BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2021
         (985 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP003299_1827631 Oryza sativa (japonica cultivar-group) genom...   112   9e-24   
gb:AC130605_1740821 Oryza sativa (japonica cultivar-group) chrom...   112   1e-23   
gb:AB011475_1511369 Arabidopsis thaliana genomic DNA, chromosome...   107   5e-22   
pir|B86168|B86168 hypothetical protein [imported] - Arabidopsis ...   106   6e-22   Arabidopsis thaliana [mouse-ear cress]
gb:BX883042_2111383 Rattus norvegicus chromosome 20, major histo...    72   2e-11   
gb:BC082771_2108440 Mus musculus ring finger protein 1, mRNA (cD...    72   2e-11   
gb:AF100956_2054530 Mus musculus major histocompatibility locus ...    72   2e-11   
gb:MMU421778_2039431 Macaca mulatta znfl gene (partial), sacm2L ...    72   2e-11   
gb:HS1033B10_1996561 Human DNA sequence from clone RP5-1033B10 o...    72   2e-11   
gb:AL844527_1933050 Human DNA sequence from clone DAQB-314F24 on...    72   2e-11   
gb:AL645940_1931364 Human DNA sequence from clone XXbac-157A10 o...    72   2e-11   
gb:AJ630366_1422770 Canis familiaris MHC class II region on chro...    72   2e-11   
gb:AJ630366_1422769 Canis familiaris MHC class II region on chro...    72   2e-11   
sp|Q06587|RNG1_HUMAN|RNG1_HUMAN Polycomb complex protein RING1 (RNF1).>pir|...    72   2e-11   Homo sapiens [man]
gb:BC081039_2561947 Xenopus laevis MGC81738 protein, mRNA (cDNA ...    70   5e-11   
gb:BC067955_2554939 Xenopus tropicalis hypothetical protein MGC6...    70   5e-11   
gb:BC046935_2549803 Xenopus laevis similar to ring finger protei...    70   5e-11   
gb:BC044472_2548776 Danio rerio ring finger protein 2, mRNA (cDN...    70   5e-11   
gb:AY576996_2538240 Danio rerio clone RK125A1A09 ring finger pro...    70   5e-11   
gb:AF196346_2479494 Danio rerio Ring finger protein 1b (ring1b) ...    70   5e-11   
gb:MMY12880_2124444 Mus musculus mRNA for polycomb-M33 interacti...    70   5e-11   
gb:HSG120K12_2013315 Human DNA sequence from clone GS1-120K12 on...    70   5e-11   
gb:AF141327_1885879 Homo sapiens ring finger protein BAP-1 mRNA,...    70   5e-11   
gb:CR859392_1183510 Pongo pygmaeus mRNA; cDNA DKFZp469E2020 (fro...    70   5e-11   
gb:AK090066_1176126 Mus musculus B lymphocyte B cells CRL-1702 W...    70   5e-11   
gb:AK012358_1156912 Mus musculus 11 days embryo whole body cDNA,...    70   5e-11   
gb:DMDRING_1378669 Drosophila melanogaster mRNA for DRING protein.     70   6e-11   
gb:AE014297_1141757 Drosophila melanogaster chromosome 3R, compl...    70   6e-11   
gb:BC009070_2090779 Mus musculus ring finger protein 1, mRNA (cD...    69   1e-10   
gb:BC085530_2564433 Danio rerio zgc:103481, mRNA (cDNA clone MGC...    49   2e-04   
gb:AY081328_1568674 Arabidopsis thaliana unknown protein (At4g21...    49   2e-04   
gb:ATF7J7_1550958 Arabidopsis thaliana DNA chromosome 4, BAC clo...    49   2e-04   
pir|T04938|T04938 hypothetical protein F7J7.10 - Arabidopsis tha...    49   2e-04   Arabidopsis thaliana [mouse-ear cress]
pir|T10649|T10649 hypothetical protein T13K14.230 - Arabidopsis ...    49   2e-04   Arabidopsis thaliana [mouse-ear cress]
pir|A85240|A85240 hypothetical protein AT4g21070 [imported] - Ar...    49   2e-04   Arabidopsis thaliana [mouse-ear cress]
gb:BC077164_2559882 Danio rerio zgc:91888, mRNA (cDNA clone MGC:...    49   2e-04   
gb:AC108873_1738586 Oryza sativa (japonica cultivar-group) chrom...    45   0.003   
gb:U39653_1403016 Caenorhabditis elegans cosmid T13H2, complete ...    44   0.004   
pir|T16870|T16870 hypothetical protein T13H2.3 - Caenorhabditis ...    44   0.004   Caenorhabditis elegans [roundworm]
gb:AE017347_1757682 Cryptococcus neoformans var. neoformans JEC2...    42   0.019   
gb:AY662590_2542580 Phrynosoma mcallii recombination activating ...    41   0.032   
gb:BC047945_1984070 Homo sapiens ring finger protein 36, mRNA (c...    41   0.041   
gb:AX969481_1484790 Sequence 284 from Patent EP1104808.                41   0.041   
gb:AF502391_1277433 Heterodera glycines putative gland protein G...    41   0.041   
gb:AY305385_1177707 Homo sapiens HSD-34 mRNA, complete cds.            41   0.041   
gb:BC070792_2555761 Xenopus laevis ring finger protein (C3HC4 ty...    40   0.054   
pir|T41364|T41364 hypothetical protein SPCC4G3.12c - fission yea...    40   0.054   Schizosaccharomyces pombe
gb:AY662643_2542633 Cordylus polyzonus recombination activating ...    40   0.070   
gb:AE017347_1757678 Cryptococcus neoformans var. neoformans JEC2...    40   0.070   
gb:AY294955_2081734 Mesocricetus auratus recombination activatin...    40   0.092   
gb:AF274046_2061190 Mus musculus nuclear zinc finger protein Np9...    40   0.092   
