV  SW     +PC   W  V
Sbjct: 11  RLCLAVAVVWVVAVAVSRVGANTEGDALYSLRQSLKDANNVLQSWDPTLVNPCT--WFHV 68

Query: 303 GCN-GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL 479
            CN  + V+ + L +  L+G L   + +L  LQ L+L Y+ +++G++P E+GNL  L +L
Sbjct: 69  TCNPDNSVIRVDLGNAQLSGALVPQLGQLKNLQYLEL-YSNNISGTIPNELGNLTNLVSL 127

Query: 480 ILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
            L    F G IP+++G                G IP SL  ++ L  LDL++N L+G +P
Sbjct: 128 DLYLNNFTGFIPETLGQLYKLRFLRLNNNSLSGSIPKSLTNITTLQVLDLSNNNLSGEVP 187



>gb:AY085401_1570470 Arabidopsis thaliana clone 15013 mRNA, complete
           sequence.
          Length = 680

 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 71/233 (30%), Positives = 97/233 (41%), Gaps = 29/233 (12%)
 Frame = +3

Query: 138 IQLLLVPLFIQFLGIVAFTDNNDYVA----IKALRDGWKNVPPSWAEGSDPCGDHWEGVG 305
           + LLL+PL           +  D +A    +K   D       SW+   D C D +EGVG
Sbjct: 8   LHLLLLPLLFLHFSNQVMAEITDELATLMEVKTELDPEDKHLASWSVNGDLCKD-FEGVG 66

Query: 306 CNGS-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI 482
           C+   RV +++L    L+G++S +I +L  L  L L YN  L G +PRE+GNL +L  L 
Sbjct: 67  CDWKGRVSNISLQGKGLSGKISPNIGKLKHLTGLFLHYNA-LVGDIPRELGNLSELTGLY 125

Query: 483 LVGCGFFGLIPDSIG------------------------XXXXXXXXXXXXXXFIGPIPP 590
           L      G IP +IG                                        G IP 
Sbjct: 126 LNVNNLSGEIPSNIGKMQGLQVLQLCYNNLTGSIPRELSSLRKLSVLALQSNKLTGAIPA 185

Query: 591 SLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           SLG LS L  LDL+ N L GS+P    + P L +L          N  +G +P
Sbjct: 186 SLGDLSALERLDLSYNHLFGSVPGKLASPPLLRVL------DIRNNSLTGNVP 232



 Score = 45.4 bits (106), Expect = 0.001
 Identities = 29/94 (30%), Positives = 44/94 (46%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L   +LTG +  ++  L +L +L L  NK LTG++P  +G+L  L  L L     FG 
Sbjct: 148 LQLCYNNLTGSIPRELSSLRKLSVLALQSNK-LTGAIPASLGDLSALERLDLSYNHLFGS 206

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSE 611
           +P  +                 G +PP L +L+E
Sbjct: 207 VPGKLASPPLLRVLDIRNNSLTGNVPPVLKRLNE 240



>gb:ATH550163_1552879 Arabidopsis thaliana mRNA for LRR
           receptor-like kinase 2 (rch2 gene).
          Length = 1120

 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 54/158 (34%), Positives = 80/158 (50%)
 Frame = +3

Query: 282 GDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNL 461
           G+   G+G +  ++  L  SS  L G++  +I   SELQ++DLS N  L GSLP  + +L
Sbjct: 480 GEIPSGIG-SLKKINFLDFSSNRLHGKVPDEIGSCSELQMIDLS-NNSLEGSLPNPVSSL 537

Query: 462 KKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQ 641
             L  L +    F G IP S+G              F G IP SLG  S L  LDL  N+
Sbjct: 538 SGLQVLDVSANQFSGKIPASLGRLVSLNKLILSKNLFSGSIPTSLGMCSGLQLLDLGSNE 597

Query: 642 LTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           L+G IP   G+   L++ +     +   N+ +G+IP++
Sbjct: 598 LSGEIPSELGDIENLEIAL-----NLSSNRLTGKIPSK 630



 Score = 73.2 bits (178), Expect = 5e-12
 Identities = 50/146 (34%), Positives = 73/146 (50%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           ++ +L++ +  ++GE+  D+   SEL  L L Y   L+GS+PREIG L KL  L L    
Sbjct: 251 KLETLSIYTTMISGEIPSDLGNCSELVDLFL-YENSLSGSIPREIGQLTKLEQLFLWQNS 309

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
             G IP+ IG                G IP S+G+LS L    ++DN+ +GSIP +  N 
Sbjct: 310 LVGGIPEEIGNCSNLKMIDLSLNLLSGSIPSSIGRLSFLEEFMISDNKFSGSIPTTISNC 369

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIPAQ 755
             L  L          N+ SG IP++
Sbjct: 370 SSLVQL------QLDKNQISGLIPSE 389



 Score = 68.9 bits (167), Expect = 9e-11
 Identities = 43/127 (33%), Positives = 63/127 (49%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S++ SL L    LTG +  ++ +LS L+++ +  NK+++G +P EIG+   L  L L   
Sbjct: 177 SKLKSLILFDNLLTGSIPTELGKLSGLEVIRIGGNKEISGQIPLEIGDCSNLTVLGLAET 236

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G +P S+G                G IP  LG  SEL  L L +N L+GSIP   G 
Sbjct: 237 SVSGNLPSSLGKLKKLETLSIYTTMISGEIPSDLGNCSELVDLFLYENSLSGSIPREIGQ 296

Query: 675 TPGLDML 695
              L+ L
Sbjct: 297 LTKLEQL 303



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 48/143 (33%), Positives = 67/143 (46%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +  L L S  L+G +  +I   S L  L L +N+ +TG +P  IG+LKK+  L       
Sbjct: 444 LTKLLLISNSLSGFIPQEIGNCSSLVRLRLGFNR-ITGEIPSGIGSLKKINFLDFSSNRL 502

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G +PD IG                G +P  +  LS L  LD++ NQ +G IP S G   
Sbjct: 503 HGKVPDEIGSCSELQMIDLSNNSLEGSLPNPVSSLSGLQVLDVSANQFSGKIPASLGRLV 562

Query: 681 GLDMLVGTKHFHFGXNKFSGEIP 749
            L+ L+ +K      N FSG IP
Sbjct: 563 SLNKLILSK------NLFSGSIP 579



 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 51/162 (31%), Positives = 76/162 (46%), Gaps = 2/162 (1%)
 Frame = +3

Query: 276 PCGDHWEGVGCNGSRVVS-LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREI 452
           PC ++W  + C+    ++ + + S+ L   L  ++     LQ L +S   +LTG+LP  +
Sbjct: 68  PC-NNWTFITCSSQGFITDIDIESVPLQLSLPKNLPAFRSLQKLTIS-GANLTGTLPESL 125

Query: 453 GNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLA 632
           G+   L  L L   G  G IP S+                 G IPP + + S+L  L L 
Sbjct: 126 GDCLGLKVLDLSSNGLVGDIPWSLSKLRNLETLILNSNQLTGKIPPDISKCSKLKSLILF 185

Query: 633 DNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNK-FSGEIPAQ 755
           DN LTGSIP   G   GL+++        G NK  SG+IP +
Sbjct: 186 DNLLTGSIPTELGKLSGLEVI------RIGGNKEISGQIPLE 221



 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 49/150 (32%), Positives = 67/150 (44%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           C+  +++ L+L+   L+G +   I  LS L+   +S NK  +GS+P  I N   L  L L
Sbjct: 321 CSNLKMIDLSLNL--LSGSIPSSIGRLSFLEEFMISDNK-FSGSIPTTISNCSSLVQLQL 377

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                 GLIP  +G                G IPP L   ++L  LDL+ N LTG+IP  
Sbjct: 378 DKNQISGLIPSELGTLTKLTLFFAWSNQLEGSIPPGLADCTDLQALDLSRNSLTGTIP-- 435

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
                GL ML          N  SG IP +
Sbjct: 436 ----SGLFMLRNLTKLLLISNSLSGFIPQE 461



 Score = 41.6 bits (96), Expect = 0.016
 Identities = 26/66 (39%), Positives = 40/66 (60%)
 Frame = +3

Query: 324 VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF 503
           ++L LSS  LTG++   I  L++L ILDLS+N  L G L   + N++ L +L +    F 
Sbjct: 614 IALNLSSNRLTGKIPSKIASLNKLSILDLSHNM-LEGDL-APLANIENLVSLNISYNSFS 671

Query: 504 GLIPDS 521
           G +PD+
Sbjct: 672 GYLPDN 677



 Score = 37.0 bits (84), Expect = 0.39
 Identities = 22/56 (39%), Positives = 38/56 (67%), Gaps = 1/56 (1%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQI-LDLSYNKDLTGSLPREIGNLKKL 470
           C+G ++  L L S +L+GE+  ++ ++  L+I L+LS N+ LTG +P +I +L KL
Sbjct: 585 CSGLQL--LDLGSNELSGEIPSELGDIENLEIALNLSSNR-LTGKIPSKIASLNKL 637



>gb:CQ768565_1451800 Sequence 60 from Patent WO2004007712.
          Length = 601

 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 63/177 (35%), Positives = 88/177 (49%), Gaps = 8/177 (4%)
 Frame = +3

Query: 159 LFIQFLGIVAFTDNNDYVAIKALR------DGWKNVPPSW-AEGSDPCGDHWEGVGCNGS 317
           LF+ F+  V  T      A+ ALR      D   N+  SW A    PC   W  V CN  
Sbjct: 14  LFLDFVSRV--TGKTQVDALIALRSSLSSGDHTNNILQSWNATHVTPCS--WFHVTCNTE 69

Query: 318 RVVS-LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
             V+ L L S +L+GEL   + +L  LQ L+L +N ++TG +P E+G+L +L +L L   
Sbjct: 70  NSVTRLDLGSANLSGELVPQLAQLPNLQYLEL-FNNNITGEIPEELGDLMELVSLDLFAN 128

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
              G IP S+G                G IP SL  L  L  LD+++N+L+G IPV+
Sbjct: 129 NISGPIPSSLGKLGKLRFLRLYNNSLSGEIPRSLTALP-LDVLDISNNRLSGDIPVN 184



>gb:AE016959_1021016 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC091724_1734925 Oryza sativa
            chromosome 10 clone OSJNBa0004E08, complete
            sequence.>gb:AE017058_1750835 Oryza sativa (japonica
            cultivar-group) chromosome 10, section 12 of 77 of the
            complete sequence.
          Length = 1130

 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 55/150 (36%), Positives = 75/150 (50%), Gaps = 1/150 (0%)
 Frame = +3

Query: 309  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
            N S + +L +SS  LTG +  ++    +L +LDL  N  L+GS+P EI  L  L NL+L 
Sbjct: 585  NLSNLGTLRMSSNRLTGPIPHELGNCKKLALLDLG-NNFLSGSIPAEITTLGSLQNLLLA 643

Query: 489  GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSEL-YWLDLADNQLTGSIPVS 665
            G    G IPDS                  G IP SLG L  +   L++++NQL+G IP S
Sbjct: 644  GNNLTGTIPDSFTATQALLELQLGDNSLEGAIPHSLGSLQYISKALNISNNQLSGQIPSS 703

Query: 666  DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
             GN   L++L          N  SG IP+Q
Sbjct: 704  LGNLQDLEVL------DLSNNSLSGIIPSQ 727



 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 51/166 (30%), Positives = 64/166 (38%), Gaps = 23/166 (13%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNK-----------------------DLT 431
           +V L+L S  L GEL   +     L +L LSYNK                          
Sbjct: 227 LVYLSLYSNQLAGELPRSLTNCGNLTVLYLSYNKIGGEVPDFFASMANLQTLYLDDNAFV 286

Query: 432 GSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSE 611
           G LP  IG L  L  L++    F G IP++IG              F G IP  +G L+ 
Sbjct: 287 GELPASIGELVNLEELVVSENAFTGTIPEAIGRCRSLTMLYLNGNRFTGSIPKFIGDLTR 346

Query: 612 LYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           L    +ADN +TG IP   G   GL  +          N  SG IP
Sbjct: 347 LQLFSIADNGITGEIPPEIGKCRGLVEIA------LQNNSLSGMIP 386



 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 41/148 (27%), Positives = 64/148 (43%), Gaps = 2/148 (1%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIG--NLKKLYNLILV 488
           S +  L L++   +GE+  DI ++  L  + L YN + TG LP+E+G      L ++ L 
Sbjct: 417 SNMAVLQLNNNSFSGEIHSDITQMRNLTNITL-YNNNFTGELPQELGLNTTPGLLHIDLT 475

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
              F G IP  +               F G  P  + +   LY ++L +NQ+ GS+P   
Sbjct: 476 RNHFRGAIPPGLCTGGQLAVLDLGYNQFDGGFPSEIAKCQSLYRVNLNNNQINGSLPADF 535

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           G   GL       +     N   G IP+
Sbjct: 536 GTNWGL------SYIDMSSNLLEGIIPS 557



 Score = 56.2 bits (134), Expect = 6e-07
 Identities = 41/140 (29%), Positives = 58/140 (41%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           + L++  + G L  D      L  +D+S N  L G +P  +G+   L  L L    F G 
Sbjct: 520 VNLNNNQINGSLPADFGTNWGLSYIDMSSNL-LEGIIPSALGSWSNLTKLDLSSNSFSGP 578

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP  +G                GPIP  LG   +L  LDL +N L+GSIP        + 
Sbjct: 579 IPRELGNLSNLGTLRMSSNRLTGPIPHELGNCKKLALLDLGNNFLSGSIPAE------IT 632

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
            L   ++     N  +G IP
Sbjct: 633 TLGSLQNLLLAGNNLTGTIP 652



 Score = 52.4 bits (124), Expect = 9e-06
 Identities = 39/142 (27%), Positives = 63/142 (44%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L+    TG +   I +L+ LQ+  ++ N  +TG +P EIG  + L  + L      G+
Sbjct: 326 LYLNGNRFTGSIPKFIGDLTRLQLFSIADN-GITGEIPPEIGKCRGLVEIALQNNSLSGM 384

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP  I                 GP+P +L +LS +  L L +N  +G I  SD     + 
Sbjct: 385 IPPDIAELNQLQKLSLFDNILRGPVPLALWRLSNMAVLQLNNNSFSGEIH-SD-----IT 438

Query: 690 MLVGTKHFHFGXNKFSGEIPAQ 755
            +    +     N F+GE+P +
Sbjct: 439 QMRNLTNITLYNNNFTGELPQE 460



 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 47/174 (27%), Positives = 63/174 (36%), Gaps = 6/174 (3%)
 Frame = +3

Query: 252 PSWAEGSDPCGDH--WEGVGCNGS-RVVSLTLSSMDLTGELSGDIEELSELQIL---DLS 413
           PSW  G      H  + GV C+ +  V +L LS   L GEL+     L  L  L   DLS
Sbjct: 52  PSWRRGGGGGAPHCAFLGVTCDAAGAVAALNLSGAGLAGELAASAPRLCALPALAALDLS 111

Query: 414 YNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPS 593
            N                         GF G +P ++                 G +PP 
Sbjct: 112 RN-------------------------GFTGSVPAALAACSCIATLVLSFNSLSGAVPPE 146

Query: 594 LGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           +     L  +DL  N LTG IP + G   G  +L   ++     N  SG IP +
Sbjct: 147 ILSSRRLRKVDLNSNALTGEIPTT-GLAAGSSVL---EYLDLCVNSLSGAIPPE 196



>pir|T46070|T46070 hypothetical protein T18N14.120 - Arabidopsis
           thaliana>gb:ATT18N14_1554791 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T18N14.>gb:AY054515_1563169
           Arabidopsis thaliana putative protein (At3g51740;
           T18N14.120) mRNA, complete cds.>gb:BT006350_1639237
           Arabidopsis thaliana At3g51740/T18N14_120 gene, complete
           cds.>gb:AF372978_1792690 Arabidopsis thaliana
           AT3g51740/T18N14_120 mRNA, complete cds.
          Length = 836

 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 64/196 (32%), Positives = 90/196 (45%), Gaps = 5/196 (2%)
 Frame = +3

Query: 177 GIVAFTDNNDYVAIKALRD---GWKNVPPSW--AEGSDPCGDHWEGVGCNGSRVVSLTLS 341
           GIV    N  Y A++A++     +  V  SW  +  S  C   W G+ C   +VV++ L 
Sbjct: 46  GIVVTQAN--YQALQAIKHELIDFTGVLKSWNNSASSQVCSG-WAGIKCLRGQVVAIQLP 102

Query: 342 SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS 521
              L G +S  I +L  L+ L L +N  + GS+PR +G LK L  + L      G IP S
Sbjct: 103 WKGLGGTISEKIGQLGSLRKLSL-HNNVIAGSVPRSLGYLKSLRGVYLFNNRLSGSIPVS 161

Query: 522 IGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVG 701
           +G                G IPPSL + + LY L+L+ N L+G +PVS   +  L  L  
Sbjct: 162 LGNCPLLQNLDLSSNQLTGAIPPSLTESTRLYRLNLSFNSLSGPLPVSVARSYTLTFL-- 219

Query: 702 TKHFHFGXNKFSGEIP 749
                   N  SG IP
Sbjct: 220 ----DLQHNNLSGSIP 231



 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 54/179 (30%), Positives = 78/179 (43%), Gaps = 10/179 (5%)
 Frame = +3

Query: 243 NVPPSWAEGSDPCG----DHWEGVG------CNGSRVVSLTLSSMDLTGELSGDIEELSE 392
           ++P  +  GS P      DH    G      C  S +  +++S   L+G +  +   L  
Sbjct: 229 SIPDFFVNGSHPLKTLNLDHNRFSGAVPVSLCKHSLLEEVSISHNQLSGSIPRECGGLPH 288

Query: 393 LQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXF 572
           LQ LD SYN  + G++P    NL  L +L L      G IPD+I                
Sbjct: 289 LQSLDFSYNS-INGTIPDSFSNLSSLVSLNLESNHLKGPIPDAIDRLHNLTELNLKRNKI 347

Query: 573 IGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            GPIP ++G +S +  LDL++N  TG IP+S      L  L     F+   N  SG +P
Sbjct: 348 NGPIPETIGNISGIKKLDLSENNFTGPIPLS------LVHLAKLSSFNVSYNTLSGPVP 400



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 33/98 (33%), Positives = 44/98 (44%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +VSL L S  L G +   I+ L  L  L+L  NK + G +P  IGN+  +  L L 
Sbjct: 309 NLSSLVSLNLESNHLKGPIPDAIDRLHNLTELNLKRNK-INGPIPETIGNISGIKKLDLS 367

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQ 602
              F G IP S+                 GP+PP L +
Sbjct: 368 ENNFTGPIPLSLVHLAKLSSFNVSYNTLSGPVPPVLSK 405



>pir|H84421|H84421 probable receptor-like protein kinase [imported]
           - Arabidopsis thaliana>gb:AC006200_1533560 Arabidopsis
           thaliana chromosome 2 clone F10A8 map rga, complete
           sequence.
          Length = 716

 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 52/161 (32%), Positives = 79/161 (49%)
 Frame = +3

Query: 270 SDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPRE 449
           SD     W GV C   RVVSL++   +L G L   +  LS L+ L+L  N+   GSLP +
Sbjct: 49  SDENACSWNGVTCKELRVVSLSIPRKNLYGSLPSSLGFLSSLRHLNLRSNR-FYGSLPIQ 107

Query: 450 IGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDL 629
           + +L+ L +L+L G  F G + + IG              F G +P S+ Q + L  LD+
Sbjct: 108 LFHLQGLQSLVLYGNSFDGSLSEEIGKLKLLQTLDLSQNLFNGSLPLSILQCNRLKTLDV 167

Query: 630 ADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           + N L+G +P   G+       V  +      N+F+G IP+
Sbjct: 168 SRNNLSGPLPDGFGSA-----FVSLEKLDLAFNQFNGSIPS 203



 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 41/113 (36%), Positives = 53/113 (46%), Gaps = 2/113 (1%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGN-LKKLYNLILVGCGFF 503
           +L LS     G L   I + + L+ LD+S N +L+G LP   G+    L  L L    F 
Sbjct: 140 TLDLSQNLFNGSLPLSILQCNRLKTLDVSRN-NLSGPLPDGFGSAFVSLEKLDLAFNQFN 198

Query: 504 GLIPDSIGXXXXXXXXXXXXXX-FIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
           G IP  IG               F G IPP+LG L E  ++DL  N L+G IP
Sbjct: 199 GSIPSDIGNLSNLQGTADFSHNHFTGSIPPALGDLPEKVYIDLTFNNLSGPIP 251



>gb:AJ841698_1814401 Poa pratensis serk1 gene for somatic
           embryogenesis receptor-like kinase 1, exons 1-11, allele
           1.
          Length = 629

 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 62/182 (34%), Positives = 85/182 (46%), Gaps = 2/182 (1%)
 Frame = +3

Query: 210 VAIKALRDGWKNVPPSWAEGS-DPCGDHWEGVGCNGSR-VVSLTLSSMDLTGELSGDIEE 383
           +A+K+     K V   W   S DPC   W  V C+  + VVSL +++  L G LS  I  
Sbjct: 51  MAVKSRMRDEKGVMAGWDINSVDPCT--WSMVTCSADQFVVSLQMANNGLAGALSPSIGN 108

Query: 384 LSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXX 563
           LS LQ + L  N+ ++G +P E+G L KL  L L G                        
Sbjct: 109 LSYLQTMLLQNNR-ISGDIPPEVGKLAKLKALDLSG------------------------ 143

Query: 564 XXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGE 743
             F+G IP SLGQL++L +L L  N L+G IP++  + PGL  L          N  SG 
Sbjct: 144 NQFLGEIPNSLGQLTQLNYLRLDRNNLSGQIPINVASLPGLTFL------DISFNNLSGP 197

Query: 744 IP 749
           +P
Sbjct: 198 VP 199



>gb:AF364177_1791593 Oryza sativa leucine-rich repeat protein mRNA,
           complete cds.>gb:AF364178_1791594 Oryza sativa
           leucine-rich repeat protein mRNA, complete
           cds.>gb:AP003260_1826552 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0468B07.
          Length = 213

 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 54/161 (33%), Positives = 83/161 (51%), Gaps = 5/161 (3%)
 Frame = +3

Query: 198 NNDYVAIKALRDGWKN---VPPSWAEGS-DPCGDHWEGVGCN-GSRVVSLTLSSMDLTGE 362
           N++  A+ ALR   ++   V  SW     +PC   W  V C+  +RV  L L +++L+G 
Sbjct: 24  NSEGDALSALRRSLRDPGGVLQSWDPTLVNPCT--WFHVTCDRDNRVTRLDLGNLNLSGH 81

Query: 363 LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXX 542
           L  ++ +L  LQ L+L Y  ++ G++P E+GNLK L +L L      G IP ++G     
Sbjct: 82  LVPELGKLDHLQYLEL-YKNNIQGTIPSELGNLKNLISLDLYKNNISGTIPPTLGKLTSL 140

Query: 543 XXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                      GPIP  L  +S L  +D++ N L G+IP S
Sbjct: 141 VFLRLNGNRLTGPIPRELAGISSLKVVDVSSNDLCGTIPTS 181



>gb:AY804250_1628647 Daucus carota antifreeze protein mRNA, complete
           cds.
          Length = 332

 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 60/211 (28%), Positives = 93/211 (44%), Gaps = 5/211 (2%)
 Frame = +3

Query: 132 PRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKN--VPPSWAEGSDPCGDHWEGVG 305
           P + + ++ L +  L      +NND  A+  ++   KN  +  SW    D CG  W+ V 
Sbjct: 9   PILCICMIFLCLPNLSASQRCNNNDKQALLQIKTALKNPTITDSWVSDDDCCG--WDLVE 66

Query: 306 CN--GSRVVSLTLSSMD-LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYN 476
           C+   +R++SL +   + LTG++   + +L  LQ L      +L G +P EI  LK L +
Sbjct: 67  CDETSNRIISLIIQDDEALTGQIPPQVGDLPYLQALWFRKLPNLFGKIPEEISALKDLKS 126

Query: 477 LILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSI 656
           L L      G +P                   +G IPP L  L+ L  L L  N+LTG I
Sbjct: 127 LRLSSTSLSGPVPLFFPQLTKLTCLDLSFNKLLGVIPPQLSTLANLKALHLERNELTGEI 186

Query: 657 PVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           P   GN        G+   +   N+ +G +P
Sbjct: 187 PDIFGN------FAGSPDIYLSHNQLTGFVP 211



 Score = 32.3 bits (72), Expect = 9.5
 Identities = 39/166 (23%), Positives = 59/166 (35%), Gaps = 23/166 (13%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNK-----------------------DLTGS 437
           SL LSS  L+G +     +L++L  LDLS+NK                       +LTG 
Sbjct: 126 SLRLSSTSLSGPVPLFFPQLTKLTCLDLSFNKLLGVIPPQLSTLANLKALHLERNELTGE 185

Query: 438 LPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELY 617
           +P   GN     ++ L      G +P + G                G I    G    L 
Sbjct: 186 IPDIFGNFAGSPDIYLSHNQLTGFVPKTFG-RADPIRLDFSGNRLEGDISFLFGPKKRLE 244

Query: 618 WLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            LD + N+L+ +        P L  L          N+ SG + ++
Sbjct: 245 TLDFSGNELSFNFSRVQEFPPSLTYL------DLNHNQISGSLSSE 284



>gb:AY603422_1617457 Pyrus pyrifolia isolate Kousui2 leucine-rich
           repeat receptor-like protein kinase mRNA, complete cds.
          Length = 998

 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 44/122 (36%), Positives = 62/122 (50%)
 Frame = +3

Query: 384 LSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXX 563
           +S L++L+LSYN    G +P E+GNL  L  L L  C   G IPDS+G            
Sbjct: 187 ISTLKMLNLSYNPFHPGRIPAELGNLTNLEVLWLTECNLVGEIPDSLGRLKNLKDLDLAI 246

Query: 564 XXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGE 743
               G IPPSL +L+ +  ++L +N LTG +P      PG+  L   +      N+ SG+
Sbjct: 247 NGLTGRIPPSLSELTSVVQIELYNNSLTGELP------PGMSKLTRLRLLDASMNQLSGQ 300

Query: 744 IP 749
           IP
Sbjct: 301 IP 302



 Score = 69.3 bits (168), Expect = 7e-11
 Identities = 52/148 (35%), Positives = 74/148 (50%), Gaps = 3/148 (2%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           VV + L +  LTGEL   + +L+ L++LD S N+ L+G +P E+  L  L +L L     
Sbjct: 263 VVQIELYNNSLTGELPPGMSKLTRLRLLDASMNQ-LSGQIPDELCRLP-LESLNLYENNL 320

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS---DG 671
            G +P SI                 G +P +LG+ S L W D++ NQ TG+IP S    G
Sbjct: 321 EGSVPASIANSPNLYEVRLFRNKLSGELPQNLGKNSPLKWFDVSSNQFTGTIPASLCEKG 380

Query: 672 NTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
               + ML          N+FSGEIPA+
Sbjct: 381 QMEEILML---------HNEFSGEIPAR 399



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 38/133 (28%), Positives = 62/133 (46%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           L+GE+      L  + +++L+ N +L+G + + I     L  LIL    F G IP+ IG 
Sbjct: 416 LSGEVPVGFWGLPRVYLMELAEN-ELSGPIAKSIAGATNLSLLILAKNKFSGPIPEEIGW 474

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH 710
                        F GP+P  + +L +L  LDL  N+++G +PV      G+        
Sbjct: 475 VKNLMEFSGGDNKFSGPLPEGIARLGQLGTLDLHSNEVSGELPV------GIQSWTKLNE 528

Query: 711 FHFGXNKFSGEIP 749
            +   N+ SG+IP
Sbjct: 529 LNLASNQLSGKIP 541



 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 42/140 (30%), Positives = 60/140 (42%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L+  +L GE+   +  L  L+ LDL+ N  LTG +P  +  L  +  + L      G 
Sbjct: 218 LWLTECNLVGEIPDSLGRLKNLKDLDLAIN-GLTGRIPPSLSELTSVVQIELYNNSLTGE 276

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           +P  +                 G IP  L +L  L  L+L +N L GS+P S  N+P L 
Sbjct: 277 LPPGMSKLTRLRLLDASMNQLSGQIPDELCRL-PLESLNLYENNLEGSVPASIANSPNL- 334

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
                       NK SGE+P
Sbjct: 335 -----YEVRLFRNKLSGELP 349



 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 53/174 (30%), Positives = 73/174 (41%), Gaps = 7/174 (4%)
 Frame = +3

Query: 255 SWAEG-SDPCGDHWEGVGCNGSR-----VVSLTLSSMDLTGELSGDIEELSELQILDLSY 416
           SW +  S PC  +W GV C+ +      V SL L S +L G     +  L  L  L L Y
Sbjct: 44  SWNDADSTPC--NWLGVECDDASSSSPVVRSLDLPSANLAGPFPTVLCRLPNLTHLSL-Y 100

Query: 417 NKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSL 596
           N  +  +LP  +   + L +L L      G +P ++               F GPIP S 
Sbjct: 101 NNSINSTLPPSLSTCQTLEHLDLAQNLLTGALPATLPDLPNLKYLDLTGNNFSGPIPDSF 160

Query: 597 GQLSELYWLDLADNQLTGSIPVSDGNTPGLDML-VGTKHFHFGXNKFSGEIPAQ 755
           G+  +L  L L  N +  +IP   GN   L ML +    FH       G IPA+
Sbjct: 161 GRFQKLEVLSLVYNLIESTIPPFLGNISTLKMLNLSYNPFH------PGRIPAE 208



>gb:AY603421_1617456 Pyrus pyrifolia isolate Kousui1 leucine-rich
           repeat receptor-like protein kinase mRNA, complete cds.
          Length = 998

 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 44/122 (36%), Positives = 62/122 (50%)
 Frame = +3

Query: 384 LSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXX 563
           +S L++L+LSYN    G +P E+GNL  L  L L  C   G IPDS+G            
Sbjct: 187 ISTLKMLNLSYNPFHPGRIPAELGNLTNLEVLWLTECNLVGEIPDSLGRLKNLKDLDLAI 246

Query: 564 XXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGE 743
               G IPPSL +L+ +  ++L +N LTG +P      PG+  L   +      N+ SG+
Sbjct: 247 NGLTGRIPPSLSELTSVVQIELYNNSLTGELP------PGMSKLTRLRLLDASMNQLSGQ 300

Query: 744 IP 749
           IP
Sbjct: 301 IP 302



 Score = 69.3 bits (168), Expect = 7e-11
 Identities = 52/148 (35%), Positives = 74/148 (50%), Gaps = 3/148 (2%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           VV + L +  LTGEL   + +L+ L++LD S N+ L+G +P E+  L  L +L L     
Sbjct: 263 VVQIELYNNSLTGELPPGMSKLTRLRLLDASMNQ-LSGQIPDELCRLP-LESLNLYENNL 320

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS---DG 671
            G +P SI                 G +P +LG+ S L W D++ NQ TG+IP S    G
Sbjct: 321 EGSVPASIANSPNLYEVRLFRNKLSGELPQNLGKNSPLKWFDVSSNQFTGTIPASLCEKG 380

Query: 672 NTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
               + ML          N+FSGEIPA+
Sbjct: 381 QMEEILML---------HNEFSGEIPAR 399



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 38/133 (28%), Positives = 62/133 (46%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           L+GE+      L  + +++L+ N +L+G + + I     L  LIL    F G IP+ IG 
Sbjct: 416 LSGEVPVGFWGLPRVYLMELAEN-ELSGPIAKSIAGATNLSLLILAKNKFSGPIPEEIGW 474

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH 710
                        F GP+P  + +L +L  LDL  N+++G +PV      G+        
Sbjct: 475 VKNLMEFSGGDNKFSGPLPEGIARLGQLGTLDLHSNEVSGELPV------GIQSWTKLNE 528

Query: 711 FHFGXNKFSGEIP 749
            +   N+ SG+IP
Sbjct: 529 LNLASNQLSGKIP 541



 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 53/174 (30%), Positives = 74/174 (42%), Gaps = 7/174 (4%)
 Frame = +3

Query: 255 SWAEG-SDPCGDHWEGVGCNGSR-----VVSLTLSSMDLTGELSGDIEELSELQILDLSY 416
           SW +  S PC  +W GV C+ +      V+SL L S +L G     +  L  L  L L Y
Sbjct: 44  SWNDADSTPC--NWLGVSCDDASSSYPVVLSLDLPSANLAGPFPTVLCRLPNLTHLSL-Y 100

Query: 417 NKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSL 596
           N  +  +LP  +   + L +L L      G +P ++               F GPIP S 
Sbjct: 101 NNSINSTLPPSLSTCQNLEHLDLSQNLLTGGLPATLSDVPNLKYLDLTGNNFSGPIPDSF 160

Query: 597 GQLSELYWLDLADNQLTGSIPVSDGNTPGLDML-VGTKHFHFGXNKFSGEIPAQ 755
           G+  +L  L L  N +  +IP   GN   L ML +    FH       G IPA+
Sbjct: 161 GRFQKLEVLSLVYNLIESTIPPFLGNISTLKMLNLSYNPFH------PGRIPAE 208



 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 42/140 (30%), Positives = 60/140 (42%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L+  +L GE+   +  L  L+ LDL+ N  LTG +P  +  L  +  + L      G 
Sbjct: 218 LWLTECNLVGEIPDSLGRLKNLKDLDLAIN-GLTGRIPPSLSELTSVVQIELYNNSLTGE 276

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           +P  +                 G IP  L +L  L  L+L +N L GS+P S  N+P L 
Sbjct: 277 LPPGMSKLTRLRLLDASMNQLSGQIPDELCRL-PLESLNLYENNLEGSVPASIANSPNL- 334

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
                       NK SGE+P
Sbjct: 335 -----YEVRLFRNKLSGELP 349



>gb:AY518287_1610789 Arabidopsis thaliana strubbelig receptor family
           2 (SRF2) mRNA, complete cds.>gb:AP002032_1821494
           Arabidopsis thaliana genomic DNA, chromosome 5, P1
           clone:MPH15.
          Length = 735

 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 57/196 (29%), Positives = 90/196 (45%), Gaps = 9/196 (4%)
 Frame = +3

Query: 135 RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPP-----SWA-EGSDPCGDHWE 296
           +++ L   L    L ++A TD  D + + AL+D +K++        W  EG DPCG+ W 
Sbjct: 6   QLRFLATILLTTILFVLAKTDT-DPLEVLALQDLYKSLRNPEQLRGWRLEGGDPCGEAWL 64

Query: 297 GVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNK---DLTGSLPREIGNLKK 467
           G+ C+GS +V L L  + L G L   ++ L  L+ILD+S+N    ++   LP    ++  
Sbjct: 65  GISCSGSSIVDLQLRELKLLGSLGNQLQHLHNLKILDVSFNNLEGEIPFGLPPNATHINM 124

Query: 468 LYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLT 647
            YN +         IP S+                 GP+      L ++  +DL+ N LT
Sbjct: 125 AYNNLTQS------IPFSLPLMTSLQSLNLSHNSLSGPLGNVFSGL-QIKEMDLSFNNLT 177

Query: 648 GSIPVSDGNTPGLDML 695
           G +P S G    L  L
Sbjct: 178 GDLPSSFGTLMNLTSL 193



>gb:AY463361_1607685 Oryza sativa (indica cultivar-group)
           benzothiadiazole-induced somatic embryogenesis receptor
           kinase 1 (BISERK1) mRNA, complete cds.
          Length = 624

 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 55/178 (30%), Positives = 88/178 (49%), Gaps = 2/178 (1%)
 Frame = +3

Query: 144 LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGS-DPCGDHWEGVGCNGSR 320
           +LL+ L +    ++A  + +   +++       NV  SW     +PC   W  V CN   
Sbjct: 11  VLLLRLLVPAARVLANMEGDALHSLRTNLVDPNNVLQSWDPTLVNPCT--WFHVTCNNDN 68

Query: 321 -VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
            V+ + L +  L+G L   + +L  LQ L+L Y+ +++G++P E+GNL  L +L L    
Sbjct: 69  SVIRVDLGNAALSGTLVPQLGQLKNLQYLEL-YSNNISGTIPSELGNLTNLVSLDLYLNN 127

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG 671
           F G IPDS+G                G IP SL  ++ L  LDL++N L+G +P   G
Sbjct: 128 FTGPIPDSLGNLLKLRFLRLNNNSLSGSIPKSLTAITALQVLDLSNNNLSGEVPYKHG 185



 Score = 37.7 bits (86), Expect = 0.23
 Identities = 22/58 (37%), Positives = 29/58 (50%)
 Frame = +3

Query: 576 GPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           G + P LGQL  L +L+L  N ++G+IP   GN   L  L          N F+G IP
Sbjct: 82  GTLVPQLGQLKNLQYLELYSNNISGTIPSELGNLTNLVSL------DLYLNNFTGPIP 133



>gb:AY182165_1587873 Elaeis guineensis clone Rlk-OPff receptor-like
           protein kinase mRNA, complete cds.
          Length = 938

 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 51/148 (34%), Positives = 71/148 (47%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           + S +  L LSS   +G +   + +L  L++LDLS N+ L GS+P EIG    L  L L 
Sbjct: 380 SASNLQVLVLSSNAFSGSIPEGLGKLKSLEVLDLSGNR-LNGSIPLEIGGAVSLKELRLE 438

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP  IG                GPIPP+L  L+ L  ++ + N+LTG+IP   
Sbjct: 439 KNSLKGAIPTQIGNCASLTSLDLSQNNLTGPIPPTLANLTNLQIINFSRNRLTGTIPKQL 498

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            N P L        F+   N  SG+IP+
Sbjct: 499 SNLPHL------LSFNIAHNVLSGDIPS 520



 Score = 70.1 bits (170), Expect = 4e-11
 Identities = 46/142 (32%), Positives = 68/142 (47%), Gaps = 1/142 (0%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREI-GNLKKLYNLILVGCGFF 503
           +L+LS  + +G LS D+  L  L+ LDLS NK L+G +P +  G  + +  + L    FF
Sbjct: 98  TLSLSKNNFSGTLSSDLLRLESLRNLDLSENK-LSGPIPDDFFGQCRSIRAISLAKNAFF 156

Query: 504 GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG 683
           G IP ++G                G +P  L  L+ L  LDL+DN L G IPV      G
Sbjct: 157 GAIPSNVGFCSTLAALNLSSNRLSGSLPWRLWSLNALRSLDLSDNTLVGEIPV------G 210

Query: 684 LDMLVGTKHFHFGXNKFSGEIP 749
           +  +   +      N+ SG +P
Sbjct: 211 ISKMYNLRSISLHGNRLSGHLP 232



 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 40/112 (35%), Positives = 53/112 (47%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           SL L+   L+G L   + +LS    L LS N   +G +P  IG +K L  L L   GFFG
Sbjct: 243 SLDLAGNSLSGSLPESMRKLSTCSYLSLSSNF-FSGEVPTWIGEMKSLETLDLSRNGFFG 301

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPV 662
            +P S+G              F G  P SL     L  +DL+ N LTG +P+
Sbjct: 302 QLPGSLGDLQLLKALKLSRNGFTGSFPESLCSCKSLVDVDLSQNSLTGKLPL 353



 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 44/141 (31%), Positives = 66/141 (46%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           SL LS   L GE+   I ++  L+ + L  N+ L+G LP +IG+   L +L L G    G
Sbjct: 195 SLDLSDNTLVGEIPVGISKMYNLRSISLHGNR-LSGHLPDDIGDCLLLKSLDLAGNSLSG 253

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
            +P+S+               F G +P  +G++  L  LDL+ N   G +P S G+   L
Sbjct: 254 SLPESMRKLSTCSYLSLSSNFFSGEVPTWIGEMKSLETLDLSRNGFFGQLPGSLGD---L 310

Query: 687 DMLVGTKHFHFGXNKFSGEIP 749
            +L   K      N F+G  P
Sbjct: 311 QLL---KALKLSRNGFTGSFP 328



 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 55/186 (29%), Positives = 83/186 (44%)
 Frame = +3

Query: 192 TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG 371
           T ++D + +++LR    N+  S  + S P  D + G  C   R +SL  ++    G +  
Sbjct: 109 TLSSDLLRLESLR----NLDLSENKLSGPIPDDFFGQ-CRSIRAISLAKNAF--FGAIPS 161

Query: 372 DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXX 551
           ++   S L  L+LS N+ L+GSLP  + +L  L +L L      G IP  I         
Sbjct: 162 NVGFCSTLAALNLSSNR-LSGSLPWRLWSLNALRSLDLSDNTLVGEIPVGISKMYNLRSI 220

Query: 552 XXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNK 731
                   G +P  +G    L  LDLA N L+GS+P S      +  L    +     N 
Sbjct: 221 SLHGNRLSGHLPDDIGDCLLLKSLDLAGNSLSGSLPES------MRKLSTCSYLSLSSNF 274

Query: 732 FSGEIP 749
           FSGE+P
Sbjct: 275 FSGEVP 280



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 41/113 (36%), Positives = 52/113 (46%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           S++L    L+G L  DI +   L+ LDL+ N  L+GSLP  +  L     L L    F G
Sbjct: 219 SISLHGNRLSGHLPDDIGDCLLLKSLDLAGNS-LSGSLPESMRKLSTCSYLSLSSNFFSG 277

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
            +P  IG              F G +P SLG L  L  L L+ N  TGS P S
Sbjct: 278 EVPTWIGEMKSLETLDLSRNGFFGQLPGSLGDLQLLKALKLSRNGFTGSFPES 330



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 48/168 (28%), Positives = 66/168 (39%), Gaps = 18/168 (10%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           C+   +V + LS   LTG+L   + E    Q+L +S NK L GS+     +   L  L+L
Sbjct: 332 CSCKSLVDVDLSQNSLTGKLPLWVFESGLQQVL-VSENK-LNGSIVIPSSSASNLQVLVL 389

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
               F G IP+ +G                G IP  +G    L  L L  N L G+IP  
Sbjct: 390 SSNAFSGSIPEGLGKLKSLEVLDLSGNRLNGSIPLEIGGAVSLKELRLEKNSLKGAIPTQ 449

Query: 666 DGN------------------TPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            GN                   P L  L   +  +F  N+ +G IP Q
Sbjct: 450 IGNCASLTSLDLSQNNLTGPIPPTLANLTNLQIINFSRNRLTGTIPKQ 497



>gb:AC016163_1538127 Arabidopsis thaliana chromosome 1 BAC F26A9
           genomic sequence, complete sequence.
          Length = 784

 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 55/167 (32%), Positives = 77/167 (46%), Gaps = 28/167 (16%)
 Frame = +3

Query: 258 WAEGSDPCGDHWEGVGCN--GSRVVSLTL--------------------------SSMDL 353
           W + +D C   W+GV C+    +V+SL L                          S  +L
Sbjct: 57  WNKTTDCCS--WDGVTCDDKSGQVISLDLRSTLLNSSLKTNSSLFRLQYLRHLDLSGCNL 114

Query: 354 TGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXX 533
            GE+   +  LS L+ L+LS N+ L G +P  IGNLK+L NL L      G IP S+G  
Sbjct: 115 HGEIPSSLGNLSRLENLELSSNR-LVGEIPYSIGNLKQLRNLSLGDNDLIGEIPSSLGNL 173

Query: 534 XXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
                        +G +P S+G L+EL  + L  N L+GSIP+S  N
Sbjct: 174 SLLLDLDLWNNSLVGEVPASIGNLNELRVMSLDRNSLSGSIPISFTN 220



 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 50/147 (34%), Positives = 64/147 (43%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N SR+ +L LSS  L GE+   I  L +L+ L L  N DL G +P  +GNL  L +L L 
Sbjct: 124 NLSRLENLELSSNRLVGEIPYSIGNLKQLRNLSLGDN-DLIGEIPSSLGNLSLLLDLDLW 182

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G +P SIG                G IP S   L++L    +  N  T S+P   
Sbjct: 183 NNSLVGEVPASIGNLNELRVMSLDRNSLSGSIPISFTNLTKLSEFRIFFNNFT-SLP--- 238

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            +  G   LV    F    N FSG  P
Sbjct: 239 SDLSGFHNLV---TFDISANSFSGHFP 262



 Score = 40.8 bits (94), Expect = 0.027
 Identities = 40/169 (23%), Positives = 68/169 (40%), Gaps = 22/169 (13%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           + S++ +L L+   L G +   I +   L +LD+++N +++G +PR +  L  L      
Sbjct: 292 SSSKLQNLILTRNKLDGSIPESISKFLNLVLLDVAHN-NISGPVPRSMSKLVSLRIFGFS 350

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFI--------------------GPIPPSLGQLS 608
                G +P  +               F                     G  P  + +L 
Sbjct: 351 NNKLEGEVPSWLWRLSSTMLSHNSFSSFEKIYSKETMIQVLDLSFNSFRGTFPVWICKLK 410

Query: 609 ELYWLDLADNQLTGSIP--VSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            L++LDL++N   GSIP  + + N  GL +         G NKFSG +P
Sbjct: 411 GLHFLDLSNNLFNGSIPLCLRNFNLTGLIL---------GNNKFSGTLP 450



 Score = 38.5 bits (88), Expect = 0.13
 Identities = 25/83 (30%), Positives = 36/83 (43%)
 Frame = +3

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
           +G IP+SIG              F   IP     L++L  LDL+ N+L+G IP   G   
Sbjct: 611 YGEIPESIGCLEELRLLNLSGNAFTSDIPRVWENLTKLETLDLSRNKLSGQIPQDLGKLS 670

Query: 681 GLDMLVGTKHFHFGXNKFSGEIP 749
            L       + +F  N+  G +P
Sbjct: 671 FL------SYMNFSHNRLQGPVP 687



 Score = 38.1 bits (87), Expect = 0.17
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 3/116 (2%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLK---KLYNLILVG 491
           +V+  +S+   +G     +  +  L  + +  N+    S P E  N+    KL NLIL  
Sbjct: 247 LVTFDISANSFSGHFPKFLFSIPSLAWVSMDRNQF---SGPIEFANISSSSKLQNLILTR 303

Query: 492 CGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
               G IP+SI                 GP+P S+ +L  L     ++N+L G +P
Sbjct: 304 NKLDGSIPESISKFLNLVLLDVAHNNISGPVPRSMSKLVSLRIFGFSNNKLEGEVP 359



>gb:AX008789_1456287 Sequence 1 from Patent
           WO9964600.>gb:AF053127_1764428 Malus domestica
           leucine-rich receptor-like protein kinase (LRPKm1) mRNA,
           complete cds.
          Length = 999

 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 44/122 (36%), Positives = 62/122 (50%)
 Frame = +3

Query: 384 LSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXX 563
           +S L++L+LSYN    G +P E+GNL  L  L L  C   G IPDS+G            
Sbjct: 188 ISTLKMLNLSYNPFHPGRIPAELGNLTNLEVLRLTECNLVGEIPDSLGRLKNLKDLDLAI 247

Query: 564 XXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGE 743
               G IPPSL +L+ +  ++L +N LTG +P      PG+  L   +      N+ SG+
Sbjct: 248 NGLTGRIPPSLSELTSVVQIELYNNSLTGELP------PGMSKLTRLRLLDASMNQLSGQ 301

Query: 744 IP 749
           IP
Sbjct: 302 IP 303



 Score = 69.3 bits (168), Expect = 7e-11
 Identities = 52/148 (35%), Positives = 74/148 (50%), Gaps = 3/148 (2%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           VV + L +  LTGEL   + +L+ L++LD S N+ L+G +P E+  L  L +L L     
Sbjct: 264 VVQIELYNNSLTGELPPGMSKLTRLRLLDASMNQ-LSGQIPDELCRLP-LESLNLYENNL 321

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS---DG 671
            G +P SI                 G +P +LG+ S L W D++ NQ TG+IP S    G
Sbjct: 322 EGSVPASIANSPNLYEVRLFRNKLSGELPQNLGKNSPLKWFDVSSNQFTGTIPASLCEKG 381

Query: 672 NTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
               + ML          N+FSGEIPA+
Sbjct: 382 QMEEILML---------HNEFSGEIPAR 400



 Score = 59.3 bits (142), Expect = 7e-08
 Identities = 39/133 (29%), Positives = 63/133 (47%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           L+GE+      L  + +++L+ N +L+G + + I     L  LIL    F G IP+ IG 
Sbjct: 417 LSGEVPVGFWGLPRVYLMELAEN-ELSGPIAKSIARATNLSLLILAKNKFSGPIPEEIGW 475

