BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2112
         (618 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB025631_1516571 Arabidopsis thaliana genomic DNA, chromosome...    83   3e-15   
gb:AY095995_1575869 Arabidopsis thaliana AT3g19950/MPN9_19 mRNA,...    83   4e-15   
gb:AE016959_1023177 Oryza sativa (japonica cultivar-group) chrom...    79   5e-14   
gb:AP002842_1823059 Oryza sativa (japonica cultivar-group) genom...    55   9e-07   
gb:AC135207_1742048 Oryza sativa (japonica cultivar-group) chrom...    45   7e-04   
pir|T02286|T02286 hypothetical protein T13D8.23 - Arabidopsis th...    42   0.008   Arabidopsis thaliana [mouse-ear cress]
gb:AP004125_1837961 Oryza sativa (japonica cultivar-group) genom...    41   0.018   
gb:AC079022_1541716 Oryza sativa chromosome 5 clone P0574H01, co...    38   0.12    
pir|T45599|T45599 hypothetical protein F12A12.140 - Arabidopsis ...    37   0.20    Arabidopsis thaliana [mouse-ear cress]
gb:AP003221_1825506 Oryza sativa (japonica cultivar-group) genom...    37   0.26    
gb:AP004687_1843386 Oryza sativa (japonica cultivar-group) genom...    36   0.58    
gb:OSJN00073_1694344 Oryza sativa genomic DNA, chromosome 4, BAC...    35   0.76    
pir|F96597|F96597 hypothetical protein T5A14.7 [imported] - Arab...    35   1.3     Arabidopsis thaliana [mouse-ear cress]
gb:AP000603_1820397 Arabidopsis thaliana genomic DNA, chromosome...    34   1.7     
gb:OSJN00158_1695884 Oryza sativa genomic DNA, chromosome 4, BAC...    34   1.7     
gb:BT010726_1640672 Arabidopsis thaliana At3g13430 mRNA, complet...    34   1.7     
gb:BA000030_704581 Streptomyces avermitilis MA-4680 genomic DNA,...    34   1.7     
gb:AP000836_1820660 Oryza sativa (japonica cultivar-group) genom...    34   2.2     
gb:AB009049_1510600 Arabidopsis thaliana genomic DNA, chromosome...    34   2.2     
gb:BC079688_2561227 Xenopus laevis MGC80300 protein, mRNA (cDNA ...    33   3.8     
gb:AC135594_1742644 Oryza sativa chromosome 3 BAC OSJNBa0024F18 ...    33   3.8     
gb:AY045983_1561479 Arabidopsis thaliana unknown protein (At3g56...    33   3.8     
gb:CR377166_93323 Circular plasmid pWCFS103 from Lactobacillus p...    33   3.8     
pir|T01001|T01001 hypothetical protein At2g39720 [imported] - Ar...    33   3.8     Arabidopsis thaliana [mouse-ear cress]
pir|T49059|T49059 hypothetical protein T5P19.230 - Arabidopsis t...    33   3.8     Arabidopsis thaliana [mouse-ear cress]
gb:BC070697_2555668 Xenopus laevis hypothetical protein MGC83223...    33   4.9     
gb:BC056088_2551670 Xenopus laevis hypothetical protein MGC69096...    33   4.9     
gb:AC097175_1736469 Oryza sativa (japonica cultivar-group) chrom...    33   4.9     
gb:BC059189_2552314 Danio rerio zgc:64189, mRNA (cDNA clone MGC:...    32   6.4     
gb:AP006456_1861919 Oryza sativa (japonica cultivar-group) genom...    32   6.4     
gb:AP005655_1855575 Oryza sativa (japonica cultivar-group) genom...    32   6.4     
gb:AP004648_1842613 Oryza sativa (japonica cultivar-group) genom...    32   6.4     
gb:AP003443_1829482 Oryza sativa (japonica cultivar-group) genom...    32   6.4     
gb:AE014297_1138575 Drosophila melanogaster chromosome 3R, compl...    32   6.4     
gb:AE017261_420434 Picrophilus torridus DSM 9790, complete genome.     32   6.4     
pir|AB3388|AB3388 soluble lytic murein transglycosylase (EC 3.2....    32   6.4     Brucella melitensis
gb:AB042530_2045589 Rattus norvegicus Muc5AC mRNA for mucin, par...    32   8.4     
gb:AP005817_1858362 Oryza sativa (japonica cultivar-group) genom...    32   8.4     
gb:AB010070_1510885 Arabidopsis thaliana genomic DNA, chromosome...    32   8.4     
gb:AE016959_1020790 Oryza sativa (japonica cultivar-group) chrom...    32   8.4     


>gb:AB025631_1516571 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MPN9.
          Length = 386

 Score = 83.2 bits (204), Expect = 3e-15
 Identities = 63/201 (31%), Positives = 85/201 (42%), Gaps = 13/201 (6%)
 Frame = +1