gb:AK025578_1910333 Homo sapiens cDNA: FLJ21925 fis, clone HEP04...    40   0.092   
gb:AF274048_1894211 Homo sapiens nuclear zinc finger protein Np9...    40   0.092   
gb:AX063422_1458763 Sequence 7 from Patent WO0078949.                  40   0.092   
gb:AX063416_1458760 Sequence 1 from Patent WO0078949.>gb:AF12950...    40   0.092   
gb:AK075819_1171033 Mus musculus adult male small intestine cDNA...    40   0.092   
gb:BC046256_2549602 Xenopus laevis ring finger protein (C3HC4 ty...    39   0.12    
gb:AY662644_2542634 Zonosaurus sp. TMT-2004b recombination activ...    39   0.12    
gb:AY662599_2542589 Basiliscus plumifrons recombination activati...    39   0.12    
gb:AY662596_2542586 Uracentron flaviceps recombination activatin...    39   0.12    
gb:AY662591_2542581 Sauromalus ater recombination activating gen...    39   0.12    
gb:AY662589_2542579 Anolis paternus recombination activating gen...    39   0.12    
gb:BC022167_2093774 Mus musculus ubiquitin-like, containing PHD ...    39   0.12    
gb:AY249876_1427999 Tupaia tana recombination activating protein...    39   0.12    
gb:AY662642_2542632 Xantusia vigilis recombination activating ge...    39   0.16    
gb:AY662598_2542588 Leiocephalus carinatus recombination activat...    39   0.16    
gb:AY662597_2542587 Stenocercus crassicaudatus recombination act...    39   0.16    
gb:AY662593_2542583 Enyalioides laticeps recombination activatin...    39   0.16    
gb:AY662592_2542582 Hoplocercus spinosus recombination activatin...    39   0.16    
gb:AY648713_2541541 Danio rerio NP95 mRNA, complete cds.               39   0.16    
gb:AF355273_2489086 Gallus gallus breast and ovarian cancer susc...    39   0.16    
gb:AY589041_1957235 Macaca mulatta breast cancer type 1 (BRCA1) ...    39   0.16    
gb:CAC20C1_1644753 C.albicans cosmid Ca20C1.                           39   0.16    
gb:AY312278_1428790 Bos taurus Ro52/SS-A autoantigen mRNA, compl...    39   0.16    
gb:AY239184_1427658 Equus grevyi recombination activating protei...    39   0.16    
gb:AY321334_1177780 Rattus norvegicus Ac2-121 mRNA, complete cds.      39   0.16    
sp|Q95153|BRC1_CANFA|BRC1_CANFA Breast cancer type 1 susceptibility protein...    39   0.16    Canis lupus familiaris [dogs]
gb:BC089632_2566182 Xenopus tropicalis cDNA clone MGC:107803 IMA...    39   0.20    
gb:BC058055_2552244 Danio rerio ubiquitin-like, containing PHD a...    39   0.20    
gb:AY662600_2542590 Gambelia wislizenii recombination activating...    39   0.20    
gb:AY662594_2542584 Phymaturus somuncurensis recombination activ...    39   0.20    
gb:AY662588_2542578 Uromastyx acanthinura recombination activati...    39   0.20    
gb:AY662583_2542573 Hydrosaurus sp. TMT-2004a recombination acti...    39   0.20    
gb:AY662582_2542572 Physignathus cocincinus recombination activa...    39   0.20    
gb:AY662581_2542571 Physignathus lesueurii recombination activat...    39   0.20    
gb:AP005196_1849269 Oryza sativa (japonica cultivar-group) genom...    39   0.20    
gb:CR382131_1664644 Yarrowia lipolytica chromosome E of strain C...    39   0.20    
gb:AY249881_1428001 Ochotona princeps recombination activating p...    39   0.20    
gb:BC071534_2556270 Danio rerio zgc:86917, mRNA (cDNA clone MGC:...    38   0.27    
gb:AY662627_2542617 Crenadactylus ocellatus recombination activa...    38   0.27    
gb:AY662622_2542612 Eublepharis turcmenicus recombination activa...    38   0.27    
gb:AY662608_2542598 Varanus griseus recombination activating gen...    38   0.27    
gb:AY662605_2542595 Anniella pulchra recombination activating ge...    38   0.27    
gb:AY621088_2540693 Danio rerio RNF141 protein mRNA, partial cds.      38   0.27    
gb:AY428536_2532323 Tetraodon nigroviridis breast cancer 1 (BRCA...    38   0.27    
gb:BT007862_2150794 Synthetic construct Homo sapiens STRIN prote...    38   0.27    
gb:AY241496_2080441 Protoxerus stangeri RAG1 protein (RAG1) gene...    38   0.27    
gb:AY241464_2080409 Microtus irene RAG1 protein (RAG1) gene, par...    38   0.27    
gb:BC018107_1976414 Homo sapiens ring finger protein 138, transc...    38   0.27    
gb:AF162680_1887102 Homo sapiens HSD-4 protein (HSD-4) mRNA, com...    38   0.27    
gb:AE017349_1758747 Cryptococcus neoformans var. neoformans JEC2...    38   0.27    
gb:AY249882_1428002 Amblysomus hottentotus recombination activat...    38   0.27    
gb:AY662630_2542620 Ctenotus robustus recombination activating g...    38   0.35    
gb:AY662625_2542615 Gekko gecko recombination activating gene 1 ...    38   0.35    
gb:AY662618_2542608 Rhineura floridana recombination activating ...    38   0.35    