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH 710
                        F GP+P S+ +L +L  LDL  N+++G +PV      G+        
Sbjct: 476 VENLMEFSGGDNKFSGPLPESIVRLGQLGTLDLHSNEVSGELPV------GIQSWTNLNE 529

Query: 711 FHFGXNKFSGEIP 749
            +   N+ SG+IP
Sbjct: 530 LNLASNQLSGKIP 542



 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 42/140 (30%), Positives = 60/140 (42%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L+  +L GE+   +  L  L+ LDL+ N  LTG +P  +  L  +  + L      G 
Sbjct: 219 LRLTECNLVGEIPDSLGRLKNLKDLDLAIN-GLTGRIPPSLSELTSVVQIELYNNSLTGE 277

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           +P  +                 G IP  L +L  L  L+L +N L GS+P S  N+P L 
Sbjct: 278 LPPGMSKLTRLRLLDASMNQLSGQIPDELCRL-PLESLNLYENNLEGSVPASIANSPNL- 335

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
                       NK SGE+P
Sbjct: 336 -----YEVRLFRNKLSGELP 350



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 36/142 (25%), Positives = 55/142 (38%)
 Frame = +3

Query: 270 SDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPRE 449
           S PC  +W GV C+ +   S  + S+DL                     + +L G  P  
Sbjct: 51  STPC--NWLGVTCDDASSSSPVVRSLDLP--------------------SANLAGPFPTV 88

Query: 450 IGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDL 629
           +  L  L +L L        +P S+                 G +P +L  L  L +LDL
Sbjct: 89  LCRLPNLTHLSLYNNSINSTLPPSLSTCQTLEDLDLAQNLLTGALPATLPDLPNLKYLDL 148

Query: 630 ADNQLTGSIPVSDGNTPGLDML 695
           + N  +G+IP S G    L++L
Sbjct: 149 SGNNFSGAIPDSFGRFQKLEVL 170



>pir|T00971|T00971 probable disease resistance protein [imported] -
           Arabidopsis thaliana>gb:AC002505_1530747 Arabidopsis
           thaliana chromosome 2 clone T9J22 map B68, complete
           sequence.
          Length = 480

 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 58/194 (29%), Positives = 90/194 (46%), Gaps = 11/194 (5%)
 Frame = +3

Query: 201 NDYVAIKALRDGWKNVPP----SWAEGSDPCGDHWEGVGC-NGSRVVSLTL------SSM 347
           +D   + A + G    P     +W +G+D C   W GV C NG+RVV LT+      + +
Sbjct: 32  DDEAGLLAFKSGITKDPSGILSTWKKGTDCCS--WNGVSCPNGNRVVVLTIRIESDDAGI 89

Query: 348 DLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG 527
            L+G +S  + +L  L+ +     K++TG  P  +  L  L  + L      G +P +IG
Sbjct: 90  FLSGTISPSLAKLQHLEGVVFINLKNITGPFPPFLFRLPHLKYVYLENTRLSGPLPANIG 149

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTK 707
                         FIG IP S+  L+ L +L+L  N LTG+IP+      G+  L    
Sbjct: 150 ALNRLDTLTVKGNRFIGSIPSSISNLTRLNYLNLGGNLLTGTIPL------GIANLKLIS 203

Query: 708 HFHFGXNKFSGEIP 749
           + +   N+ SG IP
Sbjct: 204 NLNLDGNRLSGTIP 217



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 50/146 (34%), Positives = 69/146 (47%), Gaps = 1/146 (0%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           +R+ +LT+      G +   I  L+ L  L+L  N  LTG++P  I NLK + NL L G 
Sbjct: 152 NRLDTLTVKGNRFIGSIPSSISNLTRLNYLNLGGNL-LTGTIPLGIANLKLISNLNLDGN 210

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSE-LYWLDLADNQLTGSIPVSDG 671
              G IPD                 F G +PPS+  L+  L +L+L  N L+GSIP    
Sbjct: 211 RLSGTIPDIFKSMTNLRILTLSRNRFSGKLPPSIASLAPVLAFLELGQNNLSGSIPSYLS 270

Query: 672 NTPGLDMLVGTKHFHFGXNKFSGEIP 749
               LD L  +K      N+FSG +P
Sbjct: 271 RFVALDTLDLSK------NRFSGAVP 290



>pir|F86410|F86410 protein F3M18.12 [imported] - Arabidopsis
           thaliana>gb:AE005172_891730 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC010155_1536924 Genomic sequence for
           Arabidopsis thaliana BAC F3M18 from chromosome I,
           complete sequence.>gb:AY093235_1575189 Arabidopsis
           thaliana putative receptor protein kinase (At1g28440)
           mRNA, complete cds.>gb:BT008808_1640004 Arabidopsis
           thaliana At1g28440 gene, complete cds.
          Length = 996

 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 49/143 (34%), Positives = 72/143 (50%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           V+SL  + +D  G +   +  +S L++L+LSYN      +P E GNL  L  + L  C  
Sbjct: 160 VLSLVYNLLD--GTIPPFLGNISTLKMLNLSYNPFSPSRIPPEFGNLTNLEVMWLTECHL 217

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IPDS+G               +G IPPSLG L+ +  ++L +N LTG IP   GN  
Sbjct: 218 VGQIPDSLGQLSKLVDLDLALNDLVGHIPPSLGGLTNVVQIELYNNSLTGEIPPELGNLK 277

Query: 681 GLDMLVGTKHFHFGXNKFSGEIP 749
            L +L  +       N+ +G+IP
Sbjct: 278 SLRLLDAS------MNQLTGKIP 294



 Score = 69.7 bits (169), Expect = 5e-11
 Identities = 50/140 (35%), Positives = 66/140 (47%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L +   +GE+S  I   S L +L LS N + TGSLP EIG+L  L  L   G  F G 
Sbjct: 425 LELVNNSFSGEISKSIGGASNLSLLILS-NNEFTGSLPEEIGSLDNLNQLSASGNKFSGS 483

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           +PDS+               F G +   +    +L  L+LADN+ TG IP   G+   L+
Sbjct: 484 LPDSLMSLGELGTLDLHGNQFSGELTSGIKSWKKLNELNLADNEFTGKIPDEIGSLSVLN 543

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
            L          N FSG+IP
Sbjct: 544 YL------DLSGNMFSGKIP 557



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 60/185 (32%), Positives = 78/185 (42%), Gaps = 6/185 (3%)
 Frame = +3

Query: 159 LFIQFLGIVAFTDNNDYVAIKALR---DGWKNVPPSW-AEGSDPCGDHWEGVGCNG--SR 320
           LF+  L    F+ N D   ++ ++   D   +   SW +  + PC   W GV C G  S 
Sbjct: 4   LFLFLLFPTVFSLNQDGFILQQVKLSLDDPDSYLSSWNSNDASPC--RWSGVSCAGDFSS 61

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           V S+ LSS +L G     I  LS L  L L YN  +  +LP  I   K L  L L     
Sbjct: 62  VTSVDLSSANLAGPFPSVICRLSNLAHLSL-YNNSINSTLPLNIAACKSLQTLDLSQNLL 120

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G +P ++               F G IP S G+   L  L L  N L G+IP   GN  
Sbjct: 121 TGELPQTLADIPTLVHLDLTGNNFSGDIPASFGKFENLEVLSLVYNLLDGTIPPFLGNIS 180

Query: 681 GLDML 695
            L ML
Sbjct: 181 TLKML 185



 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 45/145 (31%), Positives = 68/145 (46%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           + VV + L +  LTGE+  ++  L  L++LD S N+ LTG +P E+  +  L +L L   
Sbjct: 253 TNVVQIELYNNSLTGEIPPELGNLKSLRLLDASMNQ-LTGKIPDELCRV-PLESLNLYEN 310

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G +P SI                 G +P  LG  S L WLD+++N+ +G +P     
Sbjct: 311 NLEGELPASIALSPNLYEIRIFGNRLTGGLPKDLGLNSPLRWLDVSENEFSGDLPADLCA 370

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIP 749
              L+ L+         N FSG IP
Sbjct: 371 KGELEELL------IIHNSFSGVIP 389



 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 41/147 (27%), Positives = 62/147 (42%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           C    +  L +     +G +   + +   L  + L+YN+  +GS+P     L  +  L L
Sbjct: 369 CAKGELEELLIIHNSFSGVIPESLADCRSLTRIRLAYNR-FSGSVPTGFWGLPHVNLLEL 427

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
           V   F G I  SIG              F G +P  +G L  L  L  + N+ +GS+P S
Sbjct: 428 VNNSFSGEISKSIGGASNLSLLILSNNEFTGSLPEEIGSLDNLNQLSASGNKFSGSLPDS 487

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEI 746
             +   L    GT   H   N+FSGE+
Sbjct: 488 LMSLGEL----GTLDLH--GNQFSGEL 508



>pir|A57676|A57676 protein kinase Xa21 (EC 2.7.1.-), receptor type
           precursor - rice>gb:OLU72723_1692256 Oryza
           longistaminata receptor kinase-like protein (Xa21) gene,
           complete cds and family member C,
           pseudogene.>gb:OSU37133_1698440 Oryza sativa receptor
           kinase-like protein (Xa21) gene, complete cds.
          Length = 1025

 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 56/146 (38%), Positives = 71/146 (48%), Gaps = 1/146 (0%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIG-NLKKLYNLILVG 491
           SR+  L LS   + G +   I   ++L  LDLS+N+ L G +PREIG +LK L NL L  
Sbjct: 127 SRLQLLELSDNSIQGSIPAAIGACTKLTSLDLSHNQ-LRGMIPREIGASLKHLSNLYLYK 185

Query: 492 CGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG 671
            G  G IP ++G                G IP SLGQLS L  ++L  N L+G IP S  
Sbjct: 186 NGLSGEIPSALGNLTSLQEFDLSFNRLSGAIPSSLGQLSSLLTMNLGQNNLSGMIPNSIW 245

Query: 672 NTPGLDMLVGTKHFHFGXNKFSGEIP 749
           N   L      + F    NK  G IP
Sbjct: 246 NLSSL------RAFSVRENKLGGMIP 265



 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 47/147 (31%), Positives = 71/147 (48%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + ++SL LS+ +L+G +  ++  +  L I+      +L GS+P+EIG+LK L      
Sbjct: 470 NLTNLLSLGLSTNNLSGPIPSELFNIQTLSIMINVSKNNLEGSIPQEIGHLKNLVEFHAE 529

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP+++G                G IP +LGQL  L  LDL+ N L+G IP S 
Sbjct: 530 SNRLSGKIPNTLGDCQLLRYLYLQNNLLSGSIPSALGQLKGLETLDLSSNNLSGQIPTSL 589

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            +   L  L      +   N F GE+P
Sbjct: 590 ADITMLHSL------NLSFNSFVGEVP 610



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 51/150 (34%), Positives = 70/150 (46%), Gaps = 1/150 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELS-ELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           N S++ +L L   +L G L      LS  L  L L  NK +TGS+P++IGNL  L +L L
Sbjct: 349 NCSKLQTLNLGENNLGGVLPNSFSNLSTSLSFLALELNK-ITGSIPKDIGNLIGLQHLYL 407

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
               F G +P S+G                G IP ++G L+EL  L L  N+ +G IP +
Sbjct: 408 CNNNFRGSLPSSLGRLKNLGILLAYENNLSGSIPLAIGNLTELNILLLGTNKFSGWIPYT 467

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
             N   L  L          N  SG IP++
Sbjct: 468 LSNLTNLLSL------GLSTNNLSGPIPSE 491



 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 47/142 (33%), Positives = 68/142 (47%), Gaps = 2/142 (1%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG-FFG 506
           L L + +  G L   +  L  L IL L+Y  +L+GS+P  IGNL +L N++L+G   F G
Sbjct: 405 LYLCNNNFRGSLPSSLGRLKNLGIL-LAYENNLSGSIPLAIGNLTEL-NILLLGTNKFSG 462

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSEL-YWLDLADNQLTGSIPVSDGNTPG 683
            IP ++                 GPIP  L  +  L   ++++ N L GSIP   G+   
Sbjct: 463 WIPYTLSNLTNLLSLGLSTNNLSGPIPSELFNIQTLSIMINVSKNNLEGSIPQEIGHLKN 522

Query: 684 LDMLVGTKHFHFGXNKFSGEIP 749
           L        FH   N+ SG+IP
Sbjct: 523 L------VEFHAESNRLSGKIP 538



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 45/150 (30%), Positives = 65/150 (43%), Gaps = 4/150 (2%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTG----ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI 482
           +++ SL LS   L G    E+   ++ LS L +    Y   L+G +P  +GNL  L    
Sbjct: 151 TKLTSLDLSHNQLRGMIPREIGASLKHLSNLYL----YKNGLSGEIPSALGNLTSLQEFD 206

Query: 483 LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPV 662
           L      G IP S+G                G IP S+  LS L    + +N+L G IP 
Sbjct: 207 LSFNRLSGAIPSSLGQLSSLLTMNLGQNNLSGMIPNSIWNLSSLRAFSVRENKLGGMIPT 266

Query: 663 SDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           +   T  L  ++       G N+F G+IPA
Sbjct: 267 NAFKTLHLLEVI-----DMGTNRFHGKIPA 291



 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 52/165 (31%), Positives = 71/165 (43%), Gaps = 8/165 (4%)
 Frame = +3

Query: 282 GDH--WEGVGC------NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGS 437
           G H  W GV C      +  RVV L L S +L+G +S  +  LS L+ LDL  N  L+G 
Sbjct: 60  GQHCTWVGVVCGRRRRRHPHRVVKLLLRSSNLSGIISPSLGNLSFLRELDLGDNY-LSGE 118

Query: 438 LPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELY 617
           +P E+  L +L  L L                              G IP ++G  ++L 
Sbjct: 119 IPPELSRLSRLQLLEL------------------------SDNSIQGSIPAAIGACTKLT 154

Query: 618 WLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            LDL+ NQL G IP   G +     L    + +   N  SGEIP+
Sbjct: 155 SLDLSHNQLRGMIPREIGAS-----LKHLSNLYLYKNGLSGEIPS 194



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 29/97 (29%), Positives = 41/97 (42%)
 Frame = +3

Query: 465 KLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQL 644
           ++  L+L      G+I  S+G                G IPP L +LS L  L+L+DN +
Sbjct: 80  RVVKLLLRSSNLSGIISPSLGNLSFLRELDLGDNYLSGEIPPELSRLSRLQLLELSDNSI 139

Query: 645 TGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            GSIP + G    L  L          N+  G IP +
Sbjct: 140 QGSIPAAIGACTKLTSL------DLSHNQLRGMIPRE 170



>gb:AP005966_1860364 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:B1047H05.>gb:AP007273_1863472 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBb0035K09.
          Length = 1036

 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 65/212 (30%), Positives = 94/212 (44%), Gaps = 10/212 (4%)
 Frame = +3

Query: 144 LLLVPLFIQFLGIVAFT------DNNDYVAIKALRDGWKNVPPSWAEGS-DPCGDHWEGV 302
           ++ + LF  F+ I   T      D    +  K+   G   V  SW+  S + C   W GV
Sbjct: 11  IVWLSLFTIFVSIPLATSDDHENDRQTLLCFKSQLSGPTGVLDSWSNASLEFCS--WHGV 68

Query: 303 GCNGS---RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLY 473
            C+     RV S+ L+S  ++G +S  I  L+ L  L LS N    GS+P E+G L +L 
Sbjct: 69  TCSTQSPRRVASIDLASEGISGFISPCIANLTFLTRLQLS-NNSFHGSIPSELGLLSQLN 127

Query: 474 NLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGS 653
            L L      G IP  +                 G IP SL Q + L  +DL+ N+L G 
Sbjct: 128 TLNLSTNALEGNIPSELSSCSQLEILDLSNNFIQGEIPASLSQCNHLKDIDLSKNKLKGM 187

Query: 654 IPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           IP   GN P + ++V         N+ +G+IP
Sbjct: 188 IPSDFGNLPKMQIIV------LASNRLTGDIP 213



 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 50/145 (34%), Positives = 70/145 (48%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S++ +L LS+  L G +  ++   S+L+ILDLS N  + G +P  +     L ++ L   
Sbjct: 124 SQLNTLNLSTNALEGNIPSELSSCSQLEILDLS-NNFIQGEIPASLSQCNHLKDIDLSKN 182

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G+IP   G                G IPPSLG    L ++DL  N LTGSIP S  N
Sbjct: 183 KLKGMIPSDFGNLPKMQIIVLASNRLTGDIPPSLGSGHSLTYVDLGSNDLTGSIPESLVN 242

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIP 749
           +  L +LV T       N  SGE+P
Sbjct: 243 SSSLQVLVLT------SNTLSGELP 261



 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 48/150 (32%), Positives = 69/150 (46%), Gaps = 1/150 (0%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSEL-QILDLSYNKDLTGSLPREIGNLKKLYNLI 482
           C    +++L  +S+D  G +   I ++S   Q LDLS+N  L G +P E+GNL  L  L 
Sbjct: 493 CTQLEILNLAHNSLD--GRIPNQIFKISSFSQELDLSHNY-LYGGIPEEVGNLINLKKLS 549

Query: 483 LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPV 662
           +      G IP ++G              F G IP S   L  +  LD++ N ++G IP 
Sbjct: 550 ISDNRLSGNIPSTLGQCVVLESLEMQSNLFAGSIPNSFENLVGIQKLDISRNNMSGKIPD 609

Query: 663 SDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
             GN   L  L      +   N F GE+PA
Sbjct: 610 FLGNFSLLYDL------NLSFNNFDGEVPA 633



 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 50/182 (27%), Positives = 75/182 (41%), Gaps = 19/182 (10%)
 Frame = +3

Query: 264 EGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLP 443
           +G++  G     +G   S +  L +    ++G +  +I  L  L++L + YN  LTG +P
Sbjct: 381 DGNNLKGKLPHSIGNLSSSLKWLWIRDNKISGNIPPEIGNLKSLEMLYMDYNL-LTGDIP 439

Query: 444 REIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWL 623
             IGNL  L  L +      G IPD+IG              F G IP +L   ++L  L
Sbjct: 440 PTIGNLHNLVVLAIAQNKLSGQIPDTIGNLVKLTDLKLDRNNFSGGIPVTLEHCTQLEIL 499

Query: 624 DLADNQLTGSIP-------------------VSDGNTPGLDMLVGTKHFHFGXNKFSGEI 746
           +LA N L G IP                   +  G    +  L+  K      N+ SG I
Sbjct: 500 NLAHNSLDGRIPNQIFKISSFSQELDLSHNYLYGGIPEEVGNLINLKKLSISDNRLSGNI 559

Query: 747 PA 752
           P+
Sbjct: 560 PS 561



 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 42/147 (28%), Positives = 63/147 (42%), Gaps = 7/147 (4%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           + L+S  LTG++   +     L  +DL  N DLTGS+P  + N   L  L+L      G 
Sbjct: 201 IVLASNRLTGDIPPSLGSGHSLTYVDLGSN-DLTGSIPESLVNSSSLQVLVLTSNTLSGE 259

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLG---QLSELYW----LDLADNQLTGSIPVSD 668
           +P ++               F+G IPP+      L  LY     L L++N+  G IP + 
Sbjct: 260 LPKALFNSSSLIAIYLDENSFVGSIPPATAISLPLKYLYLGGNKLSLSNNRFKGFIPPTL 319

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            N   L +L      +   N  +G IP
Sbjct: 320 LNASDLSLL------YMRNNSLTGLIP 340



 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 39/124 (31%), Positives = 55/124 (44%), Gaps = 7/124 (5%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           +G  +  + L S DLTG +   +   S LQ+L L+ N  L+G LP+ + N   L  + L 
Sbjct: 218 SGHSLTYVDLGSNDLTGSIPESLVNSSSLQVLVLTSN-TLSGELPKALFNSSSLIAIYLD 276

Query: 489 GCGFFGLIPDSIGXX-------XXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLT 647
              F G IP +                       F G IPP+L   S+L  L + +N LT
Sbjct: 277 ENSFVGSIPPATAISLPLKYLYLGGNKLSLSNNRFKGFIPPTLLNASDLSLLYMRNNSLT 336

Query: 648 GSIP 659
           G IP
Sbjct: 337 GLIP 340



>gb:AC144737_1744140 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0018K15, complete sequence.
          Length = 917

 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 46/145 (31%), Positives = 74/145 (51%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           SR+  L LSS  ++G+L   I  ++ L+++D+S N+ L+G +P EIG    L  L++   
Sbjct: 354 SRLQHLNLSSNTMSGKLPVSIGRMALLEVMDVSRNQ-LSGGVPPEIGGAAALRKLLMGSN 412

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G+IP  IG                GPIP ++G L+ L  +D ++N+L G++PV    
Sbjct: 413 SLTGIIPPQIGNCRNLIALDLSHNKLTGPIPATIGNLTGLQMVDFSENKLNGTLPVE--- 469

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIP 749
              L  L   + F+   N  SG +P
Sbjct: 470 ---LSKLANLRVFNVSHNLLSGNLP 491



 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 51/166 (30%), Positives = 71/166 (42%), Gaps = 24/166 (14%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL-------- 485
           ++L+   L+G +    +  S LQ LDLS N   +G +PREI +L +L +L L        
Sbjct: 311 VSLAGNALSGWIKAPGDNASALQELDLSGNA-FSGVIPREIASLSRLQHLNLSSNTMSGK 369

Query: 486 --VGCGFFGL--------------IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELY 617
             V  G   L              +P  IG                G IPP +G    L 
Sbjct: 370 LPVSIGRMALLEVMDVSRNQLSGGVPPEIGGAAALRKLLMGSNSLTGIIPPQIGNCRNLI 429

Query: 618 WLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            LDL+ N+LTG IP + GN  GL M+       F  NK +G +P +
Sbjct: 430 ALDLSHNKLTGPIPATIGNLTGLQMV------DFSENKLNGTLPVE 469



 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 61/213 (28%), Positives = 86/213 (40%), Gaps = 29/213 (13%)
 Frame = +3

Query: 198 NNDYVAIKALRDGWKN---VPPSWAEGSD-PCGDHWEGVGCNG--SRVVSLTLSSMDLTG 359
           N+D +A+   + G  +   V  +W+E +D  C   W GV C+    RV ++ L S  L+G
Sbjct: 24  NDDVLALVVFKSGVSDPGGVLAAWSEDADRACA--WPGVSCDARAGRVDAVALPSAGLSG 81

Query: 360 EL---------------------SGDIEEL--SELQILDLSYNKDLTGSLPREIGNLKKL 470
            L                     SG + +      + LDLS N  L+G LP  + +   L
Sbjct: 82  RLPRSALLRLDALLSLALPGNNLSGPLPDALPPRARALDLSANS-LSGYLPAALASCGSL 140

Query: 471 YNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTG 650
            +L L G    G +PD I                 G +P    + S L  LDL+ N L G
Sbjct: 141 VSLNLSGNLLSGPVPDGIWSLPSLRSLDLSGNQLAGSVPGGFPRSSSLRVLDLSRNLLEG 200

Query: 651 SIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            IP   G   GL      K    G N F+GE+P
Sbjct: 201 EIPADVGEA-GL-----LKSLDVGHNLFTGELP 227



 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 36/110 (32%), Positives = 49/110 (44%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS   L GE+  D+ E   L+ LD+ +N   TG LP  +  L  L +L   G    G 
Sbjct: 191 LDLSRNLLEGEIPADVGEAGLLKSLDVGHNL-FTGELPESLRGLTGLSSLGAGGNALAGE 249

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
           +P  IG              F+G IP  +     L  +DL+ N LTG +P
Sbjct: 250 LPGWIGEMAALETLDLSGNRFVGAIPDGISGCKNLVEVDLSGNALTGELP 299



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 46/166 (27%), Positives = 64/166 (38%), Gaps = 23/166 (13%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNK-----------------------DLTGS 437
           SL      L GEL G I E++ L+ LDLS N+                        LTG 
Sbjct: 238 SLGAGGNALAGELPGWIGEMAALETLDLSGNRFVGAIPDGISGCKNLVEVDLSGNALTGE 297

Query: 438 LPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELY 617
           LP  +  L  L  + L G    G I                   F G IP  +  LS L 
Sbjct: 298 LPWWVFGLAALQRVSLAGNALSGWIKAPGDNASALQELDLSGNAFSGVIPREIASLSRLQ 357

Query: 618 WLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L+L+ N ++G +PVS G    L+++          N+ SG +P +
Sbjct: 358 HLNLSSNTMSGKLPVSIGRMALLEVM------DVSRNQLSGGVPPE 397



>gb:AC133334_1741356 Oryza sativa chromosome 3 BAC OSJNBa0004L11
           genomic sequence, complete sequence.
          Length = 605

 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 57/154 (37%), Positives = 76/154 (49%), Gaps = 6/154 (3%)
 Frame = +3

Query: 273 DPCGDHWEGVGC-NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPRE 449
           +PC   W  V C N   VV +TL+SM  TG LS  I EL  L +L L  NK +TG +P +
Sbjct: 49  NPCT--WNSVICDNNYNVVQVTLASMGFTGVLSPRIGELQFLNVLSLPGNK-ITGGIPEQ 105

Query: 450 IGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDL 629
           IGNL  L +L L      G IP S+G                G IP ++ ++S L  + L
Sbjct: 106 IGNLSSLTSLDLEDNLLVGPIPASLGQLSKLQILILSQNNLNGTIPDTVARISSLTDIRL 165

Query: 630 ADNQLTGSIP-----VSDGNTPGLDMLVGTKHFH 716
           A N+L+GSIP     V+  N  G ++  G    H
Sbjct: 166 AYNKLSGSIPGSLFQVARYNFSGNNLTCGANFLH 199



>gb:AC079633_1732635 Genomic Sequence for Oryza sativa, Nipponbare
           strain, clone OSJNBa0032G08, from Chromosome 3, complete
           sequence.
          Length = 530

 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 65/173 (37%), Positives = 75/173 (43%), Gaps = 6/173 (3%)
 Frame = +3

Query: 192 TDNNDYVAIKALRDGWKNVPPSWAEGSDPC---GDHWEGVGCN-GS--RVVSLTLSSMDL 353
           T   D VA++ L    KN PP WA   DPC    + W GV C+ GS  RVVSL L     
Sbjct: 367 TATRDVVAMEELARSIKNPPPDWA--GDPCLPRQNSWTGVICSEGSPVRVVSLDLK---- 420

Query: 354 TGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXX 533
                                N  L+GSLP  IGNL  + N+   G    G IPD +   
Sbjct: 421 ---------------------NHGLSGSLPDSIGNLTGMKNIYFGGNKLTGSIPD-LSSM 458

Query: 534 XXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM 692
                         GPI PSLG L+ L  L L +N LTG IP S  N P LDM
Sbjct: 459 HILEELHFEGNQLSGPISPSLGTLTNLKELYLNNNNLTGQIPESLKNKPELDM 511



>gb:OSJN00075_1694384 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0036B21, complete sequence.
          Length = 628

 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 57/177 (32%), Positives = 89/177 (50%), Gaps = 10/177 (5%)
 Frame = +3

Query: 159 LFIQFLGIVAFT-----DNNDYVAIKALRDGWK---NVPPSWAEGS-DPCGDHWEGVGCN 311
           L + F+ +VA        N +  A+ +LR   K   NV  SW     +PC   W  V CN
Sbjct: 14  LAVPFVWVVAVAVSRVGANTEGDALYSLRQSLKDANNVLQSWDPTLVNPCT--WFHVTCN 71

Query: 312 -GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
             + V+ + L +  L+G L   + +L  LQ L+L Y+ +++G++P E+GNL  L +L L 
Sbjct: 72  PDNSVIRVDLGNAQLSGALVPQLGQLKNLQYLEL-YSNNISGTIPNELGNLTNLVSLDLY 130

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
              F G IP+++G                G IP SL  ++ L  LDL++N L+G +P
Sbjct: 131 LNNFTGFIPETLGQLYKLRFLRLNNNSLSGSIPKSLTNITTLQVLDLSNNNLSGEVP 187



>gb:OSJN00072_1694323 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0020J04, complete sequence.
          Length = 1104

 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 49/141 (34%), Positives = 66/141 (46%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L     TG +  +I     LQ+LDL  N+  +G +P  +G L++L  + L G  F G 
Sbjct: 320 LRLGGNAFTGTVPAEIGRCGALQVLDLEDNR-FSGEVPAALGGLRRLREVYLGGNSFSGQ 378

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S+G                G +P  L  L  L +LDL+DN+L G IP S GN   L 
Sbjct: 379 IPASLGNLSWLEALSTPGNRLTGDLPSELFVLGNLTFLDLSDNKLAGEIPPSIGNLAALQ 438

Query: 690 MLVGTKHFHFGXNKFSGEIPA 752
            L      +   N FSG IP+
Sbjct: 439 SL------NLSGNSFSGRIPS 453



 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 58/194 (29%), Positives = 86/194 (44%), Gaps = 1/194 (0%)
 Frame = +3

Query: 174 LGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDL 353
           L ++   DN     + A   G + +   +  G+   G     +G N S + +L+     L
Sbjct: 341 LQVLDLEDNRFSGEVPAALGGLRRLREVYLGGNSFSGQIPASLG-NLSWLEALSTPGNRL 399

Query: 354 TGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXX 533
           TG+L  ++  L  L  LDLS NK L G +P  IGNL  L +L L G  F G IP +IG  
Sbjct: 400 TGDLPSELFVLGNLTFLDLSDNK-LAGEIPPSIGNLAALQSLNLSGNSFSGRIPSNIGNL 458

Query: 534 XXXXXXXXXXXXFI-GPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH 710
                        + G +P  L  L +L ++ LA N  +G +P       G   L   +H
Sbjct: 459 LNLRVLDLSGQKNLSGNLPAELFGLPQLQYVSLAGNSFSGDVP------EGFSSLWSLRH 512

Query: 711 FHFGXNKFSGEIPA 752
            +   N F+G +PA
Sbjct: 513 LNLSVNSFTGSMPA 526



 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 56/148 (37%), Positives = 70/148 (47%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +  L L S  LTG + GD   L EL+ LDLS+N+ L+  +P EI N   L  L   
Sbjct: 554 NCSNLTVLDLRSNQLTGPIPGDFARLGELEELDLSHNQ-LSRKIPPEISNCSSLVTL--- 609

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                 L  + +G                G IP SL  LS+L  LDL+ N LTGSIP S 
Sbjct: 610 -----KLDDNHLG----------------GEIPASLSNLSKLQTLDLSSNNLTGSIPASL 648

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
              PG+  L      +   N+ SGEIPA
Sbjct: 649 AQIPGMLSL------NVSQNELSGEIPA 670



 Score = 69.3 bits (168), Expect = 7e-11
 Identities = 44/147 (29%), Positives = 68/147 (46%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + + SL LS    +G +  +I  L  L++LDLS  K+L+G+LP E+  L +L  + L 
Sbjct: 433 NLAALQSLNLSGNSFSGRIPSNIGNLLNLRVLDLSGQKNLSGNLPAELFGLPQLQYVSLA 492

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
           G  F G +P+                 F G +P + G L  L  L  + N++ G +PV  
Sbjct: 493 GNSFSGDVPEGFSSLWSLRHLNLSVNSFTGSMPATYGYLPSLQVLSASHNRICGELPVEL 552

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            N   L +L          N+ +G IP
Sbjct: 553 ANCSNLTVL------DLRSNQLTGPIP 573



 Score = 66.2 bits (160), Expect = 6e-10
 Identities = 50/155 (32%), Positives = 71/155 (45%), Gaps = 3/155 (1%)
 Frame = +3

Query: 297 GVGCNGSRVVSL---TLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKK 467
           GVG +  R+V +     S +D+   L  D      LQ++DL  NK L G  P  +     
Sbjct: 240 GVGNSSLRIVQVGGNAFSQVDVPVSLGKD------LQVVDLRANK-LAGPFPSWLAGAGG 292

Query: 468 LYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLT 647
           L  L L G  F G +P ++G              F G +P  +G+   L  LDL DN+ +
Sbjct: 293 LTVLDLSGNAFTGEVPPAVGQLTALQELRLGGNAFTGTVPAEIGRCGALQVLDLEDNRFS 352

Query: 648 GSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           G +P + G   GL  L   +  + G N FSG+IPA
Sbjct: 353 GEVPAALG---GLRRL---REVYLGGNSFSGQIPA 381



 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 42/153 (27%), Positives = 63/153 (41%), Gaps = 4/153 (2%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPRE----IGNLKKLYN 476
           N S ++ L+L    L G L   +  +  LQIL +S N+ LTG++P      +GN      
Sbjct: 191 NCSALLHLSLQGNALRGILPPAVAAIPSLQILSVSRNR-LTGAIPAAAFGGVGNSS--LR 247

Query: 477 LILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSI 656
           ++ VG   F  +   +                 GP P  L     L  LDL+ N  TG +
Sbjct: 248 IVQVGGNAFSQVDVPVSLGKDLQVVDLRANKLAGPFPSWLAGAGGLTVLDLSGNAFTGEV 307

Query: 657 PVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           P      P +  L   +    G N F+G +PA+
Sbjct: 308 P------PAVGQLTALQELRLGGNAFTGTVPAE 334



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 53/179 (29%), Positives = 72/179 (40%), Gaps = 3/179 (1%)
 Frame = +3

Query: 222 ALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS--RVVSLTLSSMDLTGELSGDIEELSEL 395
           A   GW    PS      PC   W GV C     RVV L L  + L+G +S  +  L+  
Sbjct: 52  AAMSGWNASSPS-----APCS--WRGVACAAGTGRVVELALPKLRLSGAISPALSSLT-- 102

Query: 396 QILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFI 575
              D+S N  L+G +P  +     L  L L    F G IP ++                +
Sbjct: 103 --FDVSGNL-LSGPVP--VSFPPSLKYLELSSNAFSGTIPANVSASATSLQFLNLAVNRL 157

Query: 576 -GPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            G +P SLG L +L++L L  N L G+IP +  N   L       H     N   G +P
Sbjct: 158 RGTVPASLGTLQDLHYLWLDGNLLEGTIPSALSNCSAL------LHLSLQGNALRGILP 210



 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 33/113 (29%), Positives = 57/113 (50%), Gaps = 1/113 (0%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIE-ELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           L LSS   +G +  ++    + LQ L+L+ N+ L G++P  +G L+ L+ L L G    G
Sbjct: 125 LELSSNAFSGTIPANVSASATSLQFLNLAVNR-LRGTVPASLGTLQDLHYLWLDGNLLEG 183

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
            IP ++                 G +PP++  +  L  L ++ N+LTG+IP +
Sbjct: 184 TIPSALSNCSALLHLSLQGNALRGILPPAVAAIPSLQILSVSRNRLTGAIPAA 236



 Score = 43.5 bits (101), Expect = 0.004
 Identities = 29/91 (31%), Positives = 42/91 (46%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +V+L L    L GE+   +  LS+LQ LDLS N +LTGS+P  +  +  + +L + 
Sbjct: 602 NCSSLVTLKLDDNHLGGEIPASLSNLSKLQTLDLSSN-NLTGSIPASLAQIPGMLSLNVS 660

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGP 581
                G IP  +G                GP
Sbjct: 661 QNELSGEIPAMLGSRFGTPSVFASNPNLCGP 691



>gb:BT004058_1637167 Arabidopsis thaliana clone RAFL15-09-P09
           (R20481) putative receptor protein kinase (At5g25930)
           mRNA, complete cds.>gb:T1N24_1723664 Arabidopsis
           thaliana BAC T1N24.
          Length = 1005

 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 54/141 (38%), Positives = 73/141 (51%), Gaps = 1/141 (0%)
 Frame = +3

Query: 336 LSSMDLTGELSGDI-EELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLI 512
           L  M+L GE+S  + E +++L+ +DLS N +LTG +P  +  LK L    L   G  G I
Sbjct: 217 LEEMNLIGEISPVVFENMTDLEHVDLSVN-NLTGRIPDVLFGLKNLTEFYLFANGLTGEI 275

Query: 513 PDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM 692
           P SI                 G IP S+G L++L  L+L +N+LTG IP   G  PGL  
Sbjct: 276 PKSISATNLVFLDLSANN-LTGSIPVSIGNLTKLQVLNLFNNKLTGEIPPVIGKLPGL-- 332

Query: 693 LVGTKHFHFGXNKFSGEIPAQ 755
               K F    NK +GEIPA+
Sbjct: 333 ----KEFKIFNNKLTGEIPAE 349



 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 54/191 (28%), Positives = 82/191 (42%), Gaps = 4/191 (2%)
 Frame = +3

Query: 135 RIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPS---WAEGSDPCGDHWEGVG 305
           R+ L  +  F+  + +  F+  ND   +  L+    + PPS   W   S PC  +W  + 
Sbjct: 3   RLPLPFLFFFLTSIPLSVFSQFNDQSTLLNLKRDLGD-PPSLRLWNNTSSPC--NWSEIT 59

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           C    V  +   + + TG +   I +LS L  LDLS+N    G  P  + N  KL  L L
Sbjct: 60  CTAGNVTGINFKNQNFTGTVPTTICDLSNLNFLDLSFNY-FAGEFPTVLYNCTKLQYLDL 118

Query: 486 VGCGFFGLIPDSIGXXX-XXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPV 662
                 G +P  I                F G IP SLG++S+L  L+L  ++  G+ P 
Sbjct: 119 SQNLLNGSLPVDIDRLSPELDYLDLAANGFSGDIPKSLGRISKLKVLNLYQSEYDGTFPS 178

Query: 663 SDGNTPGLDML 695
             G+   L+ L
Sbjct: 179 EIGDLSELEEL 189



 Score = 59.3 bits (142), Expect = 7e-08
 Identities = 46/149 (30%), Positives = 72/149 (48%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           + + +V L LS+ +LTG +   I  L++LQ+L+L +N  LTG +P  IG L  L    + 
Sbjct: 280 SATNLVFLDLSANNLTGSIPVSIGNLTKLQVLNL-FNNKLTGEIPPVIGKLPGLKEFKIF 338

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP  IG                G +P +L +  +L  + +  N LTG IP S 
Sbjct: 339 NNKLTGEIPAEIGVHSKLERFEVSENQLTGKLPENLCKGGKLQGVVVYSNNLTGEIPESL 398

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           G+  G  + V  ++     N FSG+ P++
Sbjct: 399 GDC-GTLLTVQLQN-----NDFSGKFPSR 421



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 38/133 (28%), Positives = 60/133 (45%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           LTGE+  +I   S+L+  ++S N+ LTG LP  +    KL  +++      G IP+S+G 
Sbjct: 342 LTGEIPAEIGVHSKLERFEVSENQ-LTGKLPENLCKGGKLQGVVVYSNNLTGEIPESLGD 400

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH 710
                        F G  P  +   S +Y L +++N  TG +P         ++      
Sbjct: 401 CGTLLTVQLQNNDFSGKFPSRIWNASSMYSLQVSNNSFTGELPE--------NVAWNMSR 452

Query: 711 FHFGXNKFSGEIP 749
                N+FSGEIP
Sbjct: 453 IEIDNNRFSGEIP 465



 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 44/170 (25%), Positives = 70/170 (41%), Gaps = 21/170 (12%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIE-ELSELQILDLSY--------------------NKD 425
           N S + SL +S+   TGEL  ++   +S ++I +  +                    N  
Sbjct: 424 NASSMYSLQVSNNSFTGELPENVAWNMSRIEIDNNRFSGEIPKKIGTWSSLVEFKAGNNQ 483

Query: 426 LTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQL 605
            +G  P+E+ +L  L ++ L      G +PD I                 G IP +LG L
Sbjct: 484 FSGEFPKELTSLSNLISIFLDENDLTGELPDEIISWKSLITLSLSKNKLSGEIPRALGLL 543

Query: 606 SELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
             L  LDL++NQ +G IP   G+       +    F+   N+ +G IP Q
Sbjct: 544 PRLLNLDLSENQFSGGIPPEIGS-------LKLTTFNVSSNRLTGGIPEQ 586



 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 44/173 (25%), Positives = 65/173 (37%), Gaps = 25/173 (14%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           C G ++  + + S +LTGE+   + +   L  + L  N D +G  P  I N   +Y+L +
Sbjct: 375 CKGGKLQGVVVYSNNLTGEIPESLGDCGTLLTVQLQ-NNDFSGKFPSRIWNASSMYSLQV 433

Query: 486 VGCGFFGLIPDS----------------------IGXXXXXXXXXXXXXXFIGPIPPSLG 599
               F G +P++                      IG              F G  P  L 
Sbjct: 434 SNNSFTGELPENVAWNMSRIEIDNNRFSGEIPKKIGTWSSLVEFKAGNNQFSGEFPKELT 493

Query: 600 QLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH---FHFGXNKFSGEIP 749
            LS L  + L +N LTG +P         D ++  K         NK SGEIP
Sbjct: 494 SLSNLISIFLDENDLTGELP---------DEIISWKSLITLSLSKNKLSGEIP 537



>gb:AY736123_1626037 Triticum aestivum leucine-rich repeat protein
           mRNA, complete cds.
          Length = 218

 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 64/188 (34%), Positives = 89/188 (47%), Gaps = 9/188 (4%)
 Frame = +3

Query: 126 MIPRI--QLLLV--PLFIQFLGIVAFTDNNDYVAIKALR---DGWKNVPPSWAEGS-DPC 281
           M PR+   LLLV   L +      A   N +  A+ ALR        V  SW     +PC
Sbjct: 1   MAPRVPSSLLLVGAALLLGLAAGAARASNEEGDALYALRMRLSDPNGVLQSWDPTLVNPC 60

Query: 282 GDHWEGVGCN-GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGN 458
              W  V C+  SRVV L L + +++G +  ++  L  LQ L+L Y  +L G +P+E+G 
Sbjct: 61  T--WFHVTCDTASRVVRLDLGNSNVSGSIGPELSRLVNLQYLEL-YRNNLNGEIPKELGK 117

Query: 459 LKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADN 638
           LK L +L L      G IP S+                 G IP  L +LS L  +DL++N
Sbjct: 118 LKNLISLDLYANKLTGRIPKSLSKLSSLRFMRLNNNKLAGSIPRELAKLSNLKVIDLSNN 177

Query: 639 QLTGSIPV 662
            L G+IPV
Sbjct: 178 DLCGTIPV 185



>gb:AE005173_893273 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC024260_1539286 Arabidopsis
           thaliana chromosome 1 BAC F22G10 genomic sequence,
           complete sequence.
          Length = 516

 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 60/189 (31%), Positives = 83/189 (43%), Gaps = 4/189 (2%)
 Frame = +3

Query: 192 TDNNDYVAIKALRDGWKNVPP--SW-AEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGE 362
           TD +D  A+  L  G  +      W A   DPCG +W GV C+GSRV  + LS ++L+G 
Sbjct: 27  TDASDTSALNTLFSGMHSPAQLTQWTAAAGDPCGQNWRGVTCSGSRVTQIKLSGLELSGT 86

Query: 363 LSG-DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXX 539
           L G  +++L+ L  LDLS N +L G LP +      L  L L    F G    S+     
Sbjct: 87  LGGYMLDKLTSLTELDLSSN-NLGGDLPYQFP--PNLQRLNLANNQFTGAASYSLSQITP 143

Query: 540 XXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHF 719
                     F G I     +L  L  LD + N  T S+P +         L   K  + 
Sbjct: 144 LKYLNLGHNQFKGQIAIDFSKLDSLTTLDFSFNSFTNSLPAT------FSSLTSLKSLYL 197

Query: 720 GXNKFSGEI 746
             N+FSG +
Sbjct: 198 QNNQFSGTV 206



>pir|T30553|T30553 disease resistance protein Hcr2-5D -
           tomato>gb:AF053998_1764492 Lycopersicon esculentum
           Hcr2-5D (Hcr2-5D) gene, complete cds.
          Length = 1016

 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 57/147 (38%), Positives = 72/147 (48%), Gaps = 4/147 (2%)
 Frame = +3

Query: 327 SLTLSSMD---LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           SLT  S+D   L+G +   +  L+ L  L L YN  L+GS+P EIG L+ L  L L G  
Sbjct: 216 SLTKLSLDINFLSGSIPASLGNLNNLSFLYL-YNNQLSGSIPEEIGYLRSLTKLSL-GIN 273

Query: 498 FF-GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
           F  G IP S+G                G IP  +G L  L +LDL +N L GSIP S GN
Sbjct: 274 FLSGSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGN 333

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
              L ML      +   N+ SG IP +
Sbjct: 334 LNNLFML------YLYNNQLSGSIPEE 354



 Score = 75.9 bits (185), Expect = 8e-13
 Identities = 61/157 (38%), Positives = 72/157 (45%), Gaps = 9/157 (5%)
 Frame = +3

Query: 309 NGSRVVSL----TLSSMDL-TGELSGDIEE----LSELQILDLSYNKDLTGSLPREIGNL 461
           NGS   SL     LS +DL   +LSG I E    L  L  LDL  N  L GS+P  +GNL
Sbjct: 372 NGSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENA-LNGSIPASLGNL 430

Query: 462 KKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQ 641
             L+ L L      G IP+ IG                G IP SLG L+ L+ L L +NQ
Sbjct: 431 NNLFMLYLYNNQLSGSIPEEIGYLSSLTELYLGNNSLNGSIPASLGNLNNLFMLYLYNNQ 490

Query: 642 LTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           L+GSIP   G    L  L        G N  +G IPA
Sbjct: 491 LSGSIPEEIGYLSSLTEL------FLGNNSLNGSIPA 521



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 54/148 (36%), Positives = 68/148 (45%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + +  L L +  L+G +  +I  LS L  L L  N  L GS+P  +GNL  L+ L L 
Sbjct: 429 NLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELYLG-NNSLNGSIPASLGNLNNLFMLYLY 487

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP+ IG                G IP SLG L+ L  L L +NQL+GSIP S 
Sbjct: 488 NNQLSGSIPEEIGYLSSLTELFLGNNSLNGSIPASLGNLNNLSRLYLYNNQLSGSIPASF 547

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           GN   L  L          N   GEIP+
Sbjct: 548 GNMRNLQTL------FLSDNDLIGEIPS 569



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 53/148 (35%), Positives = 68/148 (45%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + +  L L +  L+G +  +I  L  L  LDL  N  L GS+P  +GNL  L  L L 
Sbjct: 333 NLNNLFMLYLYNNQLSGSIPEEIGYLRSLTYLDLGENA-LNGSIPASLGNLNNLSRLDLY 391

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP+ IG                G IP SLG L+ L+ L L +NQL+GSIP   
Sbjct: 392 NNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEI 451

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           G    L  L      + G N  +G IPA
Sbjct: 452 GYLSSLTEL------YLGNNSLNGSIPA 473



 Score = 73.2 bits (178), Expect = 5e-12
 Identities = 52/142 (36%), Positives = 66/142 (46%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L    L G +   +  L+ L +L L YN  L+GS+P EIG L+ L  L L      G 
Sbjct: 316 LDLGENALNGSIPASLGNLNNLFMLYL-YNNQLSGSIPEEIGYLRSLTYLDLGENALNGS 374

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S+G                G IP  +G L  L +LDL +N L GSIP S GN   L 
Sbjct: 375 IPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNLF 434

Query: 690 MLVGTKHFHFGXNKFSGEIPAQ 755
           ML      +   N+ SG IP +
Sbjct: 435 ML------YLYNNQLSGSIPEE 450



 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 51/141 (36%), Positives = 64/141 (45%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L +  L+G +  +I  L  L  L L  N  L+GS+P  +GNL  L  L L      G 
Sbjct: 244 LYLYNNQLSGSIPEEIGYLRSLTKLSLGINF-LSGSIPASLGNLNNLSRLDLYNNKLSGS 302

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP+ IG                G IP SLG L+ L+ L L +NQL+GSIP   G    L 
Sbjct: 303 IPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLRSLT 362

Query: 690 MLVGTKHFHFGXNKFSGEIPA 752
            L        G N  +G IPA
Sbjct: 363 YL------DLGENALNGSIPA 377



 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 47/145 (32%), Positives = 63/145 (43%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S +  L L +  L G +   +  L+ L +L L YN  L+GS+P EIG L  L  L L   
Sbjct: 455 SSLTELYLGNNSLNGSIPASLGNLNNLFMLYL-YNNQLSGSIPEEIGYLSSLTELFLGNN 513

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G IP S+G                G IP S G +  L  L L+DN L G IP    N
Sbjct: 514 SLNGSIPASLGNLNNLSRLYLYNNQLSGSIPASFGNMRNLQTLFLSDNDLIGEIPSFVCN 573

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIP 749
              L++L      +   N   G++P
Sbjct: 574 LTSLEVL------YMSRNNLKGKVP 592



