BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2103
         (1403 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|B84420|B84420 transfactor-like protein [imported] - Arabidop...   260   5e-68   Arabidopsis thaliana [mouse-ear cress]
gb:AP004011_1836355 Oryza sativa (japonica cultivar-group) genom...   223   6e-57   
gb:AP004396_1841133 Oryza sativa (japonica cultivar-group) genom...   199   1e-49   
gb:AP003616_1831451 Oryza sativa (japonica cultivar-group) genom...   198   3e-49   
gb:AC129718_1740647 Oryza sativa (japonica cultivar-group) chrom...   168   2e-40   
gb:AY625680_1618493 Triticum aestivum MYB transcription factor (...   164   3e-39   
gb:OSJN00091_1694740 Oryza sativa genomic DNA, chromosome 4, BAC...   136   9e-31   
gb:AB017693_1513678 Nicotiana tabacum WERBP-1 mRNA, complete cds.     130   5e-29   
gb:AF219972_1778222 Mesembryanthemum crystallinum CDPK substrate...   129   1e-28   
gb:BT005352_1638292 Arabidopsis thaliana At3g04445 mRNA, complet...   128   2e-28   
gb:ATH310799_1552469 Arabidopsis thaliana mRNA for phosphate sta...   128   2e-28   
gb:ATAC022287_1543760 Arabidopsis thaliana chromosome III BAC T2...   128   2e-28   
gb:AP004324_1840172 Oryza sativa (japonica cultivar-group) genom...   126   9e-28   
gb:AP005647_1855421 Oryza sativa (japonica cultivar-group) genom...   124   4e-27   
gb:BT002344_1635947 Arabidopsis thaliana clone C104936 unknown p...   122   1e-26   
gb:AY085154_1570235 Arabidopsis thaliana clone 13378 mRNA, compl...   122   1e-26   
gb:AY045943_1561440 Arabidopsis thaliana unknown protein (At5g29...   122   1e-26   
gb:BT012658_1641728 Arabidopsis thaliana At5g06800 gene, complet...   120   9e-26   
pir|T10655|T10655 hypothetical protein T5F17.60 - Arabidopsis th...   120   9e-26   Arabidopsis thaliana [mouse-ear cress]
gb:AP005772_1857596 Oryza sativa (japonica cultivar-group) genom...   119   1e-25   
gb:AY084738_1569823 Arabidopsis thaliana clone 116381 mRNA, comp...   119   2e-25   
gb:AY050889_1562382 Arabidopsis thaliana unknown protein (At3g13...   119   2e-25   
gb:AB026645_1517177 Arabidopsis thaliana genomic DNA, chromosome...   119   2e-25   
gb:AY087771_1572798 Arabidopsis thaliana clone 38327 mRNA, compl...   119   2e-25   
gb:AP005167_1848631 Oryza sativa (japonica cultivar-group) genom...   118   3e-25   
gb:AY050355_1562134 Arabidopsis thaliana AT3g24120/MUJ8_3 mRNA, ...   117   4e-25   
gb:BT006119_1639013 Arabidopsis thaliana clone U50843 unknown pr...   116   1e-24   
pir|D96825|D96825 hypothetical protein T8K14.15 [imported] - Ara...   116   1e-24   Arabidopsis thaliana [mouse-ear cress]
gb:AP005101_1847836 Oryza sativa (japonica cultivar-group) genom...   114   4e-24   
pir|E96717|E96717 probable transfactor F24J1.30 [imported] - Ara...   114   5e-24   Arabidopsis thaliana [mouse-ear cress]
gb:AY303170_1597396 Solanum bulbocastanum chromosome 8 clone CB3...   111   3e-23   
gb:OSJN00089_1694698 Oryza sativa genomic DNA, chromosome 4, BAC...   111   4e-23   
gb:BT003421_1636844 Arabidopsis thaliana transfactor-like protei...   108   2e-22   
gb:AY042878_1560943 Arabidopsis thaliana transfactor-like protei...   108   2e-22   
gb:AB012246_1511802 Arabidopsis thaliana genomic DNA, chromosome...   108   2e-22   
gb:AB028621_1518059 Arabidopsis thaliana genomic DNA, chromosome...   108   3e-22   
gb:ATAC011698_1543379 Arabidopsis thaliana chromosome III BAC T1...   107   5e-22   
gb:AP003994_1836065 Oryza sativa (japonica cultivar-group) genom...   107   8e-22   
pir|T05233|T05233 hypothetical protein F18A5.30 - Arabidopsis th...   105   2e-21   Arabidopsis thaliana [mouse-ear cress]
gb:AF291817_1783719 Arabidopsis thaliana MYR1 (MYR1) mRNA, compl...   104   4e-21   
gb:AY070764_1566911 Arabidopsis thaliana AT3g12730/MBK21_9 mRNA,...   104   5e-21   
gb:AY074563_1567603 Arabidopsis thaliana AT3g04030/T11I18_14 mRN...   103   9e-21   
gb:AB024033_1515787 Arabidopsis thaliana genomic DNA, chromosome...   102   1e-20   
gb:AP004396_1841130 Oryza sativa (japonica cultivar-group) genom...   102   2e-20   
gb:AP004120_1837881 Oryza sativa (japonica cultivar-group) genom...    99   2e-19   
gb:AF174480_1774478 Chlamydomonas reinhardtii phosphate starvati...    99   3e-19   
gb:AY224478_1590680 Oryza sativa (japonica cultivar-group) isola...    94   5e-18   
gb:AB022213_1515000 Arabidopsis thaliana genomic DNA, chromosome...    94   9e-18   
gb:AP005757_1857329 Oryza sativa (japonica cultivar-group) genom...    92   3e-17   
pir|G84588|G84588 hypothetical protein At2g20400 [imported] - Ar...    83   1e-14   Arabidopsis thaliana [mouse-ear cress]
pir|C84474|C84474 hypothetical protein At2g06020 [imported] - Ar...    79   2e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AF085279_1767161 Arabidopsis thaliana ABA-regulated gene clus...    77   7e-13   
pir|C84827|C84827 hypothetical protein At2g40260 [imported] - Ar...    77   7e-13   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00155_1695809 Oryza sativa genomic DNA, chromosome 4, BAC...    77   9e-13   
pir|F84856|F84856 hypothetical protein At2g42660 [imported] - Ar...    77   9e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AC099739_1737230 Oryza sativa (japonica cultivar-group) chrom...    76   2e-12   
gb:AP004635_1842362 Oryza sativa (japonica cultivar-group) genom...    75   3e-12   
gb:AP003635_1831904 Oryza sativa (japonica cultivar-group) genom...    75   3e-12   
gb:AP005734_1856832 Oryza sativa (japonica cultivar-group) genom...    74   7e-12   
gb:AY030192_1559357 Arabidopsis thaliana clone A1-2 KANADI prote...    74   7e-12   
gb:AP005859_1859148 Oryza sativa (japonica cultivar-group) genom...    74   9e-12   
gb:AP005613_1854942 Oryza sativa (japonica cultivar-group) genom...    74   9e-12   
gb:AP004810_1845470 Oryza sativa (japonica cultivar-group) genom...    74   9e-12   
gb:AC099043_1737023 Oryza sativa chromosome 3 BAC OSJNBa0079B15 ...    74   9e-12   
gb:AY632360_1618717 Gossypium hirsutum BAC 106I22, complete sequ...    73   1e-11   
gb:AY048689_1561775 Arabidopsis thaliana GARP-like putative tran...    73   1e-11   
gb:BT004973_1637919 Arabidopsis thaliana clone U50495 unknown pr...    73   2e-11   
gb:AY048690_1561776 Arabidopsis thaliana GARP-like putative tran...    72   2e-11   
gb:AY568658_1178638 Arabidopsis thaliana myb family transcriptio...    72   2e-11   
gb:AE005172_890454 Arabidopsis thaliana chromosome 1, top arm co...    72   2e-11   
gb:AB013391_1512091 Arabidopsis thaliana genomic DNA, chromosome...    72   3e-11   
gb:BT008556_1639773 Arabidopsis thaliana clone U50358 unknown pr...    72   4e-11   
pir|E84432|E84432 hypothetical protein At2g02060 [imported] - Ar...    72   4e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AY086694_1571738 Arabidopsis thaliana clone 2686 mRNA, comple...    70   8e-11   
pir|B96532|B96532 hypothetical protein F14J22.20 [imported] - Ar...    70   8e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AP005071_1847548 Oryza sativa (japonica cultivar-group) genom...    70   1e-10   
gb:AY039841_1560355 Arabidopsis thaliana AT4g37180/C7A10_180 mRN...    70   1e-10   
gb:ATU62741_1557129 Arabidopsis thaliana putative cytoskeletal p...    70   1e-10   
pir|C85439|C85439 probable cytoskeletal protein [imported] - Ara...    70   1e-10   Arabidopsis thaliana [mouse-ear cress]
pir|T01261|T02515 cytoskeletal protein homolog F16M14.23 - Arabi...    69   2e-10   
gb:AB005242_1509524 Arabidopsis thaliana genomic DNA, chromosome...    68   4e-10   
gb:AC099043_1737041 Oryza sativa chromosome 3 BAC OSJNBa0079B15 ...    68   5e-10   
gb:AY085570_1570639 Arabidopsis thaliana clone 157740 mRNA, comp...    67   7e-10   
gb:AB028607_1517898 Arabidopsis thaliana genomic DNA, chromosome...    67   7e-10   
pir|G85057|G85057 hypothetical protein AT4g04580 [imported] - Ar...    67   1e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AC092780_1735724 Oryza sativa chromosome 3 BAC OSJNBb0079B16 ...    66   2e-09   
gb:BT002674_1636277 Arabidopsis thaliana At1g25550/F2J7_21 gene,...    66   2e-09   
gb:AY085913_1570976 Arabidopsis thaliana clone 1959 mRNA, comple...    66   2e-09   
gb:AY045662_1561253 Arabidopsis thaliana At1g79430/T8K14_15 mRNA...    66   2e-09   
pir|H86385|H86385 38.7K hypothetical protein F2J7.21 - Arabidops...    66   2e-09   Arabidopsis thaliana [mouse-ear cress]
pir|F86267|F86267 T6J4.6 protein - Arabidopsis thaliana>gb:AE005...    66   2e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AP004262_1839336 Oryza sativa (japonica cultivar-group) genom...    65   3e-09   
gb:AP007226_1863314 Oryza sativa (japonica cultivar-group) genom...    63   1e-08   
gb:AY087993_1573017 Arabidopsis thaliana clone 40196 mRNA, compl...    63   1e-08   
gb:AY063886_1565833 Arabidopsis thaliana unknown protein (At1g68...    63   1e-08   
pir|C96711|C96711 F24J5.9 [imported] - Arabidopsis thaliana>gb:A...    63   1e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AP003628_1831710 Oryza sativa (japonica cultivar-group) genom...    63   2e-08   
gb:AB024029_1515743 Arabidopsis thaliana genomic DNA, chromosome...    63   2e-08   
gb:AP004789_1845103 Oryza sativa (japonica cultivar-group) genom...    62   2e-08   
gb:AP002523_1822367 Oryza sativa (japonica cultivar-group) genom...    62   3e-08   
gb:AC130607_1740836 Oryza sativa (japonica cultivar-group) chrom...    62   3e-08   
gb:AY084791_1569875 Arabidopsis thaliana clone 118003 mRNA, comp...    62   3e-08   
gb:ATAC011708_1543399 Arabidopsis thaliana chromosome III BAC T7...    62   3e-08   
gb:AB060130_1521812 Zea mays ZmRR8 mRNA for response regulator 8...    62   3e-08   
gb:AB005245_1509589 Arabidopsis thaliana genomic DNA, chromosome...    62   3e-08   
gb:AP005688_1856036 Oryza sativa (japonica cultivar-group) genom...    62   4e-08   
gb:AP005688_1856035 Oryza sativa (japonica cultivar-group) genom...    62   4e-08   
gb:AP003975_1835813 Oryza sativa (japonica cultivar-group) genom...    62   4e-08   
gb:AF318581_1785615 Oryza sativa putative transcription factor O...    62   4e-08   
gb:AY088089_1573113 Arabidopsis thaliana clone 41153 mRNA, compl...    62   4e-08   
gb:AB025604_1516271 Arabidopsis thaliana genomic DNA, chromosome...    62   4e-08   
gb:AP003277_1827064 Oryza sativa (japonica cultivar-group) genom...    61   5e-08   
gb:AC006284_1533992 Arabidopsis thaliana chromosome 2 clone T4M8...    61   5e-08   
gb:AB062489_1522125 Arabidopsis thaliana mRNA for GPRI1, complet...    61   5e-08   
pir|T00761|T02122 hypothetical protein At2g40970 [imported] - Ar...    61   5e-08   
pir|T45601|T45601 hypothetical protein F12A12.160 - Arabidopsis ...    61   5e-08   Arabidopsis thaliana [mouse-ear cress]
pir|H84590|H84590 hypothetical protein At2g20570 [imported] - Ar...    61   5e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AF534891_1809606 Catharanthus roseus type-B response regulato...    61   6e-08   
gb:AC120535_1739896 Oryza sativa (japonica cultivar-group) chrom...    61   6e-08   
gb:AF318580_1785614 Zea mays putative transcription factor ZmGLK...    60   8e-08   
gb:AY581256_1616063 Oryza sativa (japonica cultivar-group) induc...    60   8e-08   
gb:AP002855_1823203 Oryza sativa (japonica cultivar-group) genom...    60   1e-07   
gb:AK175378_1817366 Arabidopsis thaliana mRNA for hypothetical p...    60   1e-07   
gb:AF318582_1785616 Oryza sativa putative transcription factor O...    60   1e-07   
gb:AY050386_1562164 Arabidopsis thaliana AT5g44190/MLN1_11 mRNA,...    60   1e-07   
gb:AB005239_1509450 Arabidopsis thaliana genomic DNA, chromosome...    60   1e-07   
pir|T51247|T51247 ARR2 protein [imported] - Arabidopsis thaliana...    60   1e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AY741685_1626384 Physcomitrella patens golden 2-like protein ...    60   1e-07   
gb:AY741684_1626383 Physcomitrella patens golden 2-like protein ...    60   1e-07   
gb:AC107226_1738402 Oryza sativa (japonica cultivar-group) chrom...    59   2e-07   
gb:AB071695_1522928 Zea mays ZmRR10 mRNA for response regulator ...    59   2e-07   
gb:AF298118_1784085 Zea mays putative transcription factor Golde...    59   2e-07   
gb:AY088149_1573172 Arabidopsis thaliana clone 41875 mRNA, compl...    59   2e-07   
pir|G84428|G84428 hypothetical protein At2g01760 [imported] - Ar...    59   2e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AK176489_1818477 Arabidopsis thaliana mRNA for putative ARR1 ...    58   4e-07   
gb:AY056099_1563437 Arabidopsis thaliana AT3g16857/MUH15_1 mRNA,...    58   4e-07   
pir|T52074|T52074 response regulator ARR11 [imported] - Arabidop...    58   4e-07   Arabidopsis thaliana [mouse-ear cress]
pir|T51246|T51246 ARR1 protein [imported] - Arabidopsis thaliana...    58   4e-07   Arabidopsis thaliana [mouse-ear cress]
pir|T52034|T52034 receiver-like protein 3 [imported] - Arabidops...    58   4e-07   Arabidopsis thaliana [mouse-ear cress]
pir|C96700|C96700 protein F12A21.15 [imported] - Arabidopsis tha...    58   4e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AP003517_1830268 Oryza sativa (japonica cultivar-group) genom...    58   5e-07   
pir|C84645|C84645 hypothetical protein At2g25180 [imported] - Ar...    58   5e-07   Arabidopsis thaliana [mouse-ear cress]
sp|O49397|ARRA_ARATH|ARRA_ARATH Putative transcription factor ARR10 (Arabid...    58   5e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AB092509_1525077 Oryza glaberrima Ehd1 gene for B-type respon...    57   7e-07   
gb:AB092508_1525076 Oryza sativa (indica cultivar-group) Ehd1 ge...    57   7e-07   
gb:AB092506_1525074 Oryza sativa (japonica cultivar-group) Ehd1 ...    57   7e-07   
gb:AB062095_1522097 Zea mays ZmRR9 mRNA for response regulator 9...    57   7e-07   
gb:AE016959_1022979 Oryza sativa (japonica cultivar-group) chrom...    57   7e-07   
gb:AP006838_1862972 Oryza sativa (japonica cultivar-group) genom...    57   1e-06   
pir|T48056|T48056 hypothetical protein F26K9.100 - Arabidopsis t...    57   1e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AP004087_1837524 Oryza sativa (japonica cultivar-group) genom...    56   2e-06   
gb:AY143963_1583420 Arabidopsis thaliana At4g18020/T6K21_200 mRN...    55   3e-06   
gb:AB041531_1519683 Arabidopsis thaliana APRR2 mRNA for pseudo-r...    55   3e-06   
pir|F96528|F96528 protein F27J15.4 [imported] - Arabidopsis thal...    55   3e-06   Arabidopsis thaliana [mouse-ear cress]
pir|T48492|T48492 hypothetical protein T28J14.150 - Arabidopsis ...    55   5e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AB092507_1525075 Oryza sativa (japonica cultivar-group) Ehd1 ...    54   6e-06   
pir|B84449|B84449 hypothetical protein At2g03500 [imported] - Ar...    54   1e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AP004396_1841131 Oryza sativa (japonica cultivar-group) genom...    51   5e-05   
pir|D84668|D84668 hypothetical protein At2g27070 [imported] - Ar...    51   7e-05   Arabidopsis thaliana [mouse-ear cress]
pir|T05088|T05088 hypothetical protein T6K21.200 - Arabidopsis t...    50   9e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AC149488_1745026 Solanum demissum chromosome 11 clone PGEC542...    49   2e-04   
gb:AY389751_1178358 Hyacinthus orientalis cytokinin response reg...    47   0.001   
gb:AP000735_1820580 Arabidopsis thaliana genomic DNA, chromosome...    46   0.002   
gb:AB016872_1512916 Arabidopsis thaliana genomic DNA, chromosome...    46   0.002   
gb:AC132483_1741114 Oryza sativa (japonica cultivar-group) chrom...    45   0.005   
gb:OSJN00163_1695977 Oryza sativa genomic DNA, chromosome 4, BAC...    43   0.018   
gb:AC132483_1741113 Oryza sativa (japonica cultivar-group) chrom...    40   0.089   
gb:AY822600_1353077 Giardia intestinalis GARP-like protein 2 (gl...    37   0.75    
gb:AP003225_1825611 Oryza sativa (japonica cultivar-group) genom...    35   2.9     
pir|T02684|T02684 MYB-related transcription factor (CCA1) [impor...    35   2.9     Arabidopsis thaliana [mouse-ear cress]
gb:AB005238_1509435 Arabidopsis thaliana genomic DNA, chromosome...    35   4.9     
gb:SPY347840_189928 Streptococcus pyogenes sfbI gene for fibrone...    34   6.4     
gb:SPY347830_189918 Streptococcus pyogenes sfbI gene for fibrone...    34   6.4     
gb:AC151804_1745148 Solanum demissum chromosome 5 BAC PGEC475B22...    34   8.3     
gb:AY519507_1610934 Arabidopsis thaliana MYB transcription facto...    34   8.3     
gb:A68428_1450387 Sequence 1 from Patent WO9749811.>gb:ATAJ6404_...    34   8.3     
gb:AE005172_889158 Arabidopsis thaliana chromosome 1, top arm co...    34   8.3     
gb:SPY347832_189920 Streptococcus pyogenes sfbI gene for fibrone...    34   8.3     
pir|T03547|T03547 probable ferrous iron transport protein b - Rh...    34   8.3     Rhodobacter capsulatus


>pir|B84420|B84420 transfactor-like protein [imported] - Arabidopsis
            thaliana>gb:AC006837_1534623 Arabidopsis thaliana
            chromosome 2 BAC F23H14 genomic sequence, complete
            sequence.>gb:AY084725_1569811 Arabidopsis thaliana clone
            115924 mRNA, complete sequence.>gb:BT000013_1634291
            Arabidopsis thaliana transfactor-like protein (At2g01060)
            mRNA, complete cds.>gb:AF370550_1792335 Arabidopsis
            thaliana transfactor-like protein (At2g01060; F23H14.3)
            mRNA, complete cds.
          Length = 286

 Score =  260 bits (664), Expect = 5e-68
 Identities = 159/294 (54%), Positives = 178/294 (60%)
 Frame = +3

Query: 378  SLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLA 557
            S ASKQRLRWT+ELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLA
Sbjct: 11   SHASKQRLRWTHELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLA 70