gb:AY662617_2542607 Trogonophis wiegmanni recombination activati...    38   0.35    
gb:AY662607_2542597 Xenosaurus grandis recombination activating ...    38   0.35    
gb:AY662586_2542576 Phrynocephalus raddei recombination activati...    38   0.35    
gb:AY662576_2542566 Sphenodon punctatus recombination activating...    38   0.35    
gb:AF022391_2180250 Feline herpesvirus 1 immediate early protein...    38   0.35    
gb:RNU60523_2137527 Rattus norvegicus Brca1 mRNA, partial cds.>g...    38   0.35    
gb:AY294953_2081732 Ondatra zibethicus recombination activating ...    38   0.35    
gb:HSU64805_2025481 Homo sapiens Brca1-delta11b (Brca1) mRNA, co...    38   0.35    
gb:BC085615_1989924 Homo sapiens breast cancer 1, early onset, m...    38   0.35    
gb:BC072418_1988987 Homo sapiens breast cancer 1, early onset, m...    38   0.35    
gb:BA000041_1966283 Pan troglodytes DNA, major histocompatibilit...    38   0.35    
gb:AY751490_1961698 Homo sapiens breast and ovarian cancer susce...    38   0.35    
gb:AY589042_1957236 Gorilla gorilla breast cancer type 1 (BRCA1)...    38   0.35    
gb:AY589040_1957234 Pongo pygmaeus breast cancer type 1 (BRCA1) ...    38   0.35    
gb:AY365046_1948079 Pan troglodytes BRCA1 (BRCA1) gene, complete...    38   0.35    
gb:AY354539_1946931 Homo sapiens IRIS mRNA, complete cds; altern...    38   0.35    
gb:AL845439_1933148 Human DNA sequence from clone DAQB-215D11 on...    38   0.35    
gb:AL845439_1933147 Human DNA sequence from clone DAQB-215D11 on...    38   0.35    
gb:AL845439_1933146 Human DNA sequence from clone DAQB-215D11 on...    38   0.35    
gb:AL671859_1932237 Human DNA sequence from clone XXbac-218N7 on...    38   0.35    
gb:AL669914_1932060 Human DNA sequence from clone XXbac-250I8 on...    38   0.35    
gb:AL669914_1932059 Human DNA sequence from clone XXbac-250I8 on...    38   0.35    
gb:AF238317_1892407 Homo sapiens HZFw3 protein mRNA, complete cds.     38   0.35    
gb:AF238316_1892406 Homo sapiens HZFw2 protein mRNA, complete cds.     38   0.35    
gb:AF238315_1892405 Homo sapiens HZFw1 protein mRNA, complete cds.     38   0.35    
gb:AF207822_1889989 Pan troglodytes BRCA1 (BRCA1) mRNA, partial ...    38   0.35    
gb:AB128049_1873990 Macaca mulatta genes, MHC class I region, pa...    38   0.35    
gb:AB088087_1872099 Homo sapiens HCGVII, HTEX4,HTEX6A, HCGV, HZF...    38   0.35    
gb:AY085755_1570822 Arabidopsis thaliana clone 17759 mRNA, compl...    38   0.35    
gb:AY249872_1427996 Scalopus aquaticus recombination activating ...    38   0.35    
gb:AY077732_1424730 Bos taurus breast and ovarian cancer suscept...    38   0.35    
gb:AF479649_1420917 Bos taurus breast and ovarian cancer suscept...    38   0.35    
gb:AF479648_1420916 Bos taurus breast and ovarian cancer suscept...    38   0.35    
gb:CR858870_1183014 Pongo pygmaeus mRNA; cDNA DKFZp469H0810 (fro...    38   0.35    
pir|D96594|D96594 unknown protein, 71207-66119 [imported] - Arab...    38   0.35    Arabidopsis thaliana [mouse-ear cress]
sp|O54952|BRC1_RAT|BRC1_RAT Breast cancer type 1 susceptibility protein h...    38   0.35    Rattus norvegicus [brown rat]
sp|Q9GKK8|BRC1_PANTR|BRC1_PANTR Breast cancer type 1 susceptibility protein...    38   0.35    Pan troglodytes
sp|P38398|BRC1_HUMAN|BRC1_HUMAN Breast cancer type 1 susceptibility protein...    38   0.35    Homo sapiens [man]
gb:AY662645_2542635 Dibamus sp. TMT-2004c recombination activati...    37   0.46    
gb:AY662629_2542619 Euprepis auratus recombination activating ge...    37   0.46    
gb:AY662628_2542618 Lialis jicari recombination activating gene ...    37   0.46    
gb:AY662620_2542610 Aspidoscelis tigris recombination activating...    37   0.46    
gb:AY662613_2542603 Cylindrophis ruffus recombination activating...    37   0.46    
gb:AY662611_2542601 Dinodon sp. TMT-2004a recombination activati...    37   0.46    
gb:AY662609_2542599 Lanthanotus borneensis recombination activat...    37   0.46    
gb:AY662606_2542596 Heloderma suspectum recombination activating...    37   0.46    
gb:AY662604_2542594 Celestus enneagrammus recombination activati...    37   0.46    
gb:AY662603_2542593 Elgaria panamintina recombination activating...    37   0.46    
gb:AY662602_2542592 Ophisaurus attenuatus recombination activati...    37   0.46    
gb:AY662584_2542574 Calotes calotes recombination activating gen...    37   0.46    
gb:AY662580_2542570 Ctenophorus salinarum recombination activati...    37   0.46    
gb:AY228782_2520927 Chionis minor recombination activating prote...    37   0.46    
gb:BT008042_2150974 Synthetic construct Homo sapiens C3HC4-like ...    37   0.46    
gb:AY621087_2086904 Rattus norvegicus RNF141 protein mRNA, compl...    37   0.46    