 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 53/171 (30%), Positives = 74/171 (43%), Gaps = 23/171 (13%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQIL-------------DLSYNKDLT------ 431
           N + +V L L++  ++G +   I  L++LQI+             ++ Y + LT      
Sbjct: 117 NLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRSLTKLSLGI 176

Query: 432 ----GSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLG 599
               GS+P  +GN+  L  L L      G IP+ IG                G IP SLG
Sbjct: 177 NFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINFLSGSIPASLG 236

Query: 600 QLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            L+ L +L L +NQL+GSIP   G    L  L        G N  SG IPA
Sbjct: 237 NLNNLSFLYLYNNQLSGSIPEEIGYLRSLTKL------SLGINFLSGSIPA 281



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 48/145 (33%), Positives = 62/145 (42%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +  L+L    L+G +   +  ++ L  L L Y   L+G +P EIG L+ L  L L     
Sbjct: 169 LTKLSLGINFLSGSIPASLGNMTNLSFLFL-YENQLSGFIPEEIGYLRSLTKLSLDINFL 227

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IP S+G                G IP  +G L  L  L L  N L+GSIP S GN  
Sbjct: 228 SGSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTKLSLGINFLSGSIPASLGNLN 287

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L  L          NK SG IP +
Sbjct: 288 NLSRL------DLYNNKLSGSIPEE 306



 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 47/148 (31%), Positives = 63/148 (42%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + +  L L +  L+G +  +I  LS L  L L  N  L GS+P  +GNL  L  L L 
Sbjct: 477 NLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELFLG-NNSLNGSIPASLGNLNNLSRLYLY 535

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP S G               IG IP  +  L+ L  L ++ N L G +P   
Sbjct: 536 NNQLSGSIPASFGNMRNLQTLFLSDNDLIGEIPSFVCNLTSLEVLYMSRNNLKGKVPQCL 595

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           GN   L +L          N F GE+P+
Sbjct: 596 GNISDLHIL------SMSSNSFRGELPS 617



 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 42/137 (30%), Positives = 60/137 (43%)
 Frame = +3

Query: 330  LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
            L++SS    GEL   I  L+ L+ILD   N +L G++P+  GN+  L    +      G 
Sbjct: 604  LSMSSNSFRGELPSSISNLTSLKILDFGRN-NLEGAIPQFFGNISSLQVFDMQNNKLSGT 662

Query: 510  IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
            +P +                    IP SL    +L  LDL DNQL  + P+  G  P L 
Sbjct: 663  LPTNFSIGCSLISLNLHGNELADEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELR 722

Query: 690  MLVGTKHFHFGXNKFSG 740
            +L  T +   G  + SG
Sbjct: 723  VLRLTSNKLHGPIRSSG 739



 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 53/217 (24%), Positives = 76/217 (35%), Gaps = 23/217 (10%)
 Frame = +3

Query: 171 FLGIVAFTDNNDYVAIKALRDGWKNVP----PSWAEGSDPCGDHWEGVGCNGSRVVSLTL 338
           +L  VAF    +  A+   +  +KN       SW   S+ C D W GV C   RV +L +
Sbjct: 19  YLFTVAFASTEEATALLKWKATFKNQNNSFLASWTTSSNACKD-WYGVVCLNGRVNTLNI 77

Query: 339 SSMDLTGELSG-DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIP 515
           ++  + G L       L  L+ LDLS N                                
Sbjct: 78  TNASVIGTLYAFPFSSLPFLENLDLSNNN------------------------------- 106

Query: 516 DSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDML 695
                               G IPP +G L+ L +LDL  NQ++G+IP   G+   L ++
Sbjct: 107 ------------------ISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQII 148

Query: 696 -VGTKHFH-----------------FGXNKFSGEIPA 752
            +   H +                  G N  SG IPA
Sbjct: 149 RIFNNHLNGFIPEEIGYLRSLTKLSLGINFLSGSIPA 185



 Score = 42.7 bits (99), Expect = 0.007
 Identities = 33/91 (36%), Positives = 42/91 (46%), Gaps = 1/91 (1%)
 Frame = +3

Query: 426  LTGSLPREIGNLKKLYNLI-LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQ 602
            +T  L  EI  +  LY +I L    F G IP  +G                G IP SLG 
Sbjct: 795  VTKGLELEIVRILSLYTIIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGS 854

Query: 603  LSELYWLDLADNQLTGSIPVSDGNTPGLDML 695
            LS L  LDL+ NQL+G IP    +   L++L
Sbjct: 855  LSILESLDLSFNQLSGEIPQQLASLTFLEVL 885



 Score = 33.5 bits (75), Expect = 4.3
 Identities = 23/74 (31%), Positives = 37/74 (50%)
 Frame = +3

Query: 300 VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL 479
           +GC+   ++SL L   +L  E+   ++   +LQ+LDL  N+ L  + P  +G L +L  L
Sbjct: 669 IGCS---LISLNLHGNELADEIPRSLDNCKKLQVLDLGDNQ-LNDTFPMWLGTLPELRVL 724

Query: 480 ILVGCGFFGLIPDS 521
            L      G I  S
Sbjct: 725 RLTSNKLHGPIRSS 738



>pir|F96577|F96577 hypothetical protein F22G10.3 [imported] -
           Arabidopsis thaliana>gb:AE005173_893272 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC024260_1539285 Arabidopsis thaliana
           chromosome 1 BAC F22G10 genomic sequence, complete
           sequence.>gb:AY518291_1610793 Arabidopsis thaliana
           strubbelig receptor family 6 (SRF6) mRNA, complete
           cds.>gb:BT010600_1640546 Arabidopsis thaliana At1g53730
           gene, complete cds.
          Length = 719

 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 60/189 (31%), Positives = 83/189 (43%), Gaps = 4/189 (2%)
 Frame = +3

Query: 192 TDNNDYVAIKALRDGWKNVPP--SW-AEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGE 362
           TD +D  A+  L  G  +      W A   DPCG +W GV C+GSRV  + LS ++L+G 
Sbjct: 27  TDASDTSALNTLFSGMHSPAQLTQWTAAAGDPCGQNWRGVTCSGSRVTQIKLSGLELSGT 86

Query: 363 LSG-DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXX 539
           L G  +++L+ L  LDLS N +L G LP +      L  L L    F G    S+     
Sbjct: 87  LGGYMLDKLTSLTELDLSSN-NLGGDLPYQFP--PNLQRLNLANNQFTGAASYSLSQITP 143

Query: 540 XXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHF 719
                     F G I     +L  L  LD + N  T S+P +         L   K  + 
Sbjct: 144 LKYLNLGHNQFKGQIAIDFSKLDSLTTLDFSFNSFTNSLPAT------FSSLTSLKSLYL 197

Query: 720 GXNKFSGEI 746
             N+FSG +
Sbjct: 198 QNNQFSGTV 206



>pir|T01268|T01268 leucine-rich repeat transmembrane protein kinase
           2 - maize>gb:AF023165_1762044 Zea mays leucine-rich
           repeat transmembrane protein kinase 2 (ltk2) mRNA,
           complete cds.
          Length = 725

 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 64/191 (33%), Positives = 85/191 (44%), Gaps = 4/191 (2%)
 Frame = +3

Query: 186 AFTDNNDYVAIKALRDGWKNVPP--SW-AEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLT 356
           A TD ND   +  L     +     +W A G DPCG  W+G+ C+GS V  + L ++ LT
Sbjct: 37  ADTDPNDLNVLNTLFTSLNSPGQLRAWRANGGDPCGQSWQGITCSGSGVTKILLPNLSLT 96

Query: 357 GELSGDIEELSELQILDLSYNK-DLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXX 533
           G L+ ++  L  L  LDLS N     G +   + N+ KL  L L G  F G +P SI   
Sbjct: 97  GNLAYNMNNLGSLVELDLSQNNLGGGGQIQYNLPNV-KLEKLNLAGNQFGGNLPYSISTM 155

Query: 534 XXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHF 713
                         G I      L  L  LDL+ N LTG +P S     GL  L   K  
Sbjct: 156 PNLKYLNLNHNQLQGNITDVFSNLYSLSELDLSFNSLTGDLPQS---FTGLSSL---KRM 209

Query: 714 HFGXNKFSGEI 746
           +   N+F+G I
Sbjct: 210 YLQNNQFTGYI 220



>pir|H84632|H84632 probable receptor-like protein kinase [imported]
           - Arabidopsis thaliana>gb:AC005967_1533267 Arabidopsis
           thaliana chromosome 2 clone F27D4 map CIC06C07, complete
           sequence.
          Length = 980

 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 71/231 (30%), Positives = 101/231 (43%), Gaps = 27/231 (11%)
 Frame = +3

Query: 144 LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGD--HWEGVGCN-- 311
           LL+V   I  + ++A +  ND+  IK  ++   +   S +  S    D  +W GV CN  
Sbjct: 6   LLVVSFLITVMTVLA-SKENDHELIKNPQNSLSSWISSSSSSSSMLVDVCNWSGVKCNKE 64

Query: 312 GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKK-LYNLILV 488
            ++V+ L +S  DL GE+S  I  L+ L +LDLS N    G +P EIG+L + L  L L 
Sbjct: 65  STQVIELDISGRDLGGEISPSIANLTGLTVLDLSRNF-FVGKIPPEIGSLHETLKQLSLS 123

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSL---GQLSELYWLDLADNQLTGSIP 659
                G IP  +G                G IP  L   G  S L ++DL++N LTG IP
Sbjct: 124 ENLLHGNIPQELGLLNRLVYLDLGSNRLNGSIPVQLFCNGSSSSLQYIDLSNNSLTGEIP 183

Query: 660 VS------------------DGNTP-GLDMLVGTKHFHFGXNKFSGEIPAQ 755
           ++                   G  P  L      K      N  SGE+P+Q
Sbjct: 184 LNYHCHLKELRFLLLWSNKLTGTVPSSLSNSTNLKWMDLESNMLSGELPSQ 234



 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 47/175 (26%), Positives = 77/175 (44%), Gaps = 26/175 (14%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           C  S++  + LS+  LTGE+  ++ ++  L +LD+S N +L+GS+P   GNL +L  L+L
Sbjct: 342 CKLSKLERVYLSNNHLTGEIPMELGDIPRLGLLDVSRN-NLSGSIPDSFGNLSQLRRLLL 400

Query: 486 VGCGFFGLIPDSIG--------------------------XXXXXXXXXXXXXXFIGPIP 587
            G    G +P S+G                                          GPIP
Sbjct: 401 YGNHLSGTVPQSLGKCINLEILDLSHNNLTGTIPVEVVSNLRNLKLYLNLSSNHLSGPIP 460

Query: 588 PSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
             L ++  +  +DL+ N+L+G IP      P L   +  +H +   N FS  +P+
Sbjct: 461 LELSKMDMVLSVDLSSNELSGKIP------PQLGSCIALEHLNLSRNGFSSTLPS 509



 Score = 66.2 bits (160), Expect = 6e-10
 Identities = 49/143 (34%), Positives = 71/143 (49%), Gaps = 1/143 (0%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LSS  L+G +  ++ +LS+L+ + LS N  LTG +P E+G++ +L  L +      G 
Sbjct: 326 LNLSSNLLSGPIPRELCKLSKLERVYLS-NNHLTGEIPMELGDIPRLGLLDVSRNNLSGS 384

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS-DGNTPGL 686
           IPDS G                G +P SLG+   L  LDL+ N LTG+IPV    N   L
Sbjct: 385 IPDSFGNLSQLRRLLLYGNHLSGTVPQSLGKCINLEILDLSHNNLTGTIPVEVVSNLRNL 444

Query: 687 DMLVGTKHFHFGXNKFSGEIPAQ 755
            +     + +   N  SG IP +
Sbjct: 445 KL-----YLNLSSNHLSGPIPLE 462



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 44/142 (30%), Positives = 64/142 (45%), Gaps = 3/142 (2%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYN---KDLTGSLPREIGNLKKLYNLILVGCGF 500
           L LS  +LTG +   +E +S L+ L L  N     L+G +P E+  +  + ++ L     
Sbjct: 422 LDLSHNNLTGTIP--VEVVSNLRNLKLYLNLSSNHLSGPIPLELSKMDMVLSVDLSSNEL 479

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IP  +G              F   +P SLGQL  L  LD++ N+LTG+IP      P
Sbjct: 480 SGKIPPQLGSCIALEHLNLSRNGFSSTLPSSLGQLPYLKELDVSFNRLTGAIP------P 533

Query: 681 GLDMLVGTKHFHFGXNKFSGEI 746
                   KH +F  N  SG +
Sbjct: 534 SFQQSSTLKHLNFSFNLLSGNV 555



 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 46/148 (31%), Positives = 63/148 (42%), Gaps = 1/148 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELS-ELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           N S +  L L+   L GE++  +  LS  L  + L  N+ + GS+P EI NL  L  L L
Sbjct: 270 NSSDLQELELAGNSLGGEITSSVRHLSVNLVQIHLDQNR-IHGSIPPEISNLLNLTLLNL 328

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                                         GPIP  L +LS+L  + L++N LTG IP+ 
Sbjct: 329 ------------------------SSNLLSGPIPRELCKLSKLERVYLSNNHLTGEIPME 364

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            G+ P L +L          N  SG IP
Sbjct: 365 LGDIPRLGLL------DVSRNNLSGSIP 386



>gb:AP003434_1829316 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0452F10.
          Length = 942

 Score = 75.9 bits (185), Expect = 8e-13
 Identities = 47/123 (38%), Positives = 65/123 (52%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           +L++SS      +   + +L  L  L L  N+ LTGS+P  +GNL  + +L L  C   G
Sbjct: 157 TLSISSNSFVDVVPAWLAQLPYLTELFLGGNQ-LTGSIPPGLGNLTGVTSLDLSFCNLTG 215

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
            IP  +G                GPIP SLG LS+L +LDL  NQLTG++P + GN P L
Sbjct: 216 EIPSELGLMRSLSTLRLTYNQLTGPIPTSLGNLSQLSFLDLQMNQLTGAVPATLGNIPAL 275

Query: 687 DML 695
           + L
Sbjct: 276 NWL 278



 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 56/149 (37%), Positives = 68/149 (45%), Gaps = 1/149 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELS-ELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           N  ++  +TL S   TG+L      LS +L I   S NK LTG LP  + NL  L  L L
Sbjct: 297 NCRQIWIITLDSNSFTGDLPDHTGNLSAQLSIFSASENK-LTGGLPSSLSNLSSLEQLQL 355

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
            G    G IP+SI                 GPIP  +G LS L  LDL  N+L GSIP S
Sbjct: 356 PGNQLTGPIPESITMMPNLVRLDVSSNDISGPIPTQIGMLSSLQRLDLQRNRLFGSIPDS 415

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            GN   L+      H     N+ +  IPA
Sbjct: 416 IGNLSELE------HIMLSHNQLNSTIPA 438



 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 49/143 (34%), Positives = 68/143 (47%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +V L +SS D++G +   I  LS LQ LDL  N+ L GS+P  IGNL +L +++L     
Sbjct: 374 LVRLDVSSNDISGPIPTQIGMLSSLQRLDLQRNR-LFGSIPDSIGNLSELEHIMLSHNQL 432

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
              IP S                F G +P  L +L +   +DL+ N L GSIP S G   
Sbjct: 433 NSTIPASFFNLGKLVRLNLSHNSFTGALPNDLSRLKQGDTIDLSSNSLLGSIPESFGQ-- 490

Query: 681 GLDMLVGTKHFHFGXNKFSGEIP 749
            + ML    + +   N F   IP
Sbjct: 491 -IRMLT---YLNLSHNSFGDSIP 509



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 50/156 (32%), Positives = 68/156 (43%)
 Frame = +3

Query: 282 GDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNL 461
           GD  +  G   +++   + S   LTG L   +  LS L+ L L  N+ LTG +P  I  +
Sbjct: 313 GDLPDHTGNLSAQLSIFSASENKLTGGLPSSLSNLSSLEQLQLPGNQ-LTGPIPESITMM 371

Query: 462 KKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQ 641
             L  L +      G IP  IG                G IP S+G LSEL  + L+ NQ
Sbjct: 372 PNLVRLDVSSNDISGPIPTQIGMLSSLQRLDLQRNRLFGSIPDSIGNLSELEHIMLSHNQ 431

Query: 642 LTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           L  +IP S  N   L  LV     +   N F+G +P
Sbjct: 432 LNSTIPASFFN---LGKLV---RLNLSHNSFTGALP 461



 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 44/147 (29%), Positives = 64/147 (43%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +  + LS   L   +      L +L  L+LS+N   TG+LP ++  LK+   + L 
Sbjct: 418 NLSELEHIMLSHNQLNSTIPASFFNLGKLVRLNLSHNS-FTGALPNDLSRLKQGDTIDLS 476

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP+S G              F   IP S  +L+ L  LDL+ N L+G+IP   
Sbjct: 477 SNSLLGSIPESFGQIRMLTYLNLSHNSFGDSIPYSFQELANLATLDLSSNNLSGTIPKFL 536

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            N   L  L      +   N+  G+IP
Sbjct: 537 ANFTYLTAL------NLSFNRLEGQIP 557



 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 47/164 (28%), Positives = 73/164 (44%), Gaps = 2/164 (1%)
 Frame = +3

Query: 267 GSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPR 446
           G+   G    G+G N + V SL LS  +LTGE+  ++  +  L  L L+YN+ LTG +P 
Sbjct: 186 GNQLTGSIPPGLG-NLTGVTSLDLSFCNLTGEIPSELGLMRSLSTLRLTYNQ-LTGPIPT 243

Query: 447 EIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIP--PSLGQLSELYW 620
            +GNL +L  L L      G +P ++G                G +    SL    +++ 
Sbjct: 244 SLGNLSQLSFLDLQMNQLTGAVPATLGNIPALNWLTLSLNNLEGNLGFLSSLSNCRQIWI 303

Query: 621 LDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           + L  N  TG +P   GN     +      F    NK +G +P+
Sbjct: 304 ITLDSNSFTGDLPDHTGN-----LSAQLSIFSASENKLTGGLPS 342



 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 46/145 (31%), Positives = 61/145 (42%), Gaps = 3/145 (2%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIG---NLKKLYNLILVGCGF 500
           L L    L G +   +  +S L+ L LS+N +LTG +P       +L  L    +   GF
Sbjct: 83  LNLRGNRLAGAVPPAVYNMSRLRGLVLSHN-NLTGWIPTTSNGSFHLPMLRTFSISSNGF 141

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IP  +               F+  +P  L QL  L  L L  NQLTGSIP      P
Sbjct: 142 AGRIPAGLAACRYLQTLSISSNSFVDVVPAWLAQLPYLTELFLGGNQLTGSIP------P 195

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
           GL  L G           +GEIP++
Sbjct: 196 GLGNLTGVTSLDLSFCNLTGEIPSE 220



>gb:AP003210_1825238 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBa0010K01.
          Length = 1002

 Score = 75.9 bits (185), Expect = 8e-13
 Identities = 48/144 (33%), Positives = 70/144 (48%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           ++ SL+L    L GE+   +  +S L+ L+LSYN  + G +P E+GNL  L  L L GC 
Sbjct: 167 KLESLSLVYNLLGGEVPPFLGGVSTLRELNLSYNPFVAGPVPAELGNLSALRVLWLAGCN 226

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
             G IP S+G                G IPP + +L+ +  ++L +N LTG IPV     
Sbjct: 227 LIGAIPASLGRLGNLTDLDLSTNALTGSIPPEITRLTSVVQIELYNNSLTGPIPV----- 281

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIP 749
            G   L   +      N+ +G IP
Sbjct: 282 -GFGKLAELQGVDLAMNRLNGAIP 304



 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 49/142 (34%), Positives = 67/142 (47%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L+   LTG +S  I   + L  L LS N+ LTGS+P EIG+  KLY L   G    G 
Sbjct: 436 LELNDNQLTGVISPVIGGAANLSKLVLSNNR-LTGSIPPEIGSASKLYELSADGNMLSGP 494

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           +P S+G                G +   +    +L  L+LADN  TG+IP   G+ P L+
Sbjct: 495 LPGSLGGLEELGRLVLRNNSLSGQLLRGINSWKKLSELNLADNGFTGAIPAELGDLPVLN 554

Query: 690 MLVGTKHFHFGXNKFSGEIPAQ 755
            L          N+ +GE+P Q
Sbjct: 555 YL------DLSGNRLTGEVPMQ 570



 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 47/170 (27%), Positives = 70/170 (41%), Gaps = 5/170 (2%)
 Frame = +3

Query: 261 AEGSDPCGDHWEGVGCN----GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDL 428
           A  + PC   W GV C+    G  V  ++L+ ++LTG     +  L  +  +DLSYN   
Sbjct: 49  ARDATPCS--WTGVSCDAGVGGGAVTGISLAGLNLTGSFPAALCRLPRVASIDLSYNYIG 106

Query: 429 TGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLS 608
                  +   K L  L L      G +PD++               F GPIP S G+  
Sbjct: 107 PNLSSDAVAPCKALRRLDLSMNALVGPLPDALAALPELVYLKLDSNNFSGPIPESFGRFK 166

Query: 609 ELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKF-SGEIPAQ 755
           +L  L L  N L G +P      P L  +   +  +   N F +G +PA+
Sbjct: 167 KLESLSLVYNLLGGEVP------PFLGGVSTLRELNLSYNPFVAGPVPAE 210



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 47/164 (28%), Positives = 69/164 (42%)
 Frame = +3

Query: 258 WAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGS 437
           W  G +  G     +G  G+ +  L LS+  LTG +  +I  L+ +  ++L YN  LTG 
Sbjct: 221 WLAGCNLIGAIPASLGRLGN-LTDLDLSTNALTGSIPPEITRLTSVVQIEL-YNNSLTGP 278

Query: 438 LPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELY 617
           +P   G L +L  + L      G IPD                   GP+P S+ + + L 
Sbjct: 279 IPVGFGKLAELQGVDLAMNRLNGAIPDDFFEAPKLESVHLYANSLTGPVPESVAKAASLV 338

Query: 618 WLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            L L  N+L G++P   G    L  +          N  SGEIP
Sbjct: 339 ELRLFANRLNGTLPADLGKNSPLVCV------DMSDNSISGEIP 376



 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 42/167 (25%), Positives = 63/167 (37%), Gaps = 23/167 (13%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNK-----------------------DLT 431
           VV + L +  LTG +     +L+ELQ +DL+ N+                        LT
Sbjct: 265 VVQIELYNNSLTGPIPVGFGKLAELQGVDLAMNRLNGAIPDDFFEAPKLESVHLYANSLT 324

Query: 432 GSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSE 611
           G +P  +     L  L L      G +P  +G                G IPP++    E
Sbjct: 325 GPVPESVAKAASLVELRLFANRLNGTLPADLGKNSPLVCVDMSDNSISGEIPPAICDRGE 384

Query: 612 LYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           L  L + DN+L+G IP       GL      +      N+  G++PA
Sbjct: 385 LEELLMLDNKLSGRIP------DGLGRCRRLRRVRLSNNRLDGDVPA 425



 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 42/168 (25%), Positives = 62/168 (36%), Gaps = 18/168 (10%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           C+   +  L +    L+G +   +     L+ + LS N+ L G +P  +  L  +  L L
Sbjct: 380 CDRGELEELLMLDNKLSGRIPDGLGRCRRLRRVRLSNNR-LDGDVPAAVWGLPHMSLLEL 438

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                 G+I   IG                G IPP +G  S+LY L    N L+G +P S
Sbjct: 439 NDNQLTGVISPVIGGAANLSKLVLSNNRLTGSIPPEIGSASKLYELSADGNMLSGPLPGS 498

Query: 666 DGNTPGLDMLV------------------GTKHFHFGXNKFSGEIPAQ 755
            G    L  LV                       +   N F+G IPA+
Sbjct: 499 LGGLEELGRLVLRNNSLSGQLLRGINSWKKLSELNLADNGFTGAIPAE 546



>gb:AC149487_1745022 Solanum demissum chromosome 5 clone PGEC407 map
           MAP_LOC, complete sequence.
          Length = 1250

 Score = 75.9 bits (185), Expect = 8e-13
 Identities = 50/149 (33%), Positives = 66/149 (44%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S + SL L S  LTG +  +I  L  LQ+L +  N  LTG +P  +G+L+ L  L L 
Sbjct: 115 NLSSLQSLLLYSNQLTGPIPNEIGLLKNLQVLRIGDNVGLTGLIPSSLGDLENLVTLGLA 174

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
            C   G+IP  +G                  IP  +G  S L    +A N L GSIP   
Sbjct: 175 SCSLSGMIPPELGKLGRIENMNLQENQLENEIPSEIGNCSSLVAFSVAVNNLNGSIPEE- 233

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
                L ML   +  +   N  SG+IP Q
Sbjct: 234 -----LSMLKNLQVMNLANNSISGQIPTQ 257



 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 53/150 (35%), Positives = 72/150 (48%), Gaps = 1/150 (0%)
 Frame = +3

Query: 309  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
            N S+++ L+L    + G L  +I EL  L IL+   N+ L+G +P  IGNL KLY L L 
Sbjct: 694  NCSKLLVLSLEDNSINGTLPLEIGELKSLNILNFDKNQ-LSGPIPSTIGNLSKLYILRLS 752

Query: 489  GCGFFGLIPDSIGXXXXXXXXXXXXXXFI-GPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
            G    G IP  +G               I G IPPS+G L++L  LDL+ N LTG +P  
Sbjct: 753  GNSLTGEIPSELGQLKNLQSILDLSFNNISGQIPPSVGTLTKLETLDLSHNHLTGEVPPQ 812

Query: 666  DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
             G    L  L      +   N   G++  Q
Sbjct: 813  VGEMSSLGKL------NLSYNNLQGKLDKQ 836



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 45/130 (34%), Positives = 65/130 (50%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + + +L LS   L G +  +I  +  L+IL L Y    +G +P EIGN  +L  +   
Sbjct: 407 NLTNLQTLALSHNSLHGNIPKEIGMVENLEILFL-YENQFSGEIPMEIGNCSRLQMIDFY 465

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
           G  F G IP +IG                G IP S+G   +L  LDLADN+L+GS+P + 
Sbjct: 466 GNAFSGRIPITIGGLKELNFIDFRQNDLSGEIPASVGNCHQLKILDLADNRLSGSVPATF 525

Query: 669 GNTPGLDMLV 698
           G    L+ L+
Sbjct: 526 GYLRALEQLM 535



 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 46/141 (32%), Positives = 70/141 (49%)
 Frame = +3

Query: 330  LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
            L L +   TGE+   +  + EL +LDLS N +LTG +P ++   +KL +L L     +G 
Sbjct: 605  LRLGNNRFTGEIPWTLGLIRELSLLDLSGN-ELTGLIPPQLSLCRKLTHLDLNNNRLYGS 663

Query: 510  IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
            IP  +G              F GP+P  L   S+L  L L DN + G++P+  G    L+
Sbjct: 664  IPFWLGNLPLLGELKLSSNKFSGPLPRELFNCSKLLVLSLEDNSINGTLPLEIGELKSLN 723

Query: 690  MLVGTKHFHFGXNKFSGEIPA 752
            +L      +F  N+ SG IP+
Sbjct: 724  IL------NFDKNQLSGPIPS 738



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 43/145 (29%), Positives = 70/145 (48%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +V+L L+S  L+G +  ++ +L  ++ ++L  N+ L   +P EIGN   L    +     
Sbjct: 168 LVTLGLASCSLSGMIPPELGKLGRIENMNLQENQ-LENEIPSEIGNCSSLVAFSVAVNNL 226

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IP+ +                 G IP  LG++ EL +L+L  NQL GSIP+S     
Sbjct: 227 NGSIPEELSMLKNLQVMNLANNSISGQIPTQLGEMIELQYLNLLGNQLEGSIPMS----- 281

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L  L   ++     N+ +GEIP +
Sbjct: 282 -LAKLSNVRNLDLSGNRLTGEIPGE 305



 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 50/167 (29%), Positives = 70/167 (41%), Gaps = 21/167 (12%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           R+ ++ L    L  E+  +I   S L    ++ N +L GS+P E+  LK L  + L    
Sbjct: 191 RIENMNLQENQLENEIPSEIGNCSSLVAFSVAVN-NLNGSIPEELSMLKNLQVMNLANNS 249

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
             G IP  +G                G IP SL +LS +  LDL+ N+LTG IP   GN 
Sbjct: 250 ISGQIPTQLGEMIELQYLNLLGNQLEGSIPMSLAKLSNVRNLDLSGNRLTGEIPGEFGNM 309

Query: 678 PGLDMLVGT---------------------KHFHFGXNKFSGEIPAQ 755
             L +LV T                     +H     N+ SGEIP +
Sbjct: 310 DQLQVLVLTSNNLSGGIPKTICSSNGNSSLEHMMLSENQLSGEIPVE 356



 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 49/144 (34%), Positives = 65/144 (45%)
 Frame = +3

Query: 318  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
            ++  L L++  L G +   +  L  L  L LS NK  +G LPRE+ N  KL  L L    
Sbjct: 649  KLTHLDLNNNRLYGSIPFWLGNLPLLGELKLSSNK-FSGPLPRELFNCSKLLVLSLEDNS 707

Query: 498  FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
              G +P  IG                GPIP ++G LS+LY L L+ N LTG IP   G  
Sbjct: 708  INGTLPLEIGELKSLNILNFDKNQLSGPIPSTIGNLSKLYILRLSGNSLTGEIPSELGQL 767

Query: 678  PGLDMLVGTKHFHFGXNKFSGEIP 749
              L  ++         N  SG+IP
Sbjct: 768  KNLQSIL-----DLSFNNISGQIP 786



 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 47/145 (32%), Positives = 66/145 (45%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S +  + LS   L+GE+  ++ E   L+ LDLS N  L GS+P E+  L +L +L+L   
Sbjct: 337 SSLEHMMLSENQLSGEIPVELRECISLKQLDLS-NNTLNGSIPVELYELVELTDLLLNNN 395

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G +   I                 G IP  +G +  L  L L +NQ +G IP+  GN
Sbjct: 396 TLVGSVSPLIANLTNLQTLALSHNSLHGNIPKEIGMVENLEILFLYENQFSGEIPMEIGN 455

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIP 749
              L M+       F  N FSG IP
Sbjct: 456 CSRLQMI------DFYGNAFSGRIP 474



 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 57/190 (30%), Positives = 82/190 (43%), Gaps = 8/190 (4%)
 Frame = +3

Query: 141 QLLLVPLFIQFLGIVAFTDNNDYVAI----KALRDGWKNVPPSWAEGSDP-CGDHWEGVG 305
           +LLLV  F+  L +       ++  +    K+  D  +NV  +W++ +   C   W GV 
Sbjct: 6   KLLLVWFFVVTLVLGYVFSETEFEVLLEIKKSFLDDPENVLSNWSDKNQNFC--QWSGVS 63

Query: 306 CNGS--RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL 479
           C     +VV L LS   ++G +S  I  L +L  LDLS N  L+G +P  + NL  L +L
Sbjct: 64  CEEDTLKVVRLNLSDCSISGSISPSIGFLHDLLHLDLSSNL-LSGPIPPTLSNLSSLQSL 122

Query: 480 ILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADN-QLTGSI 656
           +L                              GPIP  +G L  L  L + DN  LTG I
Sbjct: 123 LLYS------------------------NQLTGPIPNEIGLLKNLQVLRIGDNVGLTGLI 158

Query: 657 PVSDGNTPGL 686
           P S G+   L
Sbjct: 159 PSSLGDLENL 168



 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 40/134 (29%), Positives = 61/134 (45%)
 Frame = +3

Query: 348 DLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG 527
           DL+GE+   +    +L+ILDL+ N+ L+GS+P   G L+ L  L+L      G +PD + 
Sbjct: 492 DLSGEIPASVGNCHQLKILDLADNR-LSGSVPATFGYLRALEQLMLYNNSLEGNLPDELI 550

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTK 707
                           G I  SL   +     D+ +N     +P   G +P L+ L    
Sbjct: 551 NLSNLTRINFSHNKLNGSI-ASLCSSTSFLSFDVTNNAFDHEVPPHLGYSPFLERL---- 605

Query: 708 HFHFGXNKFSGEIP 749
               G N+F+GEIP
Sbjct: 606 --RLGNNRFTGEIP 617



 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 46/173 (26%), Positives = 67/173 (38%), Gaps = 26/173 (15%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYN------------------------- 419
           S V +L LS   LTGE+ G+   + +LQ+L L+ N                         
Sbjct: 286 SNVRNLDLSGNRLTGEIPGEFGNMDQLQVLVLTSNNLSGGIPKTICSSNGNSSLEHMMLS 345

Query: 420 -KDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSL 596
              L+G +P E+     L  L L      G IP  +                +G + P +
Sbjct: 346 ENQLSGEIPVELRECISLKQLDLSNNTLNGSIPVELYELVELTDLLLNNNTLVGSVSPLI 405

Query: 597 GQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
             L+ L  L L+ N L G+IP   G    L++L          N+FSGEIP +
Sbjct: 406 ANLTNLQTLALSHNSLHGNIPKEIGMVENLEIL------FLYENQFSGEIPME 452



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 50/165 (30%), Positives = 65/165 (39%), Gaps = 23/165 (13%)
 Frame = +3

Query: 330  LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSL----------------------- 440
            L L +  L G L  ++  LS L  ++ S+NK L GS+                       
Sbjct: 534  LMLYNNSLEGNLPDELINLSNLTRINFSHNK-LNGSIASLCSSTSFLSFDVTNNAFDHEV 592

Query: 441  PREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYW 620
            P  +G    L  L L    F G IP ++G                G IPP L    +L  
Sbjct: 593  PPHLGYSPFLERLRLGNNRFTGEIPWTLGLIRELSLLDLSGNELTGLIPPQLSLCRKLTH 652

Query: 621  LDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            LDL +N+L GSIP   GN P L  L          NKFSG +P +
Sbjct: 653  LDLNNNRLYGSIPFWLGNLPLLGEL------KLSSNKFSGPLPRE 691



 Score = 45.4 bits (106), Expect = 0.001
 Identities = 30/77 (38%), Positives = 33/77 (42%)
 Frame = +3

Query: 465 KLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQL 644
           K+  L L  C   G I  SIG                GPIPP+L  LS L  L L  NQL
Sbjct: 70  KVVRLNLSDCSISGSISPSIGFLHDLLHLDLSSNLLSGPIPPTLSNLSSLQSLLLYSNQL 129

Query: 645 TGSIPVSDGNTPGLDML 695
           TG IP   G    L +L
Sbjct: 130 TGPIPNEIGLLKNLQVL 146



 Score = 35.8 bits (81), Expect = 0.86
 Identities = 22/58 (37%), Positives = 30/58 (51%)
 Frame = +3

Query: 576 GPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           G I PS+G L +L  LDL+ N L+G IP +  N   L  L+         N+ +G IP
Sbjct: 83  GSISPSIGFLHDLLHLDLSSNLLSGPIPPTLSNLSSLQSLL------LYSNQLTGPIP 134



>gb:BT000466_1634744 Arabidopsis thaliana putative disease
           resistance protein (At4g13900) mRNA, complete cds.
          Length = 751

 Score = 75.9 bits (185), Expect = 8e-13
 Identities = 64/172 (37%), Positives = 76/172 (44%), Gaps = 18/172 (10%)
 Frame = +3

Query: 234 GWKN---VPPS-WAEGSDPCGDHWEGVGCNGS--RVVSLTLSSMDLTGEL--SGDIEELS 389
           G+KN   VP   W   +D C   W+GV C+     VV L L+  DL G L  +  +  L 
Sbjct: 45  GFKNEFHVPSEKWRNNTDCCS--WDGVSCDPKTGNVVGLDLAGSDLNGPLRSNSSLFRLQ 102

Query: 390 ELQIL---------DLSYNKDLTGS-LPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXX 539
            LQ L          LSYN  L G  L   IGNLK L  L L GC  FG IP S+G    
Sbjct: 103 HLQKLYLGCNTSFGSLSYNDGLKGGELLDSIGNLKYLKVLSLRGCNLFGKIPSSLGNLSY 162

Query: 540 XXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDML 695
                     F G IP S+G L+ L  L+L      G +P S GN   L  L
Sbjct: 163 LTHLDLSFNDFTGVIPDSMGNLNYLRVLNLGKCNFYGKVPSSLGNLSYLAQL 214



 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 53/182 (29%), Positives = 67/182 (36%), Gaps = 42/182 (23%)
 Frame = +3

Query: 330  LTLSSMDLTGEL--SGDIEELSELQILDLSYNKDLTGSLPRE------------------ 449
            L L S +  G +   GD      L+I D+S N+  TG LP +                  
Sbjct: 488  LVLRSNEFYGPIFSPGDSLSFPRLRIFDISENR-FTGVLPSDYFAPWSAMSSVVDRIIQH 546

Query: 450  ---------IGNLKKLYNLILVGCGFF-------------GLIPDSIGXXXXXXXXXXXX 563
                     +    K  N+ LVG GF              G IP+SI             
Sbjct: 547  FFQGYYHNSVVLTNKGLNMELVGSGFTIYKTIDVSGNRLEGDIPESISLLKELIVLNMSN 606

Query: 564  XXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGE 743
              F G IPPSL  LS L  LDL+ N+L+GSIP   G       L      +F  N+  G 
Sbjct: 607  NAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGE------LTFLARMNFSYNRLEGP 660

Query: 744  IP 749
            IP
Sbjct: 661  IP 662



 Score = 38.5 bits (88), Expect = 0.13
 Identities = 39/149 (26%), Positives = 59/149 (39%), Gaps = 12/149 (8%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL-------V 488
           L L   +  G++   +  LS L  LDLSYN D T   P  +GNL +L +++L       +
Sbjct: 190 LNLGKCNFYGKVPSSLGNLSYLAQLDLSYN-DFTREGPDSMGNLNRLTDMLLKLNSLTDI 248

Query: 489 GCGF-----FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGS 653
             G        L   S                 I   P  L   ++LY LD++ NQ+ G 
Sbjct: 249 DLGSNQLKGINLKISSTVSLPSPIEYLVLSSCNISEFPKFLRNQTKLYSLDISANQIEGQ 308

Query: 654 IPVSDGNTPGLDMLVGTKHFHFGXNKFSG 740
           +P    + P L  +      +   N F+G
Sbjct: 309 VPEWLWSLPELQSI------NISHNSFNG 331



 Score = 37.4 bits (85), Expect = 0.30
 Identities = 46/171 (26%), Positives = 75/171 (43%), Gaps = 24/171 (14%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPRE-IGNLKKLYNLIL 485
           N +++ SL +S+  + G++   +  L ELQ +++S+N       P + I    +LY L +
Sbjct: 291 NQTKLYSLDISANQIEGQVPEWLWSLPELQSINISHNSFNGFEGPADVIQGGGELYMLDI 350

Query: 486 VGCGF---FGLIP-DSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGS 653
               F   F L+P DS+               F G IP ++ +L  L  L L++N  +GS
Sbjct: 351 SSNIFQDPFPLLPVDSMN------FLFSSNNRFSGEIPKTICELDNLVMLVLSNNNFSGS 404

Query: 654 IP------------VSDGNTPGL-------DMLVGTKHFHFGXNKFSGEIP 749
           IP            + + N  G+       D L   +    G N FSGE+P
Sbjct: 405 IPRCFENLHLYVLHLRNNNLSGIFPEEAISDRL---QSLDVGHNLFSGELP 452



>gb:AY075617_1567762 Arabidopsis thaliana AT3g25560/MWL2_18 mRNA,
           complete cds.>gb:BT002619_1636222 Arabidopsis thaliana
           At3g25560/MWL2_18 mRNA, complete cds.
          Length = 635

 Score = 75.9 bits (185), Expect = 8e-13
 Identities = 48/135 (35%), Positives = 67/135 (49%)
 Frame = +3

Query: 273 DPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREI 452
           DPC   W  + C+   V+ L   S +L+G LS  I  L+ LQ + L  N  +TG++P EI
Sbjct: 69  DPCS--WNMITCSDGFVIRLEAPSQNLSGTLSSSIGNLTNLQTV-LLQNNYITGNIPHEI 125

Query: 453 GNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLA 632
           G L KL  L L    F G IP ++                 G IP SL  +++L +LDL+
Sbjct: 126 GKLMKLKTLDLSTNNFTGQIPFTLSYSKNLQYLRVNNNSLTGTIPSSLANMTQLTFLDLS 185

Query: 633 DNQLTGSIPVSDGNT 677
            N L+G +P S   T
Sbjct: 186 YNNLSGPVPRSLAKT 200



>gb:AB025639_1516701 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone:MWL2.
          Length = 630

 Score = 75.9 bits (185), Expect = 8e-13
 Identities = 48/135 (35%), Positives = 67/135 (49%)
 Frame = +3

Query: 273 DPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREI 452
           DPC   W  + C+   V+ L   S +L+G LS  I  L+ LQ + L  N  +TG++P EI
Sbjct: 64  DPCS--WNMITCSDGFVIRLEAPSQNLSGTLSSSIGNLTNLQTV-LLQNNYITGNIPHEI 120

Query: 453 GNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLA 632
           G L KL  L L    F G IP ++                 G IP SL  +++L +LDL+
Sbjct: 121 GKLMKLKTLDLSTNNFTGQIPFTLSYSKNLQYLRVNNNSLTGTIPSSLANMTQLTFLDLS 180

Query: 633 DNQLTGSIPVSDGNT 677
            N L+G +P S   T
Sbjct: 181 YNNLSGPVPRSLAKT 195



>gb:CQ768553_1451794 Sequence 48 from Patent WO2004007712.
          Length = 603

 Score = 75.9 bits (185), Expect = 8e-13
 Identities = 56/142 (39%), Positives = 70/142 (49%), Gaps = 2/142 (1%)
 Frame = +3

Query: 240 KNVPPSWAEGS-DPCGDHWEGVGCNGSR-VVSLTLSSMDLTGELSGDIEELSELQILDLS 413
           K V   W   S DPC   W  VGC+    VVSL ++S  L+G LS  I EL+ L  L L 
Sbjct: 49  KEVLSGWDINSVDPCT--WNMVGCSSEGFVVSLEMASKGLSGILSTSIGELTHLHTL-LL 105

Query: 414 YNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPS 593
            N  LTG +P E+G L +L  L L G  F G IP S+G                G +P  
Sbjct: 106 QNNQLTGPIPSELGQLSELETLDLSGNRFSGEIPASLGFLTHLNYLRLSRNLLSGQVPHL 165

Query: 594 LGQLSELYWLDLADNQLTGSIP 659
           +  LS L +LDL+ N L+G  P
Sbjct: 166 VAGLSGLSFLDLSFNNLSGPTP 187



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 31/92 (33%), Positives = 41/92 (44%)
 Frame = +3

Query: 474 NLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGS 653
           +L +   G  G++  SIG                GPIP  LGQLSEL  LDL+ N+ +G 
Sbjct: 78  SLEMASKGLSGILSTSIGELTHLHTLLLQNNQLTGPIPSELGQLSELETLDLSGNRFSGE 137

Query: 654 IPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           IP S      L  L    +     N  SG++P
Sbjct: 138 IPAS------LGFLTHLNYLRLSRNLLSGQVP 163



 Score = 41.6 bits (96), Expect = 0.016
 Identities = 25/59 (42%), Positives = 33/59 (55%)
 Frame = +3

Query: 576 GPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           G +  S+G+L+ L+ L L +NQLTG IP   G    L+ L          N+FSGEIPA
Sbjct: 88  GILSTSIGELTHLHTLLLQNNQLTGPIPSELGQLSELETL------DLSGNRFSGEIPA 140



>gb:A91926_1451169 Sequence 6 from Patent
           WO9822591.>gb:DCA131340_1675604 Daucus carota afp
           gene.>gb:AF055480_1764632 Daucus carota antifreeze
           protein (AFP) mRNA, complete cds.
          Length = 332

 Score = 75.9 bits (185), Expect = 8e-13
 Identities = 60/211 (28%), Positives = 92/211 (43%), Gaps = 5/211 (2%)
 Frame = +3

Query: 132 PRIQLLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKN--VPPSWAEGSDPCGDHWEGVG 305
           P + + ++ L +  L      +NND  A+  ++   KN  +  SW    D CG  W+ V 
Sbjct: 9   PILCICMIFLCLPNLSASQRCNNNDKQALLQIKTALKNPTITDSWVSDDDCCG--WDLVE 66

Query: 306 CN--GSRVVSLTLSSMD-LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYN 476
           C+   +R++SL +   + LTG++   + +L  LQ L      +L G +P EI  LK L +
Sbjct: 67  CDETSNRIISLIIQDDEALTGQIPPQVGDLPYLQALWFRKLPNLFGKIPEEISALKDLKS 126

Query: 477 LILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSI 656
           L L      G +P                   +G IPP L  L  L  L L  N+LTG I
Sbjct: 127 LRLSSTSLSGPVPLFFPQLTKLTCLDLSFNKLLGVIPPQLSTLPNLKALHLERNELTGEI 186

Query: 657 PVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           P   GN        G+   +   N+ +G +P
Sbjct: 187 PDIFGN------FAGSPDIYLSHNQLTGFVP 211



>pir|A86460|A86460 99.9K hypothetical protein T1E4.10 - Arabidopsis
           thaliana>gb:AE005172_892173 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC069299_1540787 Arabidopsis thaliana
           chromosome 1 BAC T1E4 genomic sequence, complete
           sequence.
          Length = 907

 Score = 75.9 bits (185), Expect = 8e-13
 Identities = 57/194 (29%), Positives = 87/194 (44%), Gaps = 11/194 (5%)
 Frame = +3

Query: 201 NDYVAIKALRDGWKNVPP----SWAEGSDPCGDHWEGVGC-NGSRVVSLTLSSM------ 347
           +D   + A + G    P     SW +G+  C   W+G+ C N  RV  L L         
Sbjct: 31  DDEAGLLAFKSGITQDPSGMLSSWKKGTSCCS--WKGIICFNSDRVTMLELVGFPKKPER 88

Query: 348 DLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG 527
            L+G LS  + +L  L ++ L  + ++TGS P+ +  L KL  + +      G +P +IG
Sbjct: 89  SLSGTLSPSLAKLQHLSVISLGGHVNITGSFPKFLLQLPKLRYVDIQNNRLSGPLPANIG 148

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTK 707
                         F GPIP S+  L+ L +L    N LTG+IP+      G+  L   +
Sbjct: 149 VLSLLEEIFLQGNKFTGPIPNSISNLTRLSYLIFGGNLLTGTIPL------GIANLKLMQ 202

Query: 708 HFHFGXNKFSGEIP 749
           +   G N+ SG IP
Sbjct: 203 NLQLGDNRLSGTIP 216



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 53/169 (31%), Positives = 82/169 (48%), Gaps = 11/169 (6%)
 Frame = +3

Query: 186 AFTDNNDYVAIKALRDGWKNVPP----SWAEGSDPCGDHWEGVGC-NGSRVVSLTLS--- 341
           A  D +D   +   + G    P     SW +G+D C   W GV C N  RV  L++    
Sbjct: 478 ATCDPDDEAGLLGFKSGITKDPSGILSSWKKGTDCC--FWSGVFCVNNDRVTQLSVDGDF 535

Query: 342 SMD---LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLI 512
           S+D    +G +S  + +L  L+ + L+  + +TG  P+ I  L KL  + + GC   G +
Sbjct: 536 SLDGNSPSGTISPMLAKLQHLERILLTSLRKITGPFPQFIFRLPKLNYINIQGCLLSGPL 595

Query: 513 PDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
           P +IG              F G IP S+  L+ L WL+L +N+L+G+IP
Sbjct: 596 PANIGELSQLKTLVIDGNMFTGHIPSSIANLTRLTWLNLGNNRLSGTIP 644



 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 47/134 (35%), Positives = 65/134 (48%), Gaps = 1/134 (0%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           L+G L  +I ELS+L+ L +  N   TG +P  I NL +L  L L      G IP+    
Sbjct: 591 LSGPLPANIGELSQLKTLVIDGNM-FTGHIPSSIANLTRLTWLNLGNNRLSGTIPNIFKS 649

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLS-ELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTK 707
                        F G +PPS+  L+  LY+LDL+ N L+G+IP        L  LV +K
Sbjct: 650 MKELNSLDLSRNGFFGRLPPSIASLAPTLYYLDLSQNNLSGTIPNYLSRFEALSTLVLSK 709

Query: 708 HFHFGXNKFSGEIP 749
                 NK+SG +P
Sbjct: 710 ------NKYSGVVP 717