Query: 55  VNRTRKMSHAXXXXXXXXXXXXXXXPQD---YFCYHCERTVTITPLPNSELVCPNCNGNF 225
           ++R+ K + +               P+    +FCY C +TVTI+   +++  CP CN  F
Sbjct: 48  LSRSEKFAESVMSSGVNSTGSAAAAPEVDKMFFCYQCNQTVTISISSSADPFCPICNQGF 107

Query: 226 LEEAETAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSTASSGGGIALDDLSA 405
           LEE E                                       S+A++  G+   D  +
Sbjct: 108 LEEYEDPNPNQSLNFNPNSSDSFFPMADPFSTLLPLIFG-----SSAAAPSGM---DFMS 159

Query: 406 LFGG--MAAGRSPNQ------FHPLLFLQNYLQTMRASGANIQLVFEN--SXXXXXXXXX 555
           LFG       RS  Q      F P  FLQN+LQT+R+SG + + V EN  S         
Sbjct: 160 LFGPSMQPQARSTQQNPQSDAFDPFTFLQNHLQTLRSSGTHFEFVIENHPSDPGNRMPGN 219

Query: 556 XXDYFVGPGLEQLIQQLMEND 618
             DYF GPGLEQLIQQL END
Sbjct: 220 FGDYFFGPGLEQLIQQLAEND 240



>gb:AY095995_1575869 Arabidopsis thaliana AT3g19950/MPN9_19 mRNA,
           complete cds.>gb:BT000583_1634861 Arabidopsis thaliana
           unknown protein (At3g19950/MPN9_19) mRNA, complete cds.
          Length = 328

 Score = 82.8 bits (203), Expect = 4e-15
 Identities = 60/170 (35%), Positives = 76/170 (44%), Gaps = 10/170 (5%)
 Frame = +1

Query: 139 YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETAXXXXXXXXXXXXXXXXXXXXXXXX 318
           +FCY C +TVTI+   +++  CP CN  FLEE E                          
Sbjct: 21  FFCYQCNQTVTISISSSADPFCPICNQGFLEEYEDPNPNQSLNFNPNSSDSFFPMADPFS 80

Query: 319 XXXXXXXXXXXXXSTASSGGGIALDDLSALFGG--MAAGRSPNQ------FHPLLFLQNY 474
                        S+A++  G+   D  +LFG       RS  Q      F P  FLQN+
Sbjct: 81  TLLPLIFG-----SSAAAPSGM---DFMSLFGPSMQPQARSTQQNPQSDAFDPFTFLQNH 132

Query: 475 LQTMRASGANIQLVFEN--SXXXXXXXXXXXDYFVGPGLEQLIQQLMEND 618
           LQT+R+SG + + V EN  S           DYF GPGLEQLIQQL END
Sbjct: 133 LQTLRSSGTHFEFVIENHPSDPGNRMPGNFGDYFFGPGLEQLIQQLAEND 182



>gb:AE016959_1023177 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC087182_1733960
           Oryza sativa chromosome 10 BAC OSJNBa0029C15 genomic
           sequence, complete sequence.>gb:AE017107_1752996 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           61 of 77 of the complete sequence.
          Length = 370

 Score = 79.3 bits (194), Expect = 5e-14
 Identities = 57/192 (29%), Positives = 73/192 (38%), Gaps = 30/192 (15%)
 Frame = +1

Query: 133 QDYFCYHCERTVTI--TPLPNSELVCPNCNGNFLEEAETAXXXXXXXXXXXXXXXXXXXX 306
           + YFCY C RTV +  +      L CP C G+F+EE                        
Sbjct: 14  KQYFCYQCNRTVLLPASAAAAGALSCPECRGDFIEEVNVPAPAIIPFPFAFPPMMPTATS 73

Query: 307 XXXXXXXXXXXXXXXXXSTASSGGGIALDDLSALFGGM-----------------AAGRS 435
                            S A+S       DLSA    M                 AAG +
Sbjct: 74  ASAAAAAAASPTQSSSSSAATSPSS----DLSAFLNSMLGPLNLRTDERMPGTTSAAGTA 129

Query: 436 -----PNQFHPLLFLQNYLQTMRASGANIQLVFENSXXXXX------XXXXXXDYFVGPG 582
                P+ F  + F QNYLQ +   GANIQ++ +++                 DYFVGPG
Sbjct: 130 TPEDEPDGFDAVTFFQNYLQNLMDGGANIQVLLDDASVGLAPGIGRVGGASFGDYFVGPG 189

Query: 583 LEQLIQQLMEND 618
           LEQLI+QL END
Sbjct: 190 LEQLIEQLTEND 201



>gb:AP002842_1823059 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:OSJNBa0075G19.>gb:AP006751_1862856 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:B1460A05.
          Length = 338

 Score = 55.1 bits (131), Expect = 9e-07
 Identities = 35/87 (40%), Positives = 43/87 (49%), Gaps = 12/87 (13%)
 Frame = +1