gb:AJ421479_2068272 Mus musculus X-inactivation center region; s...    37   0.46    
gb:AF214680_1890389 Homo sapiens C3HC4-like zinc finger protein ...    37   0.46    
gb:AY249883_1428003 Tenrec ecaudatus recombination activating pr...    37   0.46    
gb:AY239186_1427660 Tapirus indicus recombination activating pro...    37   0.46    
gb:AY239179_1427653 Lagenorhynchus obscurus recombination activa...    37   0.46    
gb:CR860107_1184197 Pongo pygmaeus mRNA; cDNA DKFZp459N103 (from...    37   0.46    
gb:AK015505_1158408 Mus musculus adult male testis cDNA, RIKEN f...    37   0.46    
gb:AK011839_1156620 Mus musculus 10 days embryo whole body cDNA,...    37   0.46    
gb:AK006791_1153719 Mus musculus adult male testis cDNA, RIKEN f...    37   0.46    
pir|JC7972|JC7972 spermatogenesis-related ring finger protein, Z...    37   0.46    Mus musculus [mouse]
gb:AY687907_2544158 Chelonia mydas recombination activating gene...    37   0.60    
gb:AY662640_2542630 Typhlosaurus gariepensis recombination activ...    37   0.60    
gb:AY662639_2542629 Acontias meleagris recombination activating ...    37   0.60    
gb:AY662638_2542628 Chalcides ocellatus recombination activating...    37   0.60    
gb:AY662637_2542627 Feylinia polylepis recombination activating ...    37   0.60    
gb:AY662635_2542625 Scelotes anguina recombination activating ge...    37   0.60    
gb:AY662626_2542616 Pseudothecadactylus lindneri recombination a...    37   0.60    
gb:AY662624_2542614 Teratoscincus przewalskii recombination acti...    37   0.60    
gb:AY662621_2542611 Leposoma parietale recombination activating ...    37   0.60    
gb:AY662615_2542605 Eremias sp. TMT-2004a recombination activati...    37   0.60    
gb:AY662610_2542600 Shinisaurus crocodilurus recombination activ...    37   0.60    
gb:AY294957_2081736 Peromyscus leucopus recombination activating...    37   0.60    
gb:AY294945_2081724 Mastomys hildebrandtii recombination activat...    37   0.60    
gb:AY294944_2081723 Rhynchomys isarogensis recombination activat...    37   0.60    
gb:AY294943_2081722 Chrotomys gonzalesi recombination activating...    37   0.60    
gb:AY294940_2081719 Rhabdomys pumilio recombination activating g...    37   0.60    
gb:AY294939_2081718 Parotomys sp. H656 recombination activating ...    37   0.60    
gb:AY241499_2080444 Paraxerus ochraceus RAG1 protein (RAG1) gene...    37   0.60    
gb:AY241474_2080419 Tamiasciurus hudsonicus RAG1 protein (RAG1) ...    37   0.60    
gb:AY241461_2080406 Batomys granti RAG1 protein (RAG1) gene, par...    37   0.60    
gb:AF315468_2062620 Rattus norvegicus RSD-4 mRNA, complete cds.>...    37   0.60    
gb:AB025011_2044350 Mus musculus mRNA for Trif-d, complete cds.        37   0.60    
gb:AB025010_2044349 Mus musculus mRNA for Trif, complete cds.>gb...    37   0.60    
gb:AY239185_1427659 Diceros bicornis recombination activating pr...    37   0.60    
gb:AY239177_1427651 Ovis canadensis recombination activating pro...    37   0.60    
gb:AK013419_1157508 Mus musculus 10, 11 days embryo whole body c...    37   0.60    
gb:AK004238_1152284 Mus musculus 18-day embryo whole body cDNA, ...    37   0.60    
gb:AY662634_2542624 Eumeces anthracinus recombination activating...    37   0.78    
gb:AY662632_2542622 Eumeces inexpectatus recombination activatin...    37   0.78    
gb:AY662623_2542613 Sphaerodactylus shrevei recombination activa...    37   0.78    
gb:AY662616_2542606 Bipes biporus recombination activating gene ...    37   0.78    
gb:AY662595_2542585 Liolaemus pictus recombination activating ge...    37   0.78    
gb:AY662585_2542575 Japalura tricarinata recombination activatin...    37   0.78    
gb:AY662578_2542568 Chamaeleo rudis recombination activating gen...    37   0.78    
gb:AY524961_2536222 Rhampholeon nchisiensis isolate 8 recombinat...    37   0.78    
gb:AY524957_2536218 Rhampholeon nchisiensis isolate 13 recombina...    37   0.78    
gb:AY524956_2536217 Rhampholeon chapmanorum isolate 9 recombinat...    37   0.78    
gb:AY524955_2536216 Rhampholeon platyceps isolate 14 recombinati...    37   0.78    
gb:AY524954_2536215 Rhampholeon platyceps isolate 11 recombinati...    37   0.78    
gb:AY524953_2536214 Rhampholeon boulengeri isolate 25 recombinat...    37   0.78    
gb:AY524952_2536213 Rhampholeon moyeri isolate 29 recombination ...    37   0.78    
gb:AY524951_2536212 Rhampholeon moyeri isolate 28 recombination ...    37   0.78    
gb:AY443332_2532946 Sitta carolinensis recombination activating ...    37   0.78    
gb:AY443310_2532924 Pachycephala hyperthra recombination activat...    37   0.78    