 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 44/146 (30%), Positives = 62/146 (42%), Gaps = 1/146 (0%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S +  + L     TG +   I  L+ L  L    N  LTG++P  I NLK + NL L   
Sbjct: 151 SLLEEIFLQGNKFTGPIPNSISNLTRLSYLIFGGNL-LTGTIPLGIANLKLMQNLQLGDN 209

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLS-ELYWLDLADNQLTGSIPVSDG 671
              G IPD                 F G +P S+  L+  L  L ++ N L+G+IP    
Sbjct: 210 RLSGTIPDIFESMKLLKFLDLSSNEFYGKLPLSIATLAPTLLALQVSQNNLSGAIPNYIS 269

Query: 672 NTPGLDMLVGTKHFHFGXNKFSGEIP 749
               L+ L  +K      N+FSG +P
Sbjct: 270 RFNKLEKLDLSK------NRFSGVVP 289



 Score = 49.3 bits (116), Expect = 8e-05
 Identities = 43/143 (30%), Positives = 59/143 (41%), Gaps = 1/143 (0%)
 Frame = +3

Query: 309  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKK-LYNLIL 485
            N +R+  L L +  L+G +    + + EL  LDLS N    G LP  I +L   LY L L
Sbjct: 625  NLTRLTWLNLGNNRLSGTIPNIFKSMKELNSLDLSRN-GFFGRLPPSIASLAPTLYYLDL 683

Query: 486  VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                  G IP+ +               + G +P S   L  +  LDL+ N LTG  PV 
Sbjct: 684  SQNNLSGTIPNYLSRFEALSTLVLSKNKYSGVVPMSFTNLINITNLDLSHNLLTGPFPV- 742

Query: 666  DGNTPGLDMLVGTKHFHFGXNKF 734
                  L  + G +      NKF
Sbjct: 743  ------LKSINGIESLDLSYNKF 759



 Score = 41.6 bits (96), Expect = 0.016
 Identities = 36/118 (30%), Positives = 48/118 (40%), Gaps = 1/118 (0%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKK-LYNLILVGCGFF 503
           +L L    L+G +    E +  L+ LDLS N +  G LP  I  L   L  L +      
Sbjct: 203 NLQLGDNRLSGTIPDIFESMKLLKFLDLSSN-EFYGKLPLSIATLAPTLLALQVSQNNLS 261

Query: 504 GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
           G IP+ I               F G +P     L+ +  LDL+ N LTG  P    NT
Sbjct: 262 GAIPNYISRFNKLEKLDLSKNRFSGVVPQGFVNLTNINNLDLSHNLLTGQFPDLTVNT 319



>pir|T05259|T05259 probable disease resistance protein F18A5.290 -
           Arabidopsis thaliana>gb:ATCHRIV37_1545154 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           37.>gb:ATF18A5_1549075 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F18A5 (ESSA project).
          Length = 835

 Score = 75.9 bits (185), Expect = 8e-13
 Identities = 64/172 (37%), Positives = 76/172 (44%), Gaps = 18/172 (10%)
 Frame = +3

Query: 234 GWKN---VPPS-WAEGSDPCGDHWEGVGCNGS--RVVSLTLSSMDLTGEL--SGDIEELS 389
           G+KN   VP   W   +D C   W+GV C+     VV L L+  DL G L  +  +  L 
Sbjct: 36  GFKNEFHVPSEKWRNNTDCCS--WDGVSCDPKTGNVVGLDLAGSDLNGPLRSNSSLFRLQ 93

Query: 390 ELQIL---------DLSYNKDLTGS-LPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXX 539
            LQ L          LSYN  L G  L   IGNLK L  L L GC  FG IP S+G    
Sbjct: 94  HLQKLYLGCNTSFGSLSYNDGLKGGELLDSIGNLKYLKVLSLRGCNLFGKIPSSLGNLSY 153

Query: 540 XXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDML 695
                     F G IP S+G L+ L  L+L      G +P S GN   L  L
Sbjct: 154 LTHLDLSFNDFTGVIPDSMGNLNYLRVLNLGKCNFYGKVPSSLGNLSYLAQL 205



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 52/151 (34%), Positives = 72/151 (47%), Gaps = 10/151 (6%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L+L   +L G++   +  LS L  LDLS+N D TG +P  +GNL  L  L L  C F+G 
Sbjct: 133 LSLRGCNLFGKIPSSLGNLSYLTHLDLSFN-DFTGVIPDSMGNLNYLRVLNLGKCNFYGK 191

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLG----------QLSELYWLDLADNQLTGSIP 659
           +P S+G              F    P S+G          +L+ L  +DL  NQL G +P
Sbjct: 192 VPSSLGNLSYLAQLDLSYNDFTREGPDSMGNLNRLTDMLLKLNSLTDIDLGSNQLKGMLP 251

Query: 660 VSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
               N   L  L   ++F+ G N FSG IP+
Sbjct: 252 ---SNMSSLSKL---EYFYIGGNSFSGSIPS 276



 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 53/182 (29%), Positives = 67/182 (36%), Gaps = 42/182 (23%)
 Frame = +3

Query: 330  LTLSSMDLTGEL--SGDIEELSELQILDLSYNKDLTGSLPRE------------------ 449
            L L S +  G +   GD      L+I D+S N+  TG LP +                  
Sbjct: 572  LVLRSNEFYGPIFSPGDSLSFPRLRIFDISENR-FTGVLPSDYFAPWSAMSSVVDRIIQH 630

Query: 450  ---------IGNLKKLYNLILVGCGFF-------------GLIPDSIGXXXXXXXXXXXX 563
                     +    K  N+ LVG GF              G IP+SI             
Sbjct: 631  FFQGYYHNSVVLTNKGLNMELVGSGFTIYKTIDVSGNRLEGDIPESISLLKELIVLNMSN 690

Query: 564  XXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGE 743
              F G IPPSL  LS L  LDL+ N+L+GSIP   G       L      +F  N+  G 
Sbjct: 691  NAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGE------LTFLARMNFSYNRLEGP 744

Query: 744  IP 749
            IP
Sbjct: 745  IP 746



 Score = 37.4 bits (85), Expect = 0.30
 Identities = 46/171 (26%), Positives = 75/171 (43%), Gaps = 24/171 (14%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPRE-IGNLKKLYNLIL 485
           N +++ SL +S+  + G++   +  L ELQ +++S+N       P + I    +LY L +
Sbjct: 375 NQTKLYSLDISANQIEGQVPEWLWSLPELQSINISHNSFNGFEGPADVIQGGGELYMLDI 434

Query: 486 VGCGF---FGLIP-DSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGS 653
               F   F L+P DS+               F G IP ++ +L  L  L L++N  +GS
Sbjct: 435 SSNIFQDPFPLLPVDSMN------FLFSSNNRFSGEIPKTICELDNLVMLVLSNNNFSGS 488

Query: 654 IP------------VSDGNTPGL-------DMLVGTKHFHFGXNKFSGEIP 749
           IP            + + N  G+       D L   +    G N FSGE+P
Sbjct: 489 IPRCFENLHLYVLHLRNNNLSGIFPEEAISDRL---QSLDVGHNLFSGELP 536



>pir|T10659|T10659 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) T5F17.100 - Arabidopsis
           thaliana>gb:ATCHRIV69_1546745 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 69.
          Length = 1013

 Score = 75.9 bits (185), Expect = 8e-13
 Identities = 51/145 (35%), Positives = 70/145 (48%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +V L  S  +L+G L+ D+  L  L++LDL  N    GSLP    NL+KL  L L G   
Sbjct: 142 LVHLNASGNNLSGNLTEDLGNLVSLEVLDLRGNF-FQGSLPSSFKNLQKLRFLGLSGNNL 200

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G +P  +G              F GPIPP  G ++ L +LDLA  +L+G IP   G   
Sbjct: 201 TGELPSVLGQLPSLETAILGYNEFKGPIPPEFGNINSLKYLDLAIGKLSGEIPSELGKLK 260

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L+ L+         N F+G IP +
Sbjct: 261 SLETLL------LYENNFTGTIPRE 279



 Score = 69.3 bits (168), Expect = 7e-11
 Identities = 48/140 (34%), Positives = 63/140 (45%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS  +LTGEL   + +L  L+   L YN +  G +P E GN+  L  L L      G 
Sbjct: 193 LGLSGNNLTGELPSVLGQLPSLETAILGYN-EFKGPIPPEFGNINSLKYLDLAIGKLSGE 251

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP  +G              F G IP  +G ++ L  LD +DN LTG IP+       L 
Sbjct: 252 IPSELGKLKSLETLLLYENNFTGTIPREIGSITTLKVLDFSDNALTGEIPMEITKLKNLQ 311

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
           +L      +   NK SG IP
Sbjct: 312 LL------NLMRNKLSGSIP 325



 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 44/163 (26%), Positives = 66/163 (40%), Gaps = 23/163 (14%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKD-----------------------LTGSL 440
           L L+   L+G + GDI +   L  +D S N+                        ++G +
Sbjct: 433 LELAGNRLSGGIPGDISDSVSLSFIDFSRNQIRSSLPSTILSIHNLQAFLVADNFISGEV 492

Query: 441 PREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYW 620
           P +  +   L NL L      G IP SI                 G IP  +  +S L  
Sbjct: 493 PDQFQDCPSLSNLDLSSNTLTGTIPSSIASCEKLVSLNLRNNNLTGEIPRQITTMSALAV 552

Query: 621 LDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           LDL++N LTG +P S G +P L++L      +   NK +G +P
Sbjct: 553 LDLSNNSLTGVLPESIGTSPALELL------NVSYNKLTGPVP 589



 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 32/105 (30%), Positives = 51/105 (48%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           ++GE+    ++   L  LDLS N  LTG++P  I + +KL +L L      G IP  I  
Sbjct: 488 ISGEVPDQFQDCPSLSNLDLSSNT-LTGTIPSSIASCEKLVSLNLRNNNLTGEIPRQITT 546

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                          G +P S+G    L  L+++ N+LTG +P++
Sbjct: 547 MSALAVLDLSNNSLTGVLPESIGTSPALELLNVSYNKLTGPVPIN 591



 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 59/263 (22%), Positives = 97/263 (36%), Gaps = 56/263 (21%)
 Frame = +3

Query: 135 RIQLLLVPLFIQFLG----IVAFTDNND----YVAIKALRDGWKNVPPSW--AEGSDPCG 284
           +++++++ L+  ++G    ++A  DN +     +++K+      N    W  ++ SD C 
Sbjct: 2   KMKIIVLFLYYCYIGSTSSVLASIDNVNELSVLLSVKSTLVDPLNFLKDWKLSDTSDHC- 60

Query: 285 DHWEGVGCNGS-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNL 461
            +W GV CN +  V  L L+ M+LTG++S  I +LS L   ++S N              
Sbjct: 61  -NWTGVRCNSNGNVEKLDLAGMNLTGKISDSISQLSSLVSFNISCN-------------- 105

Query: 462 KKLYNLILVGCGFFGLIPDSI--------------------------------------- 524
                      GF  L+P SI                                       
Sbjct: 106 -----------GFESLLPKSIPPLKSIDISQNSFSGSLFLFSNESLGLVHLNASGNNLSG 154

Query: 525 ------GXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
                 G              F G +P S   L +L +L L+ N LTG +P   G  P L
Sbjct: 155 NLTEDLGNLVSLEVLDLRGNFFQGSLPSSFKNLQKLRFLGLSGNNLTGELPSVLGQLPSL 214

Query: 687 DMLVGTKHFHFGXNKFSGEIPAQ 755
           +  +       G N+F G IP +
Sbjct: 215 ETAI------LGYNEFKGPIPPE 231



 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 29/87 (33%), Positives = 41/87 (47%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           +L LSS  LTG +   I    +L  L+L  N +LTG +PR+I  +  L  L L      G
Sbjct: 504 NLDLSSNTLTGTIPSSIASCEKLVSLNLR-NNNLTGEIPRQITTMSALAVLDLSNNSLTG 562

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIP 587
           ++P+SIG                GP+P
Sbjct: 563 VLPESIGTSPALELLNVSYNKLTGPVP 589



 Score = 41.6 bits (96), Expect = 0.016
 Identities = 23/46 (50%), Positives = 30/46 (65%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIG 455
           ++VSL L + +LTGE+   I  +S L +LDLS N  LTG LP  IG
Sbjct: 525 KLVSLNLRNNNLTGEIPRQITTMSALAVLDLS-NNSLTGVLPESIG 569



 Score = 39.7 bits (91), Expect = 0.060
 Identities = 38/165 (23%), Positives = 60/165 (36%), Gaps = 23/165 (13%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLS-----------------------YNKDLTGSL 440
           L L +  L+GEL  D+ + S LQ LD+S                       +N   TG +
Sbjct: 337 LELWNNTLSGELPSDLGKNSPLQWLDVSSNSFSGEIPSTLCNKGNLTKLILFNNTFTGQI 396

Query: 441 PREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYW 620
           P  +   + L  + +      G IP   G                G IP  +     L +
Sbjct: 397 PATLSTCQSLVRVRMQNNLLNGSIPIGFGKLEKLQRLELAGNRLSGGIPGDISDSVSLSF 456

Query: 621 LDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           +D + NQ+  S+P +      +  +   + F    N  SGE+P Q
Sbjct: 457 IDFSRNQIRSSLPST------ILSIHNLQAFLVADNFISGEVPDQ 495



>gb:AP005966_1860357 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:B1047H05.>gb:AP007273_1863465 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBb0035K09.
          Length = 1128

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 60/189 (31%), Positives = 86/189 (45%), Gaps = 4/189 (2%)
 Frame = +3

Query: 195 DNNDYVAIKALRDGWKNVPPSWAEGS-DPCGDHWEGVGCN---GSRVVSLTLSSMDLTGE 362
           D    +  K+   G      SW+  S + C   W+GV C+     RV+++ L+S  +TG 
Sbjct: 35  DRQALLCFKSQLSGPSRALSSWSNTSLNFCS--WDGVTCSVRRPHRVIAIDLASEGITGT 92

Query: 363 LSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXX 542
           +S  I  L+ L  L LS N    GS+P  +G L +L NL L      G IP  +      
Sbjct: 93  ISRCIANLTSLTTLQLS-NNSFHGSIPSRLGLLSELNNLNLSMNSLEGNIPSELSSCSQL 151

Query: 543 XXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFG 722
                      G IP SL +   L  ++L+ N+L GSIP + GN P L  LV        
Sbjct: 152 EILGLWNNSIQGEIPASLSKCIHLQEINLSRNKLQGSIPSTFGNLPKLKTLV------LA 205

Query: 723 XNKFSGEIP 749
            N+ +G+IP
Sbjct: 206 RNRLTGDIP 214



 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 44/149 (29%), Positives = 70/149 (46%), Gaps = 1/149 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S ++++ L      G +     + S ++ L+L  N  ++G++P  + NL  L +L L 
Sbjct: 267 NTSSLIAICLQQNSFVGSIPAVTAKSSPIKYLNLR-NNYISGAIPSSLANLSSLLSLRLN 325

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP+S+G                G +PPS+  +S L +L +A+N LTG +P   
Sbjct: 326 ENNLVGNIPESLGHIQTLEMLALNVNNLSGLVPPSIFNMSSLIFLAMANNSLTGRLPSDI 385

Query: 669 GNT-PGLDMLVGTKHFHFGXNKFSGEIPA 752
           G T P +  L+         NKF G IPA
Sbjct: 386 GYTLPKIQGLI------LSTNKFVGPIPA 408



 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 52/150 (34%), Positives = 64/150 (42%), Gaps = 1/150 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSE-LQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           N SR+  L L   +L G L   I  LS  L+ L L  NK   G +P EIGNLK L  L +
Sbjct: 462 NCSRLTKLMLDGNNLQGNLPSSIGNLSSNLEALWLKNNK-FFGPIPSEIGNLKSLNRLFM 520

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
               F G IP +IG                G IP   G LS+L  L L  N  +G IP S
Sbjct: 521 DYNVFTGNIPPTIGNMNSLVVLSFAQNKLSGHIPDIFGNLSQLTDLKLDGNNFSGKIPAS 580

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
                 L +L      +   N   G IP++
Sbjct: 581 ISQCTQLQIL------NIAHNSLDGNIPSK 604



 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 49/146 (33%), Positives = 64/146 (43%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S++  L L +  + GE+   + +   LQ ++LS NK L GS+P   GNL KL  L+L   
Sbjct: 149 SQLEILGLWNNSIQGEIPASLSKCIHLQEINLSRNK-LQGSIPSTFGNLPKLKTLVLARN 207

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G IP  +G                G IP SL   S L  L L  N L+G +P S  N
Sbjct: 208 RLTGDIPPFLGSSVSLRYVDLGNNALTGSIPESLANSSSLQVLRLMSNSLSGQLPKSLLN 267

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIPA 752
           T  L  +          N F G IPA
Sbjct: 268 TSSLIAIC------LQQNSFVGSIPA 287



 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 44/149 (29%), Positives = 71/149 (47%), Gaps = 1/149 (0%)
 Frame = +3

Query: 306  CNGSRVVSLTLSSMDLTGELSGDIEELSEL-QILDLSYNKDLTGSLPREIGNLKKLYNLI 482
            C   +++++  +S+D  G +   I E+S L + +DLS+N  L+G +P E+GNL  L  L+
Sbjct: 584  CTQLQILNIAHNSLD--GNIPSKIFEISSLSEEMDLSHNY-LSGEIPNEVGNLIHLNRLV 640

Query: 483  LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPV 662
            +      G IP S+G              F+G IP S   L  +  +D++ N L+G+IP 
Sbjct: 641  ISNNMLSGKIPSSLGQCVVLEYLEIQNNFFVGSIPQSFVNLVSIKRMDISQNNLSGNIP- 699

Query: 663  SDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
                   L  L      +   N F G +P
Sbjct: 700  -----EFLTSLSSLHSLNLSYNNFDGVVP 723



 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 41/147 (27%), Positives = 64/147 (43%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N  ++ +L L+   LTG++   +     L+ +DL  N  LTGS+P  + N   L  L L+
Sbjct: 195 NLPKLKTLVLARNRLTGDIPPFLGSSVSLRYVDLG-NNALTGSIPESLANSSSLQVLRLM 253

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G +P S+               F+G IP    + S + +L+L +N ++G+IP S 
Sbjct: 254 SNSLSGQLPKSLLNTSSLIAICLQQNSFVGSIPAVTAKSSPIKYLNLRNNYISGAIPSSL 313

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            N   L  L          N   G IP
Sbjct: 314 ANLSSLLSL------RLNENNLVGNIP 334



 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 41/130 (31%), Positives = 60/130 (46%), Gaps = 1/130 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S ++SL L+  +L G +   +  +  L++L L+ N +L+G +P  I N+  L  L + 
Sbjct: 315 NLSSLLSLRLNENNLVGNIPESLGHIQTLEMLALNVN-NLSGLVPPSIFNMSSLIFLAMA 373

Query: 489 GCGFFGLIPDSIGXXX-XXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                G +P  IG               F+GPIP SL     L  L L  N  TG IP  
Sbjct: 374 NNSLTGRLPSDIGYTLPKIQGLILSTNKFVGPIPASLLNAYHLEMLYLGKNSFTGLIPFF 433

Query: 666 DGNTPGLDML 695
            G+ P L+ L
Sbjct: 434 -GSLPNLNEL 442



 Score = 38.1 bits (87), Expect = 0.17
 Identities = 29/86 (33%), Positives = 35/86 (40%)
 Frame = +3

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
           G  G I   I               F G IP  LG LSEL  L+L+ N L G+IP    +
Sbjct: 88  GITGTISRCIANLTSLTTLQLSNNSFHGSIPSRLGLLSELNNLNLSMNSLEGNIPSELSS 147

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIPA 752
              L++L          N   GEIPA
Sbjct: 148 CSQLEIL------GLWNNSIQGEIPA 167



>gb:AP005420_1851511 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0418B08.>gb:AP005579_1854425 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OJ1740_D06.
          Length = 1080

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 57/163 (34%), Positives = 78/163 (47%), Gaps = 2/163 (1%)
 Frame = +3

Query: 270 SDPCGDHWEGVGCNGSR--VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLP 443
           +D CG  + GV C+  R  VV L LS+M + G +   + +L  L+ LDLS N  ++G++P
Sbjct: 78  TDVCG--FTGVACDRRRQHVVGLQLSNMSINGSIPLALAQLPHLRYLDLSDNH-ISGAVP 134

Query: 444 REIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWL 623
             + NL +L  L +      G IP S G                G IPPS G L+ L  L
Sbjct: 135 SFLSNLTQLLMLDMSENQLSGAIPPSFGNLTQLRKLDISKNQLSGAIPPSFGNLTNLEIL 194

Query: 624 DLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           D++ N LTG IP    N   L+ L      + G N   G IPA
Sbjct: 195 DMSINVLTGRIPEELSNIGKLEGL------NLGQNNLVGSIPA 231



 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 45/113 (39%), Positives = 53/113 (46%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +  + LSS  L G +   I  L  LQ LDLS N  LTG++P  I N   L  L L     
Sbjct: 422 ITLMNLSSNLLNGTIPTSICWLPNLQQLDLSRNS-LTGAVPACISNATSLGELDLSSNAL 480

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
            G IP SIG                G IP SLGQ   +  LDL+ N+LTG IP
Sbjct: 481 SGSIPSSIGSLKLSYLSLHRNQ-LSGEIPASLGQHLGIVRLDLSSNRLTGEIP 532



 Score = 56.2 bits (134), Expect = 6e-07
 Identities = 47/147 (31%), Positives = 65/147 (44%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N +++  L +S   L+G +      L+ L+ILD+S N  LTG +P E+ N+ KL  L L 
Sbjct: 163 NLTQLRKLDISKNQLSGAIPPSFGNLTNLEILDMSINV-LTGRIPEELSNIGKLEGLNL- 220

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                                       +G IP S  QL  L++L L  N L+GSIP + 
Sbjct: 221 -----------------------GQNNLVGSIPASFTQLKNLFYLSLEKNSLSGSIPATI 257

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
             T    M V    F  G N  +GEIP
Sbjct: 258 -FTNCTQMGV----FDLGDNNITGEIP 279



 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 34/114 (29%), Positives = 56/114 (49%)
 Frame = +3

Query: 324 VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF 503
           +SL LS   L G L   +  L   +++DLS+N +LTG++  E+G   +L  L L      
Sbjct: 541 MSLNLSRNLLGGRLPRGLSRLQMAEVIDLSWN-NLTGAIFPELGACAELQVLDLSHNSLT 599

Query: 504 GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
           G++P S+                 G IP +L + + L +L+L+ N L G +P +
Sbjct: 600 GVLPSSLDGLESIERLDVSDNSLTGEIPQTLTKCTTLTYLNLSYNDLAGVVPTA 653



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 41/143 (28%), Positives = 61/143 (42%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +V L LSS  LTGE+   +  + ++  L+LS N  L G LPR +  L+    + L     
Sbjct: 517 IVRLDLSSNRLTGEIPDAVAGIVQMS-LNLSRNL-LGGRLPRGLSRLQMAEVIDLSWNNL 574

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G I   +G                G +P SL  L  +  LD++DN LTG IP +     
Sbjct: 575 TGAIFPELGACAELQVLDLSHNSLTGVLPSSLDGLESIERLDVSDNSLTGEIPQT----- 629

Query: 681 GLDMLVGTKHFHFGXNKFSGEIP 749
            L       + +   N  +G +P
Sbjct: 630 -LTKCTTLTYLNLSYNDLAGVVP 651



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 43/172 (25%), Positives = 73/172 (42%), Gaps = 2/172 (1%)
 Frame = +3

Query: 243 NVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEEL--SELQILDLSY 416
           NV  +  +G+   G  +  V  N + ++ +   ++ + G L   +  L    +  L+L  
Sbjct: 347 NVHFASGDGNTNLGPFFAAVS-NCTSILEIEAGALGIGGRLPSLLGSLLPPNMSHLNLEL 405

Query: 417 NKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSL 596
           N  + G +P +IG++  +  + L      G IP SI                 G +P  +
Sbjct: 406 NA-IEGPIPADIGDVINITLMNLSSNLLNGTIPTSICWLPNLQQLDLSRNSLTGAVPACI 464

Query: 597 GQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
              + L  LDL+ N L+GSIP S G+       +   +     N+ SGEIPA
Sbjct: 465 SNATSLGELDLSSNALSGSIPSSIGS-------LKLSYLSLHRNQLSGEIPA 509



 Score = 32.3 bits (72), Expect = 9.5
 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 2/65 (3%)
 Frame = +3

Query: 336 LSSMDLTGELSGDIEE-LSE-LQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L   ++TGE+ GD  + LS+   +L+L Y+  LTG LPR + N   LY L +        
Sbjct: 269 LGDNNITGEIPGDASDSLSDRFAVLNL-YSNSLTGRLPRWLANCTILYLLDVENNSLADD 327

Query: 510 IPDSI 524
           +P SI
Sbjct: 328 LPTSI 332



>gb:AP002522_1822351 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0009G03.>gb:AP003045_1824369 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0030H07.
          Length = 1051

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 49/142 (34%), Positives = 64/142 (45%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L +  ++G +  DI  L  L  LDL +   L+G +P  IG L  L  + L      GL
Sbjct: 378 LYLDNNSISGSIPEDIGNLIGLDTLDLGFTS-LSGVIPASIGKLSNLVEVALYNTSLSGL 436

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP SIG                GPIP SLG+L  L+ LDL+ N+L GSIP      P L 
Sbjct: 437 IPSSIGNLTNLNRLYAYYTNLEGPIPASLGKLKTLFVLDLSTNRLNGSIPKEILELPSLS 496

Query: 690 MLVGTKHFHFGXNKFSGEIPAQ 755
                 +     N  SG +P +
Sbjct: 497 W-----YLDLSYNSLSGPLPIE 513



 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 58/142 (40%), Positives = 67/142 (47%), Gaps = 1/142 (0%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQ-ILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           L LS+  L G +  +I EL  L   LDLSYN  L+G LP E+  L  L  LIL G    G
Sbjct: 474 LDLSTNRLNGSIPKEILELPSLSWYLDLSYNS-LSGPLPIEVATLANLNQLILSGNQLSG 532

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
            IPDSIG              F G IP SL  L  L  L+L  N+L+G IP + G    L
Sbjct: 533 QIPDSIGNCQVLESLLLDKNSFEGGIPQSLTNLKGLNILNLTMNKLSGRIPDTIGRIGNL 592

Query: 687 DMLVGTKHFHFGXNKFSGEIPA 752
             L          N FSG IPA
Sbjct: 593 QQL------FLAQNNFSGPIPA 608



 Score = 69.3 bits (168), Expect = 7e-11
 Identities = 69/216 (31%), Positives = 93/216 (43%), Gaps = 10/216 (4%)
 Frame = +3

Query: 135 RIQLLLVPLFIQFLGIVA------FTDNNDYVAIKA-LRDGWKNVPPSWAEGSDPCGDHW 293
           R++L LV +    +  VA       +D    +A KA  R    +   SW   +  C   W
Sbjct: 8   RLELSLVLILTPIVAAVAGGGSSSSSDEATLLAFKAAFRGSSSSALASWNSSTSFCS--W 65

Query: 294 EGVGCNG---SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLK 464
           EGV C+    +RV +LTL S +L G L   I  LS LQ L+LS N +L G +P  +G L+
Sbjct: 66  EGVTCDRRTPARVAALTLPSGNLAGGLPPVIGNLSFLQSLNLSSN-ELYGEIPPSLGRLR 124

Query: 465 KLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQL 644
           +L  L + G                          F G +P +L     +  L LA NQL
Sbjct: 125 RLEILDIGG------------------------NSFSGELPANLSSCISMKNLGLAFNQL 160

Query: 645 TGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            G IPV  GNT     L   +      N F+G IPA
Sbjct: 161 GGRIPVELGNT-----LTQLQKLQLQNNSFTGPIPA 191



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 43/131 (32%), Positives = 56/131 (42%)
 Frame = +3

Query: 360 ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXX 539
           EL   + +L +LQ+     N   TG +P  + NL  L  L +      GLIP  +G    
Sbjct: 167 ELGNTLTQLQKLQL----QNNSFTGPIPASLANLSLLQYLYMDNNNLEGLIPLDLGKAAA 222

Query: 540 XXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHF 719
                       G  P SL  LS L  L   DN L GSIP + G     D   G ++F  
Sbjct: 223 LREFSFQQNSLSGIFPSSLWNLSTLTVLAANDNMLQGSIPANIG-----DKFPGIQYFGL 277

Query: 720 GXNKFSGEIPA 752
             N+FSG IP+
Sbjct: 278 ADNQFSGVIPS 288



 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 38/110 (34%), Positives = 52/110 (47%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS   L+G++   I     L+ L L  N    G +P+ + NLK L  L L      G 
Sbjct: 523 LILSGNQLSGQIPDSIGNCQVLESLLLDKNS-FEGGIPQSLTNLKGLNILNLTMNKLSGR 581

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
           IPD+IG              F GPIP +L  L+ L+ LD++ N L G +P
Sbjct: 582 IPDTIGRIGNLQQLFLAQNNFSGPIPATLQNLTMLWKLDVSFNNLQGEVP 631



 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 38/113 (33%), Positives = 51/113 (45%), Gaps = 1/113 (0%)
 Frame = +3

Query: 360 ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKK-LYNLILVGCGFFGLIPDSIGXXX 536
           E    +   S+LQ L +S N   +G LP  + NL   L+ L L      G IP+ IG   
Sbjct: 339 EFITSLTNCSQLQQLVISDNS-FSGQLPNSVVNLSTTLHKLYLDNNSISGSIPEDIGNLI 397

Query: 537 XXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDML 695
                        G IP S+G+LS L  + L +  L+G IP S GN   L+ L
Sbjct: 398 GLDTLDLGFTSLSGVIPASIGKLSNLVEVALYNTSLSGLIPSSIGNLTNLNRL 450



 Score = 39.3 bits (90), Expect = 0.078
 Identities = 36/134 (26%), Positives = 54/134 (40%), Gaps = 1/134 (0%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGN-LKKLYNLILVGCGFFGLIPDSIG 527
           L+G     +  LS L +L  + N  L GS+P  IG+    +    L    F G+IP S+ 
Sbjct: 233 LSGIFPSSLWNLSTLTVLAANDNM-LQGSIPANIGDKFPGIQYFGLADNQFSGVIPSSLF 291

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTK 707
                         F G +PP++G+L  L  L L  N+L  +          L      +
Sbjct: 292 NLSSLTIVLLYGNRFSGFVPPTVGRLKSLRRLYLYGNRLEANNRKGWEFITSLTNCSQLQ 351

Query: 708 HFHFGXNKFSGEIP 749
                 N FSG++P
Sbjct: 352 QLVISDNSFSGQLP 365



>gb:AJ620355_1812309 Rubus idaeus partial pgip1 gene for putative
           polygalacturonase-inhibiting protein, exons 1-2.
          Length = 249

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 59/168 (35%), Positives = 78/168 (46%), Gaps = 3/168 (1%)
 Frame = +3

Query: 255 SWAEGSDPCGDHWEGVGCNGS--RVVSLTL-SSMDLTGELSGDIEELSELQILDLSYNKD 425
           SW   +D C D W  V C+ +  R+ SLT+ +  +LTG++   + +L  L+ L+L     
Sbjct: 5   SWKSDADCCTD-WYCVECDPTTHRINSLTIFTDNNLTGQIPAQVGDLPYLETLELRKLPH 63

Query: 426 LTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQL 605
           LTG +   I  LK L  L L   G  G +PD I               F G IP SL QL
Sbjct: 64  LTGPIQPSIAKLKHLKMLRLSWNGLSGSVPDFISQLKNLTFLELNFNKFTGSIPSSLSQL 123

Query: 606 SELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
             L  L L  NQLTG IP S G   G    +   H     N+ +G+IP
Sbjct: 124 PNLGALHLDRNQLTGQIPSSFGKFVGTVPALFLSH-----NQLTGKIP 166



>gb:AJ620336_1812307 Rubus idaeus mRNA for putative
           polygalacturonase-inhibiting protein (pgip1 gene).
          Length = 331

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 59/168 (35%), Positives = 78/168 (46%), Gaps = 3/168 (1%)
 Frame = +3

Query: 255 SWAEGSDPCGDHWEGVGCNGS--RVVSLTL-SSMDLTGELSGDIEELSELQILDLSYNKD 425
           SW   +D C D W  V C+ +  R+ SLT+ +  +LTG++   + +L  L+ L+L     
Sbjct: 48  SWKSDADCCTD-WYCVECDPTTHRINSLTIFTDNNLTGQIPAQVGDLPYLETLELRKLPH 106

Query: 426 LTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQL 605
           LTG +   I  LK L  L L   G  G +PD I               F G IP SL QL
Sbjct: 107 LTGPIQPSIAKLKHLKMLRLSWNGLSGSVPDFISQLKNLTFLELNFNKFTGSIPSSLSQL 166

Query: 606 SELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
             L  L L  NQLTG IP S G   G    +   H     N+ +G+IP
Sbjct: 167 PNLGALHLDRNQLTGQIPSSFGKFVGTVPALFLSH-----NQLTGKIP 209



>gb:AF466358_1802293 Oryza sativa (japonica cultivar-group) floral
           organ regulator 1 (FOR1) mRNA, complete cds.
          Length = 213

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 46/132 (34%), Positives = 70/132 (53%), Gaps = 1/132 (0%)
 Frame = +3

Query: 273 DPCGDHWEGVGCN-GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPRE 449
           +PC   W  V C+  +RV  L L +++L+G L  ++ +L  LQ L+L Y  ++ G++P E
Sbjct: 53  NPCT--WFHVTCDRDNRVTRLDLGNLNLSGHLVPELGKLDHLQYLEL-YKNNIQGTIPSE 109

Query: 450 IGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDL 629
           +GNLK L +L L      G IP ++G                GPIP  L  +S L  +D+
Sbjct: 110 LGNLKNLISLDLYKNNISGTIPPTLGKLTSLVFLRLNGNRLTGPIPRELAGISSLKVVDV 169

Query: 630 ADNQLTGSIPVS 665
           + N L G+IP S
Sbjct: 170 SSNDLCGTIPTS 181



>gb:AF053997_1764491 Lycopersicon esculentum Hcr2-5B (Hcr2-5B) gene,
           complete cds.
          Length = 799

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 65/223 (29%), Positives = 95/223 (42%), Gaps = 29/223 (13%)
 Frame = +3

Query: 171 FLGIVAFTDNNDYVAIKALRDGWKNVP----PSWAEGSDPCGDHWEGVGCNGSRVVSLT- 335
           +L  VAF    +  A+   +  +KN       SW   S+ C D W GV C   RV +L  
Sbjct: 19  YLFTVAFASTEEATALLKWKATFKNQNNSFLASWTTSSNACKD-WYGVVCLNGRVNTLNI 77

Query: 336 ------------------------LSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLP 443
                                   LS+ +++G +  +I  L+ L  LDL+ N+ ++G++P
Sbjct: 78  TNASVIGTLYAFPFSSLPFLENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQ-ISGTIP 136

Query: 444 REIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWL 623
            +IG+L KL  + +      G IP+ IG                G IP SLG ++ L +L
Sbjct: 137 PQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRSLTKLSLGINFLSGSIPASLGNMTNLSFL 196

Query: 624 DLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            L +NQL+G IP   G    L  L          N  SG IPA
Sbjct: 197 FLYENQLSGFIPEEIGYLRSLTKL------SLDINFLSGSIPA 233



 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 53/145 (36%), Positives = 65/145 (44%), Gaps = 3/145 (2%)
 Frame = +3

Query: 327 SLTLSSMD---LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           SLT  S+D   L+G +   +  L+ L  L L YN  L+GS+P EIG L+ L  L L    
Sbjct: 216 SLTKLSLDINFLSGSIPASLGNLNNLSFLYL-YNNQLSGSIPEEIGYLRSLTYLDLKENA 274

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
             G IP S+G                G IP  +G LS L  L L +N L G IP S GN 
Sbjct: 275 LNGSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTNLYLGNNSLIGLIPASFGNM 334

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIPA 752
             L  L          N   GEIP+
Sbjct: 335 RNLQAL------FLNDNNLIGEIPS 353



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 50/141 (35%), Positives = 62/141 (43%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L    L G +   +  L+ L  L L YN  L+GS+P EIG L  L NL L      GL
Sbjct: 268 LDLKENALNGSIPASLGNLNNLSRLYL-YNNQLSGSIPEEIGYLSSLTNLYLGNNSLIGL 326

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S G               IG IP  +  L+ L  L +  N L G +P   GN    D
Sbjct: 327 IPASFGNMRNLQALFLNDNNLIGEIPSFVCNLTSLELLYMPRNNLKGKVPQCLGNIS--D 384

Query: 690 MLVGTKHFHFGXNKFSGEIPA 752
           +LV         N FSGE+P+
Sbjct: 385 LLV----LSMSSNSFSGELPS 401



 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 48/145 (33%), Positives = 65/145 (44%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +  L+L    L+G +   +  ++ L  L L Y   L+G +P EIG L+ L  L L     
Sbjct: 169 LTKLSLGINFLSGSIPASLGNMTNLSFLFL-YENQLSGFIPEEIGYLRSLTKLSLDINFL 227

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IP S+G                G IP  +G L  L +LDL +N L GSIP S GN  
Sbjct: 228 SGSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTYLDLKENALNGSIPASLGNLN 287

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L  L      +   N+ SG IP +
Sbjct: 288 NLSRL------YLYNNQLSGSIPEE 306



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 44/144 (30%), Positives = 65/144 (45%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S ++ L++SS   +GEL   I  L+ L+ILD   N +L G++P+  GN+  L    + 
Sbjct: 381 NISDLLVLSMSSNSFSGELPSSISNLTSLKILDFGRN-NLEGAIPQCFGNISSLQVFDMQ 439

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G +P +                    IP SL    +L  LDL DNQL  + P+  
Sbjct: 440 NNKLSGTLPTNFSIGCSLISLNLHGNELEDEIPWSLDNCKKLQVLDLGDNQLNDTFPMWL 499

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSG 740
           G  P L +L  T +   G  + SG
Sbjct: 500 GTLPELRVLRLTSNKLHGPIRSSG 523



 Score = 42.0 bits (97), Expect = 0.012
 Identities = 31/79 (39%), Positives = 37/79 (46%), Gaps = 1/79 (1%)
 Frame = +3

Query: 426 LTGSLPREIGNLKKLYNLI-LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQ 602
           +T  L  EI  +  LY +I L    F G IP  +G                G IP SLG 
Sbjct: 578 VTKGLELEIVRILSLYTVIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGS 637

Query: 603 LSELYWLDLADNQLTGSIP 659
           LS L  LDL+ NQL+G IP
Sbjct: 638 LSILESLDLSFNQLSGEIP 656



>gb:AF053995_1764489 Lycopersicon esculentum Hcr2-0B (Hcr2-0B) gene,
           complete cds.
          Length = 944

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 65/223 (29%), Positives = 95/223 (42%), Gaps = 29/223 (13%)
 Frame = +3

Query: 171 FLGIVAFTDNNDYVAIKALRDGWKNVP----PSWAEGSDPCGDHWEGVGCNGSRVVSLT- 335
           +L  VAF    +  A+   +  +KN       SW   S+ C D W GV C   RV +L  
Sbjct: 19  YLFTVAFASTEEATALLKWKATFKNQNNSFLASWTTSSNACKD-WYGVVCLNGRVNTLNI 77

Query: 336 ------------------------LSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLP 443
                                   LS+ +++G +  +I  L+ L  LDL+ N+ ++G++P
Sbjct: 78  TNASVIGTLYAFPFSSLPFLENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQ-ISGTIP 136

Query: 444 REIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWL 623
            +IG+L KL  + +      G IP+ IG                G IP SLG ++ L +L
Sbjct: 137 PQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRSLTKLSLGINFLSGSIPASLGNMTNLSFL 196

Query: 624 DLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            L +NQL+G IP   G    L  L          N  SG IPA
Sbjct: 197 FLYENQLSGFIPEEIGYLRSLTKL------SLDINFLSGSIPA 233



 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 53/142 (37%), Positives = 64/142 (45%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L    L G +   +  L+ L  LDL YN  L+GS+P EIG L+ L  L L      G 
Sbjct: 268 LDLGENALNGSIPASLGNLNNLSRLDL-YNNKLSGSIPEEIGYLRSLTYLDLGENALNGS 326

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S+G                G IP  +G L  L +LDL +N L GSIP S GN   L 
Sbjct: 327 IPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNLS 386

Query: 690 MLVGTKHFHFGXNKFSGEIPAQ 755
            L          NK SG IP +
Sbjct: 387 RL------DLYNNKLSGSIPEE 402



 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 55/146 (37%), Positives = 68/146 (46%), Gaps = 3/146 (2%)
 Frame = +3

Query: 327 SLTLSSMD---LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           SLT  S+D   L+G +   +  L+ L  L L YN  L+GS+P EIG L+ L  L L    
Sbjct: 216 SLTKLSLDINFLSGSIPASLGNLNNLSFLYL-YNNQLSGSIPEEIGYLRSLTYLDLGENA 274

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
             G IP S+G                G IP  +G L  L +LDL +N L GSIP S GN 
Sbjct: 275 LNGSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNL 334

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIPAQ 755
             L  L          NK SG IP +
Sbjct: 335 NNLSRL------DLYNNKLSGSIPEE 354



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 61/157 (38%), Positives = 72/157 (45%), Gaps = 9/157 (5%)
 Frame = +3

Query: 309 NGSRVVSL----TLSSMDL-TGELSGDIEE----LSELQILDLSYNKDLTGSLPREIGNL 461
           NGS   SL     LS +DL   +LSG I E    L  L  LDL  N  L GS+P  +GNL
Sbjct: 324 NGSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENA-LNGSIPASLGNL 382

Query: 462 KKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQ 641
             L  L L      G IP+ IG                G IP SLG L+ L+ L L +NQ
Sbjct: 383 NNLSRLDLYNNKLSGSIPEEIGYLRSLTKLSLGNNFLSGSIPASLGNLNNLFMLYLYNNQ 442

Query: 642 LTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           L+GSIP   G    L  L      + G N  +G IPA
Sbjct: 443 LSGSIPEEIGYLSSLTNL------YLGNNSLNGLIPA 473



 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 52/142 (36%), Positives = 65/142 (45%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L    L G +   +  L+ L  LDL YN  L+GS+P EIG L+ L  L L      G 
Sbjct: 316 LDLGENALNGSIPASLGNLNNLSRLDL-YNNKLSGSIPEEIGYLRSLTYLDLGENALNGS 374

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S+G                G IP  +G L  L  L L +N L+GSIP S GN   L 
Sbjct: 375 IPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTKLSLGNNFLSGSIPASLGNLNNLF 434

Query: 690 MLVGTKHFHFGXNKFSGEIPAQ 755
           ML      +   N+ SG IP +
Sbjct: 435 ML------YLYNNQLSGSIPEE 450



 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 50/144 (34%), Positives = 67/144 (46%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +  L+L +  L+G +   +  L+ L +L L YN  L+GS+P EIG L  L NL L     
Sbjct: 409 LTKLSLGNNFLSGSIPASLGNLNNLFMLYL-YNNQLSGSIPEEIGYLSSLTNLYLGNNSL 467

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            GLIP S G               IG IP  +  L+ L  L +  N L G +P   GN  
Sbjct: 468 NGLIPASFGNMRNLQALFLNDNNLIGEIPSFVCNLTSLELLYMPRNNLKGKVPQCLGNIS 527

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPA 752
             D+LV         N FSGE+P+
Sbjct: 528 --DLLV----LSMSSNSFSGELPS 545



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 49/145 (33%), Positives = 64/145 (44%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +  L+L    L+G +   +  ++ L  L L Y   L+G +P EIG L+ L  L L     
Sbjct: 169 LTKLSLGINFLSGSIPASLGNMTNLSFLFL-YENQLSGFIPEEIGYLRSLTKLSLDINFL 227

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IP S+G                G IP  +G L  L +LDL +N L GSIP S GN  
Sbjct: 228 SGSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLN 287

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L  L          NK SG IP +
Sbjct: 288 NLSRL------DLYNNKLSGSIPEE 306



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 44/144 (30%), Positives = 65/144 (45%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S ++ L++SS   +GEL   I  L+ L+ILD   N +L G++P+  GN+  L    + 
Sbjct: 525 NISDLLVLSMSSNSFSGELPSSISNLTSLKILDFGRN-NLEGAIPQCFGNISSLQVFDMQ 583

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G +P +                    IP SL    +L  LDL DNQL  + P+  
Sbjct: 584 NNKLSGTLPTNFSIGCSLISLNLHGNELEDEIPWSLDNCKKLQVLDLGDNQLNDTFPMWL 643

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSG 740
           G  P L +L  T +   G  + SG
Sbjct: 644 GTLPELRVLRLTSNKLHGPIRSSG 667



 Score = 42.0 bits (97), Expect = 0.012
 Identities = 30/79 (37%), Positives = 37/79 (46%), Gaps = 1/79 (1%)
 Frame = +3

Query: 426 LTGSLPREIGNLKKLYNLI-LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQ 602
           +T  L  EI  +  LY +I L    F G IP  +G                G IP SLG 
Sbjct: 723 VTKGLELEIVRILSLYTVIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGS 782

Query: 603 LSELYWLDLADNQLTGSIP 659
           LS +  LDL+ NQL+G IP
Sbjct: 783 LSRVESLDLSFNQLSGEIP 801



>gb:OSJN00042_1693769 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0045P24, complete sequence.
          Length = 1343

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 48/147 (32%), Positives = 75/147 (51%)
 Frame = +3

Query: 309  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
            N S +V L LS+  LTG +   I  + +LQ+L+LS N  ++G++PR+IG+L+ L  LIL 
Sbjct: 949  NLSNLVWLDLSNNQLTGTIPESIMLMDKLQVLNLSGNI-MSGTIPRQIGHLRNLQTLILN 1007

Query: 489  GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
               F G++P+ +G                  IP SL  ++ L  +DL+ N L G++PV  
Sbjct: 1008 NNNFSGVLPNDLGNLSNLQYLVLSKNHMSSTIPASLFHMNSLITVDLSQNSLEGALPVDI 1067

Query: 669  GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            G    +D +          N+  G IP
Sbjct: 1068 GQLNHIDRI------DLSSNRLFGRIP 1088



 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 53/188 (28%), Positives = 82/188 (43%), Gaps = 2/188 (1%)
 Frame = +3

Query: 192 TDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG--SRVVSLTLSSMDLTGEL 365
           TD    +A KA     + V  +W   +  C  HW GV C+   +RVV+L L  + L G +
Sbjct: 41  TDVTALLAFKAQLADPRGVLSNWTTATSFC--HWFGVSCSRRRARVVALVLHDVPLQGSI 98

Query: 366 SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXX 545
           S  +  LS L +L+L+ +  LTG++P ++G L +L  L+                     
Sbjct: 99  SPHLGNLSFLTVLNLT-STGLTGAIPADLGKLHRLEVLVF-------------------- 137

Query: 546 XXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGX 725
                     G IPP +G L+ L  +D+  N ++G IP+       L  L    H  F  
Sbjct: 138 ----RRNSLSGVIPPVVGNLTRLEVVDMGHNSISGQIPLE------LQKLHNLTHIDFIT 187

Query: 726 NKFSGEIP 749
           N  +G +P
Sbjct: 188 NYLTGPLP 195



 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 42/147 (28%), Positives = 68/147 (46%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           C   +++S+  +S +  G +   + +L +L +LDL YN +L G +P  +GN+  L +L L
Sbjct: 301 CKYIQIISIGENSFE--GPVPTWLSKLPDLLLLDLGYN-NLIGQIPSALGNITNLVSLGL 357

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
             C   GLIP  +G              F G IP      SEL    +  N  TGS+P +
Sbjct: 358 QSCTLSGLIPQELGQLQQLNALYLDHNHFTGSIPTFFANFSELQVFLIGANSFTGSVPTA 417

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEI 746
            G++  ++       F+ G N   G +
Sbjct: 418 LGSSRSIEW------FNIGGNYQEGSL 438



 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 41/143 (28%), Positives = 61/143 (42%)
 Frame = +3

Query: 321  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
            +V L L S +L G +   +  LS L  L L  + +LTG +P+E+  L+K+  L L    F
Sbjct: 782  LVLLDLESNNLVGPIPSALGNLSNLDTLGLQ-SCNLTGQIPQELAQLRKIKGLFLDHNHF 840