Query: 558  KYLPXXXXXXXXXXXXXXRDMISNLDGSSGMQITEALKLQMEVQKXXXXXXXXXXXXXXX 737
            KYLP               DM+S LDGSSGMQITEALKLQMEVQK               
Sbjct: 71   KYLPDSSSEGKKTDKKESGDMLSGLDGSSGMQITEALKLQMEVQKRLHEQLEVQRQLQLR 130

Query: 738  XXAQGKYLKKIIEEQQRLSGVLTEAPGSGVNPAAGEHGPESINAXXXXXXXXXXXXXXHG 917
              AQGKYLKKIIEEQQRLSGVL E       P  G+  P +                   
Sbjct: 131  IEAQGKYLKKIIEEQQRLSGVLGEPSA----PVTGDSDPATPAPTSESPLQ--------- 177

Query: 918  DKHAKERAPAKSHSLDESFSSHHEPLTPDSGGHETSQIESPTGERPSKMQKLDSGAALAK 1097
            DK  K+  P KS S+DES SS+ EPLTPDSG +  S  ES   ER SK  +L  GAA   
Sbjct: 178  DKSGKDCGPDKSLSVDESLSSYREPLTPDSGCNIGSPDESTGEERLSKKPRLVRGAAGYT 237

Query: 1098 PNVMLTHPILESSLSPPSYQQPDTVFLTREHLSHSSGLSIGNEDPREKICSGNM 1259
            P++++ HPILES L+  SY Q D V          S   +G E+  +K+   N+
Sbjct: 238  PDIVVGHPILESGLN-TSYHQSDHVLA----FDQPSTSLLGAEEQLDKVSGDNL 286



>gb:AP004011_1836355 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC
            clone:OJ1381_H04.>gb:AP004736_1844033 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 9, BAC
            clone:OSJNBa0062A09.
          Length = 288

 Score =  223 bits (569), Expect = 6e-57
 Identities = 130/269 (48%), Positives = 160/269 (59%), Gaps = 8/269 (2%)
 Frame = +3

Query: 378  SLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLA 557
            +LA++QRLRWTNELHERFV+AV QLGGPDRATPKGVLR+MGVQGLTIYHVKSHLQKYRLA
Sbjct: 19   NLAARQRLRWTNELHERFVEAVTQLGGPDRATPKGVLRIMGVQGLTIYHVKSHLQKYRLA 78

Query: 558  KYLPXXXXXXXXXXXXXXRDMISNLDGSSGMQITEALKLQMEVQKXXXXXXXXXXXXXXX 737
            KY+P               D+++ L+GSSG+QI+EALKLQMEVQK               
Sbjct: 79   KYIPDSSADGNKAENKDPGDLLAGLEGSSGLQISEALKLQMEVQKRLHEQLEVQRQLQLR 138

Query: 738  XXAQGKYLKKIIEEQQRLSGVLTEAPGSGVN--------PAAGEHGPESINAXXXXXXXX 893
              AQGKYLKKIIEEQQRL GV +E P +G +        P +    P +           
Sbjct: 139  IEAQGKYLKKIIEEQQRLGGVKSETPAAGASVTLPSDQFPDSERTDPSTPAPTSESPTQG 198

Query: 894  XXXXXXHGDKHAKERAPAKSHSLDESFSSHHEPLTPDSGGHETSQIESPTGERPSKMQKL 1073
                  +G ++   ++P +  SL     S HEPLTPDS     S   SP  ER +K Q+ 
Sbjct: 199  VPSNRDNGGQNEATKSPQRDDSL-----SRHEPLTPDSNCQPGSPTASPKHERAAKRQR- 252

Query: 1074 DSGAALAKPNVMLTHPILESSLSPPSYQQ 1160
             +GA  ++ +  L H I ESS S   +QQ
Sbjct: 253  GNGAEFSETDFALPHSIFESS-SGSEFQQ 280



>gb:AP004396_1841133 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, PAC
            clone:P0404D10.>gb:AP004459_1841316 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 8, PAC
            clone:P0410E11.
          Length = 307

 Score =  199 bits (505), Expect = 1e-49
 Identities = 131/301 (43%), Positives = 163/301 (54%), Gaps = 4/301 (1%)
 Frame = +3

Query: 246  MYQPKAVLSSSLVPNKAIVSQQTLDFSASTMEPIXXXXXXXXXPSLASKQRLRWTNELHE 425
            MYQP  + SS          +Q ++   + + P          P++A++QRLRWTNELH+
Sbjct: 1    MYQPNPISSSGQTHGNPTAHEQ-MELGNNAIVP---SNGGNNNPNMAARQRLRWTNELHD 56

Query: 426  RFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYLPXXXXXXXXXXXX 605
            RFV+AV QLGGPDRATPKGVLR+MGV GLTIYHVKSHLQKYRLAKY+P            
Sbjct: 57   RFVEAVTQLGGPDRATPKGVLRIMGVPGLTIYHVKSHLQKYRLAKYIPDPSADDNKDEDK 116

Query: 606  XXRDMISNLDGSSGMQITEALKLQMEVQKXXXXXXXXXXXXXXXXXAQGKYLKKIIEEQQ 785
               +++S L+GSSGMQI+EALKLQMEVQK                 AQGKYL+KIIEEQQ
Sbjct: 117  DPGNLLSALEGSSGMQISEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLQKIIEEQQ 176

Query: 786  RLSGV-LTEAPGSGVNPAAGEHGPESINAXXXXXXXXXXXXXXHGDKHAKERAPAKSHSL 962
            R+ G   + A  S   P + +  P +                 H      +  P KS S 
Sbjct: 177  RVIGAGASRATSSEQLPDSEKTNPPT----PVPISESPVQGAPHSKNSQSQVEPTKSPSH 232

Query: 963  DESFSSHHEPLTPDSGGHETSQIESPTGERPSKMQK-LDSG--AALAKPNVMLTHPILES 1133
            D++     EPLTPDS     S   SP  ER +K Q+  D+G   A A    +L   I ES
Sbjct: 233  DDALPC-GEPLTPDSSCRPGSPTLSPKHERAAKRQRGSDAGDVTAFADGEFVLPPGIFES 291

Query: 1134 S 1136
            S
Sbjct: 292  S 292



>gb:AP003616_1831451 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC
            clone:P0490F09.>gb:AP004279_1839712 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 6, PAC
            clone:P0556B08.
          Length = 329

 Score =  198 bits (503), Expect = 3e-49
 Identities = 120/279 (43%), Positives = 156/279 (55%), Gaps = 1/279 (0%)
 Frame = +3

Query: 246  MYQPKAVLSSSLVPNKAIVSQQTLDFSASTMEPIXXXXXXXXXPSLASKQRLRWTNELHE 425
            MY+PK   S  L  N  +   Q ++   + +  +          + A++QRLRWT++LH+
Sbjct: 1    MYEPKPFSSIVLAHNDPVSHNQQIERINNNV--VSNSGGNSSNSNFAARQRLRWTDDLHD 58

Query: 426  RFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYLPXXXXXXXXXXXX 605
            RFVDAV QLGGPDRATPKG+LR+MGVQGLTIYHVKSHLQKYRLAKY+P            
Sbjct: 59   RFVDAVTQLGGPDRATPKGILRIMGVQGLTIYHVKSHLQKYRLAKYIPDPTADGAKSDKK 118

Query: 606  XXRDMISNLDGSSGMQITEALKLQMEVQKXXXXXXXXXXXXXXXXXAQGKYLKKIIEEQQ 785
               D++++++ SSGM+I EALKLQMEVQK                 AQG+YL+KIIEEQQ
Sbjct: 119  DLGDLLADIESSSGMEIGEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGRYLQKIIEEQQ 178

Query: 786  RLSGVLTEAPGSG-VNPAAGEHGPESINAXXXXXXXXXXXXXXHGDKHAKERAPAKSHSL 962
            RLSGVL E+   G + PA GE   +S                   +   +++A +     
Sbjct: 179  RLSGVLGESGKLGALGPAPGEPYQDSNKTDPSTPVPT-------SESPIRDKAGSGLFKT 231

Query: 963  DESFSSHHEPLTPDSGGHETSQIESPTGERPSKMQKLDS 1079
              S     EPLTPDS     S +ESP   R SK  ++ S
Sbjct: 232  ISSHDDCREPLTPDSSCRAGSPLESP--PRASKRIRVSS 268



>gb:AC129718_1740647 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0088I06, complete sequence.
          Length = 257

 Score =  168 bits (426), Expect = 2e-40
 Identities = 86/143 (60%), Positives = 98/143 (68%)
 Frame = +3

Query: 375 PSLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           P+ + KQRLRWT++LH RFVDA+AQLGGPDRATPKGVL VMGV G+TIYHVKSHLQKYRL
Sbjct: 40  PAGSGKQRLRWTSDLHNRFVDAIAQLGGPDRATPKGVLTVMGVPGITIYHVKSHLQKYRL 99

Query: 555 AKYLPXXXXXXXXXXXXXXRDMISNLDGSSGMQITEALKLQMEVQKXXXXXXXXXXXXXX 734
           AKY+P               D +SN D + GMQI EALK+QMEVQK              
Sbjct: 100 AKYIPESPAEGSKDEKKDSSDSLSNTDSAPGMQINEALKMQMEVQKRLHEQLEVQRQLQL 159

Query: 735 XXXAQGKYLKKIIEEQQRLSGVL 803
              AQGKYL+ IIEEQQ+L G L
Sbjct: 160 RIEAQGKYLQMIIEEQQKLGGSL 182



>gb:AY625680_1618493 Triticum aestivum MYB transcription factor
           (MYB80) mRNA, complete cds.
          Length = 266

 Score =  164 bits (416), Expect = 3e-39
 Identities = 90/165 (54%), Positives = 104/165 (63%), Gaps = 2/165 (1%)
 Frame = +3

Query: 375 PSLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           P  + KQRLRWT++LH RFVDA+AQLGGPDRATPKGVL VMGV G+TIYHVKSHLQKYRL
Sbjct: 40  PVGSGKQRLRWTSDLHSRFVDAIAQLGGPDRATPKGVLTVMGVPGITIYHVKSHLQKYRL 99

Query: 555 AKYLPXXXXXXXXXXXXXXRDMISNLDGSSGMQITEALKLQMEVQKXXXXXXXXXXXXXX 734
           AKY+P               D  SN D + G QI EALK+QMEVQK              
Sbjct: 100 AKYIPESPAEGSKDEKKDSSDSFSNADSAPGSQINEALKMQMEVQKRLHEQLEVQKQLQL 159

Query: 735 XXXAQGKYLKKIIEEQQRLSGVL--TEAPGSGVNPAAGEHGPESI 863
              AQGKYL+ IIEEQQ+L G L  +E      +P   +  P+SI
Sbjct: 160 RIEAQGKYLQMIIEEQQKLGGSLEGSEERKLSHSPPTLDDYPDSI 204



>gb:OSJN00091_1694740 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0087O24, complete sequence.
          Length = 419

 Score =  136 bits (343), Expect = 9e-31
 Identities = 74/160 (46%), Positives = 94/160 (58%), Gaps = 10/160 (6%)
 Frame = +3

Query: 387 SKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYL 566
           SK R+RWT +LHERFVD V QLGG D+ATPKG+L++M   GLTIYH+KSHLQKYR+AKY+
Sbjct: 235 SKTRIRWTQDLHERFVDCVNQLGGADKATPKGILKLMNSDGLTIYHIKSHLQKYRIAKYM 294

Query: 567 PXXXXXXXXXXXXXXRDMISNLDGSSGMQITEALKLQMEVQKXXXXXXXXXXXXXXXXXA 746
           P               DM  NLD  +GMQITEAL++Q++VQ+                  
Sbjct: 295 PASSEGKQLEKRATGNDM-QNLDPKTGMQITEALRVQLDVQRRLHEQLEIQRNLQLRIEE 353

Query: 747 QGKYLKKIIEEQ----------QRLSGVLTEAPGSGVNPA 836
           QGK L+K+ E+Q          Q L  V+  A G G + A
Sbjct: 354 QGKRLQKMFEDQLKASRSVMEPQELDDVVAFAAGDGDDDA 393



>gb:AB017693_1513678 Nicotiana tabacum WERBP-1 mRNA, complete cds.
          Length = 291

 Score =  130 bits (328), Expect = 5e-29
 Identities = 69/133 (51%), Positives = 88/133 (66%)
 Frame = +3

Query: 384 ASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKY 563
           +SKQR+RWT ELHE FV+AV +LGG +RATPKGVL++M V+GLTIYHVKSHLQKYR A+Y
Sbjct: 70  SSKQRMRWTPELHEAFVEAVNKLGGSERATPKGVLKLMKVEGLTIYHVKSHLQKYRTARY 129

Query: 564 LPXXXXXXXXXXXXXXRDMISNLDGSSGMQITEALKLQMEVQKXXXXXXXXXXXXXXXXX 743
            P               D +S LD  +G++ITEAL+LQMEVQK                 
Sbjct: 130 KPEALEGSSEKKESSIGD-LSALDLKTGIEITEALRLQMEVQKQLHEQLEIQRNLQLRIE 188

Query: 744 AQGKYLKKIIEEQ 782
            QG+YL+++ E+Q
Sbjct: 189 EQGRYLQEMFEKQ 201



>gb:AF219972_1778222 Mesembryanthemum crystallinum CDPK substrate
           protein 1 (csp1) mRNA, complete cds.
          Length = 470

 Score =  129 bits (324), Expect = 1e-28
 Identities = 86/236 (36%), Positives = 111/236 (47%), Gaps = 5/236 (2%)
 Frame = +3

Query: 252 QPKAVLSSSLVPNKAIVSQQTLDFSASTMEPIXXXXXXXXXPSLAS---KQRLRWTNELH 422
           QPK    SS V     + QQ L      +             + A+   + R+RWT ELH
Sbjct: 207 QPKVTQPSSDVRVHQPLIQQQLSLPPREVSAAANQTSAAANQTSAAHSNRPRMRWTPELH 266

Query: 423 ERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYLPXXXXXXXXXXX 602
           E FVDAV QLGG +RATPKGVLR M V+GLTIYHVKSHLQKYR A+  P           
Sbjct: 267 EAFVDAVNQLGGSERATPKGVLRHMNVEGLTIYHVKSHLQKYRTARVRPESSEGNSERRA 326

Query: 603 XXXRDMISNLDGSSGMQITEALKLQMEVQKXXXXXXXXXXXXXXXXXAQGKYLKKIIEEQ 782
               D +S++D  + + ITEAL++QMEVQK                  QGKYL +++E Q
Sbjct: 327 SSV-DPVSSVDLKTSVTITEALRMQMEVQKQLHEQLEIQRKLQLQIEEQGKYLLQMLENQ 385

Query: 783 QRLSGVLTEAPGSGV--NPAAGEHGPESINAXXXXXXXXXXXXXXHGDKHAKERAP 944
            ++        GS    + + G     S                 HG K  K++AP
Sbjct: 386 NKVEKEKLNPDGSSAHNDKSEGSQPEPSREGAVISISSQGPGESSHGSK-GKQKAP 440



>gb:BT005352_1638292 Arabidopsis thaliana At3g04445 mRNA, complete
           cds.>gb:AK118630_1816596 Arabidopsis thaliana At3g04450
           mRNA for putative transfactor, complete cds, clone:
           RAFL19-89-P11.
          Length = 402

 Score =  128 bits (322), Expect = 2e-28
 Identities = 69/161 (42%), Positives = 95/161 (59%), Gaps = 2/161 (1%)
 Frame = +3

Query: 378 SLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLA 557
           S+ SKQR+RWT ELHE FV+A+ QLGG +RATPK VL+++   GLT+YHVKSHLQKYR A
Sbjct: 194 SMTSKQRMRWTPELHEAFVEAINQLGGSERATPKAVLKLINSPGLTVYHVKSHLQKYRTA 253

Query: 558 KYLPXXXXXXXXXXXXXXRDM--ISNLDGSSGMQITEALKLQMEVQKXXXXXXXXXXXXX 731
           +Y P              + +  I +LD  + ++ITEAL+LQM+VQK             
Sbjct: 254 RYKPELSKDTEEPLVKNLKTIEDIKSLDLKTSIEITEALRLQMKVQKQLHEQLEIQRSLQ 313

Query: 732 XXXXAQGKYLKKIIEEQQRLSGVLTEAPGSGVNPAAGEHGP 854
                QG+YL+ +IE+QQ++     ++  S   P A    P
Sbjct: 314 LQIEEQGRYLQMMIEKQQKMQENKKDSTSSSSMPEADPSAP 354



>gb:ATH310799_1552469 Arabidopsis thaliana mRNA for phosphate
           starvation response regulator 1 (phr1
           gene).>gb:AY081290_1568636 Arabidopsis thaliana putative
           protein (At4g28610) mRNA, complete
           cds.>gb:BT002187_1635790 Arabidopsis thaliana putative
           protein (At4g28610) mRNA, complete cds.
          Length = 409

 Score =  128 bits (322), Expect = 2e-28
 Identities = 80/186 (43%), Positives = 102/186 (54%)
 Frame = +3

Query: 282 VPNKAIVSQQTLDFSASTMEPIXXXXXXXXXPSLASKQRLRWTNELHERFVDAVAQLGGP 461
           +P   IV QQ     +  + P+          +   K R+RWT ELHE FV+AV  LGG 
Sbjct: 193 IPQPQIVQQQPSP--SVELRPVSTTSSNSNNGT--GKARMRWTPELHEAFVEAVNSLGGS 248

Query: 462 DRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYLPXXXXXXXXXXXXXXRDMISNLDGS 641
           +RATPKGVL++M V+GLTIYHVKSHLQKYR A+Y P               + I++LD  
Sbjct: 249 ERATPKGVLKIMKVEGLTIYHVKSHLQKYRTARYRPEPSETGSPERKLTPLEHITSLDLK 308

Query: 642 SGMQITEALKLQMEVQKXXXXXXXXXXXXXXXXXAQGKYLKKIIEEQQRLSGVLTEAPGS 821
            G+ ITEAL+LQMEVQK                  QGKYL+ + E+Q   SG LT+   S
Sbjct: 309 GGIGITEALRLQMEVQKQLHEQLEIQRNLQLRIEEQGKYLQMMFEKQN--SG-LTKGTAS 365

Query: 822 GVNPAA 839
             + AA
Sbjct: 366 TSDSAA 371



>gb:ATAC022287_1543760 Arabidopsis thaliana chromosome III BAC T27C4
           genomic sequence, complete sequence.
          Length = 438

 Score =  128 bits (322), Expect = 2e-28
 Identities = 69/159 (43%), Positives = 94/159 (59%)
 Frame = +3

Query: 378 SLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLA 557
           S+ SKQR+RWT ELHE FV+A+ QLGG +RATPK VL+++   GLT+YHVKSHLQKYR A
Sbjct: 234 SMTSKQRMRWTPELHEAFVEAINQLGGSERATPKAVLKLINSPGLTVYHVKSHLQKYRTA 293

Query: 558 KYLPXXXXXXXXXXXXXXRDMISNLDGSSGMQITEALKLQMEVQKXXXXXXXXXXXXXXX 737
           +Y P               + I +LD  + ++ITEAL+LQM+VQK               
Sbjct: 294 RYKPELSKDTVKNLKTI--EDIKSLDLKTSIEITEALRLQMKVQKQLHEQLEIQRSLQLQ 351

Query: 738 XXAQGKYLKKIIEEQQRLSGVLTEAPGSGVNPAAGEHGP 854
              QG+YL+ +IE+QQ++     ++  S   P A    P
Sbjct: 352 IEEQGRYLQMMIEKQQKMQENKKDSTSSSSMPEADPSAP 390



>gb:AP004324_1840172 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OJ1215_E11.
          Length = 479

 Score =  126 bits (317), Expect = 9e-28
 Identities = 70/167 (41%), Positives = 96/167 (57%), Gaps = 3/167 (1%)
 Frame = +3

Query: 303 SQQTLDFSASTMEPIXXXXXXXXXPSLASKQRLRWTNELHERFVDAVAQLGGPDRATPKG 482
           S Q++  + S ++            +  +K RLRWT ELHERFV+AV +L GP++ATPKG
Sbjct: 240 SNQSVQKAGSPVKVQLSSPRSSSGSATTNKARLRWTLELHERFVEAVNKLDGPEKATPKG 299