gb:AY057030_2510168 Sitta pygmaea recombination activating prote...    37   0.78    
gb:AY509253_2354457 Ostreid herpesvirus 1, complete genome.>gb:A...    37   0.78    
gb:AB042275_2161697 Canine herpesvirus CICP0 gene for infected c...    37   0.78    
gb:AY294958_2081737 Reithrodontomys fulvescens recombination act...    37   0.78    
gb:AY294951_2081730 Acomys ignitus recombination activating gene...    37   0.78    
gb:AY294949_2081728 Tatera robusta recombination activating gene...    37   0.78    
gb:AY294947_2081726 Meriones shawi recombination activating gene...    37   0.78    
gb:AY294946_2081725 Arvicanthis somalicus recombination activati...    37   0.78    
gb:AY294942_2081721 Apomys hylocoetes recombination activating g...    37   0.78    
gb:AY294936_2081715 Cricetomys gambianus recombination activatin...    37   0.78    
gb:AY294934_2081713 Graphiurus murinus recombination activating ...    37   0.78    
gb:AY241493_2080438 Marmota sibirica RAG1 protein (RAG1) gene, p...    37   0.78    
gb:AY241489_2080434 Tamias sibiricus RAG1 protein (RAG1) gene, p...    37   0.78    
gb:AY241488_2080433 Sciurotamias davidianus RAG1 protein (RAG1) ...    37   0.78    
gb:AY241487_2080432 Spermophilopsis leptodactylus RAG1 protein (...    37   0.78    
gb:AY241483_2080428 Sundasciurus philippinensis RAG1 protein (RA...    37   0.78    
gb:AY241482_2080427 Dremomys pernyi RAG1 protein (RAG1) gene, pa...    37   0.78    
gb:AY241480_2080425 Callosciurus prevostii RAG1 protein (RAG1) g...    37   0.78    
gb:AY241479_2080424 Callosciurus erythraeus RAG1 protein (RAG1) ...    37   0.78    
gb:AY241478_2080423 Microsciurus flaviventer RAG1 protein (RAG1)...    37   0.78    
gb:AY241476_2080421 Sciurus stramineus RAG1 protein (RAG1) gene,...    37   0.78    
gb:AY241468_2080413 Aplodontia rufa RAG1 protein (RAG1) gene, pa...    37   0.78    
gb:AY241462_2080407 Mus musculus RAG1 protein (RAG1) gene, parti...    37   0.78    
gb:AY241460_2080405 Deomys ferrugineus RAG1 protein (RAG1) gene,...    37   0.78    
gb:AY241459_2080404 Beamys hindei RAG1 protein (RAG1) gene, part...    37   0.78    
gb:AP004460_1841337 Oryza sativa (japonica cultivar-group) genom...    37   0.78    
gb:AY249868_1427992 Myotis velifer recombination activating prot...    37   0.78    
gb:AY239194_1427668 Trichechus manatus recombination activating ...    37   0.78    
gb:AY239193_1427667 Dugong dugon recombination activating protei...    37   0.78    
gb:CR382398_1374863 Plasmodium falciparum chromosome 6, complete...    37   0.78    
gb:AK006700_1153685 Mus musculus adult male testis cDNA, RIKEN f...    37   0.78    
pir|B33754|B33754 recombination-activating protein 1 - mouse           37   0.78    Mus musculus [mouse]
sp|P15919|RAG1_MOUSE|RAG1_MOUSE V(D)J recombination activating protein 1 (R...    37   0.78    Mus musculus [mouse]
gb:PWA010258_2578601 Pleurodeles waltl rag1 gene for V(D)J recom...    36   1.0     
gb:BC053149_2550541 Danio rerio protein inhibitor of activated S...    36   1.0     
gb:BC044430_2548737 Danio rerio zgc:55577, mRNA (cDNA clone MGC:...    36   1.0     
gb:AY524950_2536211 Rhampholeon gorongosae isolate 19 recombinat...    36   1.0     
gb:AY524948_2536209 Rhampholeon marshalli isolate 26 recombinati...    36   1.0     
gb:AY524947_2536208 Rhampholeon marshalli isolate 15 recombinati...    36   1.0     
gb:AY524946_2536207 Rhampholeon marshalli isolate 10 recombinati...    36   1.0     
gb:AY454396_2533412 Hippoglossus hippoglossus recombination acti...    36   1.0     
gb:AY423858_2532141 Ictalurus punctatus recombination activating...    36   1.0     
gb:AY319982_2526711 Eremopterix australis recombination activati...    36   1.0     
gb:AJ719510_2501697 Gallus gallus mRNA for hypothetical protein,...    36   1.0     
gb:AF170726_2207955 Myxoma virus strain Lausanne, complete genome.     36   1.0     
gb:AF170722_2207787 Rabbit fibroma virus, complete genome.>gb:RB...    36   1.0     
gb:BC010580_2091021 Mus musculus tripartite motif protein 21, mR...    36   1.0     
gb:AY294961_2081740 Rhipidomys mastacalis recombination activati...    36   1.0     
gb:AY294960_2081739 Akodon boliviensis recombination activating ...    36   1.0     
gb:AY294959_2081738 Neotoma floridana recombination activating g...    36   1.0     
gb:AY294956_2081735 Cricetulus migratorius recombination activat...    36   1.0     
gb:AY294938_2081717 Rattus norvegicus recombination activating g...    36   1.0     
gb:AY241495_2080440 Heliosciurus undulatus RAG1 protein (RAG1) g...    36   1.0     
gb:AY241491_2080436 Tamias ruficaudus RAG1 protein (RAG1) gene, ...    36   1.0     
gb:AY241490_2080435 Tamias amoenus RAG1 protein (RAG1) gene, par...    36   1.0     