Query: 501  FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
             G IP                  F G +P ++G    + W ++ DN L GS+        
Sbjct: 841  TGSIPTFFANFSELAVFLIGANSFTGAVPTAIGSTGSVEWFNIGDNYLQGSLDF----LA 896

Query: 681  GLDMLVGTKHFHFGXNKFSGEIP 749
             L          F  N F+GE+P
Sbjct: 897  TLSNCQNIWEVGFDLNYFTGELP 919



 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 42/115 (36%), Positives = 54/115 (46%), Gaps = 5/115 (4%)
 Frame = +3

Query: 366  SGDIEEL----SELQILDLSYNKDLTGSLP-REIGNLKKLYNLILVGCGFFGLIPDSIGX 530
            SG + EL    S+L++L L  N  L GS+P  +  NL  L  + L    F G IP  +  
Sbjct: 695  SGPVPELIFNMSKLEMLHLGGNGYLDGSIPGNKSFNLPMLQKICLYENRFMGQIPLGLAD 754

Query: 531  XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDML 695
                         F GP+P  LG+L +L  LDL  N L G IP + GN   LD L
Sbjct: 755  CKYLQWIFIGHNLFEGPVPAWLGKLPDLVLLDLESNNLVGPIPSALGNLSNLDTL 809



 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 45/149 (30%), Positives = 72/149 (48%), Gaps = 2/149 (1%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREI-GNLKKLYNLIL 485
           N +R+  + +    ++G++  ++++L  L  +D   N  LTG LP ++  N  KL  L  
Sbjct: 152 NLTRLEVVDMGHNSISGQIPLELQKLHNLTHIDFITNY-LTGPLPNDLFSNNSKLQYLDF 210

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADN-QLTGSIPV 662
                 G +P S+G              F GP+P ++  +S+L  L L  N  LTG+IP 
Sbjct: 211 GNNSLTGTLPYSVGSLGMLQHLDFQANHFSGPVPTTILNMSKLQILSLGGNWGLTGTIP- 269

Query: 663 SDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            + NT  L ML     F    N+F+G+IP
Sbjct: 270 GNNNTFNLPMLQMISLF---ANRFTGQIP 295



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 43/147 (29%), Positives = 62/147 (42%)
 Frame = +3

Query: 309  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
            N S +  L LS   ++  +   +  ++ L  +DLS N  L G+LP +IG L  +  + L 
Sbjct: 1021 NLSNLQYLVLSKNHMSSTIPASLFHMNSLITVDLSQNS-LEGALPVDIGQLNHIDRIDLS 1079

Query: 489  GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                FG IP+S G                G  P S  +L  L  LD++ N L+G+IP   
Sbjct: 1080 SNRLFGRIPESFGQFLMTTYLNLSHNSLNGSFPNSFDKLINLKSLDVSYNDLSGTIPQYL 1139

Query: 669  GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
             N   L  L      +   N   G IP
Sbjct: 1140 ANFTDLSSL------NLSFNNLHGPIP 1160



 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 40/121 (33%), Positives = 53/121 (43%), Gaps = 2/121 (1%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLP--REIGNLKKLYNLILVGCGFF 503
           L   +   +G +   I  +S+LQIL L  N  LTG++P      NL  L  + L    F 
Sbjct: 232 LDFQANHFSGPVPTTILNMSKLQILSLGGNWGLTGTIPGNNNTFNLPMLQMISLFANRFT 291

Query: 504 GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG 683
           G IP  +               F GP+P  L +L +L  LDL  N L G IP + GN   
Sbjct: 292 GQIPLGLANCKYIQIISIGENSFEGPVPTWLSKLPDLLLLDLGYNNLIGQIPSALGNITN 351

Query: 684 L 686
           L
Sbjct: 352 L 352



 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 47/170 (27%), Positives = 69/170 (40%), Gaps = 27/170 (15%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKL--YNL------- 479
           +L L     TG +       SELQ+  +  N   TGS+P  +G+ + +  +N+       
Sbjct: 378 ALYLDHNHFTGSIPTFFANFSELQVFLIGANS-FTGSVPTALGSSRSIEWFNIGGNYQEG 436

Query: 480 ------ILVGC-----------GFFGLIPDSIGXXXXXXXXXXXXXXFI-GPIPPSLGQL 605
                  L  C            F G +PD +G               + G +P +L  L
Sbjct: 437 SLDFLATLSNCQNIWEVGFDLNDFTGKLPDYVGNFSSTLINFFAEGNKLSGELPSTLSNL 496

Query: 606 SELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           S L WLD+++NQLTG+IP S      L +L      +   N  SG IP Q
Sbjct: 497 SNLVWLDISNNQLTGTIPESIKLMDKLQLL------NLSGNSLSGSIPRQ 540



 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 51/199 (25%), Positives = 78/199 (39%), Gaps = 50/199 (25%)
 Frame = +3

Query: 309  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYN----------------------- 419
            N S + +L L S +LTG++  ++ +L +++ L L +N                       
Sbjct: 802  NLSNLDTLGLQSCNLTGQIPQELAQLRKIKGLFLDHNHFTGSIPTFFANFSELAVFLIGA 861

Query: 420  KDLTGSLPREIGN-----------------------LKKLYNLILVGCG---FFGLIPDS 521
               TG++P  IG+                       L    N+  VG     F G +P+ 
Sbjct: 862  NSFTGAVPTAIGSTGSVEWFNIGDNYLQGSLDFLATLSNCQNIWEVGFDLNYFTGELPNY 921

Query: 522  IGXXXXXXXXXXXXXXFI-GPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLV 698
            +G               + G +P +L  LS L WLDL++NQLTG+IP S      L +L 
Sbjct: 922  VGNFSSTLINFFAVGNRLSGDLPSTLLNLSNLVWLDLSNNQLTGTIPESIMLMDKLQVL- 980

Query: 699  GTKHFHFGXNKFSGEIPAQ 755
                 +   N  SG IP Q
Sbjct: 981  -----NLSGNIMSGTIPRQ 994



 Score = 45.4 bits (106), Expect = 0.001
 Identities = 27/59 (45%), Positives = 39/59 (66%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           N S +V L +S+  LTG +   I+ + +LQ+L+LS N  L+GS+PR+IG L  L  LIL
Sbjct: 495 NLSNLVWLDISNNQLTGTIPESIKLMDKLQLLNLSGNS-LSGSIPRQIGQLWNLQTLIL 552



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 37/118 (31%), Positives = 50/118 (42%), Gaps = 21/118 (17%)
 Frame = +3

Query: 237 WKNVPPSWAEGS-------DPCGDHWEG--------------VGCNGSRVVSLTLSSMDL 353
           W N+  ++ EGS         C + WE               VG   S +++       L
Sbjct: 426 WFNIGGNYQEGSLDFLATLSNCQNIWEVGFDLNDFTGKLPDYVGNFSSTLINFFAEGNKL 485

Query: 354 TGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG 527
           +GEL   +  LS L  LD+S N  LTG++P  I  + KL  L L G    G IP  IG
Sbjct: 486 SGELPSTLSNLSNLVWLDIS-NNQLTGTIPESIKLMDKLQLLNLSGNSLSGSIPRQIG 542



 Score = 42.7 bits (99), Expect = 0.007
 Identities = 33/112 (29%), Positives = 43/112 (38%)
 Frame = +3

Query: 414  YNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPS 593
            Y     G +P  + + K L  + +    F G +P  +G               +GPIP +
Sbjct: 740  YENRFMGQIPLGLADCKYLQWIFIGHNLFEGPVPAWLGKLPDLVLLDLESNNLVGPIPSA 799

Query: 594  LGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            LG LS L  L L    LTG IP        L  L   K      N F+G IP
Sbjct: 800  LGNLSNLDTLGLQSCNLTGQIPQE------LAQLRKIKGLFLDHNHFTGSIP 845



 Score = 41.2 bits (95), Expect = 0.020
 Identities = 35/117 (29%), Positives = 51/117 (43%), Gaps = 2/117 (1%)
 Frame = +3

Query: 405 DLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIP-DSIGXXXXXXXXXXXXXXFIGP 581
           ++ YN  L+G +PRE+ NL+ L  + L+     G +P D                   G 
Sbjct: 615 NVGYNS-LSGQIPRELQNLRNLRYIDLLVNYLTGPLPNDLFNNTPKLKYLNFRNNSLSGT 673

Query: 582 IPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKF-SGEIP 749
           IP  +G L  L  L++A N  +G +P    N   L+ML      H G N +  G IP
Sbjct: 674 IPVGIGTLPILQHLEIAYNHFSGPVPELIFNMSKLEML------HLGGNGYLDGSIP 724



>gb:AY603423_1617458 Pyrus pyrifolia isolate Kinchaku leucine-rich
           repeat receptor-like protein kinase mRNA, partial cds.
          Length = 987

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 44/122 (36%), Positives = 61/122 (50%)
 Frame = +3

Query: 384 LSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXX 563
           +S L++L+LSYN    G +P E+GNL  L  L L  C   G IPDS+G            
Sbjct: 176 ISTLKMLNLSYNPFHPGRIPAELGNLTNLEVLWLTECNLVGEIPDSLGRLKNLKDLDLAI 235

Query: 564 XXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGE 743
               G IPPSL +L+ +  ++L +N LTG +P      PG+  L   +      N+ SG 
Sbjct: 236 NGLTGRIPPSLSELTSVVQIELYNNSLTGELP------PGMSKLTRLRLLDASMNQLSGP 289

Query: 744 IP 749
           IP
Sbjct: 290 IP 291



 Score = 73.2 bits (178), Expect = 5e-12
 Identities = 52/145 (35%), Positives = 76/145 (52%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           VV + L +  LTGEL   + +L+ L++LD S N+ L+G +P E+  L  L +L L    F
Sbjct: 252 VVQIELYNNSLTGELPPGMSKLTRLRLLDASMNQ-LSGPIPDELCRLP-LESLNLYENNF 309

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G +P SI                 G +P +LG+ S L WLD++ NQ TG+IP S     
Sbjct: 310 EGSVPASIANSPHLYELRLFRNRLTGELPQNLGKNSPLKWLDVSSNQFTGTIPASLCEKR 369

Query: 681 GLDMLVGTKHFHFGXNKFSGEIPAQ 755
            ++ L+         N+FSGEIPA+
Sbjct: 370 QMEELL------MIHNEFSGEIPAR 388



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 37/133 (27%), Positives = 64/133 (48%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           L+GE+      L  + +++L  N +L+G++ + I     L  LI+    F+G IP+ IG 
Sbjct: 405 LSGEVPVGFWGLPRVYLMELVEN-ELSGTIAKTIAGATNLTLLIVAKNKFWGQIPEEIGW 463

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH 710
                        F GP+P S+ +L +L  LDL  N+++G +P+      G+        
Sbjct: 464 VENLMEFSGGENKFSGPLPESIVRLGQLGTLDLHSNEISGELPI------GIQSWTKLNE 517

Query: 711 FHFGXNKFSGEIP 749
            +   N+ SG+IP
Sbjct: 518 LNLASNQLSGKIP 530



 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 53/174 (30%), Positives = 73/174 (41%), Gaps = 7/174 (4%)
 Frame = +3

Query: 255 SWAEG-SDPCGDHWEGVGCNGSR-----VVSLTLSSMDLTGELSGDIEELSELQILDLSY 416
           SW +  S PC  +W GV C+ +      V SL L S +L G     +  L  L  L L Y
Sbjct: 33  SWNDADSTPC--NWLGVECDDASSSSPVVRSLDLPSANLAGPFPTVLCRLPNLTHLSL-Y 89

Query: 417 NKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSL 596
           N  +  +LP  +   + L +L L      G +P ++               F GPIP S 
Sbjct: 90  NNSINSTLPPSLSTCQNLEHLDLSQNLLTGGLPATLSDVPNLKYLDLTGNNFSGPIPDSF 149

Query: 597 GQLSELYWLDLADNQLTGSIPVSDGNTPGLDML-VGTKHFHFGXNKFSGEIPAQ 755
           G+  +L  L L  N +  +IP   GN   L ML +    FH       G IPA+
Sbjct: 150 GRFQKLEVLSLVYNLIESTIPPFLGNISTLKMLNLSYNPFH------PGRIPAE 197



 Score = 45.4 bits (106), Expect = 0.001
 Identities = 36/118 (30%), Positives = 48/118 (40%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           SL L   +  G +   I     L  L L  N+ LTG LP+ +G    L  L +    F G
Sbjct: 301 SLNLYENNFEGSVPASIANSPHLYELRLFRNR-LTGELPQNLGKNSPLKWLDVSSNQFTG 359

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            IP S+               F G IP  LG+   L  + L  N+L+G +PV     P
Sbjct: 360 TIPASLCEKRQMEELLMIHNEFSGEIPARLGECQSLTRVRLGHNRLSGEVPVGFWGLP 417



>gb:AY048200_1561662 Arabidopsis thaliana At1g71830/F14O23_24 mRNA,
           complete cds.>gb:BT002217_1635820 Arabidopsis thaliana
           At1g71830/F14O23_24 mRNA, complete cds.
          Length = 625

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 50/141 (35%), Positives = 74/141 (52%), Gaps = 2/141 (1%)
 Frame = +3

Query: 243 NVPPSWAEGS-DPCGDHWEGVGCNGSR-VVSLTLSSMDLTGELSGDIEELSELQILDLSY 416
           NV  SW     +PC   W  V CN    V+ + L + +L+G L  ++  L  LQ L+L Y
Sbjct: 45  NVLQSWDPRLVNPCT--WFHVTCNNENSVIRVDLGNAELSGHLVPELGVLKNLQYLEL-Y 101

Query: 417 NKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSL 596
           + ++TG +P  +GNL  L +L L    F G IP+S+G                G IP SL
Sbjct: 102 SNNITGPIPSNLGNLTNLVSLDLYLNSFSGPIPESLGKLSKLRFLRLNNNSLTGSIPMSL 161

Query: 597 GQLSELYWLDLADNQLTGSIP 659
             ++ L  LDL++N+L+GS+P
Sbjct: 162 TNITTLQVLDLSNNRLSGSVP 182



 Score = 37.0 bits (84), Expect = 0.39
 Identities = 24/71 (33%), Positives = 38/71 (53%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + +VSL L     +G +   + +LS+L+ L L+ N  LTGS+P  + N+  L  L L 
Sbjct: 115 NLTNLVSLDLYLNSFSGPIPESLGKLSKLRFLRLN-NNSLTGSIPMSLTNITTLQVLDLS 173

Query: 489 GCGFFGLIPDS 521
                G +PD+
Sbjct: 174 NNRLSGSVPDN 184



>gb:AC026815_1539693 Oryza sativa chromosome 10 BAC OSJNBa0079L16
           genomic sequence, complete sequence.
          Length = 1172

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 46/134 (34%), Positives = 65/134 (48%)
 Frame = +3

Query: 348 DLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG 527
           +L G +  ++ EL  L  LDLS N  LTG +P  +GNLK+L  L L      G+IP  IG
Sbjct: 412 NLNGSIPAELGELENLVELDLSVNS-LTGPIPSSLGNLKQLIKLALFFNNLTGVIPPEIG 470

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTK 707
                           G +P ++  L  L +L + DN ++G+IP      P L   +  +
Sbjct: 471 NMTALQSFDVNTNILHGELPATITALKNLQYLAVFDNFMSGTIP------PDLGKGIALQ 524

Query: 708 HFHFGXNKFSGEIP 749
           H  F  N FSGE+P
Sbjct: 525 HVSFSNNSFSGELP 538



 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 53/144 (36%), Positives = 74/144 (51%), Gaps = 3/144 (2%)
 Frame = +3

Query: 327  SLTLSSMD---LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
            +LTL SMD   ++G +      ++ LQIL L+ N +LTG +P ++G+L  L+NL L    
Sbjct: 618  NLTLLSMDGNRISGRIPEAFGSMTRLQILSLAGN-NLTGGIPLDLGHLNLLFNLNLSHNS 676

Query: 498  FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
            F G IP S+G                G IP +LG+L  L +LDL+ N+L+G IP   GN 
Sbjct: 677  FSGPIPTSLGNNSKLQKIDMSGNMLNGTIPVALGKLGALTFLDLSKNRLSGKIPRELGNL 736

Query: 678  PGLDMLVGTKHFHFGXNKFSGEIP 749
              L  L+         N  SG IP
Sbjct: 737  VQLQTLL-----DLSSNFLSGWIP 755



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 47/143 (32%), Positives = 61/143 (42%), Gaps = 4/143 (2%)
 Frame = +3

Query: 336 LSSMDLTGELSGDI----EELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF 503
           LS+ ++TGE+   +     EL   ++     N   TG +P E+G  +KL  L L      
Sbjct: 359 LSTTNVTGEIPPALFTSWPELISFEV----QNNSFTGKIPSELGKARKLEILYLFLNNLN 414

Query: 504 GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG 683
           G IP  +G                GPIP SLG L +L  L L  N LTG IP   GN   
Sbjct: 415 GSIPAELGELENLVELDLSVNSLTGPIPSSLGNLKQLIKLALFFNNLTGVIPPEIGNMTA 474

Query: 684 LDMLVGTKHFHFGXNKFSGEIPA 752
           L      + F    N   GE+PA
Sbjct: 475 L------QSFDVNTNILHGELPA 491



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 50/139 (35%), Positives = 58/139 (41%), Gaps = 25/139 (17%)
 Frame = +3

Query: 330  LTLSSMDLTGELSGDIEELSELQILDLSYN------------------------KDLTGS 437
            L LS+  LTG+L   +  L  LQ LDLS N                         D TG 
Sbjct: 768  LILSNNQLTGKLPDCLWYLQNLQFLDLSNNAFSGEIPAAKASYSCSLISIHLSSNDFTGV 827

Query: 438  LPREIGNLKKLYNLILVGCGFFGLIPDSIGXXX-XXXXXXXXXXXFIGPIPPSLGQLSEL 614
             P  +   KKL NL +    FFG IP  IG               F G IP  L QLS+L
Sbjct: 828  FPSALEGCKKLINLDIGNNNFFGDIPIWIGKGLPSLKILSLKSNNFSGEIPSELSQLSQL 887

Query: 615  YWLDLADNQLTGSIPVSDG 671
              LD+ +N LTG IP S G
Sbjct: 888  QLLDMTNNGLTGLIPRSFG 906



 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 50/167 (29%), Positives = 70/167 (41%), Gaps = 18/167 (10%)
 Frame = +3

Query: 309  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
            N + +  + L     TG++S        L+ LD+S NK LTG L  + G    L  L + 
Sbjct: 567  NCTGLFRVRLEENHFTGDISEAFGVHPSLEYLDISGNK-LTGELSSDWGQCTNLTLLSMD 625

Query: 489  GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
            G    G IP++ G                G IP  LG L+ L+ L+L+ N  +G IP S 
Sbjct: 626  GNRISGRIPEAFGSMTRLQILSLAGNNLTGGIPLDLGHLNLLFNLNLSHNSFSGPIPTSL 685

Query: 669  GNTPGL-------DMLVGTKHFHFG-----------XNKFSGEIPAQ 755
            GN   L       +ML GT     G            N+ SG+IP +
Sbjct: 686  GNNSKLQKIDMSGNMLNGTIPVALGKLGALTFLDLSKNRLSGKIPRE 732



 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 40/140 (28%), Positives = 64/140 (45%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS    +G +   +  L++LQ L ++ N +LTG +P  +G++ +L  L L      G 
Sbjct: 237 LNLSFNAFSGPIPASLGRLTKLQDLRMAGN-NLTGGVPEFLGSMAQLRILELGDNQLGGP 295

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP  +G               +  +PP LG L+ L +LDL+ NQ +G +P      P   
Sbjct: 296 IPSVLGQLQMLQRLDIKNASLVSTLPPQLGNLNNLAYLDLSLNQFSGGLP------PTFA 349

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
            +   + F       +GEIP
Sbjct: 350 GMRAMQEFGLSTTNVTGEIP 369



 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 58/206 (28%), Positives = 73/206 (35%), Gaps = 41/206 (19%)
 Frame = +3

Query: 258 WAEGSDPCGDHWEGVGCNGS-RVVSLTLSSMDLTGELSG-DIEELSELQILDLSYNKDLT 431
           W   +  C   W GV C+ + RV SL L    L+G L   D   L  L  LDL+ N + T
Sbjct: 48  WTRAAPVCT--WRGVACDAAGRVTSLRLRDAGLSGGLDTLDFAALPALTELDLNRN-NFT 104

Query: 432 GSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSE 611
           G +P  I  L+ L  L L      G IP  +G               +G IP  L +L  
Sbjct: 105 GPIPASISRLRSLSLLDLGSNWLDGSIPPQLGDLSGLVELRLYNNNLVGAIPHQLSRLPN 164

Query: 612 LYWLDLADNQLT----------------------------------GSIPVSDGNTPGL- 686
           +   DL  N LT                                  GSI   D +   L 
Sbjct: 165 IVHFDLGANYLTDHDFRKFSPMPTVTFMSLYLNSFNGSFPEFVLRSGSITYLDLSQNALF 224

Query: 687 ----DMLVGTKHFHFGXNKFSGEIPA 752
               DML   +  +   N FSG IPA
Sbjct: 225 GPIPDMLPNLRFLNLSFNAFSGPIPA 250



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 50/196 (25%), Positives = 79/196 (40%), Gaps = 47/196 (23%)
 Frame = +3

Query: 309  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
            N S++  + +S   L G +   + +L  L  LDLS N+ L+G +PRE+GNL +L  L+ +
Sbjct: 687  NNSKLQKIDMSGNMLNGTIPVALGKLGALTFLDLSKNR-LSGKIPRELGNLVQLQTLLDL 745

Query: 489  GCGFF-GLIPDS-IGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPV 662
               F  G IP +                   G +P  L  L  L +LDL++N  +G IP 
Sbjct: 746  SSNFLSGWIPQAAFCKLLSLQILILSNNQLTGKLPDCLWYLQNLQFLDLSNNAFSGEIPA 805

Query: 663  S--------------------------DGNTPGLDMLVGTKHFHFG-------------- 722
            +                          +G    +++ +G  +F FG              
Sbjct: 806  AKASYSCSLISIHLSSNDFTGVFPSALEGCKKLINLDIGNNNF-FGDIPIWIGKGLPSLK 864

Query: 723  -----XNKFSGEIPAQ 755
                  N FSGEIP++
Sbjct: 865  ILSLKSNNFSGEIPSE 880



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 47/196 (23%), Positives = 73/196 (37%), Gaps = 44/196 (22%)
 Frame = +3

Query: 291  WEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKL 470
            W G G    +++SL   S + +GE+  ++ +LS+LQ+LD++ N  LTG +PR  G L  +
Sbjct: 855  WIGKGLPSLKILSL--KSNNFSGEIPSELSQLSQLQLLDMT-NNGLTGLIPRSFGKLTSM 911

Query: 471  YN--------------------------------------------LILVGCGFFGLIPD 518
             N                                            + L G      IPD
Sbjct: 912  KNPKLISSRELLQWSFNHDRINTIWKGKEQIFEIKTYAIDIQLVTGISLSGNSLSQCIPD 971

Query: 519  SIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLV 698
             +                   IP ++G L  L  LDL+ N+L+G+IP      P L  + 
Sbjct: 972  ELMNLQGLQFLNLSRNYLSRSIPENIGSLKNLESLDLSSNELSGAIP------PSLAGIS 1025

Query: 699  GTKHFHFGXNKFSGEI 746
                 +   N  SG+I
Sbjct: 1026 TLSSLNLSNNHLSGKI 1041



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 42/143 (29%), Positives = 60/143 (41%), Gaps = 1/143 (0%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L    L G +   + +L  LQ LD+  N  L  +LP ++GNL  L  L L    F G 
Sbjct: 285 LELGDNQLGGPIPSVLGQLQMLQRLDIK-NASLVSTLPPQLGNLNNLAYLDLSLNQFSGG 343

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSL-GQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
           +P +                  G IPP+L     EL   ++ +N  TG IP   G    L
Sbjct: 344 LPPTFAGMRAMQEFGLSTTNVTGEIPPALFTSWPELISFEVQNNSFTGKIPSELGKARKL 403

Query: 687 DMLVGTKHFHFGXNKFSGEIPAQ 755
           ++L      +   N  +G IPA+
Sbjct: 404 EIL------YLFLNNLNGSIPAE 420



 Score = 43.1 bits (100), Expect = 0.005
 Identities = 38/118 (32%), Positives = 54/118 (45%)
 Frame = +3

Query: 321  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
            V  ++LS   L+  +  ++  L  LQ L+LS N  L+ S+P  IG+LK L +L L     
Sbjct: 955  VTGISLSGNSLSQCIPDELMNLQGLQFLNLSRNY-LSRSIPENIGSLKNLESLDL----- 1008

Query: 501  FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
                                     G IPPSL  +S L  L+L++N L+G I  S GN
Sbjct: 1009 -------------------SSNELSGAIPPSLAGISTLSSLNLSNNHLSGKI--STGN 1045



>gb:A67827_1450282 Sequence 32 from Patent
           WO9743427.>gb:CQ768543_1451789 Sequence 38 from Patent
           WO2004007712.>gb:AX120037_1461704 Sequence 20 from
           Patent WO0129240.>gb:AX138071_1462207 Sequence 17 from
           Patent EP1094113.
          Length = 625

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 50/141 (35%), Positives = 74/141 (52%), Gaps = 2/141 (1%)
 Frame = +3

Query: 243 NVPPSWAEGS-DPCGDHWEGVGCNGSR-VVSLTLSSMDLTGELSGDIEELSELQILDLSY 416
           NV  SW     +PC   W  V CN    V+ + L + +L+G L  ++  L  LQ L+L Y
Sbjct: 45  NVLQSWDPTLVNPCT--WFHVTCNNENSVIRVDLGNAELSGHLVPELGVLKNLQYLEL-Y 101

Query: 417 NKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSL 596
           + ++TG +P  +GNL  L +L L    F G IP+S+G                G IP SL
Sbjct: 102 SNNITGPIPSNLGNLTNLVSLDLYLNSFSGPIPESLGKLSKLRFLRLNNNSLTGSIPMSL 161

Query: 597 GQLSELYWLDLADNQLTGSIP 659
             ++ L  LDL++N+L+GS+P
Sbjct: 162 TNITTLQVLDLSNNRLSGSVP 182



 Score = 37.0 bits (84), Expect = 0.39
 Identities = 24/71 (33%), Positives = 38/71 (53%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + +VSL L     +G +   + +LS+L+ L L+ N  LTGS+P  + N+  L  L L 
Sbjct: 115 NLTNLVSLDLYLNSFSGPIPESLGKLSKLRFLRLN-NNSLTGSIPMSLTNITTLQVLDLS 173

Query: 489 GCGFFGLIPDS 521
                G +PD+
Sbjct: 174 NNRLSGSVPDN 184



>gb:A67825_1450281 Sequence 30 from Patent WO9743427.
          Length = 218

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 44/132 (33%), Positives = 71/132 (53%), Gaps = 1/132 (0%)
 Frame = +3

Query: 273 DPCGDHWEGVGCN-GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPRE 449
           +PC   W  V CN  +RV  + L + +L+G L+ ++ +L  LQ L+L Y  ++ G++P E
Sbjct: 57  NPCT--WFHVTCNQDNRVTRVDLGNSNLSGHLAPELGKLEHLQYLEL-YKNNIQGTIPSE 113

Query: 450 IGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDL 629
           +GNLK L +L L      G++P S+G                GPIP +L  +  L  +D+
Sbjct: 114 LGNLKNLISLDLYNNNLTGIVPTSLGKLKSLVFLRLNDNRLTGPIPRALTAIPSLKVVDV 173

Query: 630 ADNQLTGSIPVS 665
           + N L G+IP +
Sbjct: 174 SSNDLCGTIPTN 185



>gb:A67821_1450279 Sequence 26 from Patent WO9743427.
          Length = 220

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 44/132 (33%), Positives = 71/132 (53%), Gaps = 1/132 (0%)
 Frame = +3

Query: 273 DPCGDHWEGVGCN-GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPRE 449
           +PC   W  V CN  +RV  + L + +L+G L+ ++ +L  LQ L+L Y  ++ G++P E
Sbjct: 59  NPCT--WFHVTCNQDNRVTRVDLGNSNLSGHLAPELGKLEHLQYLEL-YKNNIQGTIPSE 115

Query: 450 IGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDL 629
           +GNLK L +L L      G++P S+G                GPIP +L  +  L  +D+
Sbjct: 116 LGNLKNLISLDLYNNNLTGIVPTSLGKLKSLVFLRLNDNRLTGPIPRALTAIPSLKVVDV 175

Query: 630 ADNQLTGSIPVS 665
           + N L G+IP +
Sbjct: 176 SSNDLCGTIPTN 187



>gb:A67819_1450278 Sequence 24 from Patent
           WO9743427.>gb:AY081542_1568802 Arabidopsis thaliana
           unknown protein mRNA, complete cds.>gb:BT002517_1636120
           Arabidopsis thaliana Unknown protein (At5g21090) mRNA,
           complete cds.>gb:BT006268_1639160 Arabidopsis thaliana
           At5g21090 mRNA, complete cds.>gb:AC140977_1744082
           Arabidopsis thaliana chromosome 5 BAC F13M11 genomic
           sequence, complete sequence.>gb:AF324989_1786443
           Arabidopsis thaliana AT5g21090 (AT5g21090/T10F18_120)
           mRNA, complete cds.>gb:AF370543_1792328 Arabidopsis
           thaliana Unknown protein mRNA, complete cds.
          Length = 218

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 44/132 (33%), Positives = 71/132 (53%), Gaps = 1/132 (0%)
 Frame = +3

Query: 273 DPCGDHWEGVGCN-GSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPRE 449
           +PC   W  V CN  +RV  + L + +L+G L+ ++ +L  LQ L+L Y  ++ G++P E
Sbjct: 57  NPCT--WFHVTCNQDNRVTRVDLGNSNLSGHLAPELGKLEHLQYLEL-YKNNIQGTIPSE 113

Query: 450 IGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDL 629
           +GNLK L +L L      G++P S+G                GPIP +L  +  L  +D+
Sbjct: 114 LGNLKNLISLDLYNNNLTGIVPTSLGKLKSLVFLRLNDNRLTGPIPRALTAIPSLKVVDV 173

Query: 630 ADNQLTGSIPVS 665
           + N L G+IP +
Sbjct: 174 SSNDLCGTIPTN 185



>gb:AE016959_1023026 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017103_1752845
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 57 of 77 of the complete sequence.
          Length = 1175

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 46/134 (34%), Positives = 65/134 (48%)
 Frame = +3

Query: 348 DLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG 527
           +L G +  ++ EL  L  LDLS N  LTG +P  +GNLK+L  L L      G+IP  IG
Sbjct: 412 NLNGSIPAELGELENLVELDLSVNS-LTGPIPSSLGNLKQLIKLALFFNNLTGVIPPEIG 470

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTK 707
                           G +P ++  L  L +L + DN ++G+IP      P L   +  +
Sbjct: 471 NMTALQSFDVNTNILHGELPATITALKNLQYLAVFDNFMSGTIP------PDLGKGIALQ 524

Query: 708 HFHFGXNKFSGEIP 749
           H  F  N FSGE+P
Sbjct: 525 HVSFSNNSFSGELP 538



 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 53/144 (36%), Positives = 74/144 (51%), Gaps = 3/144 (2%)
 Frame = +3

Query: 327  SLTLSSMD---LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
            +LTL SMD   ++G +      ++ LQIL L+ N +LTG +P ++G+L  L+NL L    
Sbjct: 618  NLTLLSMDGNRISGRIPEAFGSMTRLQILSLAGN-NLTGGIPLDLGHLNLLFNLNLSHNS 676

Query: 498  FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
            F G IP S+G                G IP +LG+L  L +LDL+ N+L+G IP   GN 
Sbjct: 677  FSGPIPTSLGNNSKLQKIDMSGNMLNGTIPVALGKLGALTFLDLSKNRLSGKIPRELGNL 736

Query: 678  PGLDMLVGTKHFHFGXNKFSGEIP 749
              L  L+         N  SG IP
Sbjct: 737  VQLQTLL-----DLSSNFLSGWIP 755



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 47/143 (32%), Positives = 61/143 (42%), Gaps = 4/143 (2%)
 Frame = +3

Query: 336 LSSMDLTGELSGDI----EELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF 503
           LS+ ++TGE+   +     EL   ++     N   TG +P E+G  +KL  L L      
Sbjct: 359 LSTTNVTGEIPPALFTSWPELISFEV----QNNSFTGKIPSELGKARKLEILYLFLNNLN 414

Query: 504 GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG 683
           G IP  +G                GPIP SLG L +L  L L  N LTG IP   GN   
Sbjct: 415 GSIPAELGELENLVELDLSVNSLTGPIPSSLGNLKQLIKLALFFNNLTGVIPPEIGNMTA 474

Query: 684 LDMLVGTKHFHFGXNKFSGEIPA 752
           L      + F    N   GE+PA
Sbjct: 475 L------QSFDVNTNILHGELPA 491



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 50/139 (35%), Positives = 58/139 (41%), Gaps = 25/139 (17%)
 Frame = +3

Query: 330  LTLSSMDLTGELSGDIEELSELQILDLSYN------------------------KDLTGS 437
            L LS+  LTG+L   +  L  LQ LDLS N                         D TG 
Sbjct: 768  LILSNNQLTGKLPDCLWYLQNLQFLDLSNNAFSGEIPAAKASYSCSLISIHLSSNDFTGV 827

Query: 438  LPREIGNLKKLYNLILVGCGFFGLIPDSIGXXX-XXXXXXXXXXXFIGPIPPSLGQLSEL 614
             P  +   KKL NL +    FFG IP  IG               F G IP  L QLS+L
Sbjct: 828  FPSALEGCKKLINLDIGNNNFFGDIPIWIGKGLPSLKILSLKSNNFSGEIPSELSQLSQL 887

Query: 615  YWLDLADNQLTGSIPVSDG 671
              LD+ +N LTG IP S G
Sbjct: 888  QLLDMTNNGLTGLIPRSFG 906



 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 50/167 (29%), Positives = 70/167 (41%), Gaps = 18/167 (10%)
 Frame = +3

Query: 309  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
            N + +  + L     TG++S        L+ LD+S NK LTG L  + G    L  L + 
Sbjct: 567  NCTGLFRVRLEENHFTGDISEAFGVHPSLEYLDISGNK-LTGELSSDWGQCTNLTLLSMD 625

Query: 489  GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
            G    G IP++ G                G IP  LG L+ L+ L+L+ N  +G IP S 
Sbjct: 626  GNRISGRIPEAFGSMTRLQILSLAGNNLTGGIPLDLGHLNLLFNLNLSHNSFSGPIPTSL 685

Query: 669  GNTPGL-------DMLVGTKHFHFG-----------XNKFSGEIPAQ 755
            GN   L       +ML GT     G            N+ SG+IP +
Sbjct: 686  GNNSKLQKIDMSGNMLNGTIPVALGKLGALTFLDLSKNRLSGKIPRE 732



 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 40/140 (28%), Positives = 64/140 (45%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS    +G +   +  L++LQ L ++ N +LTG +P  +G++ +L  L L      G 
Sbjct: 237 LNLSFNAFSGPIPASLGRLTKLQDLRMAGN-NLTGGVPEFLGSMAQLRILELGDNQLGGP 295

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP  +G               +  +PP LG L+ L +LDL+ NQ +G +P      P   
Sbjct: 296 IPSVLGQLQMLQRLDIKNASLVSTLPPQLGNLNNLAYLDLSLNQFSGGLP------PTFA 349

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
            +   + F       +GEIP
Sbjct: 350 GMRAMQEFGLSTTNVTGEIP 369



 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 58/206 (28%), Positives = 73/206 (35%), Gaps = 41/206 (19%)
 Frame = +3

Query: 258 WAEGSDPCGDHWEGVGCNGS-RVVSLTLSSMDLTGELSG-DIEELSELQILDLSYNKDLT 431
           W   +  C   W GV C+ + RV SL L    L+G L   D   L  L  LDL+ N + T
Sbjct: 48  WTRAAPVCT--WRGVACDAAGRVTSLRLRDAGLSGGLDTLDFAALPALTELDLNRN-NFT 104

Query: 432 GSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSE 611
           G +P  I  L+ L  L L      G IP  +G               +G IP  L +L  
Sbjct: 105 GPIPASISRLRSLSLLDLGSNWLDGSIPPQLGDLSGLVELRLYNNNLVGAIPHQLSRLPN 164

Query: 612 LYWLDLADNQLT----------------------------------GSIPVSDGNTPGL- 686
           +   DL  N LT                                  GSI   D +   L 
Sbjct: 165 IVHFDLGANYLTDHDFRKFSPMPTVTFMSLYLNSFNGSFPEFVLRSGSITYLDLSQNALF 224

Query: 687 ----DMLVGTKHFHFGXNKFSGEIPA 752
               DML   +  +   N FSG IPA
Sbjct: 225 GPIPDMLPNLRFLNLSFNAFSGPIPA 250



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 50/196 (25%), Positives = 79/196 (40%), Gaps = 47/196 (23%)
 Frame = +3

Query: 309  NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
            N S++  + +S   L G +   + +L  L  LDLS N+ L+G +PRE+GNL +L  L+ +
Sbjct: 687  NNSKLQKIDMSGNMLNGTIPVALGKLGALTFLDLSKNR-LSGKIPRELGNLVQLQTLLDL 745

Query: 489  GCGFF-GLIPDS-IGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPV 662
               F  G IP +                   G +P  L  L  L +LDL++N  +G IP 
Sbjct: 746  SSNFLSGWIPQAAFCKLLSLQILILSNNQLTGKLPDCLWYLQNLQFLDLSNNAFSGEIPA 805

Query: 663  S--------------------------DGNTPGLDMLVGTKHFHFG-------------- 722
            +                          +G    +++ +G  +F FG              
Sbjct: 806  AKASYSCSLISIHLSSNDFTGVFPSALEGCKKLINLDIGNNNF-FGDIPIWIGKGLPSLK 864

Query: 723  -----XNKFSGEIPAQ 755
                  N FSGEIP++
Sbjct: 865  ILSLKSNNFSGEIPSE 880



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 47/196 (23%), Positives = 73/196 (37%), Gaps = 44/196 (22%)
 Frame = +3

Query: 291  WEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKL 470
            W G G    +++SL   S + +GE+  ++ +LS+LQ+LD++ N  LTG +PR  G L  +
Sbjct: 855  WIGKGLPSLKILSL--KSNNFSGEIPSELSQLSQLQLLDMT-NNGLTGLIPRSFGKLTSM 911

Query: 471  YN--------------------------------------------LILVGCGFFGLIPD 518
             N                                            + L G      IPD
Sbjct: 912  KNPKLISSRELLQWSFNHDRINTIWKGKEQIFEIKTYAIDIQLVTGISLSGNSLSQCIPD 971

Query: 519  SIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLV 698
             +                   IP ++G L  L  LDL+ N+L+G+IP      P L  + 
Sbjct: 972  ELMNLQGLQFLNLSRNYLSRSIPENIGSLKNLESLDLSSNELSGAIP------PSLAGIS 1025

Query: 699  GTKHFHFGXNKFSGEI 746
                 +   N  SG+I
Sbjct: 1026 TLSSLNLSNNHLSGKI 1041



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 42/143 (29%), Positives = 60/143 (41%), Gaps = 1/143 (0%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L    L G +   + +L  LQ LD+  N  L  +LP ++GNL  L  L L    F G 
Sbjct: 285 LELGDNQLGGPIPSVLGQLQMLQRLDIK-NASLVSTLPPQLGNLNNLAYLDLSLNQFSGG 343

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSL-GQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
           +P +                  G IPP+L     EL   ++ +N  TG IP   G    L
Sbjct: 344 LPPTFAGMRAMQEFGLSTTNVTGEIPPALFTSWPELISFEVQNNSFTGKIPSELGKARKL 403

Query: 687 DMLVGTKHFHFGXNKFSGEIPAQ 755
           ++L      +   N  +G IPA+
Sbjct: 404 EIL------YLFLNNLNGSIPAE 420



 Score = 43.1 bits (100), Expect = 0.005
 Identities = 38/118 (32%), Positives = 54/118 (45%)
 Frame = +3

Query: 321  VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
            V  ++LS   L+  +  ++  L  LQ L+LS N  L+ S+P  IG+LK L +L L     
Sbjct: 955  VTGISLSGNSLSQCIPDELMNLQGLQFLNLSRNY-LSRSIPENIGSLKNLESLDL----- 1008

Query: 501  FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
                                     G IPPSL  +S L  L+L++N L+G I  S GN
Sbjct: 1009 -------------------SSNELSGAIPPSLAGISTLSSLNLSNNHLSGKI--STGN 1045



>pir|T05251|T05251 probable disease resistance protein F18A5.210 -
           Arabidopsis thaliana>gb:ATCHRIV37_1545146 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           37.>gb:ATF18A5_1549067 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F18A5 (ESSA project).
          Length = 645

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 57/179 (31%), Positives = 81/179 (45%), Gaps = 15/179 (8%)
 Frame = +3

Query: 258 WAEGSDPCGDHWEGVGCNGS--RVVSLTLSSMDLTGELSGD--IEELSELQILDLSYNKD 425
           W   +D C   W+G+ C+    +VV L L +  L G L  D  +  L  L  LDL  N +
Sbjct: 61  WRNNTDCCS--WDGISCDPKTGKVVELDLMNSFLNGPLRYDSSLFRLQHLHNLDLGSN-N 117

Query: 426 LTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQL 605
            +G LP  IG+LK L  L L  C  FG IP S+G              F G +P S+G L
Sbjct: 118 FSGILPDSIGSLKYLRVLSLGDCNLFGKIPSSLGNLTYLTNLDLSVNDFTGELPDSMGHL 177

Query: 606 SELYWLDLADNQLTGSIPVSDGNTPGLDML-VGTKHF----------HFGXNKFSGEIP 749
           ++L  L L   +L+G+ P    N   L ++ +G+  F              NK  G++P
Sbjct: 178 NKLTELHLGSAKLSGNFPSMLLNLSELTLIDLGSNQFGENQTTLYYLDISANKIGGQVP 236



>gb:AF023164_1762043 Zea mays leucine-rich repeat transmembrane
           protein kinase 1 (ltk1) mRNA, partial cds.
          Length = 684

 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 58/172 (33%), Positives = 78/172 (45%), Gaps = 1/172 (0%)
 Frame = +3

Query: 234 GWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLS 413
           GW+      A G DPCG  W+G+ C+GS V  + L ++ LTG L+ ++  L  L  LD+S
Sbjct: 23  GWQ------ANGGDPCGQSWKGITCSGSGVTKIQLPNLSLTGNLAYNMNNLGSLVELDMS 76

Query: 414 YNK-DLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPP 590
            N     G +   + N+ KL  L L G  F G +P SI                 G I  
Sbjct: 77  QNNLGGGGQVQYNLPNM-KLEKLNLAGNQFGGNLPYSISTMPNLKYLNLNHNQLQGNISD 135

Query: 591 SLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEI 746
               L  L  LDL+ N LTG +P S     GL  L   K  +   N+F+G I
Sbjct: 136 VFSNLYSLSELDLSFNSLTGDLPQS---FTGLSSL---KKVYLQNNQFTGNI 181



>gb:AB188247_1529358 Oryza sativa (japonica cultivar-group) OsSERK1
           mRNA for SERK-family receptor-like protein kinase,
           complete cds.>gb:AP005164_1848543 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBa0054L03.
          Length = 624

 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 54/174 (31%), Positives = 87/174 (50%), Gaps = 2/174 (1%)
 Frame = +3

Query: 144 LLLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGS-DPCGDHWEGVGCNGSR 320
           +LL+ L +    ++A  + +   +++       NV  SW     +PC   W  V CN   
Sbjct: 11  VLLLRLLVPAARVLANMEGDALHSLRTNLVDPNNVLQSWDPTLVNPCT--WFHVTCNNDN 68

Query: 321 -VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
            V+ + L +  L+G L   + +L  LQ L+L Y+ +++G++P E+GNL  L +L L    
Sbjct: 69  SVIRVDLGNAALSGTLVPQLGQLKNLQYLEL-YSNNISGTIPSELGNLTNLVSLDLYLNN 127

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
           F G IPDS+G                G IP SL  ++ L  LDL++N L+G +P
Sbjct: 128 FTGPIPDSLGNLLKLRFLRLNNNSLSGSIPKSLTAITALQVLDLSNNNLSGEVP 181



>gb:AB029327_1518169 Nicotiana tabacum mRNA for elicitor-inducible
           LRR receptor-like protein EILP, complete cds.
          Length = 861

 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 61/168 (36%), Positives = 72/168 (42%), Gaps = 1/168 (0%)
 Frame = +3

Query: 255 SWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSG-DIEELSELQILDLSYNKDLT 431
           SW   S  C   W GV C   RV  L +    + G L+      L  L+ +DLS N+ L 
Sbjct: 50  SWTPSSKACKS-WYGVVCFNGRVSKLDIPYAGVIGTLNNFPFSSLPFLEYIDLSMNQ-LF 107

Query: 432 GSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSE 611
           GS+P EIG L  L  L L      G IP  IG                G IP  +G L  
Sbjct: 108 GSIPPEIGKLTNLVYLDLSFNQISGTIPPQIGSLAKLQTLHILDNHLNGSIPGEIGHLRS 167

Query: 612 LYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           L  LDL+ N L GSIP S GN   L +L   K      N  SG IP +
Sbjct: 168 LTELDLSINTLNGSIPPSLGNLHNLSLLCLYK------NNISGFIPEE 209



 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 51/140 (36%), Positives = 64/140 (45%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L    L+G +  +I  L  L +L L Y   L GS+P  +GNL  L +L L      G 
Sbjct: 291 LQLEHNQLSGSIPEEIGYLRTLAVLSL-YTNFLNGSIPISLGNLTSLSSLSLYENHLSGP 349

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP S+G                GPIP  LG L  L ++ L DNQL GSIP S GN     
Sbjct: 350 IPSSLGNLDNLVYLYLYANQLSGPIPSELGNLKNLNYMKLHDNQLNGSIPASFGN----- 404

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
            L   ++     N  +GEIP
Sbjct: 405 -LRNMQYLFLESNNLTGEIP 423



 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 50/146 (34%), Positives = 66/146 (45%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S ++ L L++  L G +   +E L  L +L L Y   L+GS+P EIG L+ L ++ L   
Sbjct: 214 SSLIQLDLNTNFLNGSIPASLENLHNLSLLYL-YENQLSGSIPDEIGQLRTLTDIRLNTN 272

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G IP S+G                G IP  +G L  L  L L  N L GSIP+S GN
Sbjct: 273 FLTGSIPASLGNLTSLSILQLEHNQLSGSIPEEIGYLRTLAVLSLYTNFLNGSIPISLGN 332

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIPA 752
              L  L          N  SG IP+
Sbjct: 333 LTSLSSL------SLYENHLSGPIPS 352



 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 59/157 (37%), Positives = 79/157 (50%), Gaps = 8/157 (5%)
 Frame = +3

Query: 309 NGSRVVSL-TLSSMDLT----GELSGDI-EELSELQIL-DLSYNKD-LTGSLPREIGNLK 464
           NGS   SL  L ++ L      +LSG I +E+ +L+ L D+  N + LTGS+P  +GNL 
Sbjct: 227 NGSIPASLENLHNLSLLYLYENQLSGSIPDEIGQLRTLTDIRLNTNFLTGSIPASLGNLT 286

Query: 465 KLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQL 644
            L  L L      G IP+ IG                G IP SLG L+ L  L L +N L
Sbjct: 287 SLSILQLEHNQLSGSIPEEIGYLRTLAVLSLYTNFLNGSIPISLGNLTSLSSLSLYENHL 346

Query: 645 TGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           +G IP S GN   LD LV   + +   N+ SG IP++
Sbjct: 347 SGPIPSSLGN---LDNLV---YLYLYANQLSGPIPSE 377



 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 54/149 (36%), Positives = 63/149 (42%), Gaps = 2/149 (1%)
 Frame = +3

Query: 312 GSRVVSLTLSSMD--LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           GS     TL  +D  L G + G+I  L  L  LDLS N  L GS+P  +GNL  L  L L
Sbjct: 139 GSLAKLQTLHILDNHLNGSIPGEIGHLRSLTELDLSINT-LNGSIPPSLGNLHNLSLLCL 197

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                 G IP+ IG                G IP SL  L  L  L L +NQL+GSIP  
Sbjct: 198 YKNNISGFIPEEIGYLSSLIQLDLNTNFLNGSIPASLENLHNLSLLYLYENQLSGSIPDE 257