Query: 394 DLSALFGGMAAGRSPN----QFHPLLFLQNYLQTMRASGANIQLVFENSXXXXXXXXXXX 561
           DL+A FG  +   SP+     F P  FL ++   + + GA IQ+V E S           
Sbjct: 81  DLAAFFGPPSPSPSPSPAARHFDPSNFLHDHFTGLLSGGATIQIVLEGSSASLPLGGAAA 140

Query: 562 --------DYFVGPGLEQLIQQLMEND 618
                   DYFVG GLEQLIQQL END
Sbjct: 141 GPGGISLGDYFVGSGLEQLIQQLAEND 167



 Score = 42.0 bits (97), Expect = 0.008
 Identities = 16/36 (44%), Positives = 26/36 (72%), Gaps = 2/36 (5%)
 Frame = +1

Query: 133 QDYFCYHCERTVTITP--LPNSELVCPNCNGNFLEE 234
           Q ++C+ C+RTV I P   P+++++CP C G F+EE
Sbjct: 9   QRFYCHQCDRTVPIPPPTSPDADVLCPFCGGGFVEE 44



>gb:AC135207_1742048 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1261C08, complete sequence.
          Length = 279

 Score = 45.4 bits (106), Expect = 7e-04
 Identities = 18/35 (51%), Positives = 24/35 (68%)
 Frame = +1

Query: 130 PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEE 234
           P  Y+CYHC R V ++P   S +VCP C+G FLE+
Sbjct: 5   PVSYWCYHCSRFVRVSP---STVVCPECDGGFLEQ 36



>pir|T02286|T02286 hypothetical protein T13D8.23 - Arabidopsis
           thaliana>gb:AE005173_893714 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:T13D8_1723412 Arabidopsis thaliana
           chromosome 1 BAC T13D8, complete sequence.
          Length = 327

 Score = 42.0 bits (97), Expect = 0.008
 Identities = 17/35 (48%), Positives = 21/35 (60%)
 Frame = +1

Query: 139 YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAET 243
           Y+CYHC+R V I     SE+ CP C   F+ E ET
Sbjct: 24  YWCYHCDRMVRIASSNPSEIACPRCLRQFVVEIET 58



>gb:AP004125_1837961 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1767_D02.>gb:AP005287_1849901 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1004_A11.
          Length = 340

 Score = 40.8 bits (94), Expect = 0.018
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = +1

Query: 139 YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAE 240
           Y+CY C R + I   P++++ CP C G FL E +
Sbjct: 20  YWCYQCGRAIRIISYPSTDVFCPRCFGRFLHEID 53



>gb:AC079022_1541716 Oryza sativa chromosome 5 clone P0574H01,
           complete sequence.
          Length = 386

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%)
 Frame = +1

Query: 139 YFCYHCERTVTI-TPLPNSELVCPNCNGNFLEE 234
           Y+CY C+R V    P  +S + CP+C G FLEE
Sbjct: 21  YWCYSCDRFVRAPAPHDDSAVACPDCGGGFLEE 53



>pir|T45599|T45599 hypothetical protein F12A12.140 - Arabidopsis
           thaliana>gb:ATF12A12_1548303 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F12A12.>gb:AY093203_1575157
           Arabidopsis thaliana putative protein (At3g46620) mRNA,
           complete cds.>gb:BT008859_1640055 Arabidopsis thaliana
           At3g46620 mRNA, complete cds.
          Length = 395

 Score = 37.4 bits (85), Expect = 0.20
 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 2/36 (5%)
 Frame = +1

Query: 139 YFCYHCERTVTI--TPLPNSELVCPNCNGNFLEEAE 240
           Y+CY C R +++      N+ ++CP CNG F+EE E
Sbjct: 31  YWCYSCTRFISVWEDQDANAGVLCPYCNGGFIEEIE 66



>gb:AP003221_1825506 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0003D09.
          Length = 329

 Score = 37.0 bits (84), Expect = 0.26
 Identities = 30/157 (19%), Positives = 47/157 (29%)
 Frame = +1

Query: 139 YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETAXXXXXXXXXXXXXXXXXXXXXXXX 318
           ++CY C R + ++     ++ CPNCN  F++E                            
Sbjct: 7   HWCYACRRPIRVS---GQDITCPNCNDGFIQE---ISEIGGSLNTYGIFDPSFDERRDRS 60

Query: 319 XXXXXXXXXXXXXSTASSGGGIALDDLSALFGGMAAGRSPNQFHPLLFLQNYLQTMRASG 498
                          A  G    LD           GR P     L+F  N    + +S 
Sbjct: 61  FGMVEAMSDLMRQRMAEMGRNRVLDFHGTRGASSHQGRQPTVRPMLIFGSNAPDRVSSSS 120

Query: 499 ANIQLVFENSXXXXXXXXXXXDYFVGPGLEQLIQQLM 609
               ++                + VGP LE L +QL+
Sbjct: 121 EEADILLRQGRRIGADRPNFSRFLVGPSLEALFEQLL 157



>gb:AP004687_1843386 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0021C04.
          Length = 331