gb:AY241485_2080430 Xerus inauris RAG1 protein (RAG1) gene, part...    36   1.0     
gb:AY241481_2080426 Tamiops swinhoei RAG1 protein (RAG1) gene, p...    36   1.0     
gb:AY241472_2080417 Glaucomys volans RAG1 protein (RAG1) gene, p...    36   1.0     
gb:AY241466_2080411 Phyllotis xanthopygus chilensis RAG1 protein...    36   1.0     
gb:AY241465_2080410 Sigmodon hispidus RAG1 protein (RAG1) gene, ...    36   1.0     
gb:AB070897_2047414 Rattus norvegicus Rnf39 mRNA for ring finger...    36   1.0     
gb:BC037344_1982183 Homo sapiens recombination activating gene 1...    36   1.0     
gb:AY742713_1961603 Homo sapiens Sjogren syndrome antigen A1 mRN...    36   1.0     
gb:AF391283_1900536 Homo sapiens 11p15.5 clone LOH11A, partial s...    36   1.0     
gb:AY085998_1571059 Arabidopsis thaliana clone 205719 mRNA, comp...    36   1.0     
gb:MDU51897_1440959 Monodelphis domestica recombination-activati...    36   1.0     
gb:AY249874_1427998 Uropsilus soricipes recombination activating...    36   1.0     
gb:AY249873_1427997 Talpa europaea recombination activating prot...    36   1.0     
gb:AY249871_1427995 Erinaceus europaeus recombination activating...    36   1.0     
gb:AY249870_1427994 Nyctimene albiventer recombination activatin...    36   1.0     
gb:AY249869_1427993 Rhinolophus creaghi recombination activating...    36   1.0     
gb:AY249867_1427991 Manis pentadactyla recombination activating ...    36   1.0     
gb:AY239181_1427655 Hexaprotodon liberiensis recombination activ...    36   1.0     
gb:AY239180_1427654 Balaenoptera physalus recombination activati...    36   1.0     
gb:CEC36A4_1361027 Caenorhabditis elegans cosmid C36A4, complete...    36   1.0     
gb:AE014297_1138092 Drosophila melanogaster chromosome 3R, compl...    36   1.0     
gb:AE014297_1138091 Drosophila melanogaster chromosome 3R, compl...    36   1.0     
gb:AE013599_1131589 Drosophila melanogaster chromosome 2R, compl...    36   1.0     
gb:AE016959_1022993 Oryza sativa (japonica cultivar-group) chrom...    36   1.0     
pir|T19770|T19770 hypothetical protein C36A4.8 - Caenorhabditis ...    36   1.0     
pir|JE0343|JE0343 terf protein - rat                                   36   1.0     
sp|Q9WV59|TM17_RAT|TM17_RAT Tripartite motif protein 17 (Testis RING fing...    36   1.0     
sp|Q7TPM3|TM17_MOUSE|TM17_MOUSE Tripartite motif protein 17.>gb:BC055112_21...    36   1.0     
sp|Q62191|RO52_MOUSE|RO52_MOUSE 52 kDa Ro protein (Sjogren syndrome type A ...    36   1.0     
sp|P19474|RO52_HUMAN|RO52_HUMAN 52 kDa Ro protein (Sjogren syndrome type A ...    36   1.0     
sp|P15918|RAG1_HUMAN|RAG1_HUMAN V(D)J recombination activating protein 1 (R...    36   1.0     
sp|P35820|PSC_DROME|PSC_DROME Posterior sex combs protein.>pir|S17983|S179...    36   1.0     
gb:AY662619_2542609 Amphisbaena xera recombination activating ge...    36   1.3     
gb:AY662614_2542604 Gloydius halys recombination activating gene...    36   1.3     
gb:AY662612_2542602 Ramphotyphlops braminus recombination activa...    36   1.3     
gb:AY662587_2542577 Leiolepis belliana recombination activating ...    36   1.3     
gb:AY662579_2542569 Calumma brevicornis recombination activating...    36   1.3     
gb:AY662577_2542567 Brookesia thieli recombination activating ge...    36   1.3     
gb:AY524964_2536225 Rhampholeon brevicaudatus isolate 5 recombin...    36   1.3     
gb:AY524963_2536224 Rhampholeon brevicaudatus isolate 4 recombin...    36   1.3     
gb:AY524962_2536223 Rhampholeon brevicaudatus isolate 7 recombin...    36   1.3     
gb:AY443339_2532953 Yuhina zantholeuca recombination activating ...    36   1.3     
gb:AY443328_2532942 Remiz pendulinus recombination activating pr...    36   1.3     
gb:AY443321_2532935 Pomatostomus halli recombination activating ...    36   1.3     
gb:AY443317_2532931 Creadion carunculatus recombination activati...    36   1.3     
gb:AY443315_2532929 Peneothello bimaculatus recombination activa...    36   1.3     
gb:AY443309_2532923 Orthonyx temminckii recombination activating...    36   1.3     
gb:AY443301_2532915 Microeca papuana recombination activating pr...    36   1.3     
gb:AY443300_2532914 Melanodryas cucullata recombination activati...    36   1.3     
gb:AY443299_2532913 Melanocharis versteri recombination activati...    36   1.3     
gb:AY443287_2532901 Falcunculus frontatus recombination activati...    36   1.3     
gb:AY443273_2532887 Corcorax melanorhamphos recombination activa...    36   1.3     
gb:AY319996_2526725 Phyllastrephus zosterops recombination activ...    36   1.3     
gb:AY307202_2526228 Oenanthe deserti recombination-activating pr...    36   1.3     