Query: 483 VLRVMGVQGLTIYHVKSHLQKYRLAKYLPXXXXXXXXXXXXXXRDMISNLDGS---SGMQ 653
           VL++M V+GLTIYHVKSHLQKYRLAKYLP                  S+ + S     +Q
Sbjct: 300 VLKLMKVEGLTIYHVKSHLQKYRLAKYLPETKEDKKASSEDKKSQSGSSGNDSVKKKNLQ 359

Query: 654 ITEALKLQMEVQKXXXXXXXXXXXXXXXXXAQGKYLKKIIEEQQRLS 794
           + EAL++QMEVQK                    +YL++I+EEQ ++S
Sbjct: 360 VAEALRMQMEVQKQLHEQLEVQRQLQLRIEEHARYLQRILEEQHKVS 406



>gb:AP005647_1855421 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0026E05.
          Length = 467

 Score =  124 bits (312), Expect = 4e-27
 Identities = 71/170 (41%), Positives = 92/170 (54%), Gaps = 1/170 (0%)
 Frame = +3

Query: 282 VPNKAIVSQQTLDFSASTMEPIXXXXXXXXXPSLASKQRLRWTNELHERFVDAVAQLGGP 461
           +P  +   Q+ L  + S  +            +  +K RLRWT ELHERFVDAV +L GP
Sbjct: 229 LPVSSCSDQEDLQDARSPAKVQLSSSRSSSGTASCNKPRLRWTPELHERFVDAVNKLEGP 288

Query: 462 DRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYLPXXXXXXXXXXXXXXRDMISNLDG- 638
           ++ATPKGVL++M V+GLTIYH+KSHLQKYRLAKYLP                   N    
Sbjct: 289 EKATPKGVLKLMKVEGLTIYHIKSHLQKYRLAKYLPETKEDKKQEEKKTKSVANGNDHAK 348

Query: 639 SSGMQITEALKLQMEVQKXXXXXXXXXXXXXXXXXAQGKYLKKIIEEQQR 788
               Q+ EAL++QMEVQK                    +YL+KI+EEQQ+
Sbjct: 349 KKSAQMAEALRMQMEVQKQLHEQLEVQRQLQLRIEEHARYLQKILEEQQK 398



>gb:BT002344_1635947 Arabidopsis thaliana clone C104936 unknown
           protein (At5g29000) mRNA, complete cds.
          Length = 413

 Score =  122 bits (307), Expect = 1e-26
 Identities = 65/137 (47%), Positives = 85/137 (62%), Gaps = 2/137 (1%)
 Frame = +3

Query: 387 SKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYL 566
           SKQR+RWT ELHE FV+AV QLGG +RATPK VL+++   GLTIYHVKSHLQKYR A+Y 
Sbjct: 230 SKQRMRWTPELHEAFVEAVNQLGGSERATPKAVLKLLNNPGLTIYHVKSHLQKYRTARYK 289

Query: 567 PXXXXXXXXXXXXXXRDM--ISNLDGSSGMQITEALKLQMEVQKXXXXXXXXXXXXXXXX 740
           P                +  I +LD  + ++IT+AL+LQMEVQK                
Sbjct: 290 PETSEVTGEPQEKKMTSIEDIKSLDMKTSVEITQALRLQMEVQKRLHEQLEIQRSLQLQI 349

Query: 741 XAQGKYLKKIIEEQQRL 791
             QG+YL+ + E+QQ++
Sbjct: 350 EKQGRYLQMMFEKQQKI 366



>gb:AY085154_1570235 Arabidopsis thaliana clone 13378 mRNA, complete
           sequence.
          Length = 413

 Score =  122 bits (307), Expect = 1e-26
 Identities = 65/137 (47%), Positives = 85/137 (62%), Gaps = 2/137 (1%)
 Frame = +3

Query: 387 SKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYL 566
           SKQR+RWT ELHE FV+AV QLGG +RATPK VL+++   GLTIYHVKSHLQKYR A+Y 
Sbjct: 230 SKQRMRWTPELHEAFVEAVNQLGGSERATPKAVLKLLNNPGLTIYHVKSHLQKYRTARYK 289

Query: 567 PXXXXXXXXXXXXXXRDM--ISNLDGSSGMQITEALKLQMEVQKXXXXXXXXXXXXXXXX 740
           P                +  I +LD  + ++IT+AL+LQMEVQK                
Sbjct: 290 PETSEVTGEPQEKKMTSIEDIKSLDMKTSVEITQALRLQMEVQKRLHEQLEIQRSLQLQI 349

Query: 741 XAQGKYLKKIIEEQQRL 791
             QG+YL+ + E+QQ++
Sbjct: 350 EKQGRYLQMMFEKQQKI 366



>gb:AY045943_1561440 Arabidopsis thaliana unknown protein
           (At5g29000) mRNA, partial cds.
          Length = 385

 Score =  122 bits (307), Expect = 1e-26
 Identities = 65/137 (47%), Positives = 85/137 (62%), Gaps = 2/137 (1%)
 Frame = +3

Query: 387 SKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYL 566
           SKQR+RWT ELHE FV+AV QLGG +RATPK VL+++   GLTIYHVKSHLQKYR A+Y 
Sbjct: 202 SKQRMRWTPELHEAFVEAVNQLGGSERATPKAVLKLLNNPGLTIYHVKSHLQKYRTARYK 261

Query: 567 PXXXXXXXXXXXXXXRDM--ISNLDGSSGMQITEALKLQMEVQKXXXXXXXXXXXXXXXX 740
           P                +  I +LD  + ++IT+AL+LQMEVQK                
Sbjct: 262 PETSEVTGEPQEKKMTSIEDIKSLDMKTSVEITQALRLQMEVQKRLHEQLEIQRSLQLQI 321

Query: 741 XAQGKYLKKIIEEQQRL 791
             QG+YL+ + E+QQ++
Sbjct: 322 EKQGRYLQMMFEKQQKI 338



>gb:BT012658_1641728 Arabidopsis thaliana At5g06800 gene, complete
           cds.>gb:AP002032_1821491 Arabidopsis thaliana genomic
           DNA, chromosome 5, P1 clone:MPH15.
          Length = 374

 Score =  120 bits (300), Expect = 9e-26
 Identities = 61/138 (44%), Positives = 85/138 (61%)
 Frame = +3

Query: 375 PSLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           P+  +K R+RWT +LHE+FV+ V +LGG D+ATPK +L+ M   GLTI+HVKSHLQKYR+
Sbjct: 186 PNCVNKTRIRWTQDLHEKFVECVNRLGGADKATPKAILKRMDSDGLTIFHVKSHLQKYRI 245

Query: 555 AKYLPXXXXXXXXXXXXXXRDMISNLDGSSGMQITEALKLQMEVQKXXXXXXXXXXXXXX 734
           AKY+P                 +S LD  +G+QI EAL+LQ++VQ+              
Sbjct: 246 AKYMPESQEGKFEKRACAKE--LSQLDTRTGVQIKEALQLQLDVQRHLHEQLEIQRNLQL 303

Query: 735 XXXAQGKYLKKIIEEQQR 788
               QGK LK ++E+QQ+
Sbjct: 304 RIEEQGKQLKMMMEQQQK 321



>pir|T10655|T10655 hypothetical protein T5F17.60 - Arabidopsis
           thaliana>gb:ATCHRIV69_1546741 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 69.
          Length = 422

 Score =  120 bits (300), Expect = 9e-26
 Identities = 80/199 (40%), Positives = 102/199 (51%), Gaps = 13/199 (6%)
 Frame = +3

Query: 282 VPNKAIVSQQTLDFSASTMEPIXXXXXXXXXPSLASKQRLRWTNELHERFVDAVAQLGGP 461
           +P   IV QQ     +  + P+          +   K R+RWT ELHE FV+AV  LGG 
Sbjct: 193 IPQPQIVQQQPSP--SVELRPVSTTSSNSNNGT--GKARMRWTPELHEAFVEAVNSLGGS 248

Query: 462 DRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYLP-------------XXXXXXXXXXX 602
           +RATPKGVL++M V+GLTIYHVKSHLQKYR A+Y P                        
Sbjct: 249 ERATPKGVLKIMKVEGLTIYHVKSHLQKYRTARYRPEPSETEFNVKTKVSLITTGSPERK 308

Query: 603 XXXRDMISNLDGSSGMQITEALKLQMEVQKXXXXXXXXXXXXXXXXXAQGKYLKKIIEEQ 782
               + I++LD   G+ ITEAL+LQMEVQK                  QGKYL+ + E+Q
Sbjct: 309 LTPLEHITSLDLKGGIGITEALRLQMEVQKQLHEQLEIQRNLQLRIEEQGKYLQMMFEKQ 368

Query: 783 QRLSGVLTEAPGSGVNPAA 839
              SG LT+   S  + AA
Sbjct: 369 N--SG-LTKGTASTSDSAA 384



>gb:AP005772_1857596 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0073A21.
          Length = 355

 Score =  119 bits (299), Expect = 1e-25
 Identities = 64/139 (46%), Positives = 83/139 (59%), Gaps = 9/139 (6%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYLP 569
           K RLRWT ELHERFVDAV QLGGPD+ATPK ++RVMGV+GLT+YH+KSHLQK+RL K  P
Sbjct: 16  KPRLRWTVELHERFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRLGKQ-P 74

Query: 570 XXXXXXXXXXXXXXRDMISNLDGSSGM---------QITEALKLQMEVQKXXXXXXXXXX 722
                          +M  N   SSG+          + +A+++QMEVQ+          
Sbjct: 75  HKEFSEHSVKEAAAMEMQRNAASSSGIMGRSMNHDRNVNDAIRMQMEVQRRLHEQLEVQK 134

Query: 723 XXXXXXXAQGKYLKKIIEE 779
                  AQGKY++ I+E+
Sbjct: 135 HLQMRIEAQGKYMQSILEK 153



>gb:AY084738_1569823 Arabidopsis thaliana clone 116381 mRNA,
           complete sequence.
          Length = 443

 Score =  119 bits (298), Expect = 2e-25
 Identities = 63/153 (41%), Positives = 90/153 (58%), Gaps = 4/153 (2%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYLP 569
           K R+RWT ELHE FV AV +L GP++ATPK V ++M V+GLTIYHVKSHLQKYRLAKY+P
Sbjct: 235 KSRMRWTPELHESFVKAVIKLEGPEKATPKAVKKLMNVEGLTIYHVKSHLQKYRLAKYMP 294

Query: 570 XXXXXXXXXXXXXXRDMISNLDG----SSGMQITEALKLQMEVQKXXXXXXXXXXXXXXX 737
                         +  +S  +        +Q+TEAL++QMEVQK               
Sbjct: 295 EKKEEKRTDNSEEKKLALSKSEADEKKKGAIQLTEALRMQMEVQKQLHEQQEVQRVLQLR 354

Query: 738 XXAQGKYLKKIIEEQQRLSGVLTEAPGSGVNPA 836
                KYL+K++EEQ++    ++ +  + ++P+
Sbjct: 355 IEEHAKYLEKMLEEQRKTGRWISSSSQTVLSPS 387



>gb:AY050889_1562382 Arabidopsis thaliana unknown protein
           (At3g13040) mRNA, complete cds.>gb:AY096674_1576210
           Arabidopsis thaliana unknown protein (At3g13040) mRNA,
           complete cds.
          Length = 449

 Score =  119 bits (298), Expect = 2e-25
 Identities = 63/153 (41%), Positives = 90/153 (58%), Gaps = 4/153 (2%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYLP 569
           K R+RWT ELHE FV AV +L GP++ATPK V ++M V+GLTIYHVKSHLQKYRLAKY+P
Sbjct: 241 KSRMRWTPELHESFVKAVIKLEGPEKATPKAVKKLMNVEGLTIYHVKSHLQKYRLAKYMP 300

Query: 570 XXXXXXXXXXXXXXRDMISNLDG----SSGMQITEALKLQMEVQKXXXXXXXXXXXXXXX 737
                         +  +S  +        +Q+TEAL++QMEVQK               
Sbjct: 301 EKKEEKRTDNSEEKKLALSKSEADEKKKGAIQLTEALRMQMEVQKQLHEQLEVQRVLQLR 360

Query: 738 XXAQGKYLKKIIEEQQRLSGVLTEAPGSGVNPA 836
                KYL+K++EEQ++    ++ +  + ++P+
Sbjct: 361 IEEHAKYLEKMLEEQRKTGRWISSSSQTVLSPS 393



>gb:AB026645_1517177 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MGH6.
          Length = 554

 Score =  119 bits (298), Expect = 2e-25
 Identities = 63/153 (41%), Positives = 90/153 (58%), Gaps = 4/153 (2%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYLP 569
           K R+RWT ELHE FV AV +L GP++ATPK V ++M V+GLTIYHVKSHLQKYRLAKY+P
Sbjct: 241 KSRMRWTPELHESFVKAVIKLEGPEKATPKAVKKLMNVEGLTIYHVKSHLQKYRLAKYMP 300

Query: 570 XXXXXXXXXXXXXXRDMISNLDG----SSGMQITEALKLQMEVQKXXXXXXXXXXXXXXX 737
                         +  +S  +        +Q+TEAL++QMEVQK               
Sbjct: 301 EKKEEKRTDNSEEKKLALSKSEADEKKKGAIQLTEALRMQMEVQKQLHEQLEVQRVLQLR 360

Query: 738 XXAQGKYLKKIIEEQQRLSGVLTEAPGSGVNPA 836
                KYL+K++EEQ++    ++ +  + ++P+
Sbjct: 361 IEEHAKYLEKMLEEQRKTGRWISSSSQTVLSPS 393



>gb:AY087771_1572798 Arabidopsis thaliana clone 38327 mRNA, complete
           sequence.
          Length = 292

 Score =  119 bits (297), Expect = 2e-25
 Identities = 68/165 (41%), Positives = 89/165 (53%), Gaps = 11/165 (6%)
 Frame = +3

Query: 318 DFSASTMEPIXXXXXXXXXPSLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVM 497
           D+S  T  PI         P    K RLRWT+ELHERFVDAV QLGGPD+ATPK ++R M
Sbjct: 17  DYSDGTNLPIDACLVLTTDP----KPRLRWTSELHERFVDAVTQLGGPDKATPKTIMRTM 72

Query: 498 GVQGLTIYHVKSHLQKYRL-----------AKYLPXXXXXXXXXXXXXXRDMISNLDGSS 644
           GV+GLT+YH+KSHLQK+RL           +K +                  ++  + + 
Sbjct: 73  GVKGLTLYHLKSHLQKFRLGRQSCKESIDNSKDVSCVAESQDTGSSSTSSLRLAAQEQNE 132

Query: 645 GMQITEALKLQMEVQKXXXXXXXXXXXXXXXXXAQGKYLKKIIEE 779
             Q+TEAL+ QMEVQ+                 AQGKYL+ I+E+
Sbjct: 133 SYQVTEALRAQMEVQRRLHEQLEVQRRLQLRIEAQGKYLQSILEK 177



>gb:AP005167_1848631 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBa0060O17.
          Length = 339

 Score =  118 bits (295), Expect = 3e-25
 Identities = 67/161 (41%), Positives = 90/161 (55%), Gaps = 16/161 (9%)
 Frame = +3

Query: 378 SLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLA 557
           S  +K RL+WT+ELHERFV+AV QLGGPD+ATPK ++R+MG+ GLT+YH+KSHLQKYRL+
Sbjct: 42  STDAKPRLKWTSELHERFVEAVNQLGGPDKATPKTIMRLMGIPGLTLYHLKSHLQKYRLS 101

Query: 558 KYLPXXXXXXXXXXX------------XXXRDMISNLD----GSSGMQITEALKLQMEVQ 689
           K L                               S+LD     +S M I EAL++Q+EVQ
Sbjct: 102 KNLQSQANASRAQGVLGCSTTEIDKPCEGNGSPASHLDLETQTNSSMHINEALQMQIEVQ 161

Query: 690 KXXXXXXXXXXXXXXXXXAQGKYLKKIIEEQQRLSGVLTEA 812
           +                 AQGKYL+ ++E+ Q   G +  A
Sbjct: 162 RRLHEQLEVQRHLQLRIEAQGKYLQSVLEKAQEALGTIAVA 202



>gb:AY050355_1562134 Arabidopsis thaliana AT3g24120/MUJ8_3 mRNA,
           complete cds.>gb:AY088428_1573447 Arabidopsis thaliana
           clone 6626 mRNA, complete sequence.>gb:AY094046_1575552
           Arabidopsis thaliana AT3g24120/MUJ8_3 mRNA, complete
           cds.
          Length = 295

 Score =  117 bits (294), Expect = 4e-25
 Identities = 63/141 (44%), Positives = 81/141 (57%), Gaps = 11/141 (7%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL----- 554
           K RLRWT ELHERFVDAV QLGGPD+ATPK ++R MGV+GLT+YH+KSHLQK+RL     
Sbjct: 41  KPRLRWTTELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKFRLGRQAG 100

Query: 555 ------AKYLPXXXXXXXXXXXXXXRDMISNLDGSSGMQITEALKLQMEVQKXXXXXXXX 716
                 +K                    ++  + + G Q+TEAL+ QMEVQ+        
Sbjct: 101 KESTENSKDASCVGESQDTGSSSTSSMRMAQQEQNEGYQVTEALRAQMEVQRRLHDQLEV 160

Query: 717 XXXXXXXXXAQGKYLKKIIEE 779
                    AQGKYL+ I+E+
Sbjct: 161 QRRLQLRIEAQGKYLQSILEK 181



>gb:BT006119_1639013 Arabidopsis thaliana clone U50843 unknown
           protein (At2g20400) mRNA, complete
           cds.>gb:AK118313_1816298 Arabidopsis thaliana At2g20400
           mRNA for unknown protein, complete cds, clone:
           RAFL19-59-J02.
          Length = 397

 Score =  116 bits (290), Expect = 1e-24
 Identities = 74/177 (41%), Positives = 94/177 (53%)
 Frame = +3

Query: 252 QPKAVLSSSLVPNKAIVSQQTLDFSASTMEPIXXXXXXXXXPSLASKQRLRWTNELHERF 431
           QP+AVL        + V  + LD + S+              + A+K R+RWT ELHE F
Sbjct: 192 QPQAVLQQP----SSCVELRPLDRTVSSNS---NNNSNSNNAAAAAKGRMRWTPELHEVF 244

Query: 432 VDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYLPXXXXXXXXXXXXXX 611
           VDAV QLGG + ATPKGVL+ M V+GLTI+HVKSHLQKYR AKY+P              
Sbjct: 245 VDAVNQLGGSNEATPKGVLKHMKVEGLTIFHVKSHLQKYRTAKYIPVPSEGSPEARLTPL 304

Query: 612 RDMISNLDGSSGMQITEALKLQMEVQKXXXXXXXXXXXXXXXXXAQGKYLKKIIEEQ 782
             + S+ D   G+ ITE L++QME QK                  QGK L  +IE+Q
Sbjct: 305 EQITSD-DTKRGIDITETLRIQMEHQKKLHEQLESLRTMQLRIEEQGKALLMMIEKQ 360



>pir|D96825|D96825 hypothetical protein T8K14.15 [imported] -
           Arabidopsis thaliana>gb:AE005173_895464 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:T8K14_1724174 Arabidopsis thaliana
           chromosome 1 BAC T8K14 sequence, complete sequence.
          Length = 367

 Score =  116 bits (290), Expect = 1e-24
 Identities = 67/148 (45%), Positives = 85/148 (57%), Gaps = 12/148 (8%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAK--Y 563
           K RLRWT ELHERFVDAVAQLGGPD+ATPK ++RVMGV+GLT+YH+KSHLQK+RL K  +
Sbjct: 34  KPRLRWTVELHERFVDAVAQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRLGKQPH 93

Query: 564 LPXXXXXXXXXXXXXXRDMISNLDGSSGMQITE---------ALKLQMEVQKXXXXXXXX 716
                            D+  N+  SSGM              +++QMEVQ+        
Sbjct: 94  KEYGDHSTKEGSRASAMDIQRNVASSSGMMSRNMNDNSHQVGLIRMQMEVQRRLHEQLEV 153

Query: 717 XXXXXXXXXAQGKYLKKIIEEQ-QRLSG 797
                    AQGKY++ I+E   Q L+G
Sbjct: 154 QRHLQLRIEAQGKYMQSILERACQTLAG 181



>gb:AP005101_1847836 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OSJNBa0026I22.>gb:AP005451_1852013 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0443H10.
          Length = 426

 Score =  114 bits (286), Expect = 4e-24
 Identities = 63/133 (47%), Positives = 79/133 (59%), Gaps = 1/133 (0%)
 Frame = +3