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            G    L             N  +G IPA
Sbjct: 258 IGQLRTL------TDIRLNTNFLTGSIPA 280



 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 43/130 (33%), Positives = 61/130 (46%), Gaps = 1/130 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLK-KLYNLIL 485
           N SR+  L +   +L+ E+   I  L+ L+ILDLS N +L GS+P+  G++   L  L +
Sbjct: 452 NISRLQVLKIPDNNLSEEIPSSICNLTSLRILDLSRN-NLKGSIPQCFGDMGGHLEVLDI 510

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
              G  G +P +                  G IP SL    EL  LDL DN L  + P+ 
Sbjct: 511 HKNGISGTLPTTFRIGSVLRSFTLHENELEGKIPRSLANCKELQVLDLGDNLLNDTFPMW 570

Query: 666 DGNTPGLDML 695
            G  P L +L
Sbjct: 571 LGTLPKLQVL 580



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 43/146 (29%), Positives = 60/146 (41%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + + SL+L    L+G +   +  L  L  L L Y   L+G +P E+GNLK L      
Sbjct: 332 NLTSLSSLSLYENHLSGPIPSSLGNLDNLVYLYL-YANQLSGPIPSELGNLKNL------ 384

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
              +  L  + +                 G IP S G L  + +L L  N LTG IP+S 
Sbjct: 385 --NYMKLHDNQLN----------------GSIPASFGNLRNMQYLFLESNNLTGEIPLSI 426

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEI 746
            N      L+  K    G N   G+I
Sbjct: 427 CN------LMSLKVLSLGRNSLKGDI 446



 Score = 38.1 bits (87), Expect = 0.17
 Identities = 34/118 (28%), Positives = 49/118 (41%), Gaps = 4/118 (3%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGS---LPREIGNLKKLYNLI-L 485
           R +  T+      G+   DI E          YN  +T +   L  ++  +  +Y +I L
Sbjct: 629 RKIDQTVKEPTYLGKFGADIRE----------YNYSVTVTTKGLELKLVRILTVYIIIDL 678

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
               F G +P  +G                G IPPSLG L  +  LDL+ NQL+G IP
Sbjct: 679 SSNRFEGHVPSIMGELIALRVLNLSRNGLQGHIPPSLGNLFVIESLDLSFNQLSGEIP 736



>gb:CQ768541_1451788 Sequence 36 from Patent WO2004007712.
          Length = 213

 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 61/178 (34%), Positives = 88/178 (49%), Gaps = 6/178 (3%)
 Frame = +3

Query: 147 LLVPLFIQFLGIVAFTD-NNDYVAIKALRDGWK---NVPPSWAEGS-DPCGDHWEGVGCN 311
           LL    I  L ++  T+ N++  A+ ALR       NV  SW     +PC   W  V CN
Sbjct: 10  LLAASLILTLALIRLTEANSEGDALHALRRSLSDPDNVVQSWDPTLVNPCT--WFHVTCN 67

Query: 312 GS-RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
              +V  L L + +L+G L  ++ +L  LQ L+L Y  ++ G++P E+GNLK L +L L 
Sbjct: 68  QHHQVTRLDLGNSNLSGHLVPELGKLEHLQYLEL-YKNEIQGTIPSELGNLKSLISLDLY 126

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPV 662
                G IP S+G                GPIP  L  +S L  +D++ N L G+IPV
Sbjct: 127 NNNLTGKIPSSLG-----KLKRLNENRLTGPIPRELTVISSLKVVDVSGNDLCGTIPV 179



>pir|T01267|T01267 leucine-rich repeat transmembrane protein kinase
           1 - maize  (fragment)
          Length = 684

 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 58/172 (33%), Positives = 78/172 (45%), Gaps = 1/172 (0%)
 Frame = +3

Query: 234 GWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLS 413
           GW+      A G DPCG  W+G+ C+GS V  + L ++ LTG L+ ++  L  L  LD+S
Sbjct: 23  GWQ------ANGGDPCGQSWKGITCSGSGVTKIQLPNLSLTGNLAYNMNNLGSLVELDMS 76

Query: 414 YNK-DLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPP 590
            N     G +   + N+ KL  L L G  F G +P SI                 G I  
Sbjct: 77  QNNLGGGGQVQYNLPNM-KLEKLNLAGNQFGGNLPYSISTMPNLKYLNLNHNQLQGNISD 135

Query: 591 SLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEI 746
               L  L  LDL+ N LTG +P S     GL  L   K  +   N+F+G I
Sbjct: 136 VFSNLYSLSELDLSFNSLTGDLPQS---FTGLSSL---KKVYLQNNQFTGNI 181



>gb:AP004762_1844627 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0686H11.
          Length = 1104

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 50/151 (33%), Positives = 69/151 (45%)
 Frame = +3

Query: 303 GCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI 482
           GC    +  L L+   ++G L   I  L ++Q + + Y   LTGS+P  IGN  +L +L 
Sbjct: 222 GCTD--LTMLGLAETGISGSLPATIGNLKKIQTIAI-YTAMLTGSIPESIGNCTELTSLY 278

Query: 483 LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPV 662
           L      G IP  +G               +G IPP +G   EL  +DL+ N+LTG IP 
Sbjct: 279 LYQNTLSGGIPPQLGQLKKLQTVLLWQNQLVGTIPPEIGNCKELVLIDLSLNELTGPIPR 338

Query: 663 SDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           S G  P L  L          NK +G IP +
Sbjct: 339 SFGGLPNLQQL------QLSTNKLTGVIPPE 363



 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 50/143 (34%), Positives = 69/143 (48%), Gaps = 1/143 (0%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           +L LS  +LTG +  ++ +L+EL  LDL+ N+ LTG++P E+  L+KL +L L      G
Sbjct: 107 TLVLSGTNLTGAIPKELGDLAELSTLDLTKNQ-LTGAIPAELCRLRKLQSLALNSNSLRG 165

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQ-LTGSIPVSDGNTPG 683
            IPD+IG                G IP S+G L +L  L    NQ L G +P   G    
Sbjct: 166 AIPDAIGNLTGLTSLTLYDNELSGAIPASIGNLKKLQVLRAGGNQALKGPLPPEIGGCTD 225

Query: 684 LDMLVGTKHFHFGXNKFSGEIPA 752
           L ML             SG +PA
Sbjct: 226 LTML------GLAETGISGSLPA 242



 Score = 69.3 bits (168), Expect = 7e-11
 Identities = 53/171 (30%), Positives = 72/171 (42%), Gaps = 24/171 (14%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPRE------------- 449
           N + + SLTL   +L+G +   I  L +LQ+L    N+ L G LP E             
Sbjct: 173 NLTGLTSLTLYDNELSGAIPASIGNLKKLQVLRAGGNQALKGPLPPEIGGCTDLTMLGLA 232

Query: 450 -----------IGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSL 596
                      IGNLKK+  + +      G IP+SIG                G IPP L
Sbjct: 233 ETGISGSLPATIGNLKKIQTIAIYTAMLTGSIPESIGNCTELTSLYLYQNTLSGGIPPQL 292

Query: 597 GQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           GQL +L  + L  NQL G+IP   GN   L ++          N+ +G IP
Sbjct: 293 GQLKKLQTVLLWQNQLVGTIPPEIGNCKELVLI------DLSLNELTGPIP 337



 Score = 66.2 bits (160), Expect = 6e-10
 Identities = 54/166 (32%), Positives = 71/166 (42%), Gaps = 16/166 (9%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           C G +  SL LS  +LTG +  ++  L  L  L L  N DL G +P EIGN   LY L L
Sbjct: 415 CEGLQ--SLDLSYNNLTGAIPRELFALQNLTKLLLLSN-DLAGFIPPEIGNCTNLYRLRL 471

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP-- 659
            G    G IP  IG                GP+P ++     L ++DL  N LTG++P  
Sbjct: 472 NGNRLSGTIPAEIGNLKNLNFLDLGGNRLTGPLPAAMSGCDNLEFMDLHSNALTGTLPGD 531

Query: 660 ---------VSDGNT-----PGLDMLVGTKHFHFGXNKFSGEIPAQ 755
                    VSD         G+  L      + G N+ SG IP +
Sbjct: 532 LPRSLQFVDVSDNRLTGVLGAGIGSLPELTKLNLGKNRISGGIPPE 577



 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 49/154 (31%), Positives = 72/154 (46%), Gaps = 3/154 (1%)
 Frame = +3

Query: 300 VGCNGSRVVSLTLS---SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKL 470
           +G +  R+ +LTL       LTG +   + +   LQ LDLSYN +LTG++PRE+  L+ L
Sbjct: 384 IGVDFPRLRNLTLFYAWQNRLTGGIPASLAQCEGLQSLDLSYN-NLTGAIPRELFALQNL 442

Query: 471 YNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTG 650
             L+L+     G IP                        P +G  + LY L L  N+L+G
Sbjct: 443 TKLLLLSNDLAGFIP------------------------PEIGNCTNLYRLRLNGNRLSG 478

Query: 651 SIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           +IP   GN   L+ L        G N+ +G +PA
Sbjct: 479 TIPAEIGNLKNLNFL------DLGGNRLTGPLPA 506



 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 42/126 (33%), Positives = 58/126 (46%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N  ++ ++ + +  LTG +   I   +EL  L L Y   L+G +P ++G LKKL  ++L 
Sbjct: 246 NLKKIQTIAIYTAMLTGSIPESIGNCTELTSLYL-YQNTLSGGIPPQLGQLKKLQTVLLW 304

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP  IG                GPIP S G L  L  L L+ N+LTG IP   
Sbjct: 305 QNQLVGTIPPEIGNCKELVLIDLSLNELTGPIPRSFGGLPNLQQLQLSTNKLTGVIPPEL 364

Query: 669 GNTPGL 686
            N   L
Sbjct: 365 SNCTSL 370



 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 47/143 (32%), Positives = 63/143 (44%), Gaps = 1/143 (0%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG-FFG 506
           L L    LTG L   +     L+ +DL  N  LTG+LP   G+L +    + V      G
Sbjct: 493 LDLGGNRLTGPLPAAMSGCDNLEFMDLHSNA-LTGTLP---GDLPRSLQFVDVSDNRLTG 548

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
           ++   IG                G IPP LG   +L  LDL DN L+G IP   G  P L
Sbjct: 549 VLGAGIGSLPELTKLNLGKNRISGGIPPELGSCEKLQLLDLGDNALSGGIPPELGKLPFL 608

Query: 687 DMLVGTKHFHFGXNKFSGEIPAQ 755
           ++       +   N+ SGEIP+Q
Sbjct: 609 EI-----SLNLSCNRLSGEIPSQ 626



 Score = 59.3 bits (142), Expect = 7e-08
 Identities = 47/153 (30%), Positives = 71/153 (46%)
 Frame = +3

Query: 294 EGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLY 473
           E +G N + + SL L    L+G +   + +L +LQ + L +   L G++P EIGN K+L 
Sbjct: 266 ESIG-NCTELTSLYLYQNTLSGGIPPQLGQLKKLQTV-LLWQNQLVGTIPPEIGNCKELV 323

Query: 474 NLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGS 653
            + L      G IP S G                G IPP L   + L  +++ +NQLTG+
Sbjct: 324 LIDLSLNELTGPIPRSFGGLPNLQQLQLSTNKLTGVIPPELSNCTSLTDIEVDNNQLTGA 383

Query: 654 IPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           I V       L +      F+   N+ +G IPA
Sbjct: 384 IGVDFPRLRNLTL------FYAWQNRLTGGIPA 410



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 41/146 (28%), Positives = 57/146 (39%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           ++ ++ L    L G +  +I    EL ++DLS N +LTG +PR  G L  L  L L    
Sbjct: 297 KLQTVLLWQNQLVGTIPPEIGNCKELVLIDLSLN-ELTGPIPRSFGGLPNLQQLQLSTNK 355

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
             G+IP  +                 G I     +L  L       N+LTG IP S    
Sbjct: 356 LTGVIPPELSNCTSLTDIEVDNNQLTGAIGVDFPRLRNLTLFYAWQNRLTGGIPASLAQC 415

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            GL  L          N  +G IP +
Sbjct: 416 EGLQSL------DLSYNNLTGAIPRE 435



 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 44/139 (31%), Positives = 62/139 (44%), Gaps = 1/139 (0%)
 Frame = +3

Query: 336 LSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIP 515
           +S   LTG L   I  L EL  L+L  N+ ++G +P E+G+ +KL  L L      G IP
Sbjct: 541 VSDNRLTGVLGAGIGSLPELTKLNLGKNR-ISGGIPPELGSCEKLQLLDLGDNALSGGIP 599

Query: 516 DSIGXXXXXXXXXXXXXXFI-GPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM 692
             +G               + G IP     L +L  LD++ NQL+GS+         L  
Sbjct: 600 PELGKLPFLEISLNLSCNRLSGEIPSQFAGLDKLGCLDVSYNQLSGSL-------EPLAR 652

Query: 693 LVGTKHFHFGXNKFSGEIP 749
           L      +   N FSGE+P
Sbjct: 653 LENLVTLNISYNAFSGELP 671



 Score = 37.4 bits (85), Expect = 0.30
 Identities = 25/66 (37%), Positives = 37/66 (56%)
 Frame = +3

Query: 324 VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF 503
           +SL LS   L+GE+      L +L  LD+SYN+ L+GSL   +  L+ L  L +    F 
Sbjct: 610 ISLNLSCNRLSGEIPSQFAGLDKLGCLDVSYNQ-LSGSL-EPLARLENLVTLNISYNAFS 667

Query: 504 GLIPDS 521
           G +PD+
Sbjct: 668 GELPDT 673



>gb:AP003705_1832164 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1112_E08.>gb:AP003932_1835435 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OJ1773_H01.
          Length = 750

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 47/145 (32%), Positives = 68/145 (46%), Gaps = 2/145 (1%)
 Frame = +3

Query: 186 AFTDNNDYVAIKALRD--GWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTG 359
           ++T   D  AI  L    G  +VP     G DPC + W+GV C  S + S+TL++ +L G
Sbjct: 29  SYTYEQDVFAINGLYTALGSPSVPGWITNGGDPCNEGWQGVECVVSNITSITLNAANLGG 88

Query: 360 ELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXX 539
           +L   +   + L    LS N+ L+GS+P  +  L  L  L L      G IPD+      
Sbjct: 89  QLGNTLGNFTSLITFFLSGNQ-LSGSIPSTLSTLTLLTGLSLNNNHLSGEIPDAFSTLTG 147

Query: 540 XXXXXXXXXXFIGPIPPSLGQLSEL 614
                       GP+PPS+G L+ L
Sbjct: 148 LANLDFSSNNLTGPLPPSMGNLTAL 172



>gb:AP003453_1829707 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0480C01.
          Length = 1121

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 48/141 (34%), Positives = 64/141 (45%), Gaps = 3/141 (2%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L   +L GE+   +  +  L+ L L YN  LTGS+P E+    KL  + L      G 
Sbjct: 397 LILWQNELEGEIPASLSRIQGLEHLILDYN-GLTGSIPPELAKCTKLNWISLASNRLSGP 455

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG-- 683
           IP  +G              F GPIPP LG    L WLDL  NQL GSIP       G  
Sbjct: 456 IPSWLGKLSYLAILKLSNNSFSGPIPPELGDCQSLVWLDLNSNQLNGSIPKELAKQSGKM 515

Query: 684 -LDMLVGTKHFHFGXNKFSGE 743
            + ++VG  + +   ++ S E
Sbjct: 516 NVGLIVGRPYVYLRNDELSSE 536



 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 48/147 (32%), Positives = 68/147 (46%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S++  L L +  LTG +   +   + L  LDLS N  + GS+P  +G+L  L +LIL   
Sbjct: 344 SKLHLLYLQNNYLTGGIPDAVSNCTSLVSLDLSLNY-INGSIPASLGDLGNLQDLILWQN 402

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G IP S+                 G IPP L + ++L W+ LA N+L+G IP   G 
Sbjct: 403 ELEGEIPASLSRIQGLEHLILDYNGLTGSIPPELAKCTKLNWISLASNRLSGPIPSWLGK 462

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
              L +L          N FSG IP +
Sbjct: 463 LSYLAIL------KLSNNSFSGPIPPE 483



 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 40/126 (31%), Positives = 59/126 (46%), Gaps = 2/126 (1%)
 Frame = +3

Query: 294 EGVGCNGSRVVSLTLSSMDLTGELSGD-IEELSELQILDLSYNKDLTGSLPREIGNLKKL 470
           E   C+G +   L LS   + GE+ G  + +   L++L+LS+N  L G  P +I  L  L
Sbjct: 215 EFTNCSGLQY--LDLSGNLIVGEVPGGALSDCRGLKVLNLSFNH-LAGVFPPDIAGLTSL 271

Query: 471 YNLILVGCGFFGLIP-DSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLT 647
             L L    F G +P ++                F G IP ++  L EL  LDL+ N  +
Sbjct: 272 NALNLSNNNFSGELPGEAFAKLQQLTALSLSFNHFNGSIPDTVASLPELQQLDLSSNTFS 331

Query: 648 GSIPVS 665
           G+IP S
Sbjct: 332 GTIPSS 337



 Score = 38.9 bits (89), Expect = 0.10
 Identities = 35/117 (29%), Positives = 54/117 (46%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           NGS ++ L LS   L   + G++ ++  L I++L +N  L+G++P  +   KKL  L L 
Sbjct: 580 NGS-MIFLDLSYNQLDSAIPGELGDMFYLMIMNLGHNL-LSGTIPSRLAEAKKLAVLDL- 636

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
                                        GPIP S   LS L  ++L++NQL G+IP
Sbjct: 637 -----------------------SYNQLEGPIPNSFSALS-LSEINLSNNQLNGTIP 669



>gb:AP002522_1822343 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0009G03.>gb:AP003045_1824361 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0030H07.
          Length = 1065

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 73/256 (28%), Positives = 99/256 (38%), Gaps = 56/256 (21%)
 Frame = +3

Query: 147 LLVPLFIQFLGIVAFTDNNDYVAIKALR------DGWKNVPPSWAEGSDPCGDHWEGVGC 308
           + + +F+ F+ +    D  D  A+ A +       G   V  SW   + PC   WEGV C
Sbjct: 15  VFMSIFLHFMAVRG-ADGEDAAALLAFKAVAVGNGGGNGVLASWNGSAGPCS--WEGVAC 71

Query: 309 NG-SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYN---------------------- 419
               RVV+L+L   DL+G LS  +  L+ L+ LDLSYN                      
Sbjct: 72  GRHGRVVALSLPGHDLSGTLSPAVGNLTSLRKLDLSYNWLHGGIPASLGQLHRLRELDLS 131

Query: 420 -------------------------KDLTGSLPREIGN-LKKLYNLILVGCGFFGLIPDS 521
                                      L G +P E+GN L +L  L L    F G  P S
Sbjct: 132 FNTFSGEVPSNLTSCTSLEYLALGSNKLAGHIPSELGNTLTQLQVLGLDNNSFVGHWPAS 191

Query: 522 IGXXXXXXXXXXXXXXFIGPIPPSLGQ-LSELYWLDLADNQLTGSIPVSDGNTPGLDMLV 698
           +                 G IPP  G  +  LY+LD+  N L+G++P S  N   L  L+
Sbjct: 192 LANLTSLGYLSLRMNSLEGTIPPEFGSNMPRLYFLDICSNNLSGALPSSLYN---LSSLM 248

Query: 699 GTKHFHFGXNKFSGEI 746
           G   F  G NK  G I
Sbjct: 249 G---FDAGNNKLDGSI 261



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 52/158 (32%), Positives = 76/158 (48%), Gaps = 3/158 (1%)
 Frame = +3

Query: 291 WEGVGC--NGSRVVSLTLSSMDLTGELSGDIEELSE-LQILDLSYNKDLTGSLPREIGNL 461
           WE V    N S++  L LS+ + TG+    I  LS+ LQ L L  ++ ++GS+P + GNL
Sbjct: 338 WEFVESLTNCSKLEILVLSNNNFTGQFPISIANLSKTLQKLYLGGSR-ISGSIPSDFGNL 396

Query: 462 KKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQ 641
             L +L L      G+IP+SIG                G +P S+G L+ L  L +  N 
Sbjct: 397 VGLRSLYLFSTDISGVIPESIGKLENLTTLYLNNNSLSGHVPSSVGNLTNLMKLFMQGNN 456

Query: 642 LTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           L G IP + G    L++L          N F+G IP +
Sbjct: 457 LEGPIPANLGKLKSLNVL------DLSRNHFNGSIPKE 488



 Score = 66.2 bits (160), Expect = 6e-10
 Identities = 52/142 (36%), Positives = 66/142 (46%), Gaps = 1/142 (0%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSEL-QILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           L LS     G +  +I EL  + Q L+LSYN  L+G LP E+G+L  L  LIL G    G
Sbjct: 474 LDLSRNHFNGSIPKEILELPSISQYLNLSYNS-LSGPLPSEVGSLTSLNELILSGNQLSG 532

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
            IP SI               F G IP  LG +  L  L+L  N+ +G IP + G+   L
Sbjct: 533 QIPSSIKNCIVLTVLLLDSNSFQGTIPVFLGDIKGLRVLNLTMNKFSGVIPDALGSIHNL 592

Query: 687 DMLVGTKHFHFGXNKFSGEIPA 752
             L      +   N  SG IPA
Sbjct: 593 QEL------YLAYNNLSGPIPA 608



 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 37/110 (33%), Positives = 53/110 (48%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS   L+G++   I+    L +L L  N    G++P  +G++K L  L L    F G+
Sbjct: 523 LILSGNQLSGQIPSSIKNCIVLTVLLLDSNS-FQGTIPVFLGDIKGLRVLNLTMNKFSGV 581

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
           IPD++G                GPIP  L  L+ L  LDL+ N L G +P
Sbjct: 582 IPDALGSIHNLQELYLAYNNLSGPIPAVLQNLTSLSMLDLSFNDLQGEVP 631



>gb:AF436829_1799881 Arabidopsis thaliana AT4g26540/M3E9_30 mRNA,
           complete cds.
          Length = 1096

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 52/149 (34%), Positives = 67/149 (44%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +V L L    L+GE+   I EL  LQ+L    NK+L G LP EIGN + L  L   
Sbjct: 163 NLSGLVELMLFDNKLSGEIPRSIGELKNLQVLRAGGNKNLRGELPWEIGNCENLVMLGPA 222

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G +P SIG                GPIP  +G  +EL  L L  N ++GSIP + 
Sbjct: 223 ETSLSGKLPASIGNLKRVQTIAIYTSLLSGPIPDEIGYCTELQNLYLYQNSISGSIPTTI 282

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           G    L  L+         N   G+IP +
Sbjct: 283 GGLKKLQSLL------LWQNNLVGKIPTE 305



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 41/115 (35%), Positives = 60/115 (52%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           LTG +   + +  ELQ +DLSYN  L+GS+P+EI  L+ L  L+L+     G IP  IG 
Sbjct: 394 LTGNIPQSLSQCRELQAIDLSYNS-LSGSIPKEIFGLRNLTKLLLLSNDLSGFIPPDIGN 452

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDML 695
                          G IP  +G L  L ++D+++N+L GSIP +      L+ L
Sbjct: 453 CTNLYRLRLNGNRLAGSIPSEIGNLKNLNFVDISENRLVGSIPPAISGCESLEFL 507



 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 54/145 (37%), Positives = 72/145 (49%), Gaps = 1/145 (0%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           + SLTLSS++LTG +  +I + +EL++LDLS N  L+G +P EI  LKKL  L L     
Sbjct: 95  LTSLTLSSLNLTGVIPKEIGDFTELELLDLSDN-SLSGDIPVEIFRLKKLKTLSLNTNNL 153

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQ-LTGSIPVSDGNT 677
            G IP  IG                G IP S+G+L  L  L    N+ L G +P   GN 
Sbjct: 154 EGHIPMEIGNLSGLVELMLFDNKLSGEIPRSIGELKNLQVLRAGGNKNLRGELPWEIGNC 213

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIPA 752
             L ML   +         SG++PA
Sbjct: 214 ENLVMLGPAE------TSLSGKLPA 232



 Score = 70.1 bits (170), Expect = 4e-11
 Identities = 50/155 (32%), Positives = 69/155 (44%)
 Frame = +3

Query: 291 WEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKL 470
           WE   C    +V L  +   L+G+L   I  L  +Q + + Y   L+G +P EIG   +L
Sbjct: 208 WEIGNCEN--LVMLGPAETSLSGKLPASIGNLKRVQTIAI-YTSLLSGPIPDEIGYCTEL 264

Query: 471 YNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTG 650
            NL L      G IP +IG               +G IP  LG   EL+ +D ++N LTG
Sbjct: 265 QNLYLYQNSISGSIPTTIGGLKKLQSLLLWQNNLVGKIPTELGNCPELWLIDFSENLLTG 324

Query: 651 SIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           +IP S G    L  L          N+ SG IP +
Sbjct: 325 TIPRSFGKLENLQEL------QLSVNQISGTIPEE 353



 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 46/141 (32%), Positives = 64/141 (45%), Gaps = 1/141 (0%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           +  S   L+  L   I  L+EL  L+L+ N+ L+G +PREI   + L  L L    F G 
Sbjct: 530 IDFSDNALSSTLPPGIGLLTELTKLNLAKNR-LSGEIPREISTCRSLQLLNLGENDFSGE 588

Query: 510 IPDSIGXXXXXXXXXXXX-XXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
           IPD +G               F+G IP     L  L  LD++ NQLTG++ V       L
Sbjct: 589 IPDELGQIPSLAISLNLSCNRFVGEIPSRFSDLKNLGVLDVSHNQLTGNLNV-------L 641

Query: 687 DMLVGTKHFHFGXNKFSGEIP 749
             L      +   N FSG++P
Sbjct: 642 TDLQNLVSLNISYNDFSGDLP 662



 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 36/103 (34%), Positives = 50/103 (48%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           LTG +     +L  LQ L LS N+ ++G++P E+ N  KL +L +      G IP  +  
Sbjct: 322 LTGTIPRSFGKLENLQELQLSVNQ-ISGTIPEELTNCTKLTHLEIDNNLITGEIPSLMSN 380

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
                          G IP SL Q  EL  +DL+ N L+GSIP
Sbjct: 381 LRSLTMFFAWQNKLTGNIPQSLSQCRELQAIDLSYNSLSGSIP 423



 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 41/146 (28%), Positives = 60/146 (41%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           ++ SL L   +L G++  ++    EL ++D S N  LTG++PR  G L+ L  L L    
Sbjct: 287 KLQSLLLWQNNLVGKIPTELGNCPELWLIDFSENL-LTGTIPRSFGKLENLQELQLSVNQ 345

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
             G IP+ +                 G IP  +  L  L       N+LTG+IP S    
Sbjct: 346 ISGTIPEELTNCTKLTHLEIDNNLITGEIPSLMSNLRSLTMFFAWQNKLTGNIPQS---- 401

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIPAQ 755
             L      +      N  SG IP +
Sbjct: 402 --LSQCRELQAIDLSYNSLSGSIPKE 425



 Score = 34.7 bits (78), Expect = 1.9
 Identities = 26/84 (30%), Positives = 46/84 (54%)
 Frame = +3

Query: 270 SDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPRE 449
           +D  G+  + +G   S  +SL LS     GE+     +L  L +LD+S+N+ LTG+L   
Sbjct: 583 NDFSGEIPDELGQIPSLAISLNLSCNRFVGEIPSRFSDLKNLGVLDVSHNQ-LTGNL-NV 640

Query: 450 IGNLKKLYNLILVGCGFFGLIPDS 521
           + +L+ L +L +    F G +P++
Sbjct: 641 LTDLQNLVSLNISYNDFSGDLPNT 664



>gb:AC116926_1739356 Genomic sequence for Oryza sativa (japonica
           cultivar-group) cultivar Nipponbare clone OJ1341F06,
           from chromosome 10, complete sequence.
          Length = 654

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 52/148 (35%), Positives = 75/148 (50%), Gaps = 1/148 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELS-ELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           N +R+ ++T+ +  L G L   I  LS +L++LD+ +NK ++G +P  I N  KL  L L
Sbjct: 365 NCTRLRAVTIQNNRLGGALPNSITNLSAQLELLDIGFNK-ISGKIPDGINNFLKLIKLGL 423

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
               F G IPDSIG                G IP SLG L++L  L L +N L G +P S
Sbjct: 424 SNNRFSGPIPDSIGRLETLQYLTLENNLLSGIIPSSLGNLTQLQQLSLDNNSLEGPLPAS 483

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            GN     +++ T    F  NK   ++P
Sbjct: 484 IGNLQ--QLIIAT----FSNNKLRDQLP 505



 Score = 69.7 bits (169), Expect = 5e-11
 Identities = 50/148 (33%), Positives = 70/148 (47%), Gaps = 1/148 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQ-ILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           N  +++  T S+  L  +L GDI  L  L  ILDLS N   +GSLP  +G L KL  L +
Sbjct: 486 NLQQLIIATFSNNKLRDQLPGDIFNLPSLSYILDLSRNH-FSGSLPSAVGGLTKLTYLYM 544

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
               F GL+P+S+               F G IP S+ ++  L  L+L  N L G+IP  
Sbjct: 545 YSNNFSGLLPNSLSNCQSLMELHLDDNFFNGTIPVSVSKMRGLVLLNLTKNSLLGAIP-- 602

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
                 L ++ G K  +   N  S +IP
Sbjct: 603 ----QDLRLMDGLKELYLSHNNLSAQIP 626



 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 75/267 (28%), Positives = 97/267 (36%), Gaps = 59/267 (22%)
 Frame = +3

Query: 126 MIPRIQLLLVPLFIQFLGI-----VAFTDNNDYVAIKALRDGWKNVPP---SWAEGSDPC 281
           M   ++LLL+P  +          + F++N D  A+   + G  +      SW   +  C
Sbjct: 1   MFTALKLLLLPYLLLLASASCTQGLPFSNNTDLDALLGFKAGLSHQSDALASWNTTTSYC 60

Query: 282 GDHWEGVGCNG---SRVVSLTLSSMDLTGELSGDIEEL---------------------- 386
              W GV C+     RV++L L+S  L G +S  I  L                      
Sbjct: 61  --QWSGVICSHRHKQRVLALNLTSTGLHGYISASIGNLTYLRSLDLSCNQLYGEIPLTIG 118

Query: 387 --SELQILDLSYNKDLTGSLPREIGNLKKLYNLILV-------------GC--------- 494
             S+L  LDLS N    G +PR IG L +L  L L               C         
Sbjct: 119 WLSKLSYLDLS-NNSFQGEIPRTIGQLPQLSYLYLSNNSLQGEITDELRNCTNLASIKLD 177

Query: 495 --GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IPD  G              F G IP SLG LS L  L L +N LTG IP + 
Sbjct: 178 LNSLNGKIPDWFGGFLKLNSISVGKNIFTGIIPQSLGNLSALSELFLNENHLTGPIPEAL 237

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           G    L+ L          N  SG IP
Sbjct: 238 GKISSLERLA------LQVNHLSGTIP 258



 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 42/147 (28%), Positives = 65/147 (44%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + + S+ L    L G++        +L  + +  N   TG +P+ +GNL  L  L L 
Sbjct: 167 NCTNLASIKLDLNSLNGKIPDWFGGFLKLNSISVGKNI-FTGIIPQSLGNLSALSELFLN 225

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP+++G                G IP +L  LS L  + L +N+L G +P   
Sbjct: 226 ENHLTGPIPEALGKISSLERLALQVNHLSGTIPRTLLNLSSLIHIGLQENELHGRLPSDL 285

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           GN  GL  +   ++F    N F+G IP
Sbjct: 286 GN--GLPKI---QYFIVALNHFTGSIP 307



 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 37/122 (30%), Positives = 57/122 (46%), Gaps = 1/122 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +  L L+   LTG +   + ++S L+ L L  N  L+G++PR + NL  L ++ L 
Sbjct: 215 NLSALSELFLNENHLTGPIPEALGKISSLERLALQVNH-LSGTIPRTLLNLSSLIHIGLQ 273

Query: 489 GCGFFGLIPDSIGXXX-XXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                G +P  +G               F G IPPS+   + +  +DL+ N  TG IP  
Sbjct: 274 ENELHGRLPSDLGNGLPKIQYFIVALNHFTGSIPPSIANATNMRSIDLSSNNFTGIIPPE 333

Query: 666 DG 671
            G
Sbjct: 334 IG 335



>gb:AC104427_1737594 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1015F07, complete sequence.
          Length = 891

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 55/173 (31%), Positives = 77/173 (44%), Gaps = 24/173 (13%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           C   RV+ L  ++  L G++   I +L  L +L L+ N  + GS+P E+G ++ L  L L
Sbjct: 315 CRSLRVLDLGTNA--LAGDIPPSIGKLRSLSVLRLAGNAGIAGSIPAELGGIEMLVTLDL 372

Query: 486 VG-------------CGFF-----------GLIPDSIGXXXXXXXXXXXXXXFIGPIPPS 593
            G             C F            G+IPD++                +G IP +
Sbjct: 373 AGLALIGDIPVSLSQCQFLLELNLSGNQLQGVIPDTLNNLTYLKLLDLHRNHLVGGIPVT 432

Query: 594 LGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           L QL+ L  LDL++NQLTG IP   GN   L       HF+   N  SG IPA
Sbjct: 433 LAQLTNLDLLDLSENQLTGPIPSELGNLSNL------THFNVSYNGLSGMIPA 479



 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 58/232 (25%), Positives = 85/232 (36%), Gaps = 28/232 (12%)
 Frame = +3

Query: 144 LLLVPLFIQFLGIV---AFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNG 314
           +L+V + + ++G+V      +    +  KA          SW  G DPC D + GV C+ 
Sbjct: 13  VLVVGVVLHWVGVVDAATAAERGILLEFKAAVTDPNGALASWTAGGDPCVD-FAGVTCDP 71

Query: 315 SR--VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNL-KKLYNLIL 485
           S   V  L +    + G+L+  +  L+ L+ + L +   L+G +P     L   L+ L L
Sbjct: 72  SSRAVQRLRVHGAGIAGKLTPSLARLASLESVSL-FGNGLSGGIPSSFSALGPTLHKLNL 130

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                                         G IPP LG    L  LDL+ N  +G IP S
Sbjct: 131 ------------------------SRNALSGEIPPFLGAFPWLRLLDLSYNAFSGEIPAS 166

Query: 666 ------------------DGNTP----GLDMLVGTKHFHFGXNKFSGEIPAQ 755
                              G  P        L G   F F  N+ SGE+P Q
Sbjct: 167 LFDPCLRLRYVSLAHNALTGPVPTAITNCSRLAG---FDFSYNRLSGELPDQ 215



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 37/150 (24%), Positives = 57/150 (38%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           C    +  +++ S  L+G ++G +     + +LD+  N    G  P  +  L  +    +
Sbjct: 217 CAPPEISYISVRSNSLSGAIAGKLNACRSIDLLDVGSNH-FAGPAPFGLLGLVNITYFNV 275

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
               F G IP+                   GP+P S+     L  LDL  N L G IP S
Sbjct: 276 SSNAFDGEIPNIATCGTKFSYFDASGNRLTGPVPESVANCRSLRVLDLGTNALAGDIPPS 335

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            G    L +L        G    +G IPA+
Sbjct: 336 IGKLRSLSVLRLA-----GNAGIAGSIPAE 360



 Score = 38.5 bits (88), Expect = 0.13
 Identities = 45/172 (26%), Positives = 65/172 (37%), Gaps = 24/172 (13%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREI----------- 452
           C   R VSL  ++  LTG +   I   S L   D SYN+ L+G LP ++           
Sbjct: 171 CLRLRYVSLAHNA--LTGPVPTAITNCSRLAGFDFSYNR-LSGELPDQLCAPPEISYISV 227

Query: 453 ----------GNLKKLYNLILVGCG---FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPS 593
                     G L    ++ L+  G   F G  P  +               F G IP  
Sbjct: 228 RSNSLSGAIAGKLNACRSIDLLDVGSNHFAGPAPFGLLGLVNITYFNVSSNAFDGEIPNI 287

Query: 594 LGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
               ++  + D + N+LTG +P S  N   L +L        G N  +G+IP
Sbjct: 288 ATCGTKFSYFDASGNRLTGPVPESVANCRSLRVL------DLGTNALAGDIP 333



>gb:AC079633_1732639 Genomic Sequence for Oryza sativa, Nipponbare
           strain, clone OSJNBa0032G08, from Chromosome 3, complete
           sequence.
          Length = 718

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 58/198 (29%), Positives = 81/198 (40%), Gaps = 9/198 (4%)
 Frame = +3

Query: 180 IVAFTDNNDYVAIKAL---------RDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSL 332
           + A TD ND   +  L           GW+      A G DPCG  W+G+ C+GS V ++
Sbjct: 30  VAADTDPNDVTVLNTLFTSLNSPGQLKGWQ------ASGGDPCGQSWQGITCSGSSVTAI 83

Query: 333 TLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLI 512
            L S+ L+G L+ ++  +  L  +D+S N    G   +      KL  L L G  F G +
Sbjct: 84  KLPSLGLSGNLAYNMNTMGSLIEIDMSQNNLGGGQQIQYNLPTNKLERLNLAGNQFTGNL 143

Query: 513 PDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM 692
           P SI                 G I      L  L  LDL+ N L G +P       G   
Sbjct: 144 PYSIFSMSNLKYLNLNHNQLQGNITDVFSSLYSLTTLDLSFNSLAGDLP------QGFTS 197

Query: 693 LVGTKHFHFGXNKFSGEI 746
           L   K  +   N+F+G I
Sbjct: 198 LSSLKKLYLQNNQFTGYI 215



>gb:AB025621_1516426 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MFG13.
          Length = 895

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 61/165 (36%), Positives = 75/165 (45%), Gaps = 10/165 (6%)
 Frame = +3

Query: 291 WEGVGCN--GSRVVSLTLSSMDLTGELSGD----IEELSELQILDLSYNKDLTGSLPREI 452
           W GV CN   + VVS+ LSS +L G LSG       EL EL I D S+    +G  P EI
Sbjct: 66  WSGVRCNQNSTSVVSVDLSSKNLAGSLSGKEFLVFTELLELNISDNSF----SGEFPAEI 121

Query: 453 -GNLKKLYNLILVGCGFFGLIPDSIGXXXX---XXXXXXXXXXFIGPIPPSLGQLSELYW 620
             N+  L +L +    F G  PD  G                 F GP+P  L QL  L  
Sbjct: 122 FFNMTNLRSLDISRNNFSGRFPDGNGGDSSLKNLIFLDALSNSFSGPLPIHLSQLENLKV 181

Query: 621 LDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           L+LA +  TGSIP   G+   L+ L      H G N  SG IP +
Sbjct: 182 LNLAGSYFTGSIPSQYGSFKNLEFL------HLGGNLLSGHIPQE 220



 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 45/143 (31%), Positives = 66/143 (46%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           ++ L   S   +G L   + +L  L++L+L+     TGS+P + G+ K L  L L G   
Sbjct: 155 LIFLDALSNSFSGPLPIHLSQLENLKVLNLA-GSYFTGSIPSQYGSFKNLEFLHLGGNLL 213

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IP  +G              + G IP  +G +SEL +LD+A   L+G +P    N  
Sbjct: 214 SGHIPQELGNLTTLTHMEIGYNSYEGVIPWEIGYMSELKYLDIAGANLSGFLPKHFSNLT 273

Query: 681 GLDMLVGTKHFHFGXNKFSGEIP 749
            L+ L     F F  N  S EIP
Sbjct: 274 KLESL-----FLF-RNHLSREIP 290



 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 37/117 (31%), Positives = 58/117 (49%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N +++ SL L    L+ E+  ++ E++ L  LDLS N  ++G++P     LK L  L L+
Sbjct: 271 NLTKLESLFLFRNHLSREIPWELGEITSLVNLDLSDNH-ISGTIPESFSGLKNLRLLNLM 329

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
                G +P+ I               F G +P SLG  S+L W+D++ N   G IP
Sbjct: 330 FNEMSGTLPEVIAQLPSLDTLFIWNNYFSGSLPKSLGMNSKLRWVDVSTNSFQGEIP 386



 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 44/167 (26%), Positives = 65/167 (38%), Gaps = 24/167 (14%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +V+L LS   ++G +      L  L++L+L +N +++G+LP  I  L  L  L +    F
Sbjct: 299 LVNLDLSDNHISGTIPESFSGLKNLRLLNLMFN-EMSGTLPEVIAQLPSLDTLFIWNNYF 357

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIP------------------------PSLGQLS 608
            G +P S+G              F G IP                        PSL   S
Sbjct: 358 SGSLPKSLGMNSKLRWVDVSTNSFQGEIPQGICSRGVLFKLILFSNNFTGTLSPSLSNCS 417

Query: 609 ELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            L  + L DN  +G IP S    P +       +     NK +G IP
Sbjct: 418 TLVRIRLEDNSFSGVIPFSFSEIPDI------SYIDLSRNKLTGGIP 458



 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 36/133 (27%), Positives = 62/133 (46%), Gaps = 1/133 (0%)
 Frame = +3

Query: 354 TGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXX 533
           +G L   +   S+L+ +D+S N    G +P+ I +   L+ LIL    F G +  S+   
Sbjct: 358 SGSLPKSLGMNSKLRWVDVSTNS-FQGEIPQGICSRGVLFKLILFSNNFTGTLSPSLSNC 416

Query: 534 XXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHF 713
                       F G IP S  ++ ++ ++DL+ N+LTG IP+       LD      +F
Sbjct: 417 STLVRIRLEDNSFSGVIPFSFSEIPDISYIDLSRNKLTGGIPLDISKATKLD------YF 470

Query: 714 HFGXN-KFSGEIP 749
           +   N +  G++P
Sbjct: 471 NISNNPELGGKLP 483



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 42/164 (25%), Positives = 65/164 (39%), Gaps = 24/164 (14%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L+    TG +         L+ L L  N  L+G +P+E+GNL  L ++ +    + G+
Sbjct: 182 LNLAGSYFTGSIPSQYGSFKNLEFLHLGGNL-LSGHIPQELGNLTTLTHMEIGYNSYEGV 240

Query: 510 IPDSIGXXXXXXXXXXXXXXFIG------------------------PIPPSLGQLSELY 617
           IP  IG                G                         IP  LG+++ L 
Sbjct: 241 IPWEIGYMSELKYLDIAGANLSGFLPKHFSNLTKLESLFLFRNHLSREIPWELGEITSLV 300

Query: 618 WLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            LDL+DN ++G+IP S      L +L      +   N+ SG +P
Sbjct: 301 NLDLSDNHISGTIPESFSGLKNLRLL------NLMFNEMSGTLP 338



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 30/110 (27%), Positives = 46/110 (41%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           + LS   LTG +  DI + ++L   ++S N +L G LP  I +   L N     C   G 
Sbjct: 446 IDLSRNKLTGGIPLDISKATKLDYFNISNNPELGGKLPPHIWSAPSLQNFSASSCSISGG 505

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
           +P                    G + P++     L  +DL+ N L G+IP
Sbjct: 506 LP-VFESCKSITVIELSNNNISGMLTPTVSTCGSLKKMDLSHNNLRGAIP 554



>gb:AE016959_1023023 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC022457_1538988
           Oryza sativa chromosome 10 BAC OSJNBa0006L06 genomic
           sequence, complete sequence.>gb:AE017103_1752842 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           57 of 77 of the complete sequence.
          Length = 1278

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 49/145 (33%), Positives = 68/145 (46%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S++  L L +   TG +  ++ EL  L  LDLS N  LTG +P   GNLK+L  L L   
Sbjct: 406 SKLNILYLFTNKFTGSIPAELGELENLTELDLSVNS-LTGPIPSSFGNLKQLTKLALFFN 464

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G+IP  IG                G +P ++  L  L +L + DN ++G+IP   G 
Sbjct: 465 NLTGVIPPEIGNMTALQSLDVNTNSLHGELPATITALRSLQYLAVFDNHMSGTIPADLGK 524

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIP 749
              L      +H  F  N FSGE+P
Sbjct: 525 GLAL------QHVSFTNNSFSGELP 543



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 53/158 (33%), Positives = 77/158 (48%)
 Frame = +3

Query: 282  GDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNL 461
            GD  E  G +  ++V L +S   LTGELS    +   L +L L  N+ ++G +P   G++
Sbjct: 588  GDISEAFGVH-PKLVYLDVSGNKLTGELSSAWGQCINLTLLHLDGNR-ISGGIPAAFGSM 645

Query: 462  KKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQ 641
              L +L L G    G IP  +G              F GPIP SL   S+L  +D + N 
Sbjct: 646  TSLKDLNLAGNNLTGGIPPVLGNIRVFNLNLSHNS-FSGPIPASLSNNSKLQKVDFSGNM 704

Query: 642  LTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L G+IPV+      L +L  +K      N+ SGEIP++
Sbjct: 705  LDGTIPVAISKLDALILLDLSK------NRLSGEIPSE 736



 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 49/143 (34%), Positives = 60/143 (41%), Gaps = 4/143 (2%)
 Frame = +3

Query: 336 LSSMDLTGELSGDI----EELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF 503
           +S+ +LTGE+   +     EL   Q+     N  LTG +P E+G   KL  L L    F 
Sbjct: 364 ISTNNLTGEIPPVLFTSWPELISFQV----QNNSLTGKIPPELGKASKLNILYLFTNKFT 419

Query: 504 GLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPG 683
           G IP  +G                GPIP S G L +L  L L  N LTG IP   GN   
Sbjct: 420 GSIPAELGELENLTELDLSVNSLTGPIPSSFGNLKQLTKLALFFNNLTGVIPPEIGNMTA 479

Query: 684 LDMLVGTKHFHFGXNKFSGEIPA 752
           L  L          N   GE+PA
Sbjct: 480 LQSL------DVNTNSLHGELPA 496



 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 67/206 (32%), Positives = 87/206 (42%), Gaps = 6/206 (2%)
 Frame = +3

Query: 144 LLLVPLFIQFLGIVAFTDNNDYVAIKA-LRDGWKNVPPSWAEGSDPCGDHWEGVGCN--- 311
           L L+ L +      A T+ +  +A KA L+DG   +   W+  +  C   W GV C+   
Sbjct: 8   LRLLLLVVVVAAADAATEADALLAWKAGLQDGAAALS-GWSRAAPVCA--WRGVACDAAA 64

Query: 312 -GSRVVSLTLSSMDLTGELSG-DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
            G+RV SL L    L G L   D   L  L  LDL+ N + TG++P  I  L+ L +L L
Sbjct: 65  GGARVTSLRLRGAGLGGGLDALDFAALPALAELDLNGN-NFTGAIPASISRLRSLASLDL 123

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
              GF     DSI                    PP LG LS L  L L +N L G+IP  
Sbjct: 124 GNNGF----SDSI--------------------PPQLGDLSGLVDLRLYNNNLVGAIPHQ 159

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGE 743
                 L  L    HF  G N  + E
Sbjct: 160 ------LSRLPKVAHFDLGANYLTDE 179



 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 45/146 (30%), Positives = 66/146 (45%), Gaps = 1/146 (0%)
 Frame = +3

Query: 318  RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
            RV +L LS    +G +   +   S+LQ +D S N  L G++P  I  L  L  L L    
Sbjct: 670  RVFNLNLSHNSFSGPIPASLSNNSKLQKVDFSGNM-LDGTIPVAISKLDALILLDLSKNR 728

Query: 498  FFGLIPDSIGXXXXXXXXXXXXXXFI-GPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G IP  +G               + G IPP+L +L  L  L+L+ N+L+GSIP     
Sbjct: 729  LSGEIPSELGNLAQLQILLDLSSNSLSGAIPPNLEKLITLQRLNLSHNELSGSIPA---- 784

Query: 675  TPGLDMLVGTKHFHFGXNKFSGEIPA 752
              G   +   +   F  N+ +G IP+
Sbjct: 785  --GFSRMSSLESVDFSYNRLTGSIPS 808



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 45/172 (26%), Positives = 72/172 (41%), Gaps = 24/172 (13%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + + SL +++  L GEL   I  L  LQ L + ++  ++G++P ++G    L ++   
Sbjct: 476 NMTALQSLDVNTNSLHGELPATITALRSLQYLAV-FDNHMSGTIPADLGKGLALQHVSFT 534

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSL-----------------GQLSE-- 611
              F G +P  I               F G +PP L                 G +SE  
Sbjct: 535 NNSFSGELPRHICDGFALDHLTANYNNFTGALPPCLKNCTALVRVRLEENHFTGDISEAF 594