 Score = 35.8 bits (81), Expect = 0.58
 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%)
 Frame = +1

Query: 139 YFCYHCERTV-TITPLPNSELVCPNCNGNFLEEAE 240
           Y+CY C R +  + P   S++ CP C G FL E +
Sbjct: 20  YWCYVCRRALRVVVPSATSDVYCPRCFGRFLHEID 54



>gb:OSJN00073_1694344 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0027H06, complete sequence.
          Length = 282

 Score = 35.4 bits (80), Expect = 0.76
 Identities = 27/84 (32%), Positives = 39/84 (46%), Gaps = 2/84 (2%)
 Frame = +2

Query: 203 ALIATATFLKKPKPPRLQTLATII-PSSPAPMRFLLASAVXXXXXXXGR-ALCSPRPPPA 376
           A +A  +FL    PP    L+  + PSSP   R  L   +       GR AL  P PPP 
Sbjct: 14  AAVAMLSFLLLLAPPPDALLSAFLSPSSPYAHRPKLLFLLAGQSNMAGRGALARPLPPPY 73

Query: 377 VGLRLMIFLLCSVVWLPADPQINS 448
           +    ++ L  S  W+PA P +++
Sbjct: 74  LPHPRLLRLAASRRWVPAAPPLHA 97



>pir|F96597|F96597 hypothetical protein T5A14.7 [imported] -
           Arabidopsis thaliana>gb:AE005173_893434 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC005223_1532329 Arabidopsis thaliana
           chromosome I BAC T5A14, complete
           sequence.>gb:AY039608_1560321 Arabidopsis thaliana
           At1g55530/T5A14_7 mRNA, complete
           cds.>gb:BT000502_1634780 Arabidopsis thaliana unknown
           protein (At1g55530/T5A14_7) mRNA, complete
           cds.>gb:AF424578_1798917 Arabidopsis thaliana
           At1g55530/T5A14_7 mRNA, complete cds.
          Length = 351

 Score = 34.7 bits (78), Expect = 1.3
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = +1

Query: 562 DYFVGPGLEQLIQQLMEND 618
           DYF+GPG E L+Q+L END
Sbjct: 177 DYFIGPGFEMLLQRLAEND 195



 Score = 34.7 bits (78), Expect = 1.3
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = +1

Query: 139 YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAE 240
           Y+C+ C +TV   P+  +E+ CP C   F+EE E
Sbjct: 9   YWCHMCSQTVN--PVMEAEIKCPFCQSGFVEEME 40



>gb:AP000603_1820397 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MRP15.
          Length = 315

 Score = 34.3 bits (77), Expect = 1.7
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = +1

Query: 562 DYFVGPGLEQLIQQLMEND 618
           DYF+GPG E L+Q+L END
Sbjct: 177 DYFIGPGFETLLQRLAEND 195



>gb:OSJN00158_1695884 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0019J05, complete
           sequence.>gb:OSJN00202_1696630 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBb0032D24, complete
           sequence.
          Length = 973

 Score = 34.3 bits (77), Expect = 1.7
 Identities = 31/94 (32%), Positives = 41/94 (43%), Gaps = 3/94 (3%)
 Frame = +2

Query: 101 VEKESVAAAGRRITSATIASGR*RLPPCPTPNSSALI---ATATFLKKPKPPRLQTLATI 271
           V + S++AAGR  TSA   SG  R  P P P  + +    AT      P+PP L   A+ 
Sbjct: 148 VYRPSLSAAGRS-TSARSVSGSSRTQPFPKPTLARVKSERATTAAAASPRPPALAPPAS- 205

Query: 272 IPSSPAPMRFLLASAVXXXXXXXGRALCSPRPPP 373
             +S   M     SA         ++  SPRP P
Sbjct: 206 --NSLKDMARTAPSASSKAPSTLQKSKLSPRPSP 237



>gb:BT010726_1640672 Arabidopsis thaliana At3g13430 mRNA, complete
           cds.>gb:BT011661_1641183 Arabidopsis thaliana At3g13430
           mRNA, complete cds.
          Length = 315

 Score = 34.3 bits (77), Expect = 1.7
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = +1

Query: 562 DYFVGPGLEQLIQQLMEND 618
           DYF+GPG E L+Q+L END
Sbjct: 177 DYFIGPGFETLLQRLAEND 195



>gb:BA000030_704581 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 296

 Score = 34.3 bits (77), Expect = 1.7
 Identities = 27/84 (32%), Positives = 35/84 (41%), Gaps = 4/84 (4%)
 Frame = -1

Query: 384 NPTAGGGRGEHKALPXXXXXXSTAEAKRKRIGA-GEEGIIVARVCRRGGFGFFKKVAVAI 208
           NPTAG GRG H A P      +   + R  +G   E+ +  AR    GG G      VA+
Sbjct: 10  NPTAGRGRGAHAAQPAASALRAAGFSVRTILGENAEDALARAREAVAGGTG----ALVAV 65