Query: 387 SKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYL 566
           SK R+RWT ELHERFVDAV  LGG ++ATPKGVL++M    LTIYHVKSHLQKYR A+Y 
Sbjct: 245 SKTRMRWTPELHERFVDAVNLLGGSEKATPKGVLKLMKADNLTIYHVKSHLQKYRTARYR 304

Query: 567 PXXXXXXXXXXXXXXRDMISNLDGSSG-MQITEALKLQMEVQKXXXXXXXXXXXXXXXXX 743
           P               D I ++D   G   +TEAL+LQ+E+QK                 
Sbjct: 305 PELSEGSSEKKAASKED-IPSIDLKGGNFDLTEALRLQLELQKRLHEQLEIQRSLQLRIE 363

Query: 744 AQGKYLKKIIEEQ 782
            QGK L+ ++E+Q
Sbjct: 364 EQGKCLQMMLEQQ 376



>pir|E96717|E96717 probable transfactor F24J1.30 [imported] -
           Arabidopsis thaliana>gb:AE005173_894543 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC021046_1538719 Arabidopsis thaliana
           chromosome 1 BAC F24J1 genomic sequence, complete
           sequence.
          Length = 332

 Score =  114 bits (285), Expect = 5e-24
 Identities = 63/157 (40%), Positives = 89/157 (56%), Gaps = 17/157 (10%)
 Frame = +3

Query: 378 SLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLA 557
           S  +K RL+WT +LH +F++AV QLGGP++ATPKG+++VM + GLT+YH+KSHLQKYRL 
Sbjct: 26  STDAKPRLKWTCDLHHKFIEAVNQLGGPNKATPKGLMKVMEIPGLTLYHLKSHLQKYRLG 85

Query: 558 KYLPXXXXXXXXXXXXXXRDMISNLD----------------GSSGMQITEALKLQMEVQ 689
           K +               +++ S  D                   G+QITEAL++QMEVQ
Sbjct: 86  KSMKFDDNKLEVSSASENQEVESKNDSRDLRGCSVTEENSNPAKEGLQITEALQMQMEVQ 145

Query: 690 KXXXXXXXXXXXXXXXXXAQGKYLKKII-EEQQRLSG 797
           K                 AQGKYL+ ++ + QQ L+G
Sbjct: 146 KKLHEQIEVQRHLQVKIEAQGKYLQSVLMKAQQTLAG 182



>gb:AY303170_1597396 Solanum bulbocastanum chromosome 8 clone
           CB3A14, complete sequence.>gb:AY303171_1597408 Solanum
           bulbocastanum chromosome 8 clone 177O13, complete
           sequence.
          Length = 282

 Score =  111 bits (278), Expect = 3e-23
 Identities = 63/146 (43%), Positives = 83/146 (56%), Gaps = 13/146 (8%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYLP 569
           K RLRWT +LH+RFVDAV +LGGPD+ATPK VLR+MG++GLT+YH+KSHLQKYRL +   
Sbjct: 26  KPRLRWTADLHDRFVDAVTKLGGPDKATPKSVLRLMGLKGLTLYHLKSHLQKYRLGQQTK 85

Query: 570 XXXXX------------XXXXXXXXXRDMISNLDGSSG-MQITEALKLQMEVQKXXXXXX 710
                                         S++DG  G   I+EAL+ Q+EVQK      
Sbjct: 86  KQNAAEQNRENIGESFRQFSLHSSGPSITSSSMDGMQGEAPISEALRCQIEVQKRLHEQL 145

Query: 711 XXXXXXXXXXXAQGKYLKKIIEEQQR 788
                      AQGKYL+ I+++ Q+
Sbjct: 146 EVQQKLQMRIEAQGKYLQAILDKAQK 171



>gb:OSJN00089_1694698 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0083N12, complete sequence.
          Length = 249

 Score =  111 bits (277), Expect = 4e-23
 Identities = 64/149 (42%), Positives = 87/149 (58%), Gaps = 5/149 (3%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYLP 569
           K RLRWT +LHERFVDAV +LGGPD+ATPK VLR+MG++GLT+YH+KSHLQKYRL +   
Sbjct: 21  KPRLRWTPDLHERFVDAVTRLGGPDKATPKSVLRLMGMKGLTLYHLKSHLQKYRLGR--- 77

Query: 570 XXXXXXXXXXXXXXRDMISNLDGSSGMQIT-----EALKLQMEVQKXXXXXXXXXXXXXX 734
                                  S+G+++      +ALK Q+EVQ+              
Sbjct: 78  -------------------QSKKSAGLELAVADSGDALKYQVEVQRKLQEQLEVQKKLQM 118

Query: 735 XXXAQGKYLKKIIEEQQRLSGVLTEAPGS 821
              AQG+YLK+I+E+ Q+   +  +A GS
Sbjct: 119 RIEAQGRYLKEILEKAQK--NISLDANGS 145



>gb:BT003421_1636844 Arabidopsis thaliana transfactor-like protein
           (At5g18240) mRNA, complete cds.
          Length = 402

 Score =  108 bits (271), Expect = 2e-22
 Identities = 69/197 (35%), Positives = 98/197 (49%), Gaps = 14/197 (7%)
 Frame = +3

Query: 249 YQPKAVLSSSLVPNKAIVSQQTLDFSASTMEPIXXXXXXXXXPSLASKQRLRWTNELHER 428
           +Q K++LSSS +P    +S +   F                  S  +K RL+WT +LHER
Sbjct: 7   HQGKSILSSSRMP----ISSERHPFLRGN-----GTGDSGLILSTDAKPRLKWTPDLHER 57

Query: 429 FVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYLPXXXXXXXXXXX-- 602
           FV+AV QLGG D+ATPK +++VMG+ GLT+YH+KSHLQKYRL+K L              
Sbjct: 58  FVEAVNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSSLNKTSVM 117

Query: 603 ------------XXXRDMISNLDGSSGMQITEALKLQMEVQKXXXXXXXXXXXXXXXXXA 746
                            +      S  + I++AL++Q+EVQ+                 A
Sbjct: 118 TMVEENPPEVDESHSESLSIGPQPSMNLPISDALQMQIEVQRRLHEQLEVQRHLQLRIEA 177

Query: 747 QGKYLKKIIEEQQRLSG 797
           QGKYL+ I+E+ Q   G
Sbjct: 178 QGKYLQSILEKAQETLG 194



>gb:AY042878_1560943 Arabidopsis thaliana transfactor-like protein
           (MRG7.19) mRNA, complete cds.
          Length = 402

 Score =  108 bits (271), Expect = 2e-22
 Identities = 69/197 (35%), Positives = 98/197 (49%), Gaps = 14/197 (7%)
 Frame = +3

Query: 249 YQPKAVLSSSLVPNKAIVSQQTLDFSASTMEPIXXXXXXXXXPSLASKQRLRWTNELHER 428
           +Q K++LSSS +P    +S +   F                  S  +K RL+WT +LHER
Sbjct: 7   HQGKSILSSSRMP----ISSERHPFLRGN-----GTGDSGLILSTDAKPRLKWTPDLHER 57

Query: 429 FVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYLPXXXXXXXXXXX-- 602
           FV+AV QLGG D+ATPK +++VMG+ GLT+YH+KSHLQKYRL+K L              
Sbjct: 58  FVEAVNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSSLNKTSVM 117

Query: 603 ------------XXXRDMISNLDGSSGMQITEALKLQMEVQKXXXXXXXXXXXXXXXXXA 746
                            +      S  + I++AL++Q+EVQ+                 A
Sbjct: 118 TMVEENPPEVDESHSESLSIGPQPSMNLPISDALQMQIEVQRRLHEQLEVQRHLQLRIEA 177

Query: 747 QGKYLKKIIEEQQRLSG 797
           QGKYL+ I+E+ Q   G
Sbjct: 178 QGKYLQSILEKAQETLG 194



>gb:AB012246_1511802 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MRG7.
          Length = 402

 Score =  108 bits (271), Expect = 2e-22
 Identities = 69/197 (35%), Positives = 98/197 (49%), Gaps = 14/197 (7%)
 Frame = +3

Query: 249 YQPKAVLSSSLVPNKAIVSQQTLDFSASTMEPIXXXXXXXXXPSLASKQRLRWTNELHER 428
           +Q K++LSSS +P    +S +   F                  S  +K RL+WT +LHER
Sbjct: 7   HQGKSILSSSRMP----ISSERHPFLRGN-----GTGDSGLILSTDAKPRLKWTPDLHER 57

Query: 429 FVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYLPXXXXXXXXXXX-- 602
           FV+AV QLGG D+ATPK +++VMG+ GLT+YH+KSHLQKYRL+K L              
Sbjct: 58  FVEAVNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSSLNKTSVM 117

Query: 603 ------------XXXRDMISNLDGSSGMQITEALKLQMEVQKXXXXXXXXXXXXXXXXXA 746
                            +      S  + I++AL++Q+EVQ+                 A
Sbjct: 118 TMVEENPPEVDESHSESLSIGPQPSMNLPISDALQMQIEVQRRLHEQLEVQRHLQLRIEA 177

Query: 747 QGKYLKKIIEEQQRLSG 797
           QGKYL+ I+E+ Q   G
Sbjct: 178 QGKYLQSILEKAQETLG 194



>gb:AB028621_1518059 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone:MUJ8.
          Length = 307

 Score =  108 bits (269), Expect = 3e-22
 Identities = 62/153 (40%), Positives = 79/153 (51%), Gaps = 23/153 (15%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPD----------------RATPKGVLRVMGVQGLTIY 521
           K RLRWT ELHERFVDAV QLGGPD                 ATPK ++R MGV+GLT+Y
Sbjct: 41  KPRLRWTTELHERFVDAVTQLGGPDSEYYFVYLSLCSVSLLEATPKTIMRTMGVKGLTLY 100

Query: 522 HVKSHLQKYRLAKYLPXXXX-------XXXXXXXXXXRDMISNLDGSSGMQITEALKLQM 680
           H+KSHLQK+RL +                           ++  + + G Q+TEAL+ QM
Sbjct: 101 HLKSHLQKFRLGRQAGKESTENSKDGESQDTGSSSTSSMRMAQQEQNEGYQVTEALRAQM 160

Query: 681 EVQKXXXXXXXXXXXXXXXXXAQGKYLKKIIEE 779
           EVQ+                 AQGKYL+ I+E+
Sbjct: 161 EVQRRLHDQLEVQRRLQLRIEAQGKYLQSILEK 193



>gb:ATAC011698_1543379 Arabidopsis thaliana chromosome III BAC
           T11I18 genomic sequence, complete sequence.
          Length = 394

 Score =  107 bits (268), Expect = 5e-22
 Identities = 63/154 (40%), Positives = 86/154 (55%), Gaps = 14/154 (9%)
 Frame = +3

Query: 378 SLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLA 557
           S  +K RL+WT +LHERF++AV QLGG D+ATPK +++VMG+ GLT+YH+KSHLQKYRL+
Sbjct: 41  STDAKPRLKWTPDLHERFIEAVNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRLS 100

Query: 558 KYLPXXXXXXXXXXXXXX--------RDMISNLDGSSGMQ------ITEALKLQMEVQKX 695
           K L                        D I + + S G Q      I EAL++Q+EVQ+ 
Sbjct: 101 KNLNGQANNSFNKIGIMTMMEEKTPDADEIQSENLSIGPQPNKNSPIGEALQMQIEVQRR 160

Query: 696 XXXXXXXXXXXXXXXXAQGKYLKKIIEEQQRLSG 797
                           AQGKYL+ ++E+ Q   G
Sbjct: 161 LHEQLEVQRHLQLRIEAQGKYLQSVLEKAQETLG 194



>gb:AP003994_1836065 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1111_E07.>gb:AP004778_1844961 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0459B01.
          Length = 284

 Score =  107 bits (266), Expect = 8e-22
 Identities = 59/143 (41%), Positives = 82/143 (57%), Gaps = 11/143 (7%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYLP 569
           K RLRWT +LHERFV+AV +LGGPD+ATPK VLR+MG++GLT+YH+KSHLQKYRL K   
Sbjct: 27  KPRLRWTPDLHERFVEAVTKLGGPDKATPKSVLRLMGMKGLTLYHLKSHLQKYRLGKQNK 86

Query: 570 XXXXXXXXXXXXXXRDM---------ISNLDGSSGMQ--ITEALKLQMEVQKXXXXXXXX 716
                           +         I + + ++  +  + +AL+ Q+EVQ+        
Sbjct: 87  KDTGLEASRGAFAAHGISFASAAPPTIPSAENNNAGETPLADALRYQIEVQRKLHEQLEV 146

Query: 717 XXXXXXXXXAQGKYLKKIIEEQQ 785
                    AQGKYL+ I+E+ Q
Sbjct: 147 QKKLQMRIEAQGKYLQTILEKAQ 169



>pir|T05233|T05233 hypothetical protein F18A5.30 - Arabidopsis
           thaliana>gb:ATCHRIV37_1545128 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 37.>gb:ATF18A5_1549049
           Arabidopsis thaliana DNA chromosome 4, BAC clone F18A5
           (ESSA project).
          Length = 302

 Score =  105 bits (262), Expect = 2e-21
 Identities = 69/175 (39%), Positives = 86/175 (49%), Gaps = 21/175 (12%)
 Frame = +3

Query: 318 DFSASTMEPIXXXXXXXXXPSLASKQRLRWTNELHERFVDAVAQLGGPD--------RAT 473
           D+S  T  PI         P    K RLRWT+ELHERFVDAV QLGGPD        +AT
Sbjct: 17  DYSDGTNLPIDACLVLTTDP----KPRLRWTSELHERFVDAVTQLGGPDISTKNLTTKAT 72

Query: 474 PKGVLRVMGVQGLTIYHVKSHLQKYRL----AKYLPXXXXXXXXXXXXXXRDMISNLDGS 641
           PK ++R MGV+GLT+YH+KSHLQ   L    + Y                +D  S+   S
Sbjct: 73  PKTIMRTMGVKGLTLYHLKSHLQVLMLLPSISNYASLATYNKQISCVAESQDTGSSSTSS 132

Query: 642 ---------SGMQITEALKLQMEVQKXXXXXXXXXXXXXXXXXAQGKYLKKIIEE 779
                       Q+TEAL+ QMEVQ+                 AQGKYL+ I+E+
Sbjct: 133 LRLAAQEQNESYQVTEALRAQMEVQRRLHEQLEVQRRLQLRIEAQGKYLQSILEK 187



>gb:AF291817_1783719 Arabidopsis thaliana MYR1 (MYR1) mRNA, complete
           cds.
          Length = 396

 Score =  104 bits (260), Expect = 4e-21
 Identities = 69/197 (35%), Positives = 98/197 (49%), Gaps = 14/197 (7%)
 Frame = +3

Query: 249 YQPKAVLSSSLVPNKAIVSQQTLDFSASTMEPIXXXXXXXXXPSLASKQRLRWTNELHER 428
           +Q K++LSSS +P    +S +   F                  S  +K RL+WT +LHER
Sbjct: 7   HQGKSILSSSRMP----ISSERHPFLRGN-----GTGDSGLILSTDAKPRLKWTPDLHER 57

Query: 429 FVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYLPXXXXXXXXXXX-- 602
           FV+AV QLGG D+ATPK +++VMG+ GLT+YH+KSHLQKYRL+K L              
Sbjct: 58  FVEAVNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSSLNKTSVM 117

Query: 603 ------------XXXRDMISNLDGSSGMQITEALKLQMEVQKXXXXXXXXXXXXXXXXXA 746
                            +      S  + I++AL++Q+EVQ+                 A
Sbjct: 118 TMVEENPPEVDESHSESLSIGPQPSMNLPISDALQMQIEVQR------RLHEQLELRIEA 171

Query: 747 QGKYLKKIIEEQQRLSG 797
           QGKYL+ I+E+ Q   G
Sbjct: 172 QGKYLQSILEKAQETLG 188



>gb:AY070764_1566911 Arabidopsis thaliana AT3g12730/MBK21_9 mRNA,
           complete cds.>gb:AY143916_1583373 Arabidopsis thaliana
           At3g12730/MBK21_9 mRNA, complete cds.
          Length = 235

 Score =  104 bits (259), Expect = 5e-21
 Identities = 59/138 (42%), Positives = 77/138 (55%), Gaps = 8/138 (5%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYLP 569
           K RLRWT ELHERFVDAV  LGGP++ATPK ++RVMGV+GLT+YH+KSHLQK+RL K  P
Sbjct: 23  KPRLRWTTELHERFVDAVTHLGGPEKATPKTIMRVMGVKGLTLYHLKSHLQKFRLGKQ-P 81

Query: 570 XXXXXXXXXXXXXXRDMISNLDGSSGMQITEA--------LKLQMEVQKXXXXXXXXXXX 725
                          +  S LD       T +         ++QMEVQ+           
Sbjct: 82  HKEHSQNHSICIRDTNRASMLDLRRNAVFTTSPLIIGRNMNEMQMEVQRRIEEEVVIERQ 141

Query: 726 XXXXXXAQGKYLKKIIEE 779
                 AQGKY++ ++E+
Sbjct: 142 VNQRIAAQGKYMESMLEK 159



>gb:AY074563_1567603 Arabidopsis thaliana AT3g04030/T11I18_14 mRNA,
           complete cds.>gb:AY143915_1583372 Arabidopsis thaliana
           At3g04030/T11I18_14 mRNA, complete cds.
          Length = 388

 Score =  103 bits (257), Expect = 9e-21
 Identities = 63/154 (40%), Positives = 86/154 (55%), Gaps = 14/154 (9%)
 Frame = +3

Query: 378 SLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLA 557
           S  +K RL+WT +LHERF++AV QLGG D+ATPK +++VMG+ GLT+YH+KSHLQKYRL+
Sbjct: 41  STDAKPRLKWTPDLHERFIEAVNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRLS 100

Query: 558 KYLPXXXXXXXXXXXXXX--------RDMISNLDGSSGMQ------ITEALKLQMEVQKX 695
           K L                        D I + + S G Q      I EAL++Q+EVQ+ 
Sbjct: 101 KNLNGQANNSFNKIGIMTMMEEKTPDADEIQSENLSIGPQPNKNSPIGEALQMQIEVQR- 159

Query: 696 XXXXXXXXXXXXXXXXAQGKYLKKIIEEQQRLSG 797
                           AQGKYL+ ++E+ Q   G
Sbjct: 160 -----RLHEQLELRIEAQGKYLQSVLEKAQETLG 188



>gb:AB024033_1515787 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MBK21.
          Length = 228

 Score =  102 bits (255), Expect = 1e-20
 Identities = 57/131 (43%), Positives = 78/131 (59%), Gaps = 1/131 (0%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYLP 569
           K RLRWT ELHERFVDAV  LGGP++ATPK ++RVMGV+GLT+YH+KSHLQK+RL K  P
Sbjct: 23  KPRLRWTTELHERFVDAVTHLGGPEKATPKTIMRVMGVKGLTLYHLKSHLQKFRLGKQ-P 81

Query: 570 XXXXXXXXXXXXXXRDMISNLDGSSGMQITEAL-KLQMEVQKXXXXXXXXXXXXXXXXXA 746
                             + +  +S + I   + ++QMEVQ+                 A
Sbjct: 82  HKEHSQNHSISSMLDLRRNAVFTTSPLIIGRNMNEMQMEVQRRIEEEVVIERQVNQRIAA 141

Query: 747 QGKYLKKIIEE 779
           QGKY++ ++E+
Sbjct: 142 QGKYMESMLEK 152



>gb:AP004396_1841130 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0404D10.>gb:AP004459_1841313 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0410E11.
          Length = 246

 Score =  102 bits (253), Expect = 2e-20
 Identities = 55/138 (39%), Positives = 74/138 (53%), Gaps = 8/138 (5%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL----- 554
           K RLRWT +LH+RFVDAVAQLGGPD+ATPK ++R MGV+GLT++H+KSHLQKYRL     
Sbjct: 34  KPRLRWTADLHDRFVDAVAQLGGPDKATPKTIMRTMGVKGLTLFHLKSHLQKYRLGKQSG 93

Query: 555 ---AKYLPXXXXXXXXXXXXXXRDMISNLDGSSGMQITEALKLQMEVQKXXXXXXXXXXX 725
              A+                    +   D     ++ EAL+ QMEVQ+           
Sbjct: 94  KEMAEQSKDASYILGAQSGTNLSPTVPTPDLKESQELKEALRAQMEVQRKLHEQVEVQRH 153

Query: 726 XXXXXXAQGKYLKKIIEE 779
                 A   Y+  ++E+
Sbjct: 154 VQIRMEAYQNYIDTLLEK 171



>gb:AP004120_1837881 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1293_E04.>gb:AP005691_1856141 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0053L11.
          Length = 407