gb:AY307186_2526212 Cinclus pallasii recombination-activating pr...    36   1.3     
gb:AY307182_2526208 Aplonis panayensis recombination-activating ...    36   1.3     
gb:AY057037_2510175 Tregellasia leucops recombination activating...    36   1.3     
gb:AY057036_2510174 Toxorhamphus novaeguineae recombination acti...    36   1.3     
gb:AY057028_2510166 Regulus calendula recombination activating p...    36   1.3     
gb:AY057010_2510148 Oedistoma iliolophum recombination activatin...    36   1.3     
gb:AY057002_2510140 Melanocharis nigra recombination activating ...    36   1.3     
gb:AY057000_2510138 Lanius ludovicianus recombination activating...    36   1.3     
gb:AY056997_2510135 Hirundo pyrrhonota recombination activating ...    36   1.3     
gb:AY056985_2510123 Cinclus cinclus recombination activating pro...    36   1.3     
gb:BC020102_2093265 Mus musculus tripartite motif protein 11, mR...    36   1.3     
gb:AY294950_2081729 Lophuromys flavopunctatus recombination acti...    36   1.3     
gb:AY249879_2080744 Hystrix africaeaustralis recombination activ...    36   1.3     
gb:AY249878_2080743 Dolichotis patagonum recombination activatin...    36   1.3     
gb:AY241458_2080403 Dendromus mesomelas RAG1 protein (RAG1) gene...    36   1.3     
gb:BT001981_1635584 Arabidopsis thaliana expressed protein (At1g...    36   1.3     
gb:AB022217_1515063 Arabidopsis thaliana genomic DNA, chromosome...    36   1.3     
gb:AY249886_1428006 Dasypus novemcinctus recombination activatin...    36   1.3     
gb:AY239192_1427666 Procavia capensis recombination activating p...    36   1.3     
gb:AY239190_1427664 Manis sp. JG-2003 recombination activating p...    36   1.3     
gb:CNS07EGI_1374397 chromosome IX of strain GB-M1 of Encephalito...    36   1.3     
sp|Q99PQ2|TM11_MOUSE|TM11_MOUSE Tripartite motif protein 11.>gb:AF220124_20...    36   1.3     
gb:AY662641_2542631 Typhlosaurus lomii recombination activating ...    35   1.7     
gb:AY662601_2542591 Oplurus cuvieri recombination activating gen...    35   1.7     
gb:AY443338_2532952 Trochocercus nigromitratus recombination act...    35   1.7     
gb:AY443336_2532950 Telophorus dohertyi recombination activating...    35   1.7     
gb:AY443335_2532949 Struthidea cinerea recombination activating ...    35   1.7     
gb:AY443334_2532948 Strepera graculina recombination activating ...    35   1.7     
gb:AY443333_2532947 Sphecotheres viridis recombination activatin...    35   1.7     
gb:AY443329_2532943 Rhipidura hyperthra recombination activating...    35   1.7     
gb:AY443327_2532941 Regulus satrapa recombination activating pro...    35   1.7     
gb:AY443326_2532940 Ptilorrhoa caerulescens recombination activa...    35   1.7     
gb:AY443325_2532939 Ptiloris magnificus recombination activating...    35   1.7     
gb:AY443323_2532937 Promerops cafer recombination activating pro...    35   1.7     
gb:AY443322_2532936 Prionops plumatus recombination activating p...    35   1.7     
gb:AY443320_2532934 Polioptila caerulea recombination activating...    35   1.7     
gb:AY443318_2532932 Pitohui cristatus recombination activating p...    35   1.7     
gb:AY443316_2532930 Pericrocotus ethologus recombination activat...    35   1.7     
gb:AY443314_2532928 Parus major recombination activating protein...    35   1.7     
gb:AY443313_2532927 Pardalotus punctatus recombination activatin...    35   1.7     
gb:AY443308_2532922 Oriolus xanthonotus recombination activating...    35   1.7     
gb:AY443307_2532921 Oreoica gutturalis recombination activating ...    35   1.7     
gb:AY443305_2532919 Muscicapa ferruginea recombination activatin...    35   1.7     
gb:AY443304_2532918 Monarcha chrysomela recombination activating...    35   1.7     
gb:AY443303_2532917 Modulatrix stictigula recombination activati...    35   1.7     
gb:AY443298_2532912 Melampitta lugubris recombination activating...    35   1.7     
gb:AY443297_2532911 Melampitta gigantea recombination activating...    35   1.7     
gb:AY443295_2532909 Manucodia atra recombination activating prot...    35   1.7     
gb:AY443294_2532908 Loboparadisaea sericea recombination activat...    35   1.7     
gb:AY443293_2532907 Lanius excubitor recombination activating pr...    35   1.7     
gb:AY443292_2532906 Lalage leucomela recombination activating pr...    35   1.7     
gb:AY443291_2532905 Hylophilus poicilotis recombination activati...    35   1.7     
gb:AY443290_2532904 Hirundo rustica recombination activating pro...    35   1.7     
gb:AY443289_2532903 Gymnorhina tibicen recombination activating ...    35   1.7     
gb:AY443288_2532902 Grallina cyanoleuca recombination activating...    35   1.7     