Query: 207 RAD---EFGVGQGGNRHRPLAMVA 145
             D      +   G    PL +VA
Sbjct: 66  GGDGMAHLALQAVGGTRTPLGLVA 89



>gb:AP000836_1820660 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0038F12.
          Length = 329

 Score = 33.9 bits (76), Expect = 2.2
 Identities = 38/179 (21%), Positives = 59/179 (32%), Gaps = 19/179 (10%)
 Frame = +1

Query: 139 YFCYHCERTVTITPLPNSE--LVCPNCNGNFLEEAETAXXXXXXXXXXXXXXXXXXXXXX 312
           Y+C+ C  TV+       E  + CP C+  F+EE E+A                      
Sbjct: 11  YYCHMCASTVSAVAAAEGEVEIKCPYCHSGFVEEIESARGVATGGGGAISSVWAPIIDGM 70

Query: 313 XXXXXXXXXXXXXXXSTASSGGG--------IALDDLSALFGGMAAGRSPNQFHPLLFLQ 468
                             +   G        +AL D S      AA         LL +Q
Sbjct: 71  VGGGGGDAVRRHRRSRRLADAAGADDGYYRDLALLDFSESRRRTAA--------LLLLMQ 122

Query: 469 NY----LQTMRASGANIQLVFENS-----XXXXXXXXXXXDYFVGPGLEQLIQQLMEND 618
            +    LQ + ++ A I      +                DYF+GPGL+ L+Q++ + D
Sbjct: 123 EFRERQLQRLESATATISAAAAEAGAVVGTSRDAEGVALADYFLGPGLDALMQRVGDGD 181



>gb:AB009049_1510600 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MCD7.>gb:AY063905_1565852 Arabidopsis thaliana
           unknown protein (At5g56340) mRNA, complete
           cds.>gb:AY091194_1574403 Arabidopsis thaliana unknown
           protein (At5g56340) mRNA, complete cds.
          Length = 396

 Score = 33.9 bits (76), Expect = 2.2
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = +1

Query: 562 DYFVGPGLEQLIQQLMEND 618
           DYF+GPGL+ L+Q L END
Sbjct: 213 DYFIGPGLDLLLQHLAEND 231



 Score = 32.3 bits (72), Expect = 6.4
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = +1

Query: 139 YFCYHCERTVTITPLPNSELVCPNCNGNFLEE 234
           Y+C+ C + V   P+  SE+ CP C   F+EE
Sbjct: 9   YWCHMCSQMVN--PVMESEIKCPFCQSGFIEE 38



>gb:BC079688_2561227 Xenopus laevis MGC80300 protein, mRNA (cDNA
           clone MGC:80300 IMAGE:5073686), complete cds.
          Length = 295

 Score = 33.1 bits (74), Expect = 3.8
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = +1

Query: 139 YFCYHCERTVTITPLPNSELVCPNCNGNFLEE 234
           +FC+HC+  V    LP  E +CP C+  F+EE
Sbjct: 12  FFCHHCKGEVN-PKLP--EYICPRCDSGFIEE 40



>gb:AC135594_1742644 Oryza sativa chromosome 3 BAC OSJNBa0024F18
           genomic sequence, complete sequence.>gb:AC137507_1743432
           Oryza sativa chromosome 3 BAC OSJNBb0033J23 genomic
           sequence, complete sequence.
          Length = 369

 Score = 33.1 bits (74), Expect = 3.8
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = +1

Query: 139 YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETA 246
           Y+C+HCE    I P+   ++ CP+C+  F+EE  +A
Sbjct: 9   YWCHHCEEV--IEPV-EPDMKCPSCDSGFVEEMGSA 41



>gb:AY045983_1561479 Arabidopsis thaliana unknown protein
           (At3g56580) mRNA, complete cds.>gb:AY096613_1576153
           Arabidopsis thaliana unknown protein (At3g56580) mRNA,
           complete cds.
          Length = 320

 Score = 33.1 bits (74), Expect = 3.8
 Identities = 36/160 (22%), Positives = 48/160 (30%), Gaps = 4/160 (2%)
 Frame = +1

Query: 139 YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETAXXXXXXXXXXXXXXXXXXXXXXXX 318
           ++C+ C+R V +      + VC  C G F+EE +                          
Sbjct: 8   HWCHRCQRAVWLRA---RDAVCSYCGGGFVEEIDIGPSRAHRDVERDPTFDLMEAFSAFM 64

Query: 319 XXXXXXXXXXXXXSTASSGGGIALDDLSALFGGMAAGRSPNQFHPLLFLQNYLQTMRASG 498
                        S      G      S  F  +A         PLL          A G
Sbjct: 65  RSRLAERSYDREISGRLGSAG------SESFSNLA---------PLLIFGGQAPFRLAGG 109

Query: 499 ANIQL-VFENSXX---XXXXXXXXXDYFVGPGLEQLIQQL 606
            N  +  F N               DYF GPGLE+LI+QL
Sbjct: 110 DNSSVEAFVNGAAPGIGIARGTNAGDYFFGPGLEELIEQL 149