 Score = 99.0 bits (245), Expect = 2e-19
 Identities = 62/146 (42%), Positives = 77/146 (52%), Gaps = 1/146 (0%)
 Frame = +3

Query: 387 SKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYL 566
           +K R+RWT ELHERFVDAV +LGG ++ATPK V +VM V GLTIYHVKSHLQKYR   + 
Sbjct: 235 TKPRMRWTPELHERFVDAVNKLGGSEKATPKAVQKVMKVDGLTIYHVKSHLQKYRTVHHR 294

Query: 567 PXXXXXXXXXXXXXXRDMISNLDGSSGMQIT-EALKLQMEVQKXXXXXXXXXXXXXXXXX 743
           P               D +S+     GM+ T E L++Q+ +QK                 
Sbjct: 295 PQLSDGESAKSGQT--DEVSS-QPLKGMETTCEGLRVQIGLQKQLHEQLEIQRKLQLQVE 351

Query: 744 AQGKYLKKIIEEQQRLSGVLTEAPGS 821
              KYL  IIE+Q      L   P S
Sbjct: 352 EHSKYLAMIIEKQSESLRQLGALPRS 377



>gb:AF174480_1774478 Chlamydomonas reinhardtii phosphate starvation
           regulator protein mRNA, complete
           cds.>gb:AF174532_1774484 Chlamydomonas reinhardtii
           regulatory protein of P-starvation acclimation response
           Psr1 (PSR1) gene, complete cds.
          Length = 752

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 45/61 (73%), Positives = 52/61 (85%)
 Frame = +3

Query: 387 SKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYL 566
           +K RLRWT ELH RFV+AV  LGGPD+ATPKG+L++MGV GLTIYH+KSHLQKYRL   L
Sbjct: 186 AKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQKYRLNIRL 245

Query: 567 P 569
           P
Sbjct: 246 P 246



>gb:AY224478_1590680 Oryza sativa (japonica cultivar-group) isolate
           29112 phosphate starvation response regulator-like
           protein mRNA, complete cds.
          Length = 361

 Score = 94.4 bits (233), Expect = 5e-18
 Identities = 44/61 (72%), Positives = 50/61 (81%)
 Frame = +3

Query: 387 SKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYL 566
           SK R+RWT ELHERFVDAV  LGG ++ATPKGVL++M    LTIYHVKSHLQKYR A+Y 
Sbjct: 245 SKTRMRWTPELHERFVDAVNLLGGSEKATPKGVLKLMKADNLTIYHVKSHLQKYRTARYR 304

Query: 567 P 569
           P
Sbjct: 305 P 305



>gb:AB022213_1515000 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K2N11.
          Length = 308

 Score = 93.6 bits (231), Expect = 9e-18
 Identities = 41/57 (71%), Positives = 52/57 (91%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAK 560
           K RLRWT +LH+RFVDAVA+LGG D+ATPK VL++MG++GLT+YH+KSHLQKYRL +
Sbjct: 23  KPRLRWTADLHDRFVDAVAKLGGADKATPKSVLKLMGLKGLTLYHLKSHLQKYRLGQ 79



>gb:AP005757_1857329 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0413H11.
          Length = 296

 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 43/58 (74%), Positives = 49/58 (84%)
 Frame = +3

Query: 384 ASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLA 557
           A++ RLRWT +LHERFV AVA+LGG DRATPK VLR M V GLT+YH+KSHLQKYR A
Sbjct: 18  AARARLRWTGQLHERFVLAVAELGGADRATPKSVLRAMAVPGLTLYHLKSHLQKYRQA 75



>pir|G84588|G84588 hypothetical protein At2g20400 [imported] -
           Arabidopsis thaliana>gb:AC006569_1534460 Arabidopsis
           thaliana chromosome 2 clone F11A3 map mi148, complete
           sequence.
          Length = 341

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 49/100 (49%), Positives = 61/100 (61%)
 Frame = +3

Query: 252 QPKAVLSSSLVPNKAIVSQQTLDFSASTMEPIXXXXXXXXXPSLASKQRLRWTNELHERF 431
           QP+AVL        + V  + LD + S+              + A+K R+RWT ELHE F
Sbjct: 192 QPQAVLQQP----SSCVELRPLDRTVSSNS---NNNSNSNNAAAAAKGRMRWTPELHEVF 244

Query: 432 VDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           VDAV QLGG + ATPKGVL+ M V+GLTI+HVKSHLQ  R
Sbjct: 245 VDAVNQLGGSNEATPKGVLKHMKVEGLTIFHVKSHLQSLR 284



>pir|C84474|C84474 hypothetical protein At2g06020 [imported] -
           Arabidopsis thaliana>gb:AC006413_1534120 Arabidopsis
           thaliana chromosome 2 clone F5K7 map ve013, complete
           sequence.
          Length = 301

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 34/57 (59%), Positives = 47/57 (82%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAK 560
           K RLRW+++LH+ FV+AV +LGGP++ATPK V   M V+G+ ++HVKSHLQK+RL K
Sbjct: 86  KARLRWSSDLHDCFVNAVEKLGGPNKATPKSVKEAMEVEGIALHHVKSHLQKFRLGK 142



>gb:AF085279_1767161 Arabidopsis thaliana ABA-regulated gene
           cluster, complete sequence.
          Length = 401

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 38/55 (69%), Positives = 44/55 (80%)
 Frame = +3

Query: 396 RLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAK 560
           RLRWT ELH  F+ AV +LGGPDRATPK VL++M V+GL+I HVKSHLQ YR  K
Sbjct: 84  RLRWTPELHICFLQAVERLGGPDRATPKLVLQLMNVKGLSIAHVKSHLQMYRSKK 138



>pir|C84827|C84827 hypothetical protein At2g40260 [imported] -
           Arabidopsis thaliana>gb:AC007020_1535030 Arabidopsis
           thaliana chromosome 2 clone T3G21 map g4514, complete
           sequence.
          Length = 410

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 38/55 (69%), Positives = 44/55 (80%)
 Frame = +3

Query: 396 RLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAK 560
           RLRWT ELH  F+ AV +LGGPDRATPK VL++M V+GL+I HVKSHLQ YR  K
Sbjct: 84  RLRWTPELHICFLQAVERLGGPDRATPKLVLQLMNVKGLSIAHVKSHLQMYRSKK 138



>gb:OSJN00155_1695809 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0005N02, complete sequence.
          Length = 306

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 36/55 (65%), Positives = 44/55 (80%)
 Frame = +3

Query: 396 RLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAK 560
           RLRWT ELH  FV A+  LGG D+ATPK +L++MGV+GLTI HVKSHLQ YR ++
Sbjct: 24  RLRWTGELHCSFVQAIEFLGGQDKATPKLILQLMGVKGLTISHVKSHLQMYRCSR 78



>pir|F84856|F84856 hypothetical protein At2g42660 [imported] -
           Arabidopsis thaliana>gb:AC006931_1534843 Arabidopsis
           thaliana chromosome 2 clone F7D19 map m551, complete
           sequence.>gb:AC007087_1535208 Arabidopsis thaliana
           chromosome 2 clone F14N22 map mi551, complete
           sequence.>gb:AY074640_1567642 Arabidopsis thaliana
           F14N22.7/F14N22.7 mRNA, complete
           cds.>gb:AY078938_1568099 Arabidopsis thaliana
           At2g45350/F14N22.7 mRNA, complete cds.
          Length = 255

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 38/58 (65%), Positives = 44/58 (75%)
 Frame = +3

Query: 396 RLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYLP 569
           RLRWT +LH  FV AV +LGGPDRATPK VL +M ++GL+I HVKSHLQ YR  K  P
Sbjct: 52  RLRWTPDLHLSFVRAVQRLGGPDRATPKLVLEMMNLKGLSIAHVKSHLQMYRSKKLEP 109



>gb:AC099739_1737230 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1528D07, complete sequence.
          Length = 396

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 36/52 (69%), Positives = 42/52 (80%)
 Frame = +3

Query: 396 RLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           RLRWT +LH  FV A+ +LGG D+ATPK VL++MGV GLTI HVKSHLQ YR
Sbjct: 22  RLRWTPDLHHCFVHAIHKLGGQDKATPKRVLQLMGVGGLTISHVKSHLQMYR 73



>gb:AP004635_1842362 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0672D01.>gb:AP005504_1852984 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0577B11.
          Length = 322

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 36/55 (65%), Positives = 41/55 (74%)
 Frame = +3

Query: 396 RLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAK 560
           R+RWT+ LH RFV AV  LGG DRATPK VL +M V+ LT+ HVKSHLQ YR  K
Sbjct: 161 RMRWTSTLHARFVHAVELLGGHDRATPKSVLELMDVKDLTLAHVKSHLQMYRTVK 215



>gb:AP003635_1831904 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0686E06.>gb:AP005192_1849155 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0485A07.
          Length = 256

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 32/52 (61%), Positives = 43/52 (82%)
 Frame = +3

Query: 396 RLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           R+RWT E+H +FV+AV  LGG D ATPK +L++MGV+G++I H+KSHLQ YR
Sbjct: 19  RMRWTEEMHRQFVEAVECLGGQDEATPKRILQLMGVKGVSISHIKSHLQMYR 70



>gb:AP005734_1856832 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OSJNBb0032E15.
          Length = 425

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 35/55 (63%), Positives = 41/55 (74%)
 Frame = +3

Query: 396 RLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAK 560
           R+RWT+ LH RFV AV  LGG +RATPK VL +M V+ LT+ HVKSHLQ YR  K
Sbjct: 266 RMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRTVK 320



>gb:AY030192_1559357 Arabidopsis thaliana clone A1-2 KANADI protein
           (KAN) mRNA, complete cds.>gb:AY048688_1561774
           Arabidopsis thaliana GARP-like putative transcription
           factor KANADI1 (KAN1) mRNA, complete cds.
          Length = 403

 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 35/55 (63%), Positives = 41/55 (74%)
 Frame = +3

Query: 396 RLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAK 560
           R+RWT+ LH RFV AV  LGG +RATPK VL +M V+ LT+ HVKSHLQ YR  K
Sbjct: 221 RMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRTVK 275



>gb:AP005859_1859148 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:B1053A04.>gb:AP005868_1859315 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0666E12.
          Length = 364

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 36/59 (61%), Positives = 41/59 (69%)
 Frame = +3

Query: 384 ASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAK 560
           A   R+RWT  LH RFV AV  LGG +RATPK VL +M V+ LT+ HVKSHLQ YR  K
Sbjct: 193 ARAPRMRWTTSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRTIK 251



>gb:AP005613_1854942 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0082C09.
          Length = 545

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 36/55 (65%), Positives = 43/55 (78%)
 Frame = +3

Query: 396 RLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAK 560
           RLRWT +LH  FV AV +LGG +RATPK VL++M V+GL+I HVKSHLQ YR  K
Sbjct: 119 RLRWTPDLHMAFVHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRSKK 173



>gb:AP004810_1845470 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:B1068H08.
          Length = 543

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 36/55 (65%), Positives = 43/55 (78%)
 Frame = +3

Query: 396 RLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAK 560
           RLRWT +LH  FV AV +LGG +RATPK VL++M V+GL+I HVKSHLQ YR  K
Sbjct: 128 RLRWTPDLHMAFVHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRSKK 182



>gb:AC099043_1737023 Oryza sativa chromosome 3 BAC OSJNBa0079B15
           genomic sequence, complete sequence.
          Length = 432

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 35/55 (63%), Positives = 40/55 (72%)
 Frame = +3

Query: 396 RLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAK 560
           R+RWT  LH RFV AV  LGG +RATPK VL +M V+ LT+ HVKSHLQ YR  K
Sbjct: 122 RMRWTTALHARFVHAVELLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRTVK 176



>gb:AY632360_1618717 Gossypium hirsutum BAC 106I22, complete
           sequence.
          Length = 349

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 36/55 (65%), Positives = 43/55 (78%)
 Frame = +3

Query: 396 RLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAK 560
           RLRWT +LH  FV AV +LGG +RATPK VL++M V+GL+I HVKSHLQ YR  K
Sbjct: 81  RLRWTPDLHYSFVRAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRSKK 135



>gb:AY048689_1561775 Arabidopsis thaliana GARP-like putative
           transcription factor KANADI2 (KAN2) mRNA, complete
           cds.>gb:AC084110_1733344 Arabidopsis thaliana chromosome
           1 BAC F27G20 genomic sequence, complete sequence.
          Length = 388

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 35/55 (63%), Positives = 40/55 (72%)
 Frame = +3

Query: 396 RLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAK 560
           R+RWT  LH RFV AV  LGG +RATPK VL +M V+ LT+ HVKSHLQ YR  K
Sbjct: 215 RMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRTVK 269



>gb:BT004973_1637919 Arabidopsis thaliana clone U50495 unknown
           protein (At2g38300) mRNA, complete
           cds.>gb:AK117689_1815710 Arabidopsis thaliana At2g38300
           mRNA for unknown protein, complete cds, clone:
           RAFL17-35-G17.
          Length = 340

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 38/63 (60%), Positives = 47/63 (74%), Gaps = 1/63 (1%)
 Frame = +3

Query: 375 PSLASK-QRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           P + SK  RLRWT +LH RFV AV +LGG +RATPK V ++M ++GL+I HVKSHLQ YR
Sbjct: 48  PYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMNIKGLSIAHVKSHLQMYR 107

Query: 552 LAK 560
             K
Sbjct: 108 SKK 110



>gb:AY048690_1561776 Arabidopsis thaliana GARP-like putative
           transcription factor KANADI3 (KAN3) mRNA, complete cds.
          Length = 322

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 35/55 (63%), Positives = 39/55 (70%)
 Frame = +3

Query: 396 RLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAK 560
           R+RWT  LH  FV AV  LGG +RATPK VL +M VQ LT+ HVKSHLQ YR  K
Sbjct: 166 RMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMDVQDLTLAHVKSHLQMYRTIK 220



>gb:AY568658_1178638 Arabidopsis thaliana myb family transcription
           factor (At1g14600) mRNA, complete
           cds.>gb:AJ630486_1812745 Arabidopsis thaliana mRNA for
           hypothetical protein, clone At1g14600.
          Length = 255

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 36/52 (69%), Positives = 40/52 (76%)
 Frame = +3

Query: 396 RLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           RLRWT ELH  FV AV  LGG  +ATPK VL++M V+GLTI HVKSHLQ YR
Sbjct: 25  RLRWTPELHRSFVHAVDLLGGQYKATPKLVLKIMDVKGLTISHVKSHLQMYR 76



>gb:AE005172_890454 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC010657_1536986 Genomic sequence
           for Arabidopsis thaliana BAC T5E21 from chromosome I,
           complete sequence.
          Length = 254

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 36/52 (69%), Positives = 40/52 (76%)
 Frame = +3

Query: 396 RLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           RLRWT ELH  FV AV  LGG  +ATPK VL++M V+GLTI HVKSHLQ YR
Sbjct: 25  RLRWTPELHRSFVHAVDLLGGQYKATPKLVLKIMDVKGLTISHVKSHLQMYR 76



>gb:AB013391_1512091 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MFO20.>gb:AY048691_1561777 Arabidopsis thaliana
           GARP-like putative transcription factor KANADI4 (KAN4)
           mRNA, complete cds.
          Length = 276

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 34/55 (61%), Positives = 40/55 (72%)
 Frame = +3

Query: 396 RLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAK 560
           R+RWT+ LH  FV AV  LGG +RATPK VL +M V+ LT+ HVKSHLQ YR  K
Sbjct: 107 RMRWTSTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRTVK 161



>gb:BT008556_1639773 Arabidopsis thaliana clone U50358 unknown
           protein (At2g02060) mRNA, complete
           cds.>gb:BT008699_1639895 Arabidopsis thaliana clone
           RAFL17-14-B12 (R50358) unknown protein (At2g02060) mRNA,
           complete cds.
          Length = 256

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 36/52 (69%), Positives = 40/52 (76%)
 Frame = +3

Query: 396 RLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           RLRWT +LH  FV AV  LGG  RATPK VL++M V+GLTI HVKSHLQ YR
Sbjct: 31  RLRWTPDLHRCFVHAVEILGGQHRATPKLVLKMMDVKGLTISHVKSHLQMYR 82



>pir|E84432|E84432 hypothetical protein At2g02060 [imported] -
           Arabidopsis thaliana>gb:AC005936_1533226 Arabidopsis
           thaliana chromosome 2 clone F5O4 map CIC11A04, complete
           sequence.>gb:AC006532_1534376 Arabidopsis thaliana
           chromosome 2 clone F14H20 map CIC11A04, complete
           sequence.
          Length = 626

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 36/52 (69%), Positives = 40/52 (76%)
 Frame = +3

Query: 396 RLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           RLRWT +LH  FV AV  LGG  RATPK VL++M V+GLTI HVKSHLQ YR
Sbjct: 31  RLRWTPDLHRCFVHAVEILGGQHRATPKLVLKMMDVKGLTISHVKSHLQMYR 82



>gb:AY086694_1571738 Arabidopsis thaliana clone 2686 mRNA, complete
           sequence.
          Length = 333

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 45/100 (45%), Positives = 55/100 (55%), Gaps = 4/100 (4%)
 Frame = +3

Query: 267 LSSSLVPNKAIVSQQTLDFSASTME----PIXXXXXXXXXPSLASKQRLRWTNELHERFV 434
           LSSS +  K IV+  +  F++++M     P               KQR  W  ELH RFV
Sbjct: 149 LSSSSIRRKGIVA--SCGFTSNSMPQPPTPAVPQQPAFLKQQALRKQRRCWNPELHRRFV 206

Query: 435 DAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           DA+ QLGGP  ATPK +   M  +GLT   VKSHLQKYRL
Sbjct: 207 DALQQLGGPGVATPKQIREHMQEEGLTNDEVKSHLQKYRL 246



>pir|B96532|B96532 hypothetical protein F14J22.20 [imported] -
           Arabidopsis thaliana>gb:AE005173_892889 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC011807_1537463 Arabidopsis thaliana
           chromosome I BAC F14J22 genomic sequence, complete
           sequence.
          Length = 333

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 45/100 (45%), Positives = 55/100 (55%), Gaps = 4/100 (4%)
 Frame = +3

Query: 267 LSSSLVPNKAIVSQQTLDFSASTME----PIXXXXXXXXXPSLASKQRLRWTNELHERFV 434
           LSSS +  K IV+  +  F++++M     P               KQR  W  ELH RFV
Sbjct: 149 LSSSSIRRKGIVA--SCGFTSNSMPQPPTPAVPQQPAFLKQQALRKQRRCWNPELHRRFV 206

Query: 435 DAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           DA+ QLGGP  ATPK +   M  +GLT   VKSHLQKYRL
Sbjct: 207 DALQQLGGPGVATPKQIREHMQEEGLTNDEVKSHLQKYRL 246



>gb:AP005071_1847548 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0669G09.>gb:AP005804_1858148 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0085K21.
          Length = 235

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 31/52 (59%), Positives = 40/52 (76%)
 Frame = +3

Query: 396 RLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           R+RW  ELH RFV AV +LGG   ATPK ++++MG +G++I HVKSHLQ YR
Sbjct: 34  RMRWPEELHRRFVHAVRRLGGCHEATPKRIMQLMGAKGVSISHVKSHLQMYR 85



>gb:AY039841_1560355 Arabidopsis thaliana AT4g37180/C7A10_180 mRNA,
           partial cds.
          Length = 350

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 33/55 (60%), Positives = 41/55 (74%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           +QR RW+ ELH +FVDA+ +LGGP  ATPK +  +M V GLT   VKSHLQKYR+
Sbjct: 217 EQRRRWSQELHRKFVDALHRLGGPQVATPKQIRDLMKVDGLTNDEVKSHLQKYRM 271



>gb:ATU62741_1557129 Arabidopsis thaliana putative cytoskeletal
           protein mRNA, complete cds.
          Length = 183

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 33/55 (60%), Positives = 41/55 (74%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           +QR RW+ ELH +FVDA+ +LGGP  ATPK +  +M V GLT   VKSHLQKYR+
Sbjct: 37  EQRRRWSQELHRKFVDALHRLGGPQVATPKQIRDLMKVDGLTNDEVKSHLQKYRM 91



>pir|C85439|C85439 probable cytoskeletal protein [imported] -
           Arabidopsis thaliana>gb:ATAP21_1543979 Arabidopsis
           thaliana DNA chromosome 4, ESSA I AP2 contig fragment
           No. 1.>gb:ATCHRIV86_1547673 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 86.
          Length = 183