Query: 612 -----LYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
                L +LD++ N+LTG +  + G    L +L      H   N+ SG IPA
Sbjct: 595 GVHPKLVYLDVSGNKLTGELSSAWGQCINLTLL------HLDGNRISGGIPA 640



 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 44/145 (30%), Positives = 60/145 (41%), Gaps = 1/145 (0%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           +V    L +  LT E       +  +  + L Y     GS P  I     +  L L    
Sbjct: 165 KVAHFDLGANYLTDEDFAKFSPMPTVTFMSL-YLNSFNGSFPEFILKSGNVTYLDLSQNT 223

Query: 498 FFGLIPDSIGXXX-XXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
            FG IPD++                F GPIP SLG+L++L  L +A N LTG +P   G+
Sbjct: 224 LFGKIPDTLPEKLPNLRYLNLSINAFSGPIPASLGKLTKLQDLRMAANNLTGGVPEFLGS 283

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIP 749
            P L +L        G N+  G IP
Sbjct: 284 MPQLRIL------ELGDNQLGGPIP 302



 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 37/166 (22%), Positives = 68/166 (40%), Gaps = 19/166 (11%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           +++  L +++ +LTG +   +  + +L+IL+L  N+ L G +P  +G L+ L  L +   
Sbjct: 261 TKLQDLRMAANNLTGGVPEFLGSMPQLRILELGDNQ-LGGPIPPVLGQLQMLQRLDIKNS 319

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP----- 659
           G    +P  +G                G +PP    +  + +  ++ N LTG IP     
Sbjct: 320 GLSSTLPSQLGNLKNLIFFELSLNQLSGGLPPEFAGMRAMRYFGISTNNLTGEIPPVLFT 379

Query: 660 --------------VSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
                         ++    P L         +   NKF+G IPA+
Sbjct: 380 SWPELISFQVQNNSLTGKIPPELGKASKLNILYLFTNKFTGSIPAE 425



>gb:AE016959_1022229 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC113338_1739022
           Oryza sativa (japonica cultivar-group) cultivar
           Nipponbare clone OSJNBa0091J06 from chromosome 10,
           complete sequence.>gb:AE017085_1752048 Oryza sativa
           (japonica cultivar-group) chromosome 10, section 39 of
           77 of the complete sequence.
          Length = 1067

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 52/148 (35%), Positives = 75/148 (50%), Gaps = 1/148 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELS-ELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           N +R+ ++T+ +  L G L   I  LS +L++LD+ +NK ++G +P  I N  KL  L L
Sbjct: 365 NCTRLRAVTIQNNRLGGALPNSITNLSAQLELLDIGFNK-ISGKIPDGINNFLKLIKLGL 423

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
               F G IPDSIG                G IP SLG L++L  L L +N L G +P S
Sbjct: 424 SNNRFSGPIPDSIGRLETLQYLTLENNLLSGIIPSSLGNLTQLQQLSLDNNSLEGPLPAS 483

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            GN     +++ T    F  NK   ++P
Sbjct: 484 IGNLQ--QLIIAT----FSNNKLRDQLP 505



 Score = 69.7 bits (169), Expect = 5e-11
 Identities = 50/148 (33%), Positives = 70/148 (47%), Gaps = 1/148 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQ-ILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           N  +++  T S+  L  +L GDI  L  L  ILDLS N   +GSLP  +G L KL  L +
Sbjct: 486 NLQQLIIATFSNNKLRDQLPGDIFNLPSLSYILDLSRNH-FSGSLPSAVGGLTKLTYLYM 544

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
               F GL+P+S+               F G IP S+ ++  L  L+L  N L G+IP  
Sbjct: 545 YSNNFSGLLPNSLSNCQSLMELHLDDNFFNGTIPVSVSKMRGLVLLNLTKNSLLGAIP-- 602

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
                 L ++ G K  +   N  S +IP
Sbjct: 603 ----QDLRLMDGLKELYLSHNNLSAQIP 626



 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 75/267 (28%), Positives = 97/267 (36%), Gaps = 59/267 (22%)
 Frame = +3

Query: 126 MIPRIQLLLVPLFIQFLGI-----VAFTDNNDYVAIKALRDGWKNVPP---SWAEGSDPC 281
           M   ++LLL+P  +          + F++N D  A+   + G  +      SW   +  C
Sbjct: 1   MFTALKLLLLPYLLLLASASCTQGLPFSNNTDLDALLGFKAGLSHQSDALASWNTTTSYC 60

Query: 282 GDHWEGVGCNG---SRVVSLTLSSMDLTGELSGDIEEL---------------------- 386
              W GV C+     RV++L L+S  L G +S  I  L                      
Sbjct: 61  --QWSGVICSHRHKQRVLALNLTSTGLHGYISASIGNLTYLRSLDLSCNQLYGEIPLTIG 118

Query: 387 --SELQILDLSYNKDLTGSLPREIGNLKKLYNLILV-------------GC--------- 494
             S+L  LDLS N    G +PR IG L +L  L L               C         
Sbjct: 119 WLSKLSYLDLS-NNSFQGEIPRTIGQLPQLSYLYLSNNSLQGEITDELRNCTNLASIKLD 177

Query: 495 --GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IPD  G              F G IP SLG LS L  L L +N LTG IP + 
Sbjct: 178 LNSLNGKIPDWFGGFLKLNSISVGKNIFTGIIPQSLGNLSALSELFLNENHLTGPIPEAL 237

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           G    L+ L          N  SG IP
Sbjct: 238 GKISSLERLA------LQVNHLSGTIP 258



 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 42/147 (28%), Positives = 65/147 (44%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + + S+ L    L G++        +L  + +  N   TG +P+ +GNL  L  L L 
Sbjct: 167 NCTNLASIKLDLNSLNGKIPDWFGGFLKLNSISVGKNI-FTGIIPQSLGNLSALSELFLN 225

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP+++G                G IP +L  LS L  + L +N+L G +P   
Sbjct: 226 ENHLTGPIPEALGKISSLERLALQVNHLSGTIPRTLLNLSSLIHIGLQENELHGRLPSDL 285

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           GN  GL  +   ++F    N F+G IP
Sbjct: 286 GN--GLPKI---QYFIVALNHFTGSIP 307



 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 37/122 (30%), Positives = 57/122 (46%), Gaps = 1/122 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +  L L+   LTG +   + ++S L+ L L  N  L+G++PR + NL  L ++ L 
Sbjct: 215 NLSALSELFLNENHLTGPIPEALGKISSLERLALQVNH-LSGTIPRTLLNLSSLIHIGLQ 273

Query: 489 GCGFFGLIPDSIGXXX-XXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                G +P  +G               F G IPPS+   + +  +DL+ N  TG IP  
Sbjct: 274 ENELHGRLPSDLGNGLPKIQYFIVALNHFTGSIPPSIANATNMRSIDLSSNNFTGIIPPE 333

Query: 666 DG 671
            G
Sbjct: 334 IG 335



>gb:AE016959_1020712 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079179_1732383
           Oryza sativa chromosome 10 clone OSJNBa0079B05, complete
           sequence.>gb:AC116601_1739309 Oryza sativa chromosome 10
           clone OSJNAa0079B05, complete
           sequence.>gb:AE017051_1750531 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 5 of 77 of the
           complete sequence.
          Length = 1098

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 61/214 (28%), Positives = 83/214 (38%), Gaps = 49/214 (22%)
 Frame = +3

Query: 255 SWAEGSDPCGDHWEGVGCNGSR-------------------------------VVSLTLS 341
           SW   + PC  +W G+ C  +                                +  + LS
Sbjct: 37  SWQASTSPC--NWTGITCRAAHQAMSWVITNISLPDAGIHGQLGELNFSSLPFLTYIDLS 94

Query: 342 SMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDS 521
           S  + G +   I  LS L  LDL  N+ LTG +P EI  L++L  L L      G IP S
Sbjct: 95  SNSVYGPIPSSISSLSALTYLDLQLNQ-LTGRMPDEISELQRLTMLDLSYNNLTGHIPAS 153

Query: 522 IGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS------------ 665
           +G                GPIP  +G L+ L  L L++N L+G IP +            
Sbjct: 154 VGNLTMITELSIHRNMVSGPIPKEIGMLANLQLLQLSNNTLSGEIPTTLANLTNLDTFYL 213

Query: 666 DGN------TPGLDMLVGTKHFHFGXNKFSGEIP 749
           DGN       P L  L   ++   G NK +GEIP
Sbjct: 214 DGNELSGPVPPKLCKLTNLQYLALGDNKLTGEIP 247



 Score = 72.4 bits (176), Expect = 8e-12
 Identities = 52/147 (35%), Positives = 70/147 (47%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N ++++ L L    + G +  +I  L+ L  L L+ NK L GSLP E+GNL  L NL L 
Sbjct: 252 NLTKMIKLYLFRNQIIGSIPPEIGNLAMLTDLVLNENK-LKGSLPTELGNLTMLNNLFLH 310

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP  +G                G IP +L  L++L  LDL+ NQ+ GSIP   
Sbjct: 311 ENQITGSIPPGLGIISNLQNLILHSNQISGSIPGTLANLTKLIALDLSKNQINGSIPQEF 370

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           GN   L +L          N+ SG IP
Sbjct: 371 GNLVNLQLL------SLEENQISGSIP 391



 Score = 69.7 bits (169), Expect = 5e-11
 Identities = 49/138 (35%), Positives = 66/138 (47%)
 Frame = +3

Query: 336 LSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIP 515
           L   +L+G +   + +L+ LQ L L  NK LTG +P  IGNL K+  L L      G IP
Sbjct: 213 LDGNELSGPVPPKLCKLTNLQYLALGDNK-LTGEIPTCIGNLTKMIKLYLFRNQIIGSIP 271

Query: 516 DSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDML 695
             IG                G +P  LG L+ L  L L +NQ+TGSIP      PGL ++
Sbjct: 272 PEIGNLAMLTDLVLNENKLKGSLPTELGNLTMLNNLFLHENQITGSIP------PGLGII 325

Query: 696 VGTKHFHFGXNKFSGEIP 749
              ++     N+ SG IP
Sbjct: 326 SNLQNLILHSNQISGSIP 343



 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 51/170 (30%), Positives = 70/170 (41%), Gaps = 23/170 (13%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNK-----------------------D 425
           S +  L L    LTG +  +I EL  L +LDLSYN                         
Sbjct: 110 SALTYLDLQLNQLTGRMPDEISELQRLTMLDLSYNNLTGHIPASVGNLTMITELSIHRNM 169

Query: 426 LTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQL 605
           ++G +P+EIG L  L  L L      G IP ++                 GP+PP L +L
Sbjct: 170 VSGPIPKEIGMLANLQLLQLSNNTLSGEIPTTLANLTNLDTFYLDGNELSGPVPPKLCKL 229

Query: 606 SELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           + L +L L DN+LTG IP   GN   +  L      +   N+  G IP +
Sbjct: 230 TNLQYLALGDNKLTGEIPTCIGNLTKMIKL------YLFRNQIIGSIPPE 273



 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 45/149 (30%), Positives = 68/149 (45%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + +  L L+   L G L  ++  L+ L  L L  N+ +TGS+P  +G +  L NLIL 
Sbjct: 276 NLAMLTDLVLNENKLKGSLPTELGNLTMLNNLFLHENQ-ITGSIPPGLGIISNLQNLILH 334

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP ++                 G IP   G L  L  L L +NQ++GSIP S 
Sbjct: 335 SNQISGSIPGTLANLTKLIALDLSKNQINGSIPQEFGNLVNLQLLSLEENQISGSIPKSL 394

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
           GN   +      ++ +F  N+ S  +P +
Sbjct: 395 GNFQNM------QNLNFRSNQLSNSLPQE 417



 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 41/140 (29%), Positives = 66/140 (47%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L ++   +TG +   + +L  L  L LS N  + G +P EIGNL  LY+L L      G 
Sbjct: 523 LNIAENMITGTIPPALSKLPNLVELKLSSNH-VNGVIPPEIGNLINLYSLNLSFNKLSGS 581

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP  +G                GPIP  LG+ ++L  L + +N  +G++P + GN   + 
Sbjct: 582 IPSQLGNLRDLEYLDVSRNSLSGPIPEELGRCTKLQLLRINNNHFSGNLPATIGNLASIQ 641

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
           +++   +     NK  G +P
Sbjct: 642 IMLDVSN-----NKLDGLLP 656



 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 47/167 (28%), Positives = 70/167 (41%), Gaps = 18/167 (10%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + +V L L+S  L+G+L  +I   + L++L LS N    G +PR +     L  L L 
Sbjct: 420 NITNMVELDLASNSLSGQLPANICAGTSLKLLFLSLNM-FNGPVPRSLKTCTSLVRLFLD 478

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
           G    G I    G                G I P  G   EL  L++A+N +TG+IP + 
Sbjct: 479 GNQLTGDISKHFGVYPKLKKMSLMSNRLSGQISPKWGACPELAILNIAENMITGTIPPAL 538

Query: 669 GNTPGL-DMLVGTKH-----------------FHFGXNKFSGEIPAQ 755
              P L ++ + + H                  +   NK SG IP+Q
Sbjct: 539 SKLPNLVELKLSSNHVNGVIPPEIGNLINLYSLNLSFNKLSGSIPSQ 585



 Score = 56.2 bits (134), Expect = 6e-07
 Identities = 47/173 (27%), Positives = 67/173 (38%), Gaps = 23/173 (13%)
 Frame = +3

Query: 297 GVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNK------------------ 422
           G   N +++++L LS   + G +  +   L  LQ+L L  N+                  
Sbjct: 344 GTLANLTKLIALDLSKNQINGSIPQEFGNLVNLQLLSLEENQISGSIPKSLGNFQNMQNL 403

Query: 423 -----DLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIP 587
                 L+ SLP+E GN+  +  L L      G +P +I               F GP+P
Sbjct: 404 NFRSNQLSNSLPQEFGNITNMVELDLASNSLSGQLPANICAGTSLKLLFLSLNMFNGPVP 463

Query: 588 PSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEI 746
            SL   + L  L L  NQLTG I    G  P L      K      N+ SG+I
Sbjct: 464 RSLKTCTSLVRLFLDGNQLTGDISKHFGVYPKL------KKMSLMSNRLSGQI 510



 Score = 56.2 bits (134), Expect = 6e-07
 Identities = 42/142 (29%), Positives = 59/142 (41%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           +L L    +TG +   +  +S LQ L L  N+ ++GS+P  + NL KL  L L      G
Sbjct: 306 NLFLHENQITGSIPPGLGIISNLQNLILHSNQ-ISGSIPGTLANLTKLIALDLSKNQING 364

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
            IP   G                G IP SLG    +  L+   NQL+ S+P   GN    
Sbjct: 365 SIPQEFGNLVNLQLLSLEENQISGSIPKSLGNFQNMQNLNFRSNQLSNSLPQEFGN---- 420

Query: 687 DMLVGTKHFHFGXNKFSGEIPA 752
             +          N  SG++PA
Sbjct: 421 --ITNMVELDLASNSLSGQLPA 440



>pir|B84852|B84852 probable receptor-like protein kinase [imported]
           - Arabidopsis thaliana>gb:AC005956_1533227 Arabidopsis
           thaliana chromosome 2 clone MHK10 map EG05C12, complete
           sequence.
          Length = 646

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 58/188 (30%), Positives = 78/188 (41%), Gaps = 4/188 (2%)
 Frame = +3

Query: 198 NNDYVAIKALRDGWKNVPPS----WAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL 365
           N+D +++ AL+    N P      W+E SDP   HW G+ C   RV +L L         
Sbjct: 25  NSDGLSLLALKSAVDNDPTRVMTHWSE-SDPTPCHWSGIVCTNGRVTTLVL--------- 74

Query: 366 SGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXX 545
                           + K L+G +P E+G L  L  L L    F   IP  +       
Sbjct: 75  ----------------FGKSLSGYIPSELGLLNSLNRLDLAHNNFSKTIPVRLFEATKLR 118

Query: 546 XXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGX 725
                     GPIP  +  +  L  LD + N L GS+P S      L  LVGT +F F  
Sbjct: 119 YIDLSHNSLSGPIPAQIKSMKSLNHLDFSSNHLNGSLPES---LTELGSLVGTLNFSF-- 173

Query: 726 NKFSGEIP 749
           N+F+GEIP
Sbjct: 174 NQFTGEIP 181



>pir|B84431|B84431 probable receptor protein kinase [imported] -
           Arabidopsis thaliana>gb:AC006532_1534365 Arabidopsis
           thaliana chromosome 2 clone F14H20 map CIC11A04,
           complete sequence.>gb:AY074313_1567471 Arabidopsis
           thaliana putative receptor protein kinase (At2g01950)
           mRNA, complete cds.
          Length = 1143

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 48/135 (35%), Positives = 63/135 (46%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           +TGE+   I + SEL+ +DLS N  L G++P EIGNL+KL   I       G IP  IG 
Sbjct: 387 VTGEIPPAISQCSELRTIDLSLNY-LNGTIPPEIGNLQKLEQFIAWYNNIAGEIPPEIGK 445

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH 710
                          G IPP     S + W+    N+LTG +P   G    L +L     
Sbjct: 446 LQNLKDLILNNNQLTGEIPPEFFNCSNIEWVSFTSNRLTGEVPKDFGILSRLAVL----- 500

Query: 711 FHFGXNKFSGEIPAQ 755
              G N F+GEIP +
Sbjct: 501 -QLGNNNFTGEIPPE 514



 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 40/118 (33%), Positives = 53/118 (44%)
 Frame = +3

Query: 348 DLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG 527
           ++ GE+  +I +L  L+ L L+ N  LTG +P E  N   +  +        G +P   G
Sbjct: 434 NIAGEIPPEIGKLQNLKDLILN-NNQLTGEIPPEFFNCSNIEWVSFTSNRLTGEVPKDFG 492

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVG 701
                         F G IPP LG+ + L WLDL  N LTG IP   G  PG   L G
Sbjct: 493 ILSRLAVLQLGNNNFTGEIPPELGKCTTLVWLDLNTNHLTGEIPPRLGRQPGSKALSG 550



 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 50/149 (33%), Positives = 70/149 (46%), Gaps = 2/149 (1%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGN-LKKLYNLIL 485
           N + + SL LS  +  G++     EL  LQ LDLS+N+ LTG +P EIG+  + L NL L
Sbjct: 226 NCTNLKSLNLSYNNFDGQIPKSFGELKLLQSLDLSHNR-LTGWIPPEIGDTCRSLQNLRL 284

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPS-LGQLSELYWLDLADNQLTGSIPV 662
               F G+IP+S+                 GP P + L     L  L L++N ++G  P 
Sbjct: 285 SYNNFTGVIPESLSSCSWLQSLDLSNNNISGPFPNTILRSFGSLQILLLSNNLISGDFPT 344

Query: 663 SDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           S      L +        F  N+FSG IP
Sbjct: 345 SISACKSLRIA------DFSSNRFSGVIP 367



 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 51/149 (34%), Positives = 71/149 (47%), Gaps = 4/149 (2%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSE-LQILDLSYNKDLTG---SLPREIGNLKKLYNLI 482
           S ++S+TLS  + TG+L  D+   S+ LQ LDLSYN ++TG    L   + +   +  L 
Sbjct: 152 SNLISITLSYNNFTGKLPNDLFLSSKKLQTLDLSYN-NITGPISGLTIPLSSCVSMTYLD 210

Query: 483 LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPV 662
             G    G I DS+               F G IP S G+L  L  LDL+ N+LTG IP 
Sbjct: 211 FSGNSISGYISDSLINCTNLKSLNLSYNNFDGQIPKSFGELKLLQSLDLSHNRLTGWIPP 270

Query: 663 SDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
             G+T         ++     N F+G IP
Sbjct: 271 EIGDT-----CRSLQNLRLSYNNFTGVIP 294



 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 43/113 (38%), Positives = 54/113 (47%), Gaps = 4/113 (3%)
 Frame = +3

Query: 333 TLSSMDLTGELSGDIEEL----SELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +L S D T   SG I  L      ++ LDLSYN+ L G +P EIG +  L  L L     
Sbjct: 589 SLKSCDFTRMYSGPILSLFTRYQTIEYLDLSYNQ-LRGKIPDEIGEMIALQVLELSHNQL 647

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
            G IP +IG                G IP S   LS L  +DL++N+LTG IP
Sbjct: 648 SGEIPFTIGQLKNLGVFDASDNRLQGQIPESFSNLSFLVQIDLSNNELTGPIP 700



 Score = 42.7 bits (99), Expect = 0.007
 Identities = 46/166 (27%), Positives = 68/166 (40%), Gaps = 21/166 (12%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNL---KKLYNLI- 482
           SR+  L L + + TGE+  ++ + + L  LDL+ N  LTG +P  +G     K L  L+ 
Sbjct: 495 SRLAVLQLGNNNFTGEIPPELGKCTTLVWLDLNTNH-LTGEIPPRLGRQPGSKALSGLLS 553

Query: 483 -------------LVGCG----FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSE 611
                          G G    F G+ P+ +               + GPI     +   
Sbjct: 554 GNTMAFVRNVGNSCKGVGGLVEFSGIRPERL-LQIPSLKSCDFTRMYSGPILSLFTRYQT 612

Query: 612 LYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           + +LDL+ NQL G IP   G    L +L          N+ SGEIP
Sbjct: 613 IEYLDLSYNQLRGKIPDEIGEMIALQVL------ELSHNQLSGEIP 652



>pir|B86465|B86465 probable Protein kinase [imported] - Arabidopsis
           thaliana>gb:AE005172_892214 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC015446_1537977 Arabidopsis thaliana
           chromosome I BAC F12G12 genomic sequence, complete
           sequence.
          Length = 1064

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 51/143 (35%), Positives = 69/143 (48%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           +L L   +++G +   +   SEL+ L L  NK LTGS+P+E+G L+K+ +L+L G    G
Sbjct: 240 TLALYDTEISGTIPPQLGLCSELRNLYLHMNK-LTGSIPKELGKLQKITSLLLWGNSLSG 298

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
           +IP  I                 G IP  LG+L  L  L L+DN  TG IP    N   L
Sbjct: 299 VIPPEISNCSSLVVFDVSANDLTGDIPGDLGKLVWLEQLQLSDNMFTGQIPWELSNCSSL 358

Query: 687 DMLVGTKHFHFGXNKFSGEIPAQ 755
             L          NK SG IP+Q
Sbjct: 359 IAL------QLDKNKLSGSIPSQ 375



 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 47/143 (32%), Positives = 66/143 (46%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           +V L L     +G L  +I  ++ L++LD+ +N  +TG +P ++GNL  L  L L    F
Sbjct: 478 LVFLDLYMNHFSGGLPYEISNITVLELLDV-HNNYITGDIPAQLGNLVNLEQLDLSRNSF 536

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTP 680
            G IP S G                G IP S+  L +L  LDL+ N L+G IP   G   
Sbjct: 537 TGNIPLSFGNLSYLNKLILNNNLLTGQIPKSIKNLQKLTLLDLSYNSLSGEIPQELGQVT 596

Query: 681 GLDMLVGTKHFHFGXNKFSGEIP 749
            L     T +     N F+G IP
Sbjct: 597 SL-----TINLDLSYNTFTGNIP 614



 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 53/172 (30%), Positives = 70/172 (40%), Gaps = 23/172 (13%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYN----------------------- 419
           N S +V   +S+ DLTG++ GD+ +L  L+ L LS N                       
Sbjct: 306 NCSSLVVFDVSANDLTGDIPGDLGKLVWLEQLQLSDNMFTGQIPWELSNCSSLIALQLDK 365

Query: 420 KDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLG 599
             L+GS+P +IGNLK L +  L      G IP S G                G IP  L 
Sbjct: 366 NKLSGSIPSQIGNLKSLQSFFLWENSISGTIPSSFGNCTDLVALDLSRNKLTGRIPEELF 425

Query: 600 QLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            L  L  L L  N L+G +P S      L  L        G N+ SG+IP +
Sbjct: 426 SLKRLSKLLLLGNSLSGGLPKSVAKCQSLVRL------RVGENQLSGQIPKE 471



 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 47/144 (32%), Positives = 65/144 (45%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           R+  L L    L+G L   + +   L  L +  N+ L+G +P+EIG L+ L  L L    
Sbjct: 429 RLSKLLLLGNSLSGGLPKSVAKCQSLVRLRVGENQ-LSGQIPKEIGELQNLVFLDLYMNH 487

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNT 677
           F G +P  I                 G IP  LG L  L  LDL+ N  TG+IP+S GN 
Sbjct: 488 FSGGLPYEISNITVLELLDVHNNYITGDIPAQLGNLVNLEQLDLSRNSFTGNIPLSFGNL 547

Query: 678 PGLDMLVGTKHFHFGXNKFSGEIP 749
             L+ L+         N  +G+IP
Sbjct: 548 SYLNKLI------LNNNLLTGQIP 565



 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 47/142 (33%), Positives = 57/142 (40%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L    L G +      L  LQ   L  N +L G +P ++G LK L  L     G  G 
Sbjct: 168 LCLQDNLLNGSIPSSFGSLVSLQQFRLGGNTNLGGPIPAQLGFLKNLTTLGFAASGLSGS 227

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP + G                G IPP LG  SEL  L L  N+LTGSIP   G    + 
Sbjct: 228 IPSTFGNLVNLQTLALYDTEISGTIPPQLGLCSELRNLYLHMNKLTGSIPKELGKLQKIT 287

Query: 690 MLVGTKHFHFGXNKFSGEIPAQ 755
            L+         N  SG IP +
Sbjct: 288 SLL------LWGNSLSGVIPPE 303



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 59/207 (28%), Positives = 86/207 (41%), Gaps = 21/207 (10%)
 Frame = +3

Query: 198 NNDYVAIKALRDGWKNVPPSW-AEGSDPCGDHWEGVGCNG-SRVVSLTLSSMDLTGELSG 371
           ++D  A+ +L+    ++  SW  +   PC   W G+ C+  +RV+S+++    L      
Sbjct: 28  SSDGQALLSLKRPSPSLFSSWDPQDQTPCS--WYGITCSADNRVISVSIPDTFLNLSSIP 85

Query: 372 DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXX 551
           D+  LS LQ L+LS + +L+G +P   G L  L  L L                      
Sbjct: 86  DLSSLSSLQFLNLS-STNLSGPIPPSFGKLTHLRLLDL---------------------- 122

Query: 552 XXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDM------------- 692
                   GPIP  LG+LS L +L L  N+L+GSIP    N   L +             
Sbjct: 123 --SSNSLSGPIPSELGRLSTLQFLILNANKLSGSIPSQISNLFALQVLCLQDNLLNGSIP 180

Query: 693 -----LVGTKHFHFGXN-KFSGEIPAQ 755
                LV  + F  G N    G IPAQ
Sbjct: 181 SSFGSLVSLQQFRLGGNTNLGGPIPAQ 207



 Score = 56.2 bits (134), Expect = 6e-07
 Identities = 47/149 (31%), Positives = 66/149 (44%), Gaps = 1/149 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKL-YNLIL 485
           N S +  L L++  LTG++   I+ L +L +LDLSYN  L+G +P+E+G +  L  NL L
Sbjct: 546 NLSYLNKLILNNNLLTGQIPKSIKNLQKLTLLDLSYN-SLSGEIPQELGQVTSLTINLDL 604

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                                       F G IP +   L++L  LDL+ N L G I V 
Sbjct: 605 ------------------------SYNTFTGNIPETFSDLTQLQSLDLSSNSLHGDIKV- 639

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
                 L  L      +   N FSG IP+
Sbjct: 640 ------LGSLTSLASLNISCNNFSGPIPS 662



 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 43/152 (28%), Positives = 59/152 (38%), Gaps = 18/152 (11%)
 Frame = +3

Query: 348 DLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG 527
           +L G +   +  L  L  L  + +  L+GS+P   GNL  L  L L      G IP  +G
Sbjct: 199 NLGGPIPAQLGFLKNLTTLGFAAS-GLSGSIPSTFGNLVNLQTLALYDTEISGTIPPQLG 257

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS-------------- 665
                           G IP  LG+L ++  L L  N L+G IP                
Sbjct: 258 LCSELRNLYLHMNKLTGSIPKELGKLQKITSLLLWGNSLSGVIPPEISNCSSLVVFDVSA 317

Query: 666 ---DGNTPG-LDMLVGTKHFHFGXNKFSGEIP 749
               G+ PG L  LV  +      N F+G+IP
Sbjct: 318 NDLTGDIPGDLGKLVWLEQLQLSDNMFTGQIP 349



>gb:AP005966_1860355 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:B1047H05.>gb:AP007273_1863463 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBb0035K09.
          Length = 1087

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 71/236 (30%), Positives = 101/236 (42%), Gaps = 32/236 (13%)
 Frame = +3

Query: 138 IQLLLVPLFIQFLGIVAFTDN-NDYVAIKALRD---GWKNVPPSWAEGS-DPCGDHWEGV 302
           ++LL +  F  FL +V   +  ND  A+   +    G   V  SW+  S + C   W G+
Sbjct: 12  LRLLYILKFFCFLPLVISNETENDRQALLCFKSQITGSAEVLASWSNASMEFCS--WHGI 69

Query: 303 GCN---GSRVVSLTLSSMDLTGELS------------------------GDIEELSELQI 401
            C+     RV+ L LSS  +TG +S                         +I  LS+L I
Sbjct: 70  TCSIQSPRRVIVLDLSSEGITGCISPCIANLTDLTRLQLSNNSFRGSIPSEIGFLSKLSI 129

Query: 402 LDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGP 581
           LD+S N  L G++P E+ +  KL  + L      G IP + G                G 
Sbjct: 130 LDISMNS-LEGNIPSELTSCSKLQEIDLSNNKLQGRIPSAFGDLTELQTLELASNKLSGY 188

Query: 582 IPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           IPPSLG    L ++DL  N LTG IP S  ++  L +LV         N  SG++P
Sbjct: 189 IPPSLGSNLSLTYVDLGRNALTGEIPESLASSKSLQVLV------LMNNALSGQLP 238



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 48/140 (34%), Positives = 65/140 (46%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L +  L+G+L   +   S L  LDL  N   TG++P  +GNL  L  L L+     G 
Sbjct: 226 LVLMNNALSGQLPVALFNCSSLIDLDLEDNH-FTGTIPSSLGNLSSLIYLSLIANNLVGT 284

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IPD                   GP+PPS+  +S L +L +A+N LTG +P   G+     
Sbjct: 285 IPDIFDHVPTLQTLAVNLNNLSGPVPPSIFNISSLAYLGMANNSLTGRLPSKIGH----- 339

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
           ML   +      NKFSG IP
Sbjct: 340 MLPNIQELILLNNKFSGSIP 359



 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 41/124 (33%), Positives = 60/124 (48%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S++  + LS+  L G +     +L+ELQ L+L+ NK L+G +P  +G+   L  + L   
Sbjct: 149 SKLQEIDLSNNKLQGRIPSAFGDLTELQTLELASNK-LSGYIPPSLGSNLSLTYVDLGRN 207

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G IP+S+                 G +P +L   S L  LDL DN  TG+IP S GN
Sbjct: 208 ALTGEIPESLASSKSLQVLVLMNNALSGQLPVALFNCSSLIDLDLEDNHFTGTIPSSLGN 267

Query: 675 TPGL 686
              L
Sbjct: 268 LSSL 271



 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 48/146 (32%), Positives = 64/146 (43%), Gaps = 4/146 (2%)
 Frame = +3

Query: 327 SLTLSSMD---LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG 497
           SL +  MD   LTG +   I  L  L  L  + N+ L+G +P  IGNL +L  L L G  
Sbjct: 466 SLNMLYMDYNYLTGNIPPTIGYLHNLVFLSFAQNR-LSGQIPGTIGNLVQLNELNLDGNN 524

Query: 498 FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSEL-YWLDLADNQLTGSIPVSDGN 674
             G IP+SI                 G IP  + ++  L   LDL+ N L+G IP   GN
Sbjct: 525 LSGSIPESIHHCAQLKTLNLAHNSLHGTIPVHIFKIFSLSEHLDLSHNYLSGGIPQEVGN 584

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIPA 752
                 L+         N+ SG IP+
Sbjct: 585 ------LINLNKLSISNNRLSGNIPS 604



 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 52/176 (29%), Positives = 71/176 (40%), Gaps = 29/176 (16%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGE--LSGDIEELSELQILDLSYN--------------------- 419
           N S +  L+L++  L G   L G ++ L++L   D++YN                     
Sbjct: 364 NASHLQKLSLANNSLCGPIPLFGSLQNLTKL---DMAYNMLEANDWSFVSSLSNCSRLTE 420

Query: 420 -----KDLTGSLPREIGNLKK-LYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGP 581
                 +L G+LP  IGNL   L  L L       LIP  IG                G 
Sbjct: 421 LMLDGNNLQGNLPSSIGNLSSSLEYLWLRNNQISWLIPPGIGNLKSLNMLYMDYNYLTGN 480

Query: 582 IPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           IPP++G L  L +L  A N+L+G IP + GN      LV     +   N  SG IP
Sbjct: 481 IPPTIGYLHNLVFLSFAQNRLSGQIPGTIGN------LVQLNELNLDGNNLSGSIP 530



 Score = 40.4 bits (93), Expect = 0.035
 Identities = 31/110 (28%), Positives = 47/110 (42%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS   L+G +  ++  L  L  L +S N+ L+G++P  +G    L +L L      G+
Sbjct: 567 LDLSHNYLSGGIPQEVGNLINLNKLSISNNR-LSGNIPSALGQCVILESLELQSNFLEGI 625

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
           IP+S                  G IP  L     L  L+L+ N   G +P
Sbjct: 626 IPESFAKLQSINKLDISHNKLSGKIPEFLASFKSLINLNLSFNNFYGPLP 675



 Score = 38.1 bits (87), Expect = 0.17
 Identities = 23/63 (36%), Positives = 34/63 (53%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           SL L S  L G +     +L  +  LD+S+NK L+G +P  + + K L NL L    F+G
Sbjct: 614 SLELQSNFLEGIIPESFAKLQSINKLDISHNK-LSGKIPEFLASFKSLINLNLSFNNFYG 672

Query: 507 LIP 515
            +P
Sbjct: 673 PLP 675



>gb:AP004991_1846852 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0016O19.
          Length = 978

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 64/212 (30%), Positives = 88/212 (41%), Gaps = 20/212 (9%)
 Frame = +3

Query: 174 LGIVAFTDNNDYVAIKALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSR--VVSLTLSSM 347
           + +    D +  + IK       NV   WA G D C   W GV C+     V +L LS +
Sbjct: 19  VAVAVADDGSTLLEIKKSFRNVDNVLYDWA-GGDYCS--WRGVLCDNVTFAVAALNLSGL 75

Query: 348 DLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG 527
           +L GE+S  +  L  +  +DL  N  L+G +P EIG+   L  L L      G IP S+ 
Sbjct: 76  NLGGEISPAVGRLKGIVSIDLKSN-GLSGQIPDEIGDCSSLKTLDLSFNSLDGDIPFSVS 134

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP---------------- 659
                          IG IP +L QL  L  LDLA N+L+G IP                
Sbjct: 135 KLKHIESLILKNNQLIGVIPSTLSQLPNLKILDLAQNKLSGEIPRLIYWNEVLQYLGLRG 194

Query: 660 --VSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
             +    +P +  L G  +F    N  +G IP
Sbjct: 195 NNLEGSISPDICQLTGLWYFDVKNNSLTGPIP 226



 Score = 68.9 bits (167), Expect = 9e-11
 Identities = 54/157 (34%), Positives = 67/157 (42%), Gaps = 24/157 (15%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           LTG +   I   +  Q+LDLSYNK L+GS+P  IG L+ +  L L G  F G IP  IG 
Sbjct: 221 LTGPIPETIGNCTSFQVLDLSYNK-LSGSIPFNIGFLQ-VATLSLQGNMFTGPIPSVIGL 278

Query: 531 XXXXXXXXXXXXXF------------------------IGPIPPSLGQLSELYWLDLADN 638
                                                  GPIPP LG +S L++L+L DN
Sbjct: 279 MQALAVLDLSYNQLSGPIPSILGNLTYTEKLYMQGNKLTGPIPPELGNMSTLHYLELNDN 338

Query: 639 QLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           QL+G IP      P    L G    +   N F G IP
Sbjct: 339 QLSGFIP------PEFGKLTGLFDLNLANNNFEGPIP 369



 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 46/141 (32%), Positives = 68/141 (48%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L +    LTG +  ++  +S L  L+L+ N+ L+G +P E G L  L++L L    F G 
Sbjct: 309 LYMQGNKLTGPIPPELGNMSTLHYLELNDNQ-LSGFIPPEFGKLTGLFDLNLANNNFEGP 367

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IPD+I                 G IPPSL +L  + +L+L+ N L+GSIP+       LD
Sbjct: 368 IPDNISSCVNLNSFNAYGNRLNGTIPPSLHKLESMTYLNLSSNFLSGSIPIELSRINNLD 427

Query: 690 MLVGTKHFHFGXNKFSGEIPA 752
            L          N  +G IP+
Sbjct: 428 TL------DLSCNMITGPIPS 442



 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 50/142 (35%), Positives = 65/142 (45%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L   +L G +S DI +L+ L   D+  N  LTG +P  IGN      L L      G 
Sbjct: 190 LGLRGNNLEGSISPDICQLTGLWYFDVK-NNSLTGPIPETIGNCTSFQVLDLSYNKLSGS 248

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP +IG              F GPIP  +G +  L  LDL+ NQL+G IP   GN     
Sbjct: 249 IPFNIG-FLQVATLSLQGNMFTGPIPSVIGLMQALAVLDLSYNQLSGPIPSILGN----- 302

Query: 690 MLVGTKHFHFGXNKFSGEIPAQ 755
            L  T+  +   NK +G IP +
Sbjct: 303 -LTYTEKLYMQGNKLTGPIPPE 323



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 34/114 (29%), Positives = 50/114 (43%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           +L LS   +TG +   I  L  L  L+LS N  L G +P EIGNL+ +  + +      G
Sbjct: 428 TLDLSCNMITGPIPSTIGSLEHLLRLNLS-NNGLVGFIPAEIGNLRSIMEIDMSNNHLGG 486

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
           LIP  +G                G +  SL     L  L+++ N L G +P  +
Sbjct: 487 LIPQELGMLQNLMLLNLKNNNITGDV-SSLMNCFSLNILNVSYNNLAGVVPTDN 539



>gb:AP004256_1839206 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1224_G08.>gb:AP004695_1843583 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0474F07.
          Length = 1013

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 51/145 (35%), Positives = 67/145 (46%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           SR+  L LSS  L+G +   +   + L+++DL  NK LTG +P E+G L+ L  L L G 
Sbjct: 142 SRLGYLNLSSNSLSGSIPNTLSS-TYLEVIDLESNK-LTGGIPGELGMLRNLSVLNLAGN 199

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G IP S+G                GPIP  L   S L  L+L  N L G IP     
Sbjct: 200 SLTGNIPISLGSSTSLVSVVLANNTLTGPIPSVLANCSSLQVLNLVSNNLGGGIP----- 254

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIP 749
            P L      +  + G N F+G IP
Sbjct: 255 -PALFNSTSLRRLNLGWNNFTGSIP 278



 Score = 72.8 bits (177), Expect = 6e-12
 Identities = 61/192 (31%), Positives = 86/192 (44%), Gaps = 7/192 (3%)
 Frame = +3

Query: 198 NNDYVAIKALRDGWKNVPP----SWAEGSDPCGDHWEGVGC---NGSRVVSLTLSSMDLT 356
           N D+  +  L+    N P     SW +        W GV C   N SRVV+L L S  L 
Sbjct: 48  NTDFQTLLCLKLHLSNDPGGFLGSWKQNDSIGFCRWPGVTCSKTNTSRVVALDLGSSGLN 107

Query: 357 GELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXX 536
           G++   I  L+ L  +    N+ L+G +P E+G L +L  L L      G IP+++    
Sbjct: 108 GQIPPCITNLTLLARIHFPDNQ-LSGQIPPELGQLSRLGYLNLSSNSLSGSIPNTL-SST 165

Query: 537 XXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFH 716
                        G IP  LG L  L  L+LA N LTG+IP+S G++  L  +V      
Sbjct: 166 YLEVIDLESNKLTGGIPGELGMLRNLSVLNLAGNSLTGNIPISLGSSTSLVSVV------ 219

Query: 717 FGXNKFSGEIPA 752
              N  +G IP+
Sbjct: 220 LANNTLTGPIPS 231



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 45/129 (34%), Positives = 58/129 (44%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           + + +VS+ L++  LTG +   +   S LQ+L+L  N +L G +P  + N   L  L L 
Sbjct: 211 SSTSLVSVVLANNTLTGPIPSVLANCSSLQVLNLVSN-NLGGGIPPALFNSTSLRRLNLG 269

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
              F G IPD                   G IP SLG  S L  L LA N   GSIPVS 
Sbjct: 270 WNNFTGSIPDVSNVDSPLQYLTLSVNGLTGTIPSSLGNFSSLRLLYLAANHFQGSIPVSI 329

Query: 669 GNTPGLDML 695
              P L  L
Sbjct: 330 SKLPNLQEL 338



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 50/169 (29%), Positives = 74/169 (43%), Gaps = 19/169 (11%)
 Frame = +3

Query: 300 VGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL 479
           +G   + + +L L + +++G +  +   L+ L  L +  N  + G++P  IGNL  L +L
Sbjct: 476 IGSLANTLGALWLHANEISGPIPPETGSLTNLVWLRMEQNY-IVGNVPGTIGNLANLNSL 534

Query: 480 ILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
            L      G IP SIG              F GPIP +LG   +L  L+L+ N L GSIP
Sbjct: 535 DLSRNKLSGQIPHSIGKLGQLNELFLQDNNFSGPIPSALGDCKKLVNLNLSCNTLNGSIP 594

Query: 660 VS----DGNTPGLDM---------------LVGTKHFHFGXNKFSGEIP 749
                    T GLD+               L+     +F  N  SG+IP
Sbjct: 595 KELFSLYSLTTGLDLSHNQLSAQIPQEVGSLINIGLLNFSNNHISGKIP 643



 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 45/148 (30%), Positives = 67/148 (45%), Gaps = 1/148 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKK-LYNLIL 485
           N S +  L L S +L G +   +   + L+ L+L +N + TGS+P ++ N+   L  L L
Sbjct: 235 NCSSLQVLNLVSNNLGGGIPPALFNSTSLRRLNLGWN-NFTGSIP-DVSNVDSPLQYLTL 292

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
              G  G IP S+G              F G IP S+ +L  L  LD++ N L G++P S
Sbjct: 293 SVNGLTGTIPSSLGNFSSLRLLYLAANHFQGSIPVSISKLPNLQELDISYNYLPGTVPPS 352

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
             N   L  L          N F+  +P
Sbjct: 353 IFNISSLTYL------SLAVNDFTNTLP 374



>gb:AP004039_1836723 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1006_D05.>gb:AP005846_1858984 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:B1307A11.
          Length = 1115

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 53/148 (35%), Positives = 66/148 (44%)
 Frame = +3

Query: 306 CNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           C G    ++ L S  L G++  +   L  LQ L L  N+ LTGS+P  IG+L  L  LIL
Sbjct: 112 CRGME--NIWLYSNKLQGQIPSEFGSLQNLQALVLGENR-LTGSIPSFIGSLANLKFLIL 168

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
               F G IP  IG                GPIP S+G LS L +L +  N L GSI   
Sbjct: 169 EENNFTGEIPSDIGRLANLTVLGLGSNQLSGPIPASIGNLSALQFLSVFSNNLVGSI--- 225

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
               P +  L   + F  G N   G IP
Sbjct: 226 ----PPMQRLSSLEFFELGKNNIEGSIP 249



 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 49/140 (35%), Positives = 63/140 (45%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS  +LTG +  ++  +S L    +  +  +TG LP E+GNL  L  L        G 
Sbjct: 557 LKLSYNNLTGLIPKELFAISVLSTSLILDHNFITGPLPSEVGNLTNLALLDFSSNLISGE 616

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP SIG                G IPPSL Q   L  LDL+ N L+GSIP   G   GL 
Sbjct: 617 IPSSIGECQSLQYLNTSGNLLQGQIPPSLDQPKGLLLLDLSHNNLSGSIPKFLGTMTGLA 676

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
            L      +   N F G++P
Sbjct: 677 SL------NLSFNNFEGDVP 690



 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 43/147 (29%), Positives = 71/147 (48%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +  L++ S +L G +   ++ LS L+  +L  N ++ GS+P  +GNL  L  + L 
Sbjct: 207 NLSALQFLSVFSNNLVGSIP-PMQRLSSLEFFELGKN-NIEGSIPTWLGNLSSLLTVKLG 264

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
           G    G IP+S+G               +GP+P ++G L  +    + +N+L GS+P S 
Sbjct: 265 GNRLDGNIPESLGKLKLLTSLDLSSNNLVGPVPDTIGNLYSIKQFHVENNELEGSLPSSI 324

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            N   L+ L      +   N  +G IP
Sbjct: 325 FNLSSLEEL------NLQTNNLNGTIP 345



 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 48/150 (32%), Positives = 65/150 (43%), Gaps = 1/150 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELS-ELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           N S +  L +    LTGEL   I  LS  L+    +YN  +TG +P  +GNL  L  + +
Sbjct: 430 NCSNLRLLDVGDNKLTGELPNSIGNLSTRLEYFVTNYNS-MTGKIPEGLGNLVSLKFIEM 488

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
               + G IPDS+G                G IP S+G L  L  L +A N L+G IP S
Sbjct: 489 NNNFYEGTIPDSLGKLKNLNRLYLTNNNLSGSIPSSIGNLRMLTLLSVAGNALSGEIPPS 548

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
             N P        +      N  +G IP +
Sbjct: 549 LSNCP-------LEQLKLSYNNLTGLIPKE 571



 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 40/114 (35%), Positives = 53/114 (46%), Gaps = 1/114 (0%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           + SL LSS +L G +   I  L  ++   +  N +L GSLP  I NL  L  L L     
Sbjct: 282 LTSLDLSSNNLVGPVPDTIGNLYSIKQFHVE-NNELEGSLPSSIFNLSSLEELNLQTNNL 340

Query: 501 FGLIPDSIGXXX-XXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
            G IP  +G               F G IPPSL  +S L W+   +N L+G+IP
Sbjct: 341 NGTIPLDLGNRLPKLQLFLISENQFHGSIPPSLCNISTLRWIQTVNNSLSGTIP 394



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 45/166 (27%), Positives = 65/166 (39%), Gaps = 32/166 (19%)
 Frame = +3

Query: 348 DLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGN-LKKLYNLILVGCGFFGLIPDSI 524
           +L G L   I  LS L+ L+L  N +L G++P ++GN L KL   ++    F G IP S+
Sbjct: 315 ELEGSLPSSIFNLSSLEELNLQTN-NLNGTIPLDLGNRLPKLQLFLISENQFHGSIPPSL 373

Query: 525 GXXXXXXXXXXXXXXFIGPIPPSLG-------------------------------QLSE 611
                            G IP  +G                                 S 
Sbjct: 374 CNISTLRWIQTVNNSLSGTIPQCIGINQKSLYSVTFAVNQFETSNKYGWSFMSSLTNCSN 433

Query: 612 LYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           L  LD+ DN+LTG +P S GN     +    ++F    N  +G+IP
Sbjct: 434 LRLLDVGDNKLTGELPNSIGN-----LSTRLEYFVTNYNSMTGKIP 474



>gb:AP003858_1834409 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1014_H11.
          Length = 1023

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 54/148 (36%), Positives = 69/148 (46%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S + +L L    LTG L   I   S +Q L +S N  L+G LP+EIGNL+ L +L + 
Sbjct: 116 NLSYLNNLDLRRNYLTGPLPSFIGNFSAMQYLAVSLNP-LSGPLPKEIGNLRNLLSLGIS 174

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
              F G +P  +G              F GP P +  +L  L  L  +DN LTG IP   
Sbjct: 175 SNNFTGELPAELGNLEKLEQMYIISSGFSGPFPSTFSKLKNLKILWASDNDLTGKIPDYF 234

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           G+ P L  L       F  N F G IPA
Sbjct: 235 GSFPNLQDL------RFQGNSFQGPIPA 256



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 48/155 (30%), Positives = 65/155 (41%), Gaps = 25/155 (16%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +  L +S   L+G L  +I  L  L  L +S N + TG LP E+GNL+KL  + ++
Sbjct: 140 NFSAMQYLAVSLNPLSGPLPKEIGNLRNLLSLGISSN-NFTGELPAELGNLEKLEQMYII 198