>gb:CR377166_93323 Circular plasmid pWCFS103 from Lactobacillus
           plantarum WCFS1.
          Length = 93

 Score = 33.1 bits (74), Expect = 3.8
 Identities = 16/64 (25%), Positives = 32/64 (50%)
 Frame = -1

Query: 600 LDQLFEPRTDEVISEIPRNPSTTATVFKNQLNISTASPHGLQIVLEEKKGMELIWGSAGS 421
           +D+     T+ V+SE+  NP+T   +F  ++  + A P    +  EE+  +  +  + G+
Sbjct: 13  IDKDLADDTEAVLSELGLNPTTAINMFYKRIVANGALPFNASLTEEERANLRFLKATEGT 72

Query: 420 HTTE 409
             TE
Sbjct: 73  PVTE 76



>pir|T01001|T01001 hypothetical protein At2g39720 [imported] -
           Arabidopsis thaliana>gb:AC003000_1530915 Arabidopsis
           thaliana chromosome 2 clone T5I7 map CIC10A06, complete
           sequence.>gb:AY074579_1567618 Arabidopsis thaliana
           At2g39720/T5I7.2 mRNA, complete cds.>gb:AY086492_1571540
           Arabidopsis thaliana clone 253849 mRNA, complete
           sequence.>gb:AY094016_1575522 Arabidopsis thaliana
           At2g39720/T5I7.2 mRNA, complete cds.>gb:AF079186_1766308
           Arabidopsis thaliana RING-H2 finger protein RHC2a mRNA,
           complete cds.
          Length = 401

 Score = 33.1 bits (74), Expect = 3.8
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +1

Query: 139 YFCYHCERTVTITPLPNSELVCPNCNGNFLE 231
           Y+CY C R V ++      + CP+C+G FLE
Sbjct: 6   YWCYSCSRFVWVS----DSISCPDCDGGFLE 32



>pir|T49059|T49059 hypothetical protein T5P19.230 - Arabidopsis
           thaliana>gb:ATT5P19_1556263 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T5P19.
          Length = 617

 Score = 33.1 bits (74), Expect = 3.8
 Identities = 36/160 (22%), Positives = 48/160 (30%), Gaps = 4/160 (2%)
 Frame = +1

Query: 139 YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETAXXXXXXXXXXXXXXXXXXXXXXXX 318
           ++C+ C+R V +      + VC  C G F+EE +                          
Sbjct: 8   HWCHRCQRAVWLRA---RDAVCSYCGGGFVEEIDIGPSRAHRDVERDPTFDLMEAFSAFM 64

Query: 319 XXXXXXXXXXXXXSTASSGGGIALDDLSALFGGMAAGRSPNQFHPLLFLQNYLQTMRASG 498
                        S      G      S  F  +A         PLL          A G
Sbjct: 65  RSRLAERSYDREISGRLGSAG------SESFSNLA---------PLLIFGGQAPFRLAGG 109

Query: 499 ANIQL-VFENSXX---XXXXXXXXXDYFVGPGLEQLIQQL 606
            N  +  F N               DYF GPGLE+LI+QL
Sbjct: 110 DNSSVEAFVNGAAPGIGIARGTNAGDYFFGPGLEELIEQL 149



>gb:BC070697_2555668 Xenopus laevis hypothetical protein MGC83223,
           mRNA (cDNA clone MGC:83223 IMAGE:6635294), complete cds.
          Length = 312

 Score = 32.7 bits (73), Expect = 4.9
 Identities = 17/33 (51%), Positives = 20/33 (60%), Gaps = 1/33 (3%)
 Frame = +1

Query: 139 YFCYHCERTVTITP-LPNSELVCPNCNGNFLEE 234
           YFC+ C  T  ITP LP  E  CP C+  F+EE
Sbjct: 11  YFCHSC--TAEITPRLP--EYTCPRCDSGFIEE 39



>gb:BC056088_2551670 Xenopus laevis hypothetical protein MGC69096,
           mRNA (cDNA clone MGC:69096 IMAGE:5047313), complete cds.
          Length = 312

 Score = 32.7 bits (73), Expect = 4.9
 Identities = 17/33 (51%), Positives = 20/33 (60%), Gaps = 1/33 (3%)
 Frame = +1

Query: 139 YFCYHCERTVTITP-LPNSELVCPNCNGNFLEE 234
           YFC+ C  T  ITP LP  E  CP C+  F+EE
Sbjct: 11  YFCHSC--TAEITPRLP--EYTCPRCDSGFIEE 39



>gb:AC097175_1736469 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1119_H02, complete sequence.
          Length = 323

 Score = 32.7 bits (73), Expect = 4.9
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +1

Query: 139 YFCYHCERTVTITPLPNSELVCPNCNGNFLEE 234
           Y+C+ CE+ +    +   E+ CP+C G F+EE
Sbjct: 9   YWCHECEQAIEEAMV--DEIKCPSCGGGFVEE 38