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 33/55 (60%), Positives = 41/55 (74%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           +QR RW+ ELH +FVDA+ +LGGP  ATPK +  +M V GLT   VKSHLQKYR+
Sbjct: 37  EQRRRWSQELHRKFVDALHRLGGPQVATPKQIRDLMKVDGLTNDEVKSHLQKYRM 91



>pir|T01261|T02515 cytoskeletal protein homolog F16M14.23 -
           Arabidopsis thaliana>gb:AC003028_1530987 Arabidopsis
           thaliana chromosome 2 clone F16M14 map ve018, complete
           sequence.>gb:AC004683_1532061 Arabidopsis thaliana
           chromosome 2 clone T19C21 map ve018, complete sequence.
          Length = 299

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = +3

Query: 375 PSLASK-QRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           P + SK  RLRWT +LH RFV AV +LGG +RATPK V ++M ++GL+I HVKSHLQ + 
Sbjct: 48  PYVRSKVPRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMNIKGLSIAHVKSHLQVFD 107

Query: 552 L 554
           L
Sbjct: 108 L 108



>gb:AB005242_1509524 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MQK4.
          Length = 270

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 32/49 (65%), Positives = 38/49 (77%)
 Frame = +3

Query: 396 RLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQ 542
           R+RWT+ LH RFV AV  LGG +RATPK VL +M V+ LT+ HVKSHLQ
Sbjct: 221 RMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQ 269



>gb:AC099043_1737041 Oryza sativa chromosome 3 BAC OSJNBa0079B15
           genomic sequence, complete sequence.
          Length = 348

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 35/57 (61%), Positives = 39/57 (68%)
 Frame = +3

Query: 384 ASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           A K R  W+ ELH +FV A+ QLGGP  ATPK +  VM V GLT   VKSHLQKYRL
Sbjct: 222 ARKSRRCWSPELHRQFVAALQQLGGPQVATPKQIREVMKVDGLTNDEVKSHLQKYRL 278



>gb:AY085570_1570639 Arabidopsis thaliana clone 157740 mRNA,
           complete sequence.
          Length = 351

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 33/55 (60%), Positives = 39/55 (70%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           K R  W+ ELH RF++A+ QLGGP  ATPK +  +M V GLT   VKSHLQKYRL
Sbjct: 189 KNRRCWSQELHRRFLNALKQLGGPHVATPKQIRDIMKVDGLTNDEVKSHLQKYRL 243



>gb:AB028607_1517898 Arabidopsis thaliana genomic DNA, chromosome 3,
           TAC clone:K13N2.
          Length = 357

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 33/55 (60%), Positives = 39/55 (70%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           K R  W+ ELH RF++A+ QLGGP  ATPK +  +M V GLT   VKSHLQKYRL
Sbjct: 196 KNRRCWSQELHRRFLNALKQLGGPHVATPKQIRDIMKVDGLTNDEVKSHLQKYRL 250



>pir|G85057|G85057 hypothetical protein AT4g04580 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV13_1544302 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           13.>gb:AF074021_1765945 Arabidopsis thaliana BAC F4H6,
           chromosome IV, complete sequence.
          Length = 166

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 30/55 (54%), Positives = 40/55 (72%)
 Frame = +3

Query: 396 RLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAK 560
           R+ WT++L  RF+  + +LGG + ATPK +L +MGV+ LTI HVKSHLQ YR  K
Sbjct: 16  RMHWTDDLDIRFIQVIEKLGGEESATPKRILSLMGVRDLTISHVKSHLQMYRNKK 70



>gb:AC092780_1735724 Oryza sativa chromosome 3 BAC OSJNBb0079B16
           genomic sequence, complete sequence.
          Length = 233

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 31/49 (63%), Positives = 36/49 (73%)
 Frame = +3

Query: 396 RLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQ 542
           R+RWT  LH  FV AV  LGG +RATPK VL +M V+ LT+ HVKSHLQ
Sbjct: 116 RMRWTTALHAHFVQAVELLGGHERATPKSVLELMNVKDLTLAHVKSHLQ 164



>gb:BT002674_1636277 Arabidopsis thaliana At1g25550/F2J7_21 gene,
           complete cds.>gb:AF326890_1786749 Arabidopsis thaliana
           unknown protein (At1g25550) mRNA, complete
           cds.>gb:AF339707_1787751 Arabidopsis thaliana unknown
           protein (At1g25550) mRNA, complete
           cds.>gb:AF372906_1792621 Arabidopsis thaliana
           At1g25550/F2J7_21 mRNA, complete cds.
          Length = 344

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 47/103 (45%), Positives = 55/103 (53%), Gaps = 2/103 (1%)
 Frame = +3

Query: 252 QPKAVLSSSLVPNKAIVSQQTLDFSASTMEPIXXXXXXXXXPSLAS--KQRLRWTNELHE 425
           +PKA  S  L+  KAI    T   S ST E +             S  KQR  W+ ELH 
Sbjct: 164 KPKAADSQPLI--KAITPTSTTTTS-STAETVGGGKEFEEQKQSHSNRKQRRCWSPELHR 220

Query: 426 RFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           RF+ A+ QLGG   ATPK +  +M V GLT   VKSHLQKYRL
Sbjct: 221 RFLHALQQLGGSHVATPKQIRDLMKVDGLTNDEVKSHLQKYRL 263



>gb:AY085913_1570976 Arabidopsis thaliana clone 1959 mRNA, complete
           sequence.
          Length = 330

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 47/103 (45%), Positives = 55/103 (53%), Gaps = 2/103 (1%)
 Frame = +3

Query: 252 QPKAVLSSSLVPNKAIVSQQTLDFSASTMEPIXXXXXXXXXPSLAS--KQRLRWTNELHE 425
           +PKA  S  L+  KAI    T   S ST E +             S  KQR  W+ ELH 
Sbjct: 150 KPKAADSQPLI--KAITPTSTTTTS-STAETVGGGKEFEEQKQSHSNRKQRRCWSPELHR 206

Query: 426 RFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           RF+ A+ QLGG   ATPK +  +M V GLT   VKSHLQKYRL
Sbjct: 207 RFLHALQQLGGSHVATPKQIRDLMKVDGLTNDEVKSHLQKYRL 249



>gb:AY045662_1561253 Arabidopsis thaliana At1g79430/T8K14_15 mRNA,
           complete cds.>gb:AY143841_1583298 Arabidopsis thaliana
           At1g79430/T8K14_15 mRNA, complete cds.
          Length = 293

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 40/107 (37%), Positives = 55/107 (51%), Gaps = 3/107 (2%)
 Frame = +3

Query: 486 LRVMGVQGLTIYHVKSHLQKYRLAK--YLPXXXXXXXXXXXXXXRDMISNLDGSSGMQIT 659
           +RVMGV+GLT+YH+KSHLQK+RL K  +                 D+  N+  SSGM   
Sbjct: 1   MRVMGVKGLTLYHLKSHLQKFRLGKQPHKEYGDHSTKEGSRASAMDIQRNVASSSGMMSR 60

Query: 660 EALKLQMEVQKXXXXXXXXXXXXXXXXXAQGKYLKKIIEEQ-QRLSG 797
              ++QMEVQ+                 AQGKY++ I+E   Q L+G
Sbjct: 61  NMNEMQMEVQRRLHEQLEVQRHLQLRIEAQGKYMQSILERACQTLAG 107



>pir|H86385|H86385 38.7K hypothetical protein F2J7.21 - Arabidopsis
           thaliana>gb:AE005172_891476 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC079281_1732437 Arabidopsis thaliana
           chromosome 1 BAC F2J7 genomic sequence, complete
           sequence.
          Length = 343

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 47/103 (45%), Positives = 55/103 (53%), Gaps = 2/103 (1%)
 Frame = +3

Query: 252 QPKAVLSSSLVPNKAIVSQQTLDFSASTMEPIXXXXXXXXXPSLAS--KQRLRWTNELHE 425
           +PKA  S  L+  KAI    T   S ST E +             S  KQR  W+ ELH 
Sbjct: 163 KPKAADSQPLI--KAITPTSTTTTS-STAETVGGGKEFEEQKQSHSNRKQRRCWSPELHR 219

Query: 426 RFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           RF+ A+ QLGG   ATPK +  +M V GLT   VKSHLQKYRL
Sbjct: 220 RFLHALQQLGGSHVATPKQIRDLMKVDGLTNDEVKSHLQKYRL 262



>pir|F86267|F86267 T6J4.6 protein - Arabidopsis
           thaliana>gb:AE005172_890341 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC011810_1537503 Arabidopsis thaliana
           chromosome I BAC T6J4 genomic sequence, complete
           sequence.>gb:AY124865_1580230 Arabidopsis thaliana
           At1g13300/T6J4_6 mRNA, complete cds.>gb:AF367336_1791788
           Arabidopsis thaliana At1g13300/T6J4_6 mRNA, complete
           cds.
          Length = 344

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 32/55 (58%), Positives = 39/55 (70%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           KQR  W+++LH RF++A+  LGGP  ATPK +   M V GLT   VKSHLQKYRL
Sbjct: 181 KQRRCWSSQLHRRFLNALQHLGGPHVATPKQIREFMKVDGLTNDEVKSHLQKYRL 235



>gb:AP004262_1839336 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0022B05.
          Length = 355

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 33/57 (57%), Positives = 39/57 (68%)
 Frame = +3

Query: 384 ASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           A K R  W+ +LH +FV A+ QLGGP  ATPK +  +M V GLT   VKSHLQKYRL
Sbjct: 226 ARKTRRCWSPDLHRKFVAALQQLGGPQVATPKQIRELMKVDGLTNDEVKSHLQKYRL 282



>gb:AP007226_1863314 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBb0036B04.
          Length = 696

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 34/60 (56%), Positives = 42/60 (70%)
 Frame = +3

Query: 375 PSLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           PS A K R+ W+ ELH +FV AV QLG  D+A PK +L +M V+ LT  +V SHLQKYRL
Sbjct: 212 PSAAKKPRVVWSVELHRKFVAAVNQLG-IDKAVPKRILELMNVEKLTRENVASHLQKYRL 270



>gb:AY087993_1573017 Arabidopsis thaliana clone 40196 mRNA, complete
           sequence.
          Length = 344

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 33/55 (60%), Positives = 38/55 (69%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           KQR  W+ ELH RF++A+ QLGG   ATPK +   M V GLT   VKSHLQKYRL
Sbjct: 205 KQRRCWSPELHRRFLNALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRL 259



>gb:AY063886_1565833 Arabidopsis thaliana unknown protein
           (At1g68670) mRNA, complete cds.>gb:AY091241_1574449
           Arabidopsis thaliana unknown protein (At1g68670) mRNA,
           complete cds.
          Length = 354

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 33/55 (60%), Positives = 38/55 (69%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           KQR  W+ ELH RF++A+ QLGG   ATPK +   M V GLT   VKSHLQKYRL
Sbjct: 215 KQRRCWSPELHRRFLNALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRL 269



>pir|C96711|C96711 F24J5.9 [imported] - Arabidopsis
           thaliana>gb:AE005173_894488 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:F24J5_1677999 Arabidopsis thaliana
           chromosome 1 BAC F24J5 sequence, complete sequence.
          Length = 353

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 33/55 (60%), Positives = 38/55 (69%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           KQR  W+ ELH RF++A+ QLGG   ATPK +   M V GLT   VKSHLQKYRL
Sbjct: 214 KQRRCWSPELHRRFLNALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRL 268



>gb:AP003628_1831710 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0473H04.
          Length = 278

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 39/108 (36%), Positives = 54/108 (50%), Gaps = 10/108 (9%)
 Frame = +3

Query: 486 LRVMGVQGLTIYHVKSHLQKYRLAKYLPXXXXXXXXXXXXXXRDMISNLDGSSG------ 647
           +RVMGV+GLT+YH+KSHLQK+RL K                  DM  N   SSG      
Sbjct: 1   MRVMGVKGLTLYHLKSHLQKFRLGK----QHKDFNDHSVKDAMDMQRNAASSSGIMGRSM 56

Query: 648 ----MQITEALKLQMEVQKXXXXXXXXXXXXXXXXXAQGKYLKKIIEE 779
               + + EAL+++MEVQ+                 AQGKY++ I+E+
Sbjct: 57  NDRSVHVNEALRMKMEVQRRFHEQLEVQKHLQMRVEAQGKYMQTILEK 104



>gb:AB024029_1515743 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K21L19.
          Length = 632

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 31/55 (56%), Positives = 41/55 (74%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           K R+ W+ ELH++FV AV QLG  D+A PK +L +M ++GLT  +V SHLQKYRL
Sbjct: 191 KPRVVWSQELHQKFVSAVQQLG-LDKAVPKKILDLMSIEGLTRENVASHLQKYRL 244



>gb:AP004789_1845103 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0476C12.
          Length = 412

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 32/55 (58%), Positives = 36/55 (65%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           K R  W  ELH RF+ A+ QLGG   ATPK +  +M V GLT   VKSHLQKYRL
Sbjct: 235 KPRRCWAPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRL 289



>gb:AP002523_1822367 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0013F10.
          Length = 425

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 33/60 (55%), Positives = 38/60 (63%)
 Frame = +3

Query: 375 PSLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           P    K R  W+ ELH RFV+A+  LGG   ATPK +  +M V GLT   VKSHLQKYRL
Sbjct: 179 PQPHRKARRCWSPELHRRFVNALQILGGAQVATPKQIRELMKVDGLTNDEVKSHLQKYRL 238



>gb:AC130607_1740836 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0017D10, complete
           sequence.>gb:AC130729_1740935 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone P0668F02, complete
           sequence.
          Length = 331

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 32/55 (58%), Positives = 41/55 (74%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           + RL WT +LH+RFVDAVA LG  + A PK ++++M V GLT  +V SHLQKYRL
Sbjct: 110 RPRLVWTPQLHKRFVDAVAHLGIKN-AVPKTIMQLMSVDGLTRENVASHLQKYRL 163



>gb:AY084791_1569875 Arabidopsis thaliana clone 118003 mRNA,
           complete sequence.
          Length = 266

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 32/55 (58%), Positives = 41/55 (74%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           + RL WT +LH+RFVDAVA LG  + A PK ++++M V GLT  +V SHLQKYRL
Sbjct: 81  RPRLVWTPQLHKRFVDAVAHLGIKN-AVPKTIMQLMSVDGLTRENVASHLQKYRL 134



>gb:ATAC011708_1543399 Arabidopsis thaliana chromosome III BAC T7M13
           genomic sequence, complete sequence.
          Length = 335

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 32/55 (58%), Positives = 41/55 (74%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           + RL WT +LH+RFVDAVA LG  + A PK ++++M V GLT  +V SHLQKYRL
Sbjct: 105 RPRLVWTPQLHKRFVDAVAHLGIKN-AVPKTIMQLMSVDGLTRENVASHLQKYRL 158



>gb:AB060130_1521812 Zea mays ZmRR8 mRNA for response regulator 8,
           complete cds.
          Length = 684

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 32/60 (53%), Positives = 43/60 (71%)
 Frame = +3

Query: 375 PSLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           PS + K R+ W+ ELH++FV+AV  LG  D+A PK +L +M V GLT  +V SHLQK+RL
Sbjct: 195 PSTSKKPRVVWSVELHQQFVNAVNHLG-IDKAVPKKILELMNVPGLTRENVASHLQKFRL 253



>gb:AB005245_1509589 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MUG13.>gb:AY093188_1575142 Arabidopsis thaliana
           unknown protein (At5g05090) mRNA, complete
           cds.>gb:BT006289_1639181 Arabidopsis thaliana At5g05090
           mRNA, complete cds.
          Length = 266

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 32/55 (58%), Positives = 41/55 (74%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           + RL WT +LH+RFVDAVA LG  + A PK ++++M V GLT  +V SHLQKYRL
Sbjct: 81  RPRLVWTPQLHKRFVDAVAHLGIKN-AVPKTIMQLMSVDGLTRENVASHLQKYRL 134



>gb:AP005688_1856036 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0031J07.
          Length = 422

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 29/54 (53%), Positives = 38/54 (70%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           K ++ WT ELH RFV AV QLG  D+A P  +L +MG+  LT +++ SHLQKYR
Sbjct: 147 KAKVDWTPELHRRFVQAVEQLG-IDKAVPSRILEIMGIDSLTRHNIASHLQKYR 199



>gb:AP005688_1856035 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0031J07.
          Length = 455

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 29/54 (53%), Positives = 38/54 (70%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           K ++ WT ELH RFV AV QLG  D+A P  +L +MG+  LT +++ SHLQKYR
Sbjct: 180 KAKVDWTPELHRRFVQAVEQLG-IDKAVPSRILEIMGIDSLTRHNIASHLQKYR 232



>gb:AP003975_1835813 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1004_E04.>gb:AP004094_1837625 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1695_H09.
          Length = 688

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 38/95 (40%), Positives = 50/95 (52%), Gaps = 2/95 (2%)
 Frame = +3

Query: 375 PSLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR- 551
           PS   K R+ W+ ELH +FV AV QLG  D+A PK +L +M V+ LT  +V SHLQKYR 
Sbjct: 209 PSAPKKPRVVWSVELHRKFVAAVNQLG-IDKAVPKRILELMNVEKLTRENVASHLQKYRL 267

Query: 552 -LAKYLPXXXXXXXXXXXXXXRDMISNLDGSSGMQ 653
            L +                 RD   ++ G  G+Q
Sbjct: 268 YLKRLSAVASQQVSIVAALGGRDPFLHMGGFEGLQ 302



>gb:AF318581_1785615 Oryza sativa putative transcription factor
           OsGLK1 (Glk1) mRNA, complete cds.
          Length = 455

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 29/54 (53%), Positives = 38/54 (70%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           K ++ WT ELH RFV AV QLG  D+A P  +L +MG+  LT +++ SHLQKYR
Sbjct: 180 KAKVDWTPELHRRFVQAVEQLG-IDKAVPSRILEIMGIDSLTRHNIASHLQKYR 232



>gb:AY088089_1573113 Arabidopsis thaliana clone 41153 mRNA, complete
           sequence.
          Length = 298

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 31/57 (54%), Positives = 42/57 (73%)
 Frame = +3

Query: 384 ASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           + + RL WT +LH+RFVD VA LG  + A PK ++++M V+GLT  +V SHLQKYRL
Sbjct: 139 SKRPRLVWTPQLHKRFVDVVAHLGIKN-AVPKTIMQLMNVEGLTRENVASHLQKYRL 194



>gb:AB025604_1516271 Arabidopsis thaliana genomic DNA, chromosome 5,
           BAC clone:F2O15.>gb:AK117348_1815387 Arabidopsis
           thaliana At5g59570 mRNA for ARR1 like protein, complete
           cds, clone: RAFL16-91-G07.
          Length = 298

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 31/57 (54%), Positives = 42/57 (73%)
 Frame = +3

Query: 384 ASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           + + RL WT +LH+RFVD VA LG  + A PK ++++M V+GLT  +V SHLQKYRL
Sbjct: 139 SKRPRLVWTPQLHKRFVDVVAHLGIKN-AVPKTIMQLMNVEGLTRENVASHLQKYRL 194



>gb:AP003277_1827064 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0518C01.
          Length = 238

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 31/59 (52%), Positives = 43/59 (72%)
 Frame = +3

Query: 378 SLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           S + + RL WT +LH+RFV+ VA LG  + A PK ++++M V+GLT  +V SHLQKYRL
Sbjct: 114 SSSKRARLVWTPQLHKRFVEVVAHLGMKN-AVPKTIMQLMNVEGLTRENVASHLQKYRL 171



>gb:AC006284_1533992 Arabidopsis thaliana chromosome 2 clone T4M8
           map CIC11A04, complete sequence.>gb:AY060559_1564866
           Arabidopsis thaliana At2g03500/T4M8.7 mRNA, complete
           cds.>gb:AY133630_1581453 Arabidopsis thaliana
           At2g03500/T4M8.7 mRNA, complete cds.
          Length = 432

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 31/55 (56%), Positives = 36/55 (65%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           K R  W+ +LH RFV A+  LGG   ATPK +  +M V GLT   VKSHLQKYRL
Sbjct: 233 KARRCWSPDLHRRFVQALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRL 287



>gb:AB062489_1522125 Arabidopsis thaliana mRNA for GPRI1, complete
           cds.>gb:AC007048_1535101 Arabidopsis thaliana chromosome
           2 clone F23N11 map mi148, complete
           sequence.>gb:AC007109_1535241 Arabidopsis thaliana
           chromosome 2 clone T13C7 map mi148, complete
           sequence.>gb:AY026772_1559034 Arabidopsis thaliana
           golden2-like transcription factor (GLK1) mRNA, complete
           cds.>gb:AY028367_1559060 Arabidopsis thaliana
           golden2-like protein 1 (GLK1) gene, complete
           cds.>gb:AY054600_1563254 Arabidopsis thaliana Unknown
           protein (At2g20570; F23N11.11) mRNA, complete
           cds.>gb:AY081485_1568745 Arabidopsis thaliana unknown
           protein (At2g20570) mRNA, complete cds.
          Length = 420