Query: 489 GCGFFG------------------------LIPDSIGXXXXXXXXXXXXXXFIGPIPPSL 596
             GF G                         IPD  G              F GPIP SL
Sbjct: 199 SSGFSGPFPSTFSKLKNLKILWASDNDLTGKIPDYFGSFPNLQDLRFQGNSFQGPIPASL 258

Query: 597 GQLSELYWLDLADNQLTGSIPVS-DGNTPGLDMLV 698
             L+ L  L + D  L GS  +S   N   L++L+
Sbjct: 259 SNLTRLTSLRIGD-ILNGSSSLSFISNLTSLNVLI 292



 Score = 33.5 bits (75), Expect = 4.3
 Identities = 22/61 (36%), Positives = 27/61 (44%)
 Frame = +3

Query: 573 IGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           +G IP  L  LS L  LDL  N LTG +P   GN   +  L          N  SG +P 
Sbjct: 107 VGQIPEELQNLSYLNNLDLRRNYLTGPLPSFIGNFSAMQYLA------VSLNPLSGPLPK 160

Query: 753 Q 755
           +
Sbjct: 161 E 161



>gb:AJ864508_1814988 Phaseolus vulgaris ppgip3 gene for
           polygalacturonase inhibiting protein precursor.
          Length = 337

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 54/175 (30%), Positives = 75/175 (42%), Gaps = 9/175 (5%)
 Frame = +3

Query: 255 SWAEGSDPCGDHWEGVGCNGS----RVVSLTLSSMDLTGE--LSGDIEELSELQILDLSY 416
           SW   +D C   WEGV C+      RV SL L+ + LT    +   +  L  L  L +S 
Sbjct: 47  SWLPNTDCCKPEWEGVSCDIDTKTYRVNSLDLNDLSLTKPYPIPSSVANLPYLSFLYISR 106

Query: 417 NKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSL 596
             +L G +P  I  L KL  L +      G IP+ +                 G +PPSL
Sbjct: 107 INNLVGPIPPSIAKLTKLRFLYITHTNVSGQIPNFLSQMKTLITIDFSYNALSGTLPPSL 166

Query: 597 GQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHF---HFGXNKFSGEIPA 752
             L  L  + L  N+++G+IP S G+ P        KHF       N+ +G IPA
Sbjct: 167 SSLPNLLGISLDGNRISGTIPGSFGSFP--------KHFTVLTLSRNRLTGNIPA 213



>gb:AJ786410_1814068 Phaseolus vulgaris bpgip3 gene for
           polygalacturonase inhibiting protein.
          Length = 337

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 54/175 (30%), Positives = 75/175 (42%), Gaps = 9/175 (5%)
 Frame = +3

Query: 255 SWAEGSDPCGDHWEGVGCNGS----RVVSLTLSSMDLTGE--LSGDIEELSELQILDLSY 416
           SW   +D C   WEGV C+      RV SL L+ + LT    +   +  L  L  L +S 
Sbjct: 47  SWLPNTDCCKPEWEGVSCDIDTKTYRVNSLDLNDLSLTKPYPIPSSVANLPYLSFLYISR 106

Query: 417 NKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSL 596
             +L G +P  I  L KL  L +      G IP+ +                 G +PPSL
Sbjct: 107 INNLVGPIPPSIAKLTKLRFLYITHTNVSGQIPNFLSQMKTLITIDFSYNALSGTLPPSL 166

Query: 597 GQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHF---HFGXNKFSGEIPA 752
             L  L  + L  N+++G+IP S G+ P        KHF       N+ +G IPA
Sbjct: 167 SSLPNLLGISLDGNRISGTIPGSFGSFP--------KHFTVLTLSRNRLTGNIPA 213



>gb:AF529693_1809051 Brassica napus polygalacturonase inhibitor
           protein (PGIP2) mRNA, complete cds.>gb:AF529694_1809052
           Brassica napus polygalacturonase inhibitor protein
           (PGIP2) gene, complete cds.
          Length = 331

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 55/169 (32%), Positives = 77/169 (45%), Gaps = 4/169 (2%)
 Frame = +3

Query: 255 SWAEGSDPCGDHWEGVGCNGS----RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNK 422
           SW   +D C   W  + C  +    RV +LT+ S  ++G++  ++ +LS LQ L      
Sbjct: 49  SWDPRTDCCS--WYCLECGDATVNHRVTALTIFSGQISGQIPPEVGDLSYLQTLVFRKLT 106

Query: 423 DLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQ 602
           +LTG +PR I  LK L +L L      G +P  +                 G IP SL  
Sbjct: 107 NLTGQIPRTIAKLKYLRSLRLSWTNLTGPVPGFLSELKNLQWVDLSFNDLSGSIPSSLSL 166

Query: 603 LSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           L  L  LDL+ N+LTGSIP S G+ P           +   N+ SG IP
Sbjct: 167 LPNLVSLDLSRNKLTGSIPESFGSFP-----AKVPDLYLSHNQLSGYIP 210



>gb:AF084034_1767051 Arabidopsis thaliana receptor-like protein
           kinase (RKL1) gene, complete cds.
          Length = 645

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 57/186 (30%), Positives = 86/186 (46%), Gaps = 2/186 (1%)
 Frame = +3

Query: 198 NNDYVAIKALRDGWKNVPPSW-AEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL-SG 371
           N D  A+ +LR         W  + + PC  +W GV C  +RV +L L  + L+G++  G
Sbjct: 24  NADRTALLSLRSAVGGRTFRWNIKQTSPC--NWAGVKCESNRVTALRLPGVALSGDIPEG 81

Query: 372 DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXX 551
               L++L+ L L  N  L+GSLP+++     L +L L G  F G IP+ +         
Sbjct: 82  IFGNLTQLRTLSLRLNA-LSGSLPKDLSTSSNLRHLYLQGNRFSGEIPEVLFSLSHLVRL 140

Query: 552 XXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNK 731
                 F G I      L++L  L L +NQL+GSIP         D+ +    F+   N 
Sbjct: 141 NLASNSFTGEISSGFTNLTKLKTLFLENNQLSGSIP---------DLDLPLVQFNVSNNS 191

Query: 732 FSGEIP 749
            +G IP
Sbjct: 192 LNGSIP 197



>gb:AY064972_1566148 Arabidopsis thaliana AT4g08850/T32A17_160 mRNA,
           complete cds.
          Length = 1045

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 50/147 (34%), Positives = 68/147 (46%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N   V  L +    L+GE+  +I  ++ L  L L  NK LTG +P  +GN+K L  L L 
Sbjct: 260 NLKNVTLLNMFENQLSGEIPPEIGNMTALDTLSLHTNK-LTGPIPSTLGNIKTLAVLHLY 318

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP  +G                GP+P S G+L+ L WL L DNQL+G IP   
Sbjct: 319 LNQLNGSIPPELGEMESMIDLEISENKLTGPVPDSFGKLTALEWLFLRDNQLSGPIPPGI 378

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            N+  L +L          N F+G +P
Sbjct: 379 ANSTELTVL------QLDTNNFTGFLP 399



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 48/156 (30%), Positives = 73/156 (46%)
 Frame = +3

Query: 288 HWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKK 467
           +WE       ++V+  LS+  +TG +  +I  +++L  LDLS N+ +TG LP  I N+ +
Sbjct: 473 NWE----QSQKLVAFILSNNSITGAIPPEIWNMTQLSQLDLSSNR-ITGELPESISNINR 527

Query: 468 LYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLT 647
           +  L L G    G IP  I               F   IPP+L  L  LY+++L+ N L 
Sbjct: 528 ISKLQLNGNRLSGKIPSGIRLLTNLEYLDLSSNRFSSEIPPTLNNLPRLYYMNLSRNDLD 587

Query: 648 GSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            +IP       GL  L   +      N+  GEI +Q
Sbjct: 588 QTIP------EGLTKLSQLQMLDLSYNQLDGEISSQ 617



 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 56/179 (31%), Positives = 75/179 (41%), Gaps = 25/179 (13%)
 Frame = +3

Query: 291 WEGVGCNGSRVVSLTLSSMDLTG---------------------ELSGDIEEL----SEL 395
           W GV C+   ++ L L++  + G                       SG I  L    S+L
Sbjct: 85  WYGVACSLGSIIRLNLTNTGIEGTFEDFPFSSLPNLTFVDLSMNRFSGTISPLWGRFSKL 144

Query: 396 QILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFI 575
           +  DLS N+ L G +P E+G+L  L  L LV     G IP  IG                
Sbjct: 145 EYFDLSINQ-LVGEIPPELGDLSNLDTLHLVENKLNGSIPSEIGRLTKVTEIAIYDNLLT 203

Query: 576 GPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           GPIP S G L++L  L L  N L+GSIP   GN P L      +      N  +G+IP+
Sbjct: 204 GPIPSSFGNLTKLVNLYLFINSLSGSIPSEIGNLPNL------RELCLDRNNLTGKIPS 256



 Score = 70.1 bits (170), Expect = 4e-11
 Identities = 51/147 (34%), Positives = 67/147 (45%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S++    LS   L GE+  ++ +LS L  L L  NK L GS+P EIG L K+  + +   
Sbjct: 142 SKLEYFDLSINQLVGEIPPELGDLSNLDTLHLVENK-LNGSIPSEIGRLTKVTEIAIYDN 200

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G IP S G                G IP  +G L  L  L L  N LTG IP S GN
Sbjct: 201 LLTGPIPSSFGNLTKLVNLYLFINSLSGSIPSEIGNLPNLRELCLDRNNLTGKIPSSFGN 260

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
              + +L      +   N+ SGEIP +
Sbjct: 261 LKNVTLL------NMFENQLSGEIPPE 281



 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 49/147 (33%), Positives = 67/147 (45%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           ++V  + +    LTG +      L++L  L L  N  L+GS+P EIGNL  L  L L   
Sbjct: 190 TKVTEIAIYDNLLTGPIPSSFGNLTKLVNLYLFINS-LSGSIPSEIGNLPNLRELCLDRN 248

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G IP S G                G IPP +G ++ L  L L  N+LTG IP + GN
Sbjct: 249 NLTGKIPSSFGNLKNVTLLNMFENQLSGEIPPEIGNMTALDTLSLHTNKLTGPIPSTLGN 308

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
              L +L      H   N+ +G IP +
Sbjct: 309 IKTLAVL------HLYLNQLNGSIPPE 329



 Score = 56.2 bits (134), Expect = 6e-07
 Identities = 47/156 (30%), Positives = 75/156 (48%)
 Frame = +3

Query: 219 KALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQ 398
           K+LRD  K++     +G+   GD  E  G   + +  + LS+ +  G+LS + E+  +L 
Sbjct: 424 KSLRD-CKSLIRVRFKGNSFSGDISEAFGVYPT-LNFIDLSNNNFHGQLSANWEQSQKLV 481

Query: 399 ILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIG 578
              LS N  +TG++P EI N+ +L  L L      G +P+SI                 G
Sbjct: 482 AFILS-NNSITGAIPPEIWNMTQLSQLDLSSNRITGELPESISNINRISKLQLNGNRLSG 540

Query: 579 PIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
            IP  +  L+ L +LDL+ N+ +  IP +  N P L
Sbjct: 541 KIPSGIRLLTNLEYLDLSSNRFSSEIPPTLNNLPRL 576



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 37/147 (25%), Positives = 60/147 (40%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N + +  L L + + TG L   I    +L+ L L  N    G +P+ + + K L  +   
Sbjct: 380 NSTELTVLQLDTNNFTGFLPDTICRGGKLENLTLDDNH-FEGPVPKSLRDCKSLIRVRFK 438

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
           G  F G I ++ G              F G +  +  Q  +L    L++N +TG+IP   
Sbjct: 439 GNSFSGDISEAFGVYPTLNFIDLSNNNFHGQLSANWEQSQKLVAFILSNNSITGAIPPEI 498

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            N   L  L          N+ +GE+P
Sbjct: 499 WNMTQLSQL------DLSSNRITGELP 519



 Score = 35.8 bits (81), Expect = 0.86
 Identities = 23/69 (33%), Positives = 37/69 (53%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S++  L LS   L GE+S     L  L+ LDLS+N +L+G +P    ++  L ++ +   
Sbjct: 598 SQLQMLDLSYNQLDGEISSQFRSLQNLERLDLSHN-NLSGQIPPSFKDMLALTHVDVSHN 656

Query: 495 GFFGLIPDS 521
              G IPD+
Sbjct: 657 NLQGPIPDN 665



>gb:AY054256_1563076 Arabidopsis thaliana AT5g67280/K3G17_4 mRNA,
           complete cds.
          Length = 751

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 59/183 (32%), Positives = 84/183 (45%), Gaps = 17/183 (9%)
 Frame = +3

Query: 255 SWA-EGSDPCGDHWEGVGCNGS--RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKD 425
           SW  +   PC   W GV C+ S   V  L+L S +LTG L  ++  L+ LQ LDLS N  
Sbjct: 55  SWRFDDETPCS--WRGVTCDASSRHVTVLSLPSSNLTGTLPSNLGSLNSLQRLDLS-NNS 111

Query: 426 LTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQL 605
           + GS P  + N  +L  L L      G +P S G              F+G +P +LG  
Sbjct: 112 INGSFPVSLLNATELRFLDLSDNHISGALPASFGALSNLQVLNLSDNSFVGELPNTLGWN 171

Query: 606 SELYWLDLADNQLTGSIPVSDGNTPGLD----MLVGT----------KHFHFGXNKFSGE 743
             L  + L  N L+G IP    +T  LD    ++ G+          ++F+   N+ SGE
Sbjct: 172 RNLTEISLQKNYLSGGIPGGFKSTEYLDLSSNLIKGSLPSHFRGNRLRYFNASYNRISGE 231

Query: 744 IPA 752
           IP+
Sbjct: 232 IPS 234



>gb:ATH550162_1552878 Arabidopsis thaliana mRNA for LRR
           receptor-like kinase 1 (rch1 gene).
          Length = 1135

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 52/147 (35%), Positives = 72/147 (48%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S++ SL + S  L+GE+  ++   SEL  L L Y+ DL+G+LP+E+G L+ L  ++L   
Sbjct: 251 SKLQSLFVYSTMLSGEIPKELGNCSELINLFL-YDNDLSGTLPKELGKLQNLEKMLLWQN 309

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G IP+ IG              F G IP S G LS L  L L+ N +TGSIP     
Sbjct: 310 NLHGPIPEEIGFMKSLNAIDLSMNYFSGTIPKSFGNLSNLQELMLSSNNITGSIPSI--- 366

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
              L        F    N+ SG IP +
Sbjct: 367 ---LSDCTKLVQFQIDANQISGLIPPE 390



 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 47/140 (33%), Positives = 67/140 (47%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS  +L+G +  +I    +LQ+L+LS N  L G LP  + +L KL  L +      G 
Sbjct: 496 LDLSENNLSGPVPLEISNCRQLQMLNLS-NNTLQGYLPLSLSSLTKLQVLDVSSNDLTGK 554

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IPDS+G              F G IP SLG  + L  LDL+ N ++G+IP    +   LD
Sbjct: 555 IPDSLGHLISLNRLILSKNSFNGEIPSSLGHCTNLQLLDLSSNNISGTIPEELFDIQDLD 614

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
           + +     +   N   G IP
Sbjct: 615 IAL-----NLSWNSLDGFIP 629



 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 56/211 (26%), Positives = 90/211 (42%), Gaps = 8/211 (3%)
 Frame = +3

Query: 147 LLVPLFIQFLGIVAFTDNNDYVAIKALRDGWKNVPPSWAEG-----SDPCGDHWEGVGCN 311
           + + LF+ F         N+  A+ +      + PPS   G     SDPC   W  + C+
Sbjct: 20  ITLSLFLAFFISSTSASTNEVSALISWLHSSNSPPPSVFSGWNPSDSDPC--QWPYITCS 77

Query: 312 G---SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLI 482
                 V  + + S+ L      +I   + LQ L +S N +LTG++  EIG+  +L  + 
Sbjct: 78  SPDNKLVTEINVVSVQLALPFPPNISSFTSLQKLVIS-NTNLTGAISSEIGDCSELIVID 136

Query: 483 LVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPV 662
           L      G IP S+G                G IPP LG    L  L++ DN L+ ++P+
Sbjct: 137 LSSNSLVGEIPSSLGKLKNLQELCLNSNGLTGKIPPELGDCVSLKNLEIFDNYLSENLPL 196

Query: 663 SDGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
             G    L+ +        G ++ SG+IP +
Sbjct: 197 ELGKISTLESIRAG-----GNSELSGKIPEE 222



 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 43/133 (32%), Positives = 60/133 (45%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           L G +  ++     LQ LDLS N  LTGSLP  +  L+ L  L+L+     G+IP   G 
Sbjct: 407 LEGNIPDELAGCQNLQALDLSQNY-LTGSLPAGLFQLRNLTKLLLISNAISGVIPLETGN 465

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKH 710
                          G IP  +G L  L +LDL++N L+G +P+   N   L ML     
Sbjct: 466 CTSLVRLRLVNNRITGEIPKGIGFLQNLSFLDLSENNLSGPVPLEISNCRQLQML----- 520

Query: 711 FHFGXNKFSGEIP 749
            +   N   G +P
Sbjct: 521 -NLSNNTLQGYLP 532



 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 45/151 (29%), Positives = 64/151 (42%), Gaps = 18/151 (11%)
 Frame = +3

Query: 351 LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGX 530
           L+  L  ++ ++S L+ +    N +L+G +P EIGN + L  L L      G +P S+G 
Sbjct: 190 LSENLPLELGKISTLESIRAGGNSELSGKIPEEIGNCRNLKVLGLAATKISGSLPVSLGQ 249

Query: 531 XXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD-MLVGTK 707
                          G IP  LG  SEL  L L DN L+G++P   G    L+ ML+   
Sbjct: 250 LSKLQSLFVYSTMLSGEIPKELGNCSELINLFLYDNDLSGTLPKELGKLQNLEKMLLWQN 309

Query: 708 HFH-----------------FGXNKFSGEIP 749
           + H                    N FSG IP
Sbjct: 310 NLHGPIPEEIGFMKSLNAIDLSMNYFSGTIP 340



 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 61/197 (30%), Positives = 81/197 (41%), Gaps = 24/197 (12%)
 Frame = +3

Query: 234 GWKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLS 413
           GW+N      EG+ P     E  GC   +  +L LS   LTG L   + +L  L  L L 
Sbjct: 402 GWQNK----LEGNIPD----ELAGCQNLQ--ALDLSQNYLTGSLPAGLFQLRNLTKLLLI 451

Query: 414 YNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPI--- 584
            N  ++G +P E GN   L  L LV     G IP  IG                GP+   
Sbjct: 452 SNA-ISGVIPLETGNCTSLVRLRLVNNRITGEIPKGIGFLQNLSFLDLSENNLSGPVPLE 510

Query: 585 ---------------------PPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVG 701
                                P SL  L++L  LD++ N LTG IP S G+   L+ L+ 
Sbjct: 511 ISNCRQLQMLNLSNNTLQGYLPLSLSSLTKLQVLDVSSNDLTGKIPDSLGHLISLNRLIL 570

Query: 702 TKHFHFGXNKFSGEIPA 752
           +K      N F+GEIP+
Sbjct: 571 SK------NSFNGEIPS 581



 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 43/147 (29%), Positives = 65/147 (44%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N S +  L LSS ++TG +   + + ++L    +  N+ ++G +P EIG LK+L   +  
Sbjct: 345 NLSNLQELMLSSNNITGSIPSILSDCTKLVQFQIDANQ-ISGLIPPEIGLLKELNIFLGW 403

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IPD +                 G +P  L QL  L  L L  N ++G IP+  
Sbjct: 404 QNKLEGNIPDELAGCQNLQALDLSQNYLTGSLPAGLFQLRNLTKLLLISNAISGVIPLET 463

Query: 669 GNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           GN   L  L          N+ +GEIP
Sbjct: 464 GNCTSLVRL------RLVNNRITGEIP 484



 Score = 52.4 bits (124), Expect = 9e-06
 Identities = 45/143 (31%), Positives = 58/143 (40%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           ++ LS    +G +      LS LQ L LS N ++TGS+P  + +  KL    +      G
Sbjct: 327 AIDLSMNYFSGTIPKSFGNLSNLQELMLSSN-NITGSIPSILSDCTKLVQFQIDANQISG 385

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
           LIP  IG                G IP  L     L  LDL+ N LTGS+P       GL
Sbjct: 386 LIPPEIGLLKELNIFLGWQNKLEGNIPDELAGCQNLQALDLSQNYLTGSLPA------GL 439

Query: 687 DMLVGTKHFHFGXNKFSGEIPAQ 755
             L          N  SG IP +
Sbjct: 440 FQLRNLTKLLLISNAISGVIPLE 462



 Score = 33.1 bits (74), Expect = 5.6
 Identities = 23/66 (34%), Positives = 36/66 (54%)
 Frame = +3

Query: 324 VSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF 503
           ++L LS   L G +   I  L+ L +LD+S+N  L+G L   +  L+ L +L +    F 
Sbjct: 615 IALNLSWNSLDGFIPERISALNRLSVLDISHNM-LSGDL-SALSGLENLVSLNISHNRFS 672

Query: 504 GLIPDS 521
           G +PDS
Sbjct: 673 GYLPDS 678



>gb:AB071018_1522721 Citrus hystrix PGIP gene for
           polygalacturonase-inhibiting protein, complete cds.
          Length = 327

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 60/180 (33%), Positives = 82/180 (45%), Gaps = 2/180 (1%)
 Frame = +3

Query: 219 KALRDGWKNVPPSWAEGSDPCGDHWEGVGCNGS--RVVSLTLSSMDLTGELSGDIEELSE 392
           KAL + +  V  SW   +D C   W  V C+ S  R+ SLT+ + DL G++  ++ +L  
Sbjct: 38  KALNNPY--VLASWNPKTDCCD--WYCVTCDLSTNRINSLTIFAGDLPGQIPSEVGDLPY 93

Query: 393 LQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXF 572
           L+ L       LTG +   I  LK L  L +      G +PD I                
Sbjct: 94  LETLMFHKLPSLTGPIQPAIAKLKNLKTLRISWTNISGPVPDFISQLTNLTFLELSFNNL 153

Query: 573 IGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            G IP SL +L +L  L L  N+LTGSIP S G   G      T   +   N+ SG+IPA
Sbjct: 154 SGTIPSSLSKLQKLGALHLDRNKLTGSIPESFGTFTG-----STPDLYLSHNQLSGKIPA 208



>gb:AB025614_1516378 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K3G17.>gb:BT001094_1635349 Arabidopsis
           thaliana At5g67280/K3G17_4 mRNA, complete cds.
          Length = 751

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 59/183 (32%), Positives = 84/183 (45%), Gaps = 17/183 (9%)
 Frame = +3

Query: 255 SWA-EGSDPCGDHWEGVGCNGS--RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKD 425
           SW  +   PC   W GV C+ S   V  L+L S +LTG L  ++  L+ LQ LDLS N  
Sbjct: 55  SWRFDDETPCS--WRGVTCDASSRHVTVLSLPSSNLTGTLPSNLGSLNSLQRLDLS-NNS 111

Query: 426 LTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQL 605
           + GS P  + N  +L  L L      G +P S G              F+G +P +LG  
Sbjct: 112 INGSFPVSLLNATELRFLDLSDNHISGALPASFGALSNLQVLNLSDNSFVGELPNTLGWN 171

Query: 606 SELYWLDLADNQLTGSIPVSDGNTPGLD----MLVGT----------KHFHFGXNKFSGE 743
             L  + L  N L+G IP    +T  LD    ++ G+          ++F+   N+ SGE
Sbjct: 172 RNLTEISLQKNYLSGGIPGGFKSTEYLDLSSNLIKGSLPSHFRGNRLRYFNASYNRISGE 231

Query: 744 IPA 752
           IP+
Sbjct: 232 IPS 234



>gb:AE016959_1023018 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC022457_1538983
           Oryza sativa chromosome 10 BAC OSJNBa0006L06 genomic
           sequence, complete sequence.>gb:AE017103_1752837 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           57 of 77 of the complete sequence.
          Length = 940

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 54/171 (31%), Positives = 82/171 (47%)
 Frame = +3

Query: 237 WKNVPPSWAEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSY 416
           W N+    A+G+   G+    +    SR+  L+L++ +L+G +   I  L+ L++LDL+ 
Sbjct: 146 WTNLEVFQADGNRFTGEIPTAITM-ASRLEFLSLATNNLSGAIPPVIGTLANLKLLDLAE 204

Query: 417 NKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSL 596
           NK L G++PR IGNL  L  L L      G +PD +G                G +P  L
Sbjct: 205 NK-LAGAIPRTIGNLTSLETLRLYTNKLTGRLPDELGDMAALQRLSVSSNMLEGELPAGL 263

Query: 597 GQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            +L  L  L   DN L+G+IP   G    L ++          N+FSGE+P
Sbjct: 264 ARLPRLVGLVAFDNLLSGAIPPEFGRNGQLSIV------SMANNRFSGELP 308



 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 44/139 (31%), Positives = 63/139 (45%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LSS   +GE+   + +L++LQ + L  N  L G +P  IGN+  L  L L G    G 
Sbjct: 7   LNLSSNQFSGEIPASLAKLTKLQSVVLGSNL-LHGGVPPVIGNISGLRTLELSGNPLGGA 65

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP ++G                  IP  L   + L  + LA N+LTG +PV+      L 
Sbjct: 66  IPTTLGKLRSLEHINVSLAGLESTIPDELSLCANLTVIGLAGNKLTGKLPVA------LA 119

Query: 690 MLVGTKHFHFGXNKFSGEI 746
            L   + F+   N  SGE+
Sbjct: 120 RLTRVREFNVSKNMLSGEV 138



 Score = 49.3 bits (116), Expect = 8e-05
 Identities = 41/140 (29%), Positives = 57/140 (40%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L LS     GEL     +   L  L LS NK + G++P   G +  L +L L      G 
Sbjct: 369 LDLSGNSFDGELPEHWAQFKSLSFLHLSGNK-IAGAIPASYGAMS-LQDLDLSSNRLAGE 426

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IP  +G                G +P +LG  + +  LDL+ N L G +PV       L 
Sbjct: 427 IPPELGSLPLTKLNLRRNA-LSGRVPATLGNAARMEMLDLSGNALDGGVPVE------LT 479

Query: 690 MLVGTKHFHFGXNKFSGEIP 749
            L    + +   N  SGE+P
Sbjct: 480 KLAEMWYLNLSSNNLSGEVP 499



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 37/137 (27%), Positives = 61/137 (44%), Gaps = 6/137 (4%)
 Frame = +3

Query: 246 VPPSWAEGSDPCGDHWEGVGCNGSRVVS---LTLSSMDLTGE-LSGDIE-ELSELQILDL 410
           +P  WA+       H  G    G+   S   ++L  +DL+   L+G+I  EL  L +  L
Sbjct: 380 LPEHWAQFKSLSFLHLSGNKIAGAIPASYGAMSLQDLDLSSNRLAGEIPPELGSLPLTKL 439

Query: 411 SYNKD-LTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIP 587
           +  ++ L+G +P  +GN  ++  L L G    G +P  +                 G +P
Sbjct: 440 NLRRNALSGRVPATLGNAARMEMLDLSGNALDGGVPVELTKLAEMWYLNLSSNNLSGEVP 499

Query: 588 PSLGQLSELYWLDLADN 638
           P LG++  L  LDL+ N
Sbjct: 500 PLLGKMRSLTTLDLSGN 516



 Score = 42.4 bits (98), Expect = 0.009
 Identities = 37/146 (25%), Positives = 57/146 (39%), Gaps = 1/146 (0%)
 Frame = +3

Query: 318 RVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREI-GNLKKLYNLILVGC 494
           R+V L      L+G +  +     +L I+ ++ N+  +G LPR +  +  +L  L L   
Sbjct: 268 RLVGLVAFDNLLSGAIPPEFGRNGQLSIVSMANNR-FSGELPRGVCASAPRLRWLGLDDN 326

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
            F G +P                    G +   L    +LY+LDL+ N   G +P     
Sbjct: 327 QFSGTVPACYRNLTNLVRLRMARNKLAGDVSEILASHPDLYYLDLSGNSFDGELPEHWAQ 386

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIPA 752
              L  L      H   NK +G IPA
Sbjct: 387 FKSLSFL------HLSGNKIAGAIPA 406



 Score = 36.2 bits (82), Expect = 0.66
 Identities = 23/77 (29%), Positives = 34/77 (44%)
 Frame = +3

Query: 459 LKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADN 638
           +  L +L L    F G IP S+                 G +PP +G +S L  L+L+ N
Sbjct: 1   MPNLEHLNLSSNQFSGEIPASLAKLTKLQSVVLGSNLLHGGVPPVIGNISGLRTLELSGN 60

Query: 639 QLTGSIPVSDGNTPGLD 689
            L G+IP + G    L+
Sbjct: 61  PLGGAIPTTLGKLRSLE 77



>gb:AE016959_1022230 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC113338_1739023
           Oryza sativa (japonica cultivar-group) cultivar
           Nipponbare clone OSJNBa0091J06 from chromosome 10,
           complete sequence.>gb:AE017085_1752049 Oryza sativa
           (japonica cultivar-group) chromosome 10, section 39 of
           77 of the complete sequence.
          Length = 1040

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 55/150 (36%), Positives = 74/150 (49%), Gaps = 1/150 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSE-LQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           N + +  +TL +  L G L   I  LSE LQ+LDL +N +++  +P  IGN  KL  L L
Sbjct: 348 NCTSLRGVTLQNNRLGGALPNSIGNLSERLQLLDLRFN-EISNRIPDGIGNFPKLIKLGL 406

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
               F GLIPD+IG                G +  SLG L++L  L + +N L G +P S
Sbjct: 407 SSNRFTGLIPDNIGRLTMLQFLTLDNNLLSGMMASSLGNLTQLQHLSVNNNNLDGPLPAS 466

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIPAQ 755
            GN   L  LV      F  NK SG +P +
Sbjct: 467 LGN---LQRLVSAT---FSNNKLSGPLPGE 490



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 64/194 (32%), Positives = 84/194 (43%), Gaps = 6/194 (3%)
 Frame = +3

Query: 186 AFTDNNDYVAIKALRDGWKNVPP---SWAEGSDPCGDHWEGVGCN---GSRVVSLTLSSM 347
           AF++  D  A+ A R G  N      SW   +D C   W GV C+     RV++L LSS 
Sbjct: 9   AFSNETDLDALLAFRAGLSNQSDALASWNATTDFC--RWHGVICSIKHKRRVLALNLSSA 66

Query: 348 DLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIG 527
            L G ++  I  L+ L+ LDLSYN  L G +P  IG L ++  L L      G +P +IG
Sbjct: 67  GLVGYIAPSIGNLTYLRTLDLSYNL-LHGEIPPTIGRLSRMKYLDLSNNSLQGEMPSTIG 125

Query: 528 XXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTK 707
                           G I   L   + L  + L  N+L   IP        LD L   K
Sbjct: 126 QLPWLSTLYMSNNSLQGGITHGLRNCTRLVSIKLDLNKLNREIP------DWLDGLSRIK 179

Query: 708 HFHFGXNKFSGEIP 749
               G N F+G IP
Sbjct: 180 IMSLGKNNFTGIIP 193



 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 51/148 (34%), Positives = 71/148 (47%), Gaps = 1/148 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQ-ILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           N  R+VS T S+  L+G L G+I  LS L  +LDLS N+  + SLP E+G L KL  L +
Sbjct: 469 NLQRLVSATFSNNKLSGPLPGEIFSLSSLSFVLDLSRNQ-FSSSLPSEVGGLTKLTYLYM 527

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVS 665
                 G +PD+I                   IP S+ ++  L  L+L  N LTG+IP  
Sbjct: 528 HNNKLAGALPDAISSCQSLMELRMDGNSLNSTIPVSISKMRGLELLNLTKNSLTGAIPEE 587

Query: 666 DGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
                 L ++ G K  +   N  S +IP
Sbjct: 588 ------LGLMKGLKELYLAHNNLSLQIP 609



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 48/153 (31%), Positives = 74/153 (48%), Gaps = 1/153 (0%)
 Frame = +3

Query: 294 EGVGCNGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLY 473
           +G+G N  +++ L LSS   TG +  +I  L+ LQ L L  N  L+G +   +GNL +L 
Sbjct: 393 DGIG-NFPKLIKLGLSSNRFTGLIPDNIGRLTMLQFLTLDNNL-LSGMMASSLGNLTQLQ 450

Query: 474 NLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSEL-YWLDLADNQLTG 650
           +L +      G +P S+G                GP+P  +  LS L + LDL+ NQ + 
Sbjct: 451 HLSVNNNNLDGPLPASLGNLQRLVSATFSNNKLSGPLPGEIFSLSSLSFVLDLSRNQFSS 510

Query: 651 SIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
           S+P   G   GL  L    + +   NK +G +P
Sbjct: 511 SLPSEVG---GLTKLT---YLYMHNNKLAGALP 537



 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 44/149 (29%), Positives = 69/149 (46%), Gaps = 1/149 (0%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILV 488
           N +R+VS+ L    L  E+   ++ LS ++I+ L  N + TG +P  +GNL  L  + L 
Sbjct: 150 NCTRLVSIKLDLNKLNREIPDWLDGLSRIKIMSLGKN-NFTGIIPPSLGNLSSLREMYLN 208

Query: 489 GCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSD 668
                G IP+S+G                G IP ++  LS L  + +  N+L G++P   
Sbjct: 209 DNQLSGPIPESLGRLSKLEMLALQVNHLSGNIPRTIFNLSSLVQIGVEMNELDGTLPSDL 268

Query: 669 GNT-PGLDMLVGTKHFHFGXNKFSGEIPA 752
           GN  P +  L+         N  +G IPA
Sbjct: 269 GNALPKIQYLI------LALNHLTGSIPA 291



 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 53/178 (29%), Positives = 74/178 (41%), Gaps = 31/178 (17%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDI-EELSELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           N S +V + +   +L G L  D+   L ++Q L L+ N  LTGS+P  I N   +Y++ L
Sbjct: 246 NLSSLVQIGVEMNELDGTLPSDLGNALPKIQYLILALNH-LTGSIPASIANATTMYSIDL 304

Query: 486 VGCGFFGLIPDSIGX---------XXXXXXXXXXXXXFI--------------------G 578
            G  F G++P  IG                       FI                    G
Sbjct: 305 SGNNFTGIVPPEIGTLCPNFLLLNGNQLMASRVQDWEFITLLTNCTSLRGVTLQNNRLGG 364

Query: 579 PIPPSLGQLSE-LYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
            +P S+G LSE L  LDL  N+++  IP   GN P L  L          N+F+G IP
Sbjct: 365 ALPNSIGNLSERLQLLDLRFNEISNRIPDGIGNFPKLIKL------GLSSNRFTGLIP 416



 Score = 35.8 bits (81), Expect = 0.86
 Identities = 29/113 (25%), Positives = 50/113 (44%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGF 500
           ++ L +    L   +   I ++  L++L+L+ N  LTG++P E+G +K L  L L     
Sbjct: 546 LMELRMDGNSLNSTIPVSISKMRGLELLNLTKNS-LTGAIPEELGLMKGLKELYLAHNNL 604

Query: 501 FGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
              IP++                FI         ++ LY LD++ N L G +P
Sbjct: 605 SLQIPET----------------FI--------SMTSLYQLDISFNHLDGQVP 633



>pir|G96524|G96524 protein T1N15.9 [imported] - Arabidopsis
           thaliana>gb:AE005173_892808 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC020889_1538634 Genomic sequence for
           Arabidopsis thaliana BAC T1N15 from chromosome I,
           complete sequence.
          Length = 655

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 57/186 (30%), Positives = 86/186 (46%), Gaps = 2/186 (1%)
 Frame = +3

Query: 198 NNDYVAIKALRDGWKNVPPSW-AEGSDPCGDHWEGVGCNGSRVVSLTLSSMDLTGEL-SG 371
           N D  A+ +LR         W  + + PC  +W GV C  +RV +L L  + L+G++  G
Sbjct: 34  NADRTALLSLRSAVGGRTFRWNIKQTSPC--NWAGVKCESNRVTALRLPGVALSGDIPEG 91

Query: 372 DIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXX 551
               L++L+ L L  N  L+GSLP+++     L +L L G  F G IP+ +         
Sbjct: 92  IFGNLTQLRTLSLRLNA-LSGSLPKDLSTSSNLRHLYLQGNRFSGEIPEVLFSLSHLVRL 150

Query: 552 XXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNK 731
                 F G I      L++L  L L +NQL+GSIP         D+ +    F+   N 
Sbjct: 151 NLASNSFTGEISSGFTNLTKLKTLFLENNQLSGSIP---------DLDLPLVQFNVSNNS 201

Query: 732 FSGEIP 749
            +G IP
Sbjct: 202 LNGSIP 207



>gb:AP005846_1858989 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:B1307A11.
          Length = 1163

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 59/193 (30%), Positives = 87/193 (45%), Gaps = 9/193 (4%)
 Frame = +3

Query: 204 DYVAIKALRDGWKNVPPS----WAEGSDPCGDHWEGVGCN-----GSRVVSLTLSSMDLT 356
           D++A+ A +      P S    W          W GV C        RVV+L LS++DL+
Sbjct: 32  DHLALMAFKSQITRDPSSAMASWGGNQSLHVCQWRGVTCGIQGRCRGRVVALDLSNLDLS 91

Query: 357 GELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGLIPDSIGXXX 536
           G +   I  L+ L+ LDL  N  LTG++P E+G L  L ++ L      G IP S+    
Sbjct: 92  GTIDPSIGNLTYLRKLDLPVNH-LTGTIPSELGRLLDLQHVNLSYNSLQGGIPASLSLCQ 150

Query: 537 XXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFH 716
                        G IPP++G LS L  + L  N L G++P   G    L++L      +
Sbjct: 151 QLENISLAFNHLSGGIPPAMGDLSMLRTVQLQYNMLDGAMPRMIGKLGSLEVL------N 204

Query: 717 FGXNKFSGEIPAQ 755
              N  +G IP++
Sbjct: 205 LYNNSLAGSIPSE 217



 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 50/145 (34%), Positives = 69/145 (47%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           S + +L L   +L G +   +  LS L  L L  N+ LTG +P  +  L+KL  L+L   
Sbjct: 293 SSLTALILQENNLHGGIPSWLGNLSSLVYLSLGGNR-LTGGIPESLAKLEKLSGLVLAEN 351

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G IP S+G                G IP S+  LS L   ++ DNQLTGS+P   GN
Sbjct: 352 NLTGSIPPSLGNLHSLTDLYLDRNQLTGYIPSSISNLSSLRIFNVRDNQLTGSLPT--GN 409

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIP 749
                +L   + F+ G N+F G IP
Sbjct: 410 RVNFPLL---QIFNAGYNQFEGAIP 431



 Score = 69.3 bits (168), Expect = 7e-11
 Identities = 47/140 (33%), Positives = 66/140 (47%)
 Frame = +3

Query: 327 SLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFG 506
           +++L+   L+G +   + +LS L+ + L YN  L G++PR IG L  L  L L      G
Sbjct: 154 NISLAFNHLSGGIPPAMGDLSMLRTVQLQYNM-LDGAMPRMIGKLGSLEVLNLYNNSLAG 212

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
            IP  IG                G +P SLG L  +  L L  NQL+G +P   GN   L
Sbjct: 213 SIPSEIGNLTSLVSLILSYNHLTGSVPSSLGNLQRIKNLQLRGNQLSGPVPTFLGNLSSL 272

Query: 687 DMLVGTKHFHFGXNKFSGEI 746
            +L      + G N+F GEI
Sbjct: 273 TIL------NLGTNRFQGEI 286



 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 51/168 (30%), Positives = 70/168 (41%), Gaps = 19/168 (11%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELS-ELQILDLSYNKDLTGSLPREIGNLKKLYNLIL 485
           N S++  L  SS    G L   +  LS  L+   LS N  ++G +P  IGNL  L  L +
Sbjct: 490 NSSQLEFLDFSSNKFRGTLPNAVANLSTNLKAFALSENM-ISGKIPEGIGNLVNLLYLFM 548

Query: 486 VGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP-- 659
               F G IP S+G               +G IPP+LG L+ L  L L  N L+G +P  
Sbjct: 549 SNNSFEGNIPSSLGTLWKLSHLDLGFNNLLGQIPPALGNLTSLNKLYLGQNSLSGPLPSD 608

Query: 660 --------------VSDGNTPGLDMLVGT--KHFHFGXNKFSGEIPAQ 755
                         +  G  P    L+ T     +F  N FSG +P +
Sbjct: 609 LKNCTLEKIDIQHNMLSGPIPREVFLISTLSDFMYFQSNMFSGSLPLE 656



 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 53/171 (30%), Positives = 71/171 (41%), Gaps = 23/171 (13%)
 Frame = +3

Query: 309 NGSRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGN---------- 458
           N + +VSL LS   LTG +   +  L  ++ L L  N+ L+G +P  +GN          
Sbjct: 220 NLTSLVSLILSYNHLTGSVPSSLGNLQRIKNLQLRGNQ-LSGPVPTFLGNLSSLTILNLG 278

Query: 459 -------------LKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLG 599
                        L  L  LIL      G IP  +G                G IP SL 
Sbjct: 279 TNRFQGEIVSLQGLSSLTALILQENNLHGGIPSWLGNLSSLVYLSLGGNRLTGGIPESLA 338

Query: 600 QLSELYWLDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
           +L +L  L LA+N LTGSIP S GN   L  L      +   N+ +G IP+
Sbjct: 339 KLEKLSGLVLAENNLTGSIPPSLGNLHSLTDL------YLDRNQLTGYIPS 383



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 41/141 (29%), Positives = 61/141 (43%), Gaps = 1/141 (0%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFF-G 506
           L L    L+G L  D++  + L+ +D+ +N  L+G +PRE+  +  L + +      F G
Sbjct: 594 LYLGQNSLSGPLPSDLKNCT-LEKIDIQHNM-LSGPIPREVFLISTLSDFMYFQSNMFSG 651

Query: 507 LIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGL 686
            +P  I                 G IPPS+G    L +  +  N L G IP S     GL
Sbjct: 652 SLPLEISNLKNIADIDFSNNQISGEIPPSIGDCQSLQYFKIQGNFLQGPIPASVSRLKGL 711

Query: 687 DMLVGTKHFHFGXNKFSGEIP 749
            +L          N FSG+IP
Sbjct: 712 QVL------DLSHNNFSGDIP 726



 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 44/150 (29%), Positives = 64/150 (42%), Gaps = 5/150 (3%)
 Frame = +3

Query: 315  SRVVSLTLSSMD-----LTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNL 479
            S + + TL  +D     L+G +  ++  +S L       +   +GSLP EI NLK + ++
Sbjct: 607  SDLKNCTLEKIDIQHNMLSGPIPREVFLISTLSDFMYFQSNMFSGSLPLEISNLKNIADI 666

Query: 480  ILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIP 659
                    G IP SIG                GPIP S+ +L  L  LDL+ N  +G IP
Sbjct: 667  DFSNNQISGEIPPSIGDCQSLQYFKIQGNFLQGPIPASVSRLKGLQVLDLSHNNFSGDIP 726

Query: 660  VSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
                +  GL  L      +   N F G +P
Sbjct: 727  QFLASMNGLASL------NLSFNHFEGPVP 750



 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 42/146 (28%), Positives = 58/146 (39%), Gaps = 3/146 (2%)
 Frame = +3

Query: 321 VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCG- 497
           +  L L    LTG +   I  LS L+I ++  N+ LTGSLP   GN      L +   G 
Sbjct: 367 LTDLYLDRNQLTGYIPSSISNLSSLRIFNVRDNQ-LTGSLPT--GNRVNFPLLQIFNAGY 423

Query: 498 --FFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDG 671
             F G IP  +                 G +PP +  L+ L  L + +NQL  +     G
Sbjct: 424 NQFEGAIPTWMCNSSMLSSFSIEMNMISGVVPPCVDGLNSLSVLTIQNNQLQANDSYGWG 483

Query: 672 NTPGLDMLVGTKHFHFGXNKFSGEIP 749
               L      +   F  NKF G +P
Sbjct: 484 FLSSLTNSSQLEFLDFSSNKFRGTLP 509



>gb:AP003883_1834801 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1134_H03.>gb:AP005245_1849442 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBa0025J22.
          Length = 380

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 53/141 (37%), Positives = 67/141 (47%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L    LTGE+   I  LS L +L+L+ N  + G +P  I +L  L +L L      G 
Sbjct: 148 LELPGNRLTGEIPRSIGSLSRLTVLNLADNL-IAGEIPSSITSLASLKHLDLTNNQLTGG 206

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGNTPGLD 689
           IPD +G                G IP S+G L+ L  LDLA+N LTG IP S G    L 
Sbjct: 207 IPDDVGDLTMLSRALLGRNKLTGAIPTSVGSLTRLADLDLAENGLTGGIPDSLGGAHVLT 266

Query: 690 MLVGTKHFHFGXNKFSGEIPA 752
            L      + G N+ SG IPA
Sbjct: 267 SL------YLGGNRVSGRIPA 281



 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 47/145 (32%), Positives = 65/145 (44%)
 Frame = +3

Query: 315 SRVVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGC 494
           SR+  L L+   + GE+   I  L+ L+ LDL+ N  LTG +P ++G+L  L   +L   
Sbjct: 167 SRLTVLNLADNLIAGEIPSSITSLASLKHLDLT-NNQLTGGIPDDVGDLTMLSRALLGRN 225

Query: 495 GFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDLADNQLTGSIPVSDGN 674
              G IP S+G                G IP SLG    L  L L  N+++G IP S   
Sbjct: 226 KLTGAIPTSVGSLTRLADLDLAENGLTGGIPDSLGGAHVLTSLYLGGNRVSGRIPASLLQ 285

Query: 675 TPGLDMLVGTKHFHFGXNKFSGEIP 749
             GL +L      +   N   G IP
Sbjct: 286 NKGLGIL------NLSRNAVEGAIP 304



 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 51/165 (30%), Positives = 71/165 (43%), Gaps = 24/165 (14%)
 Frame = +3

Query: 330 LTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPREIGNLKKLYNLILVGCGFFGL 509
           L L++  LTG +  D+ +L+ L    L  NK LTG++P  +G+L +L +L L   G  G 
Sbjct: 196 LDLTNNQLTGGIPDDVGDLTMLSRALLGRNK-LTGAIPTSVGSLTRLADLDLAENGLTGG 254

Query: 510 IPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQ----------------------LSELYW- 620
           IPDS+G                G IP SL Q                       +E Y+ 
Sbjct: 255 IPDSLGGAHVLTSLYLGGNRVSGRIPASLLQNKGLGILNLSRNAVEGAIPDVFTAESYFM 314

Query: 621 -LDLADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIPA 752
            LDL+ N+LTG++P S      L       H     N+  G IPA
Sbjct: 315 VLDLSRNRLTGAVPRS------LSAAAYVGHLDLSHNRLCGSIPA 353



>gb:AJ841697_1814400 Poa pratensis serk2 gene for somatic
           embryogenesis receptor-like kinase 2, exons 1-11, allele
           1.
          Length = 629

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 57/160 (35%), Positives = 77/160 (48%), Gaps = 1/160 (0%)
 Frame = +3

Query: 273 DPCGDHWEGVGCNGSR-VVSLTLSSMDLTGELSGDIEELSELQILDLSYNKDLTGSLPRE 449
           DPC   W  V C+  + VVSL +++  L+G LS  I  LS LQ + L  N+ ++G +P E
Sbjct: 73  DPCT--WSMVTCSADQFVVSLQVANNGLSGALSPSIGNLSYLQTMLLQNNR-ISGDIPPE 129

Query: 450 IGNLKKLYNLILVGCGFFGLIPDSIGXXXXXXXXXXXXXXFIGPIPPSLGQLSELYWLDL 629
           +G L KL  L L G                          F+G IP SLGQL++L +L L
Sbjct: 130 VGKLAKLKALDLSG------------------------NQFVGEIPNSLGQLTQLNYLRL 165

Query: 630 ADNQLTGSIPVSDGNTPGLDMLVGTKHFHFGXNKFSGEIP 749
             N L+G IPV+  + PGL  L          N  SG +P
Sbjct: 166 DRNNLSGQIPVNVASLPGLTFL------DISFNNLSGPVP 199


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 868,278,347
Number of Sequences: 1806583
Number of extensions: 19508107
Number of successful extensions: 63755
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 50748
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 57949
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 46635415521
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)