>gb:BC059189_2552314 Danio rerio zgc:64189, mRNA (cDNA clone
           MGC:64189 IMAGE:6798261), complete cds.
          Length = 690

 Score = 32.3 bits (72), Expect = 6.4
 Identities = 33/105 (31%), Positives = 43/105 (40%), Gaps = 8/105 (7%)
 Frame = +2

Query: 179 PCPTPNSSALIATATFLKKPKPPRLQTLATIIP---SSPAPMRFLLASAVXXXXXXXGRA 349
           P P P   AL A    L  P PPRL  L+   P   S P P+R L   A         + 
Sbjct: 369 PAP-PRLLALPAPPRLLALPAPPRLLALSAPAPERSSMPVPVRLLALPAPL-------KL 420

Query: 350 LCSPRPP-----PAVGLRLMIFLLCSVVWLPADPQINSIPFFSSR 469
           L  P PP     PA   RL +     ++ LP   ++ ++P  S R
Sbjct: 421 LALPAPPRFLALPAPPRRLALPAPTRLLALPVPARLLALPTPSRR 465



>gb:AP006456_1861919 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OSJNBa0030A22.>gb:AP006459_1861980 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBa0084D17.
          Length = 462

 Score = 32.3 bits (72), Expect = 6.4
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 3/60 (5%)
 Frame = -1

Query: 414 TEQ---SRKIIKRNPTAGGGRGEHKALPXXXXXXSTAEAKRKRIGAGEEGIIVARVCRRG 244
           TEQ   +R+I+++    GGGRG             T + KR+R   G  G +VA V R G
Sbjct: 330 TEQRRGARRIVRQAMACGGGRGIASGRRKGFGGELTDKRKRRRRIGGSRGEVVATVGRNG 389



>gb:AP005655_1855575 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0025H07.>gb:AP006057_1860621 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:B1342C04.
          Length = 175

 Score = 32.3 bits (72), Expect = 6.4
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 3/60 (5%)
 Frame = -1

Query: 414 TEQ---SRKIIKRNPTAGGGRGEHKALPXXXXXXSTAEAKRKRIGAGEEGIIVARVCRRG 244
           TEQ   +R+I+++    GGGRG             T + KR+R   G  G +VA V R G
Sbjct: 43  TEQRRGARRIVRQAMACGGGRGIASGRRKGFGGELTDKKKRRRRIGGSHGEVVATVGRNG 102



>gb:AP004648_1842613 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1449_H02.>gb:AP005603_1854711 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:B1047A05.
          Length = 646

 Score = 32.3 bits (72), Expect = 6.4
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 3/60 (5%)
 Frame = -1

Query: 414 TEQ---SRKIIKRNPTAGGGRGEHKALPXXXXXXSTAEAKRKRIGAGEEGIIVARVCRRG 244
           TEQ   +R+I+++    GGGRG             T + KR+R   G  G +VA V R G
Sbjct: 305 TEQRRGARRIVRQAMACGGGRGIASGRRKGFGGELTDKRKRRRRIGGSRGEVVAMVGRNG 364



>gb:AP003443_1829482 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:B1144D11.>gb:AP003924_1835324 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1064G04.
          Length = 276

 Score = 32.3 bits (72), Expect = 6.4
 Identities = 16/50 (32%), Positives = 28/50 (56%)
 Frame = -3

Query: 490 PSWSANSSGGKEGDGIDLGIGRQPYHRTKQKDHQAQSHRRRRPWRTQGPP 341
           P+ +A   GG  G+G D G+G+   ++ K+K  + +S R +   +  GPP
Sbjct: 48  PTAAATGGGGGGGEG-DGGVGQAGKNKNKKKKKRKKSARTKNKGKPDGPP 96



>gb:AE014297_1138575 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003681_1220568 Drosophila melanogaster
           chromosome 3R, section 19 of 118 of the complete
           sequence.>gb:AY052007_1290601 Drosophila melanogaster
           LD47007 full length cDNA.
          Length = 380

 Score = 32.3 bits (72), Expect = 6.4
 Identities = 13/32 (40%), Positives = 18/32 (56%)
 Frame = +1

Query: 139 YFCYHCERTVTITPLPNSELVCPNCNGNFLEE 234
           +FC+ C   + I   PNS+  CP C   F+EE
Sbjct: 17  FFCHMCNVEINI---PNSDFTCPLCANGFVEE 45



>gb:AE017261_420434 Picrophilus torridus DSM 9790, complete genome.
          Length = 328

 Score = 32.3 bits (72), Expect = 6.4
 Identities = 22/78 (28%), Positives = 39/78 (50%)
 Frame = -1

Query: 597 DQLFEPRTDEVISEIPRNPSTTATVFKNQLNISTASPHGLQIVLEEKKGMELIWGSAGSH 418
           D++FE + D ++     +P+T   +    L I+ A  HG+ IV   K  + L W      
Sbjct: 76  DEIFEIKPDVIVDV---SPATKDGIRGKNLYIN-AFEHGIDIVTANKAPLALHWHDI-MD 130