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 31/54 (57%), Positives = 39/54 (72%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           K ++ WT ELH RFV+AV QLG  D+A P  +L +MGV  LT ++V SHLQKYR
Sbjct: 153 KVKVDWTPELHRRFVEAVEQLG-VDKAVPSRILELMGVHCLTRHNVASHLQKYR 205



>pir|T00761|T02122 hypothetical protein At2g40970 [imported] -
           Arabidopsis thaliana>gb:AC002409_1530717 Arabidopsis
           thaliana chromosome 2 clone T20B5 map CIC11C08, complete
           sequence.>gb:AC004261_1531641 Arabidopsis thaliana
           chromosome 2 clone T3K9 map CIC11C08, complete
           sequence.>gb:AY072381_1567198 Arabidopsis thaliana
           unknown protein (At2g40970) mRNA, complete
           cds.>gb:BT000098_1634376 Arabidopsis thaliana unknown
           protein (At2g40970) mRNA, complete cds.
          Length = 248

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 31/55 (56%), Positives = 41/55 (74%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           + RL WT +LH+RFVDAV  LG  + A PK ++++M V+GLT  +V SHLQKYRL
Sbjct: 105 RPRLVWTPQLHKRFVDAVGHLGIKN-AVPKTIMQLMSVEGLTRENVASHLQKYRL 158



>pir|T45601|T45601 hypothetical protein F12A12.160 - Arabidopsis
           thaliana>gb:ATF12A12_1548305 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F12A12.>gb:BT006425_1639312
           Arabidopsis thaliana At3g46640 gene, complete cds.
          Length = 323

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 31/55 (56%), Positives = 41/55 (74%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           + RL WT +LH+RFVD VA LG  + A PK ++++M V+GLT  +V SHLQKYRL
Sbjct: 144 RPRLVWTPQLHKRFVDVVAHLGIKN-AVPKTIMQLMNVEGLTRENVASHLQKYRL 197



>pir|H84590|H84590 hypothetical protein At2g20570 [imported] -
           Arabidopsis thaliana
          Length = 406

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 31/54 (57%), Positives = 39/54 (72%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           K ++ WT ELH RFV+AV QLG  D+A P  +L +MGV  LT ++V SHLQKYR
Sbjct: 153 KVKVDWTPELHRRFVEAVEQLG-VDKAVPSRILELMGVHCLTRHNVASHLQKYR 205



>gb:AF534891_1809606 Catharanthus roseus type-B response regulator
           (RR5) mRNA, complete cds.
          Length = 643

 Score = 60.8 bits (146), Expect = 6e-08
 Identities = 33/59 (55%), Positives = 41/59 (69%)
 Frame = +3

Query: 378 SLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           S   K R+ W+ ELH++FV AV QLG  D+A PK +L +M V GLT  +V SHLQKYRL
Sbjct: 214 STLKKPRVVWSVELHQQFVAAVNQLG-IDKAVPKKILELMNVPGLTRENVASHLQKYRL 271



>gb:AC120535_1739896 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0092N01 map MAP_LOC, complete
           sequence.>gb:AC138004_1743973 Oryza sativa chromosome 3
           BAC OSJNBb0023J24 genomic sequence, complete sequence.
          Length = 188

 Score = 60.8 bits (146), Expect = 6e-08
 Identities = 29/58 (50%), Positives = 41/58 (70%), Gaps = 3/58 (5%)
 Frame = +3

Query: 387 SKQRLRWTNELHERFVDAVAQLGGPDRATP---KGVLRVMGVQGLTIYHVKSHLQKYR 551
           ++  LRW+++LH+ FV+AVA  GGP  A P   K  ++ MGV  LT +++KSHLQKYR
Sbjct: 16  TRSYLRWSDDLHKMFVEAVAYHGGPYEAKPTAVKETMQAMGVTSLTTHNIKSHLQKYR 73



>gb:AF318580_1785614 Zea mays putative transcription factor ZmGLK1
           (Glk1) mRNA, complete cds.
          Length = 475

 Score = 60.5 bits (145), Expect = 8e-08
 Identities = 28/54 (51%), Positives = 38/54 (70%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           K ++ WT ELH RFV AV +LG  D+A P  +L +MG+  LT +++ SHLQKYR
Sbjct: 193 KAKVDWTPELHRRFVQAVEELG-IDKAVPSRILEIMGIDSLTRHNIASHLQKYR 245



>gb:AY581256_1616063 Oryza sativa (japonica cultivar-group) induced
           protein MgI1 mRNA, complete cds.
          Length = 238

 Score = 60.5 bits (145), Expect = 8e-08
 Identities = 30/57 (52%), Positives = 42/57 (73%)
 Frame = +3

Query: 384 ASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           + + RL WT +LH+RFV+ VA LG  + A PK ++++M V+GLT  +V SHLQKYRL
Sbjct: 116 SKRARLVWTPQLHKRFVEVVAHLGMKN-AVPKTIMQLMNVEGLTRENVASHLQKYRL 171



>gb:AP002855_1823203 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBa0086P08.
          Length = 539

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 29/54 (53%), Positives = 39/54 (72%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           K ++ WT ELH RFV AV QLG  D+A P  +L +MG++ LT +++ SHLQKYR
Sbjct: 215 KVKVDWTPELHRRFVQAVEQLG-IDKAVPSRILELMGIECLTRHNIASHLQKYR 267



>gb:AK175378_1817366 Arabidopsis thaliana mRNA for hypothetical
           protein, complete cds, clone: RAFL21-81-O06.
          Length = 664

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 32/59 (54%), Positives = 41/59 (69%)
 Frame = +3

Query: 378 SLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           S   K R+ W+ ELH++FV AV QLG  D+A PK +L +M V GLT  +V SHLQKYR+
Sbjct: 212 SSLKKPRVVWSVELHQQFVAAVNQLG-VDKAVPKKILEMMNVPGLTRENVASHLQKYRI 269



>gb:AF318582_1785616 Oryza sativa putative transcription factor
           OsGLK2 (Glk2) mRNA, partial cds.
          Length = 430

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 29/54 (53%), Positives = 39/54 (72%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           K ++ WT ELH RFV AV QLG  D+A P  +L +MG++ LT +++ SHLQKYR
Sbjct: 106 KVKVDWTPELHRRFVQAVEQLG-IDKAVPSRILELMGIECLTRHNIASHLQKYR 158



>gb:AY050386_1562164 Arabidopsis thaliana AT5g44190/MLN1_11 mRNA,
           complete cds.>gb:AY124819_1580184 Arabidopsis thaliana
           AT5g44190/MLN1_11 mRNA, complete cds.
          Length = 314

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 29/57 (50%), Positives = 39/57 (68%)
 Frame = +3

Query: 381 LASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           +  K ++ WT ELH +FV AV QLG  D+A P  +L +M V+ LT ++V SHLQKYR
Sbjct: 144 IKKKPKVDWTPELHRKFVQAVEQLG-VDKAVPSRILEIMNVKSLTRHNVASHLQKYR 199



>gb:AB005239_1509450 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MLN1.>gb:AB062490_1522126 Arabidopsis thaliana
           mRNA for GPRI2, complete cds.>gb:AY026773_1559035
           Arabidopsis thaliana golden2-like transcription factor
           (GLK2) mRNA, complete cds.>gb:AY028368_1559061
           Arabidopsis thaliana golden2-like protein 2 (GLK2) gene,
           complete cds.
          Length = 386

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 29/57 (50%), Positives = 39/57 (68%)
 Frame = +3

Query: 381 LASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           +  K ++ WT ELH +FV AV QLG  D+A P  +L +M V+ LT ++V SHLQKYR
Sbjct: 144 IKKKPKVDWTPELHRKFVQAVEQLG-VDKAVPSRILEIMNVKSLTRHNVASHLQKYR 199



>pir|T51247|T51247 ARR2 protein [imported] - Arabidopsis
           thaliana>gb:AB016472_1512830 Arabidopsis thaliana gene
           for ARR2 protein, complete cds.>gb:AK175737_1817725
           Arabidopsis thaliana mRNA for hypothetical protein,
           complete cds, clone: RAFL22-28-G07.>gb:AK175959_1817947
           Arabidopsis thaliana mRNA for hypothetical protein,
           complete cds, clone: RAFL22-64-J02.>gb:AK176614_1818602
           Arabidopsis thaliana mRNA for hypothetical protein,
           complete cds, clone: RAFL25-13-O13.
          Length = 664

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 32/59 (54%), Positives = 41/59 (69%)
 Frame = +3

Query: 378 SLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           S   K R+ W+ ELH++FV AV QLG  D+A PK +L +M V GLT  +V SHLQKYR+
Sbjct: 212 SSLKKPRVVWSVELHQQFVAAVNQLG-VDKAVPKKILEMMNVPGLTRENVASHLQKYRI 269



>gb:AY741685_1626384 Physcomitrella patens golden 2-like protein 2
           (Glk2) gene, complete cds.
          Length = 517

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 30/54 (55%), Positives = 39/54 (72%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           K ++ WT ELH RFV AV QLG  ++A P  +L +MGVQ LT +++ SHLQKYR
Sbjct: 226 KAKVDWTPELHRRFVHAVEQLG-VEKAYPSRILELMGVQCLTRHNIASHLQKYR 278



>gb:AY741684_1626383 Physcomitrella patens golden 2-like protein 1
           (Glk1) gene, complete cds.
          Length = 511

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 30/54 (55%), Positives = 39/54 (72%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           K ++ WT ELH RFV AV QLG  ++A P  +L +MGVQ LT +++ SHLQKYR
Sbjct: 222 KAKVDWTPELHRRFVHAVEQLG-VEKAFPSRILELMGVQCLTRHNIASHLQKYR 274



>gb:AC107226_1738402 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0081P02, complete sequence.
          Length = 691

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 31/59 (52%), Positives = 42/59 (71%)
 Frame = +3

Query: 378 SLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           S + K R+ W+ ELH++FV+AV  LG  D+A PK +L +M V GLT  +V SHLQK+RL
Sbjct: 198 STSKKPRVVWSVELHQQFVNAVNHLG-IDKAVPKKILELMNVPGLTRENVASHLQKFRL 255



>gb:AB071695_1522928 Zea mays ZmRR10 mRNA for response regulator 10,
           complete cds.
          Length = 686

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 31/59 (52%), Positives = 42/59 (71%)
 Frame = +3

Query: 378 SLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           S + K R+ W+ ELH++FV+AV  LG  D+A PK +L +M V GLT  +V SHLQK+RL
Sbjct: 197 STSKKPRVVWSVELHQQFVNAVNHLG-IDKAVPKKILELMNVPGLTRENVASHLQKFRL 254



>gb:AF298118_1784085 Zea mays putative transcription factor Golden2
           gene, complete cds.>gb:AF318579_1785613 Zea mays
           putative transcription factor GOLDEN 2 mRNA, complete
           cds.
          Length = 461

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 29/54 (53%), Positives = 37/54 (68%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           K ++ WT ELH RFV AV QLG  D+A P  +L +MG   LT +++ SHLQKYR
Sbjct: 184 KVKVDWTPELHRRFVQAVEQLG-IDKAVPSRILEIMGTDCLTRHNIASHLQKYR 236



>gb:AY088149_1573172 Arabidopsis thaliana clone 41875 mRNA, complete
           sequence.
          Length = 382

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 30/60 (50%), Positives = 43/60 (71%)
 Frame = +3

Query: 375 PSLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           P  + K R+ W+ ELH++FV+AV +LG  D+A PK +L +M V GL+  +V SHLQK+RL
Sbjct: 195 PGNSKKSRVVWSIELHQQFVNAVNKLG-IDKAVPKRILELMNVPGLSRENVASHLQKFRL 253



>pir|G84428|G84428 hypothetical protein At2g01760 [imported] -
           Arabidopsis thaliana>gb:AC006069_1533378 Arabidopsis
           thaliana chromosome 2 clone T8O11 map rga, complete
           sequence.>gb:AY099726_1576751 Arabidopsis thaliana
           putative two-component response regulator protein
           (At2g01760) mRNA, complete cds.>gb:AY128887_1580967
           Arabidopsis thaliana putative two-component response
           regulator protein (At2g01760) mRNA, complete cds.
          Length = 382

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 30/60 (50%), Positives = 43/60 (71%)
 Frame = +3

Query: 375 PSLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           P  + K R+ W+ ELH++FV+AV +LG  D+A PK +L +M V GL+  +V SHLQK+RL
Sbjct: 195 PGNSKKSRVVWSIELHQQFVNAVNKLG-IDKAVPKRILELMNVPGLSRENVASHLQKFRL 253



>gb:AK176489_1818477 Arabidopsis thaliana mRNA for putative ARR1
           protein, complete cds, clone: RAFL24-30-K07.
          Length = 690

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 30/55 (54%), Positives = 40/55 (72%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           K R+ W+ ELH++FV AV QLG  ++A PK +L +M V GLT  +V SHLQKYR+
Sbjct: 237 KPRVVWSVELHQQFVAAVNQLG-VEKAVPKKILELMNVPGLTRENVASHLQKYRI 290



>gb:AY056099_1563437 Arabidopsis thaliana AT3g16857/MUH15_1 mRNA,
           complete cds.
          Length = 690

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 30/55 (54%), Positives = 40/55 (72%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           K R+ W+ ELH++FV AV QLG  ++A PK +L +M V GLT  +V SHLQKYR+
Sbjct: 237 KPRVVWSVELHQQFVAAVNQLG-VEKAVPKKILELMNVPGLTRENVASHLQKYRI 290



>pir|T52074|T52074 response regulator ARR11 [imported] - Arabidopsis
           thaliana>gb:AB041532_1519684 Arabidopsis thaliana ARR11
           mRNA for response regulator 11, complete cds.
          Length = 457

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 30/59 (50%), Positives = 40/59 (67%)
 Frame = +3

Query: 378 SLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           S + K R+ W+ ELH +FV+AV Q+G   +A PK +L +M V  LT  +V SHLQKYRL
Sbjct: 189 SSSKKARVVWSFELHHKFVNAVNQIGCDHKAGPKKILDLMNVPWLTRENVASHLQKYRL 247



>pir|T51246|T51246 ARR1 protein [imported] - Arabidopsis
           thaliana>gb:AB016471_1512829 Arabidopsis thaliana gene
           for ARR1 protein, complete cds.
          Length = 669

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 30/55 (54%), Positives = 40/55 (72%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           K R+ W+ ELH++FV AV QLG  ++A PK +L +M V GLT  +V SHLQKYR+
Sbjct: 237 KPRVVWSVELHQQFVAAVNQLG-VEKAVPKKILELMNVPGLTRENVASHLQKYRI 290



>pir|T52034|T52034 receiver-like protein 3 [imported] - Arabidopsis
           thaliana>gb:ATAJ5194_1543912 Arabidopsis thaliana mRNA
           for receiver-like protein 3.
          Length = 444

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 30/59 (50%), Positives = 40/59 (67%)
 Frame = +3

Query: 378 SLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           S + K R+ W+ ELH +FV+AV Q+G   +A PK +L +M V  LT  +V SHLQKYRL
Sbjct: 189 SSSKKARVVWSFELHHKFVNAVNQIGCDHKAGPKKILDLMNVPWLTRENVASHLQKYRL 247



>pir|C96700|C96700 protein F12A21.15 [imported] - Arabidopsis
           thaliana>gb:AE005173_894393 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC008113_1536529 Genomic sequence for
           Arabidopsis thaliana BAC F12A21 from chromosome I,
           complete sequence.>gb:BT008768_1639964 Arabidopsis
           thaliana At1g67710 gene, complete cds.
          Length = 521

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 30/59 (50%), Positives = 40/59 (67%)
 Frame = +3

Query: 378 SLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           S + K R+ W+ ELH +FV+AV Q+G   +A PK +L +M V  LT  +V SHLQKYRL
Sbjct: 189 SSSKKARVVWSFELHHKFVNAVNQIGCDHKAGPKKILDLMNVPWLTRENVASHLQKYRL 247



>gb:AP003517_1830268 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:OSJNBa0062J02.>gb:AP004008_1836277 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OJ1226_A12.
          Length = 694

 Score = 57.8 bits (138), Expect = 5e-07
 Identities = 31/59 (52%), Positives = 40/59 (67%)
 Frame = +3

Query: 378 SLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           S   +QR+ WT ELH  FV AV +LG  DRA P+ +LR+M V  +T  ++ SHLQKYRL
Sbjct: 182 STLKRQRVVWTPELHRDFVIAVHELG-VDRAVPRKILRMMKVDYMTRENIASHLQKYRL 239



>pir|C84645|C84645 hypothetical protein At2g25180 [imported] -
           Arabidopsis thaliana
          Length = 573

 Score = 57.8 bits (138), Expect = 5e-07
 Identities = 31/55 (56%), Positives = 41/55 (74%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           KQR+ WT ELH++FV AV QLG  ++A PK +L +M V+ LT  +V SHLQK+RL
Sbjct: 195 KQRVVWTVELHKKFVAAVNQLGY-EKAMPKKILDLMNVEKLTRENVASHLQKFRL 248



>sp|O49397|ARRA_ARATH Putative transcription factor ARR10
           (Arabidopsis response regulator 10).>pir|T04653|T04653
           receiver-like protein 4 [imported] - Arabidopsis
           thaliana>gb:ATAJ5195_1543913 Arabidopsis thaliana mRNA
           for receiver-like protein 4.>gb:ATCHRIV76_1547113
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 76.>gb:ATF10N7_1548233 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F10N7 (ESSA
           project).>gb:BT003158_1636739 Arabidopsis thaliana
           At4g31920 mRNA, complete cds.
          Length = 552

 Score = 57.8 bits (138), Expect = 5e-07
 Identities = 30/61 (49%), Positives = 41/61 (67%)
 Frame = +3

Query: 375 PSLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           P+   K R+ WT+ELH +F+ AV  LG  +RA PK +L +M V  LT  +V SHLQK+R+
Sbjct: 178 PTAQKKPRVLWTHELHNKFLAAVDHLG-VERAVPKKILDLMNVDKLTRENVASHLQKFRV 236

Query: 555 A 557
           A
Sbjct: 237 A 237



>gb:AB092509_1525077 Oryza glaberrima Ehd1 gene for B-type response
           regulator, complete cds.
          Length = 341

 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 29/55 (52%), Positives = 37/55 (67%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           K RL WT +LH +F+ AV  LG  D+A PK +L +M V+ LT   V SHLQKYR+
Sbjct: 198 KSRLTWTTQLHRQFIAAVNHLG-EDKAVPKKILGIMKVKHLTREQVASHLQKYRM 251



>gb:AB092508_1525076 Oryza sativa (indica cultivar-group) Ehd1 gene
           for B-type response regulator, complete cds,
           cultivar:Kasalath.
          Length = 341

 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 29/55 (52%), Positives = 37/55 (67%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           K RL WT +LH +F+ AV  LG  D+A PK +L +M V+ LT   V SHLQKYR+
Sbjct: 198 KSRLTWTTQLHRQFIAAVNHLG-EDKAVPKKILGIMKVKHLTREQVASHLQKYRM 251



>gb:AB092506_1525074 Oryza sativa (japonica cultivar-group) Ehd1
           gene for B-type response regulator, complete cds,
           cultivar:Nipponbare.
          Length = 341

 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 29/55 (52%), Positives = 37/55 (67%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           K RL WT +LH +F+ AV  LG  D+A PK +L +M V+ LT   V SHLQKYR+
Sbjct: 198 KSRLTWTTQLHRQFIAAVNHLG-EDKAVPKKILGIMKVKHLTREQVASHLQKYRM 251



>gb:AB062095_1522097 Zea mays ZmRR9 mRNA for response regulator 9,
           complete cds.
          Length = 631

 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 31/59 (52%), Positives = 40/59 (67%)
 Frame = +3

Query: 378 SLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           S   K R+ W+ ELH +FV AV QLG  D+A PK +L +M V+ +T  +V SHLQKYRL
Sbjct: 207 SSQKKPRVVWSVELHRKFVAAVNQLG-IDKAVPKKILDLMNVENITRENVASHLQKYRL 264