Query: 417 TTEQSRKIIKRNPTAGGG 364
           +  ++R+II+   + GGG
Sbjct: 131 SASKNRRIIRYEASVGGG 148



>pir|AB3388|AB3388 soluble lytic murein transglycosylase (EC
           3.2.1.-) [imported] - Brucella melitensis (strain
           16M)>gb:AE009548_253006 Brucella melitensis 16M
           chromosome I, section 105 of 195 of the complete
           sequence.>gb:AE008917_978918 Brucella melitensis 16M
           chromosome I, complete sequence.
          Length = 969

 Score = 32.3 bits (72), Expect = 6.4
 Identities = 23/73 (31%), Positives = 29/73 (39%), Gaps = 4/73 (5%)
 Frame = -1

Query: 438 WGSAGSHTTEQSRKIIKRNPTAGGGRGEHKALPXXXXXXSTAEAKRKRIGAGEEGIIVAR 259
           W + G+ T E            GG  GE  A+P        AEA R R   G  G+I+A 
Sbjct: 617 WAAQGAQTME------------GGDYGERAAMPTEDDLGGAAEAYRNRPVRGRRGLILAS 664

Query: 258 VC----RRGGFGF 232
           V       GG G+
Sbjct: 665 VAGVAVLLGGIGY 677



>gb:AB042530_2045589 Rattus norvegicus Muc5AC mRNA for mucin, partial
            cds.
          Length = 1851

 Score = 32.0 bits (71), Expect = 8.4
 Identities = 23/83 (27%), Positives = 36/83 (43%)
 Frame = +2

Query: 113  SVAAAGRRITSATIASGR*RLPPCPTPNSSALIATATFLKKPKPPRLQTLATIIPSSPAP 292
            SV       T +T+AS      P P+P+SS   ++A     P P    T+ T +P++ +P
Sbjct: 1520 SVPVTSTEHTYSTVASSPSTHTPGPSPSSSVPSSSAPARSTPTPVSSTTVKTTLPTT-SP 1578

Query: 293  MRFLLASAVXXXXXXXGRALCSP 361
            M    ++         G  L SP
Sbjct: 1579 MPEPTSATSSVSISTLGSTLASP 1601



>gb:AP005817_1858362 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1118_F01.
          Length = 380

 Score = 32.0 bits (71), Expect = 8.4
 Identities = 32/94 (34%), Positives = 39/94 (41%), Gaps = 1/94 (1%)
 Frame = -1

Query: 387 RNPTAGGGRGEHKALPXXXXXXSTAEAKRKRIGAGEEGIIVARVCRRGGF-GFFKKVAVA 211
           R   AG  RGE   L       ++A A+    G G EG    R  R GG  G   + A A
Sbjct: 185 REAEAGARRGEEGELGLAAEAAASASAR----GDGGEG---RRWRREGGEPGLATEAAAA 237

Query: 210 IRADEFGVGQGGNRHRPLAMVAEVILRPAAATDS 109
             A   GVG GG R R       + +  AAA+ S
Sbjct: 238 ASASVRGVGGGGRRRRREGGEPGLAVAAAAASAS 271



>gb:AB010070_1510885 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MBK20.
          Length = 1289

 Score = 32.0 bits (71), Expect = 8.4
 Identities = 23/75 (30%), Positives = 29/75 (38%), Gaps = 9/75 (12%)
 Frame = +2

Query: 176 PPCPTPNSSALIATATFLKKPKPPRL------QTLATIIPSSPAP---MRFLLASAVXXX 328
           PP P P SS    + T L  P PP L          T++P  P+P     +  A A+   
Sbjct: 692 PPPPPPFSSERPNSGTVLPPPPPPPLPFSSERPNSGTVLPPPPSPPWKSVYASALAIPAI 751

Query: 329 XXXXGRALCSPRPPP 373
                    SP PPP
Sbjct: 752 CSTSQAPTSSPTPPP 766



>gb:AE016959_1020790 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC092553_1735422
           Oryza sativa (japonica cultivar-group) chromosome 10
           clone OSJNBb0072F04, complete
           sequence.>gb:AE017052_1750609 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 6 of 77 of the
           complete sequence.
          Length = 217

 Score = 32.0 bits (71), Expect = 8.4
 Identities = 13/32 (40%), Positives = 18/32 (56%)
 Frame = +1

Query: 139 YFCYHCERTVTITPLPNSELVCPNCNGNFLEE 234
           Y+CY+C+  V   P  +S +  PN  G  LEE
Sbjct: 25  YWCYNCDPFVRAAPHKDSAVAYPNYGGGILEE 56


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 586,292,681
Number of Sequences: 1806583
Number of extensions: 11531575
Number of successful extensions: 41610
Number of sequences better than 10.0: 40
Number of HSP's better than 10.0 without gapping: 39063
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 41450
length of database: 581,917,975
effective HSP length: 119
effective length of database: 366,934,598
effective search space used: 31556375428
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)