>gb:AE016959_1022979 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC027038_1539855
           Oryza sativa chromosome 10 BAC OSJNBa0071K18 genomic
           sequence, complete sequence.>gb:AE017102_1752798 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           56 of 77 of the complete sequence.
          Length = 253

 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 29/55 (52%), Positives = 37/55 (67%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           K RL WT +LH +F+ AV  LG  D+A PK +L +M V+ LT   V SHLQKYR+
Sbjct: 110 KSRLTWTTQLHRQFIAAVNHLG-EDKAVPKKILGIMKVKHLTREQVASHLQKYRM 163



>gb:AP006838_1862972 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, fosmid clone:OSJNOa013M08.
          Length = 586

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 29/58 (50%), Positives = 40/58 (68%), Gaps = 3/58 (5%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKG---VLRVMGVQGLTIYHVKSHLQKYRL 554
           K R+ W+ +LH++FV+AV Q+G     +PKG   +L +M V GLT  +V SHLQKYRL
Sbjct: 192 KARVVWSVDLHQKFVNAVNQIGFDSECSPKGPKKILDLMNVPGLTRENVASHLQKYRL 249



>pir|T48056|T48056 hypothetical protein F26K9.100 - Arabidopsis
           thaliana>gb:ATF26K9_1550114 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F26K9.
          Length = 426

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 30/62 (48%), Positives = 40/62 (64%), Gaps = 4/62 (6%)
 Frame = +3

Query: 378 SLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVM----GVQGLTIYHVKSHLQK 545
           S   K R++WT ELH +F  AV ++G  ++A PK +L+ M     VQGLT  +V SHLQK
Sbjct: 207 SPTKKPRMQWTPELHHKFEVAVEKMGSLEKAFPKTILKYMQEELNVQGLTRNNVASHLQK 266

Query: 546 YR 551
           YR
Sbjct: 267 YR 268



>gb:AP004087_1837524 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1297_C09.
          Length = 626

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 30/59 (50%), Positives = 40/59 (67%)
 Frame = +3

Query: 378 SLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           S   K R+ W+ ELH +FV AV QLG  ++A PK +L +M V+ +T  +V SHLQKYRL
Sbjct: 209 STQKKPRVVWSVELHRKFVAAVNQLG-IEKAVPKKILDLMNVENITRENVASHLQKYRL 266



>gb:AY143963_1583420 Arabidopsis thaliana At4g18020/T6K21_200 mRNA,
           complete cds.>gb:AF385725_1794617 Arabidopsis thaliana
           AT4g18020/T6K21_200 mRNA, complete cds.
          Length = 535

 Score = 55.5 bits (132), Expect = 3e-06
 Identities = 28/55 (50%), Positives = 40/55 (72%)
 Frame = +3

Query: 387 SKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           S++++ WT ELH++FV AV QLG  D+A P  +L +M V  LT ++V SHLQK+R
Sbjct: 295 SRKKVDWTPELHKKFVQAVEQLG-VDQAIPSRILELMKVGTLTRHNVASHLQKFR 348



>gb:AB041531_1519683 Arabidopsis thaliana APRR2 mRNA for
           pseudo-response regulator 2, complete cds.
          Length = 487

 Score = 55.5 bits (132), Expect = 3e-06
 Identities = 28/55 (50%), Positives = 40/55 (72%)
 Frame = +3

Query: 387 SKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           S++++ WT ELH++FV AV QLG  D+A P  +L +M V  LT ++V SHLQK+R
Sbjct: 295 SRKKVDWTPELHKKFVQAVEQLG-VDQAIPSRILELMKVGTLTRHNVASHLQKFR 348



>pir|F96528|F96528 protein F27J15.4 [imported] - Arabidopsis
           thaliana>gb:AE005173_892859 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC016041_1538067 Genomic sequence for
           Arabidopsis thaliana BAC F27J15 from chromosome I,
           complete sequence.
          Length = 612

 Score = 55.5 bits (132), Expect = 3e-06
 Identities = 25/58 (43%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGV---LRVMGVQGLTIYHVKSHLQKYRL 554
           K R+ WT ELH++F++A+  +GG ++A PK +   L+ M ++G+T  +V SHLQK+R+
Sbjct: 420 KPRMTWTEELHQKFLEAIEIIGGIEKANPKVLVECLQEMRIEGITRSNVASHLQKHRI 477



>pir|T48492|T48492 hypothetical protein T28J14.150 - Arabidopsis
           thaliana>gb:ATT28J14_1555602 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T28J14 (ESSA project).
          Length = 621

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 26/57 (45%), Positives = 39/57 (68%)
 Frame = +3

Query: 384 ASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           A K++++WT+ LH+ F+ A+  +G  D+A PK +L  M V  LT  +V SHLQKYR+
Sbjct: 228 AKKKKIQWTDSLHDLFLQAIRHIG-LDKAVPKKILAFMSVPYLTRENVASHLQKYRI 283



>gb:AB092507_1525075 Oryza sativa (japonica cultivar-group) Ehd1
           gene for B-type response regulator, complete cds,
           cultivar:Taichung 65.
          Length = 341

 Score = 54.3 bits (129), Expect = 6e-06
 Identities = 28/55 (50%), Positives = 36/55 (65%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           K RL WT +LH +F+ AV  L   D+A PK +L +M V+ LT   V SHLQKYR+
Sbjct: 198 KSRLTWTTQLHRQFIAAVNHLR-EDKAVPKKILGIMKVKHLTREQVASHLQKYRM 251



>pir|B84449|B84449 hypothetical protein At2g03500 [imported] -
           Arabidopsis thaliana
          Length = 443

 Score = 53.5 bits (127), Expect = 1e-05
 Identities = 27/53 (50%), Positives = 33/53 (62%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKY 548
           K R  W+ +LH RFV A+  LGG   ATPK +  +M V GLT   VKSHLQ +
Sbjct: 233 KARRCWSPDLHRRFVQALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQYF 285



>gb:AP004396_1841131 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0404D10.>gb:AP004459_1841314 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0410E11.
          Length = 62

 Score = 51.2 bits (121), Expect = 5e-05
 Identities = 22/28 (78%), Positives = 25/28 (89%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRAT 473
           K RLRWT +LH+RFVDAVAQLGGPDR +
Sbjct: 34  KPRLRWTADLHDRFVDAVAQLGGPDRCS 61



>pir|D84668|D84668 hypothetical protein At2g27070 [imported] -
           Arabidopsis thaliana>gb:AC005623_1532855 Arabidopsis
           thaliana chromosome 2 clone T20P8 map B68, complete
           sequence.
          Length = 575

 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 25/55 (45%), Positives = 36/55 (65%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           K+++ WTN L + F+ A+  +G  D+  PK +L +M V  LT  +V SHLQKYRL
Sbjct: 225 KKKIWWTNPLQDLFLQAIQHIGY-DKVVPKKILAIMNVPYLTRENVASHLQKYRL 278



>pir|T05088|T05088 hypothetical protein T6K21.200 - Arabidopsis
           thaliana>gb:ATCHRIV47_1545603 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 47.>gb:ATT6K21_1556391
           Arabidopsis thaliana DNA chromosome 4, BAC clone T6K21
           (ESSA project).
          Length = 483

 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 26/52 (50%), Positives = 37/52 (71%)
 Frame = +3

Query: 387 SKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQ 542
           S++++ WT ELH++FV AV QL G D+A P  +L +M V  LT ++V SHLQ
Sbjct: 295 SRKKVDWTPELHKKFVQAVEQL-GVDQAIPSRILELMKVGTLTRHNVASHLQ 345



>gb:AC149488_1745026 Solanum demissum chromosome 11 clone PGEC542
           map MAP_LOC, complete sequence.
          Length = 352

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 24/58 (41%), Positives = 38/58 (65%)
 Frame = +3

Query: 381 LASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           L +K ++ WT+ LH  F++A++ +G  D+A PK +   M V GL+  +V SH QKYR+
Sbjct: 153 LPTKSQIIWTDSLHNTFLEAISNIGF-DKAVPKKIHEHMKVPGLSRENVASHWQKYRI 209



>gb:AY389751_1178358 Hyacinthus orientalis cytokinin response
           regulator 1 protein mRNA, partial cds.
          Length = 254

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 26/55 (47%), Positives = 35/55 (63%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           + RL WT +LH R +  VA LG    A PK ++++   +GLT  +V SHLQKYRL
Sbjct: 140 RPRLVWTPQLHTRLLTWVAHLG-IKTAVPKTIMQLRMSRGLTRENVASHLQKYRL 193



>gb:AP000735_1820580 Arabidopsis thaliana genomic DNA, chromosome 3,
           TAC clone:K13E13.
          Length = 284

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 24/51 (47%), Positives = 31/51 (60%)
 Frame = +3

Query: 399 LRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 551
           L WTN L   F DAV +LGG   ATPK +  ++  +GLT   ++SHLQ  R
Sbjct: 221 LVWTNRLQLVFDDAVVRLGGLFSATPKAINELISEEGLTGDQIRSHLQVLR 271



>gb:AB016872_1512916 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K21P3.
          Length = 292

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 26/55 (47%), Positives = 36/55 (65%)
 Frame = +3

Query: 378 SLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQ 542
           S A K+R+ W  ELH+ F++AV  LG  +RA PK +L VM V  ++  +V SHLQ
Sbjct: 219 SSAKKRRVVWDEELHQNFLNAVDFLG-LERAVPKKILDVMKVDYISRENVASHLQ 272



>gb:AC132483_1741114 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0014C03, complete sequence.
          Length = 368

 Score = 44.7 bits (104), Expect = 0.005
 Identities = 22/42 (52%), Positives = 28/42 (66%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLT 515
           K+R RW  ELHERFV  V QL G D+ATP  +L ++  + LT
Sbjct: 182 KKRFRWPKELHERFVSVVLQL-GVDKATPNQILPLLNREDLT 222



>gb:OSJN00163_1695977 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0020I02, complete sequence.
          Length = 376

 Score = 42.7 bits (99), Expect = 0.018
 Identities = 21/55 (38%), Positives = 33/55 (60%)
 Frame = +3

Query: 390 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           K  L WT  L ++F+ A+  LG    A+PK + ++MGV  +    + +HLQK+RL
Sbjct: 156 KYYLMWTPHLQKKFLHALQILGKD--ASPKNIKKIMGVDNIDCRQIAAHLQKHRL 208



>gb:AC132483_1741113 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0014C03, complete
           sequence.>gb:AC134932_1741961 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBb0092G21,
           complete sequence.
          Length = 620

 Score = 40.4 bits (93), Expect = 0.089
 Identities = 30/101 (29%), Positives = 46/101 (45%), Gaps = 2/101 (1%)
 Frame = +3

Query: 255 PKAVLSSSLVPNKAIVSQQTLDFSASTMEPIXXXXXXXXXPSLASKQRLRWTNELHERFV 434
           P AV +++  P+K   + +  D  ++ +E                + R  WT   H  FV
Sbjct: 227 PPAVAAAAKAPSKKRGASEVSDRGSNNLEATTGRKKV--------RTRFTWTTVSHTSFV 278

Query: 435 DAVAQLGGPDRATPKGVLRVMGVQGL--TIYHVKSHLQKYR 551
            A  QL   D+  PK + ++M + G+  T   V SHLQKYR
Sbjct: 279 RAYEQL--KDQEGPKKIKQLMELDGIFVTKTQVSSHLQKYR 317



>gb:AY822600_1353077 Giardia intestinalis GARP-like protein 2 (glp2)
           gene, complete cds.
          Length = 359

 Score = 37.4 bits (85), Expect = 0.75
 Identities = 25/62 (40%), Positives = 34/62 (54%), Gaps = 2/62 (3%)
 Frame = +3

Query: 387 SKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMG--VQGLTIYHVKSHLQKYRLAK 560
           +  R+ WT E+++ FV A   + G +  TP  +LR M      LT  HV+S LQKYRL  
Sbjct: 219 ASSRIVWTPEMNDLFVRAYNSIIG-EVPTPVRILRFMSPFYPDLTQKHVQSKLQKYRLQN 277

Query: 561 YL 566
            L
Sbjct: 278 KL 279



>gb:AP003225_1825611 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0011G08.
          Length = 290

 Score = 35.4 bits (80), Expect = 2.9
 Identities = 22/60 (36%), Positives = 31/60 (51%)
 Frame = +3

Query: 375 PSLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 554
           P   +K R RW+ E HERF+DA+   G       K +   +G +  T   ++SH QKY L
Sbjct: 9   PYTITKPRERWSEEEHERFLDALIMYG----RDWKKIEEHVGTK--TTIQIRSHAQKYFL 62



>pir|T02684|T02684 MYB-related transcription factor (CCA1)
           [imported] - Arabidopsis thaliana>gb:AC005310_1532487
           Arabidopsis thaliana chromosome 2 clone F19D11 map
           CIC06C03, complete sequence.>gb:ATU28422_1556882
           Arabidopsis thaliana DNA-binding protein CCA1 (CCA1)
           mRNA, complete cds.>gb:ATU79156_1557285 Arabidopsis
           thaliana Myb-related transcription factor CCA1 gene,
           complete cds.>gb:AY519511_1610938 Arabidopsis thaliana
           MYB transcription factor (At2g46830) mRNA, complete cds.
          Length = 608

 Score = 35.4 bits (80), Expect = 2.9
 Identities = 20/58 (34%), Positives = 29/58 (50%)
 Frame = +3

Query: 375 PSLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKY 548
           P   +KQR RWT E H RF++A+   G   +   + V     VQ      ++SH QK+
Sbjct: 17  PYTITKQRERWTEEEHNRFIEALRLYGRAWQKIEEHVATKTAVQ------IRSHAQKF 68



>gb:AB005238_1509435 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MKP11.
          Length = 385

 Score = 34.7 bits (78), Expect = 4.9
 Identities = 20/58 (34%), Positives = 31/58 (53%)
 Frame = +3

Query: 375 PSLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKY 548
           P   +K+R RWT+E H++FV+A+   G   R   + V     VQ      ++SH QK+
Sbjct: 46  PYTITKERERWTDEEHKKFVEALKLYGRAWRRIEEHVGSKTAVQ------IRSHAQKF 97



>gb:SPY347840_189928 Streptococcus pyogenes sfbI gene for
            fibronectin-binding protein I, strain
            NS226.>gb:SPY347841_189929 Streptococcus pyogenes sfbI
            gene for fibronectin-binding protein I, strain NS415.
          Length = 706

 Score = 34.3 bits (77), Expect = 6.4
 Identities = 28/105 (26%), Positives = 45/105 (42%), Gaps = 7/105 (6%)
 Frame = +3

Query: 966  ESFSSHHEPLTPDSGGHETSQIESPTGER--PSKMQKLDSGAALAKPNVMLT-----HPI 1124
            ES      PL P+  G E  ++ S + E   P  M +LD      KP+V L      +  
Sbjct: 385  ESLEPAFPPLMPELDGQEVPEVPSESLEPALPPLMPELDGQEVPEKPSVDLPIEVPRYEF 444

Query: 1125 LESSLSPPSYQQPDTVFLTREHLSHSSGLSIGNEDPREKICSGNM 1259
                 SP + +  +T ++T  + +  + + I  + P E   SGNM
Sbjct: 445  NNKDQSPLAGESGETEYITEVYGNQQNPVDIDKKLPNETGFSGNM 489



>gb:SPY347830_189918 Streptococcus pyogenes sfbI gene for
            fibronectin-binding protein I, strain BSB19.
          Length = 665

 Score = 34.3 bits (77), Expect = 6.4
 Identities = 28/105 (26%), Positives = 45/105 (42%), Gaps = 7/105 (6%)
 Frame = +3

Query: 966  ESFSSHHEPLTPDSGGHETSQIESPTGER--PSKMQKLDSGAALAKPNVMLT-----HPI 1124
            ES      PL P+  G E  ++ S + E   P  M +LD      KP+V L      +  
Sbjct: 379  ESLEPAFPPLMPELDGQEVPEVPSESLEPALPPLMPELDGQEVPEKPSVDLPIEVPRYEF 438

Query: 1125 LESSLSPPSYQQPDTVFLTREHLSHSSGLSIGNEDPREKICSGNM 1259
                 SP + +  +T ++T  + +  + + I  + P E   SGNM
Sbjct: 439  NNKDQSPLAGESGETEYITEVYGNQQNPVDIDKKLPNETGFSGNM 483



>gb:AC151804_1745148 Solanum demissum chromosome 5 BAC PGEC475B22
           genomic sequence, complete sequence.
          Length = 543

 Score = 33.9 bits (76), Expect = 8.3
 Identities = 19/58 (32%), Positives = 30/58 (51%)
 Frame = +3

Query: 375 PSLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKY 548
           P   +KQR +WT E H+RF++A+   G   R   + V     +Q      ++SH QK+
Sbjct: 133 PYTITKQREKWTEEEHQRFLEALKLYGRAWRQIEEYVGSKTAIQ------IRSHAQKF 184



>gb:AY519507_1610934 Arabidopsis thaliana MYB transcription factor
           (At1g01060) mRNA, complete cds.
          Length = 645

 Score = 33.9 bits (76), Expect = 8.3
 Identities = 21/58 (36%), Positives = 33/58 (56%)
 Frame = +3

Query: 375 PSLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKY 548
           P   +KQR RWT + HERF++A+   G   RA  + +   +G +  T   ++SH QK+
Sbjct: 17  PYTITKQRERWTEDEHERFLEALRLYG---RAWQR-IEEHIGTK--TAVQIRSHAQKF 68



>gb:A68428_1450387 Sequence 1 from Patent
           WO9749811.>gb:ATAJ6404_1543922 Arabidopsis thaliana mRNA
           for LATE ELONGATED HYPOCOTYL MYB transcription factor.
          Length = 645

 Score = 33.9 bits (76), Expect = 8.3
 Identities = 21/58 (36%), Positives = 33/58 (56%)
 Frame = +3

Query: 375 PSLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKY 548
           P   +KQR RWT + HERF++A+   G   RA  + +   +G +  T   ++SH QK+
Sbjct: 17  PYTITKQRERWTEDEHERFLEALRLYG---RAWQR-IEEHIGTK--TAVQIRSHAQKF 68



>gb:AE005172_889158 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC007323_1535788 Genomic sequence
           for Arabidopsis thaliana BAC T25K16 from chromosome I,
           complete sequence.
          Length = 656

 Score = 33.9 bits (76), Expect = 8.3
 Identities = 21/58 (36%), Positives = 33/58 (56%)
 Frame = +3

Query: 375 PSLASKQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKY 548
           P   +KQR RWT + HERF++A+   G   RA  + +   +G +  T   ++SH QK+
Sbjct: 17  PYTITKQRERWTEDEHERFLEALRLYG---RAWQR-IEEHIGTK--TAVQIRSHAQKF 68



>gb:SPY347832_189920 Streptococcus pyogenes sfbI gene for
            fibronectin-binding protein I, strain NS539.
          Length = 654

 Score = 33.9 bits (76), Expect = 8.3
 Identities = 28/105 (26%), Positives = 45/105 (42%), Gaps = 7/105 (6%)
 Frame = +3

Query: 966  ESFSSHHEPLTPDSGGHETSQIESPTGER--PSKMQKLDSGAALAKPNVMLT-----HPI 1124
            ES      PL P+  G E  ++ S + E   P  M +LD      KP+V L      +  
Sbjct: 331  ESLEPALPPLMPELDGEEVPEVPSESLEPALPPLMPELDGEEVPEKPSVDLAIEVPRYEF 390

Query: 1125 LESSLSPPSYQQPDTVFLTREHLSHSSGLSIGNEDPREKICSGNM 1259
                 SP + +  +T ++T  + +  + + I  + P E   SGNM
Sbjct: 391  NNKDQSPLAGESGETEYITEVYGNQQNPVDIDKKLPNETGFSGNM 435



>pir|T03547|T03547 probable ferrous iron transport protein b -
           Rhodobacter capsulatus>gb:AF010496_468449 Rhodobacter
           capsulatus strain SB1003, partial genome.
          Length = 626

 Score = 33.9 bits (76), Expect = 8.3
 Identities = 14/23 (60%), Positives = 16/23 (69%)
 Frame = -2

Query: 502 TPMTLKTPFGVALSGPPSCATAS 434
           TPMTL  PF +AL GPP+C   S
Sbjct: 2   TPMTLSDPFRLALVGPPNCGKTS 24


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,432,797,646
Number of Sequences: 1806583
Number of extensions: 30588342
Number of successful extensions: 71303
Number of sequences better than 10.0: 179
Number of HSP's better than 10.0 without gapping: 66821
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 71129
length of database: 581,917,975
effective HSP length: 128
effective length of database: 350,675,351
effective search space used: 118878943989
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)