gb:AY443286_2532900 Eugerygone rubra recombination activating pr...    35   1.7     
gb:AY443285_2532899 Ephthianura tricolor recombination activatin...    35   1.7     
gb:AY443283_2532897 Dicrurus hottentottus recombination activati...    35   1.7     
gb:AY443281_2532895 Daphoenositta chrysoptera recombination acti...    35   1.7     
gb:AY443280_2532894 Cyanocitta cristata recombination activating...    35   1.7     
gb:AY443279_2532893 Culicicapa ceylonensis recombination activat...    35   1.7     
gb:AY443278_2532892 Cracticus quoyi recombination activating pro...    35   1.7     
gb:AY443276_2532890 Corvus coronoides recombination activating p...    35   1.7     
gb:AY443275_2532889 Corvinella corvina recombination activating ...    35   1.7     
gb:AY443274_2532888 Cormobates leucophaeus recombination activat...    35   1.7     
gb:AY443272_2532886 Coracina novaehollandiae recombination activ...    35   1.7     
gb:AY443270_2532884 Colluricincla harmonica recombination activa...    35   1.7     
gb:AY443269_2532883 Cnemophilus loriae recombination activating ...    35   1.7     
gb:AY443267_2532881 Chaetorhynchus papuensis recombination activ...    35   1.7     
gb:AY443263_2532877 Batis mixta recombination activating protein...    35   1.7     
gb:AY443262_2532876 Artamus cyanopterus recombination activating...    35   1.7     
gb:AY443261_2532875 Arcanator orostruthus recombination activati...    35   1.7     
gb:AY443260_2532874 Ailuroedus melanotis recombination activatin...    35   1.7     
gb:AY442925_2532646 Latimeria menadoensis RAG1 (Rag1) gene, part...    35   1.7     
gb:AY320006_2526735 Yuhina nigrimenta recombination activating p...    35   1.7     
gb:AY320005_2526734 Tichodroma muraria recombination activating ...    35   1.7     
gb:AY320004_2526733 Thamnornis chloropetoides recombination acti...    35   1.7     
gb:AY320003_2526732 Sylvietta denti recombination activating pro...    35   1.7     
gb:AY320002_2526731 Stelgidopteryx serripennis recombination act...    35   1.7     
gb:AY320000_2526729 Rhabdornis inornatus recombination activatin...    35   1.7     
gb:AY319999_2526728 Psaltriparus minimus recombination activatin...    35   1.7     
gb:AY319997_2526726 Phylloscopus collybita recombination activat...    35   1.7     
gb:AY319994_2526723 Paradoxornis gularis recombination activatin...    35   1.7     
gb:AY319993_2526722 Panurus biarmicus recombination activating p...    35   1.7     
gb:AY319990_2526719 Myadestes unicolor recombination activating ...    35   1.7     
gb:AY319989_2526718 Melanochlora sultanea recombination activati...    35   1.7     
gb:AY319988_2526717 Megalurus palustris recombination activating...    35   1.7     
gb:AY319987_2526716 Macrosphenus flavicans recombination activat...    35   1.7     
gb:AY319986_2526715 Macronous striaticeps recombination activati...    35   1.7     
gb:AY319981_2526710 Dumetella carolinensis recombination activat...    35   1.7     
gb:AY319980_2526709 Dulus dominicus recombination activating pro...    35   1.7     
gb:AY319979_2526708 Donacobius atricapillus recombination activa...    35   1.7     
gb:AY319978_2526707 Cincloramphus mathewsi recombination activat...    35   1.7     
gb:AY319977_2526706 Cettia brunnifrons recombination activating ...    35   1.7     
gb:AY319976_2526705 Bleda syndactyla recombination activating pr...    35   1.7     
gb:AY319975_2526704 Auriparus flaviceps recombination activating...    35   1.7     
gb:AY319974_2526703 Arachnothera longirostra recombination activ...    35   1.7     
gb:AY319973_2526702 Alcippe peracensis recombination activating ...    35   1.7     
gb:AY319972_2526701 Acrocephalus newtoni recombination activatin...    35   1.7     
gb:AY307215_2526241 Zoothera dauma recombination-activating prot...    35   1.7     
gb:AY307214_2526240 Turdus philomelos recombination-activating p...    35   1.7     
gb:AY307213_2526239 Toxostoma curvirostre recombination-activati...    35   1.7     
gb:AY307212_2526238 Sarcops calvus recombination-activating prot...    35   1.7     
gb:AY307211_2526237 Rhinomyias goodfellowi recombination-activat...    35   1.7     
gb:AY307210_2526236 Rhabdornis mysticalis recombination-activati...    35   1.7     
gb:AY307209_2526235 Ramphocinclus brachyurus recombination-activ...    35   1.7     
gb:AY307208_2526234 Pogonocichla stellata recombination-activati...    35   1.7     
gb:AY307207_2526233 Poeoptera lugubris recombination-activating ...    35   1.7     
gb:AY307206_2526232 Platycichla leucops recombination-activating...    35   1.7     
gb:AY307203_2526229 Oreoscoptes montanus recombination-activatin...    35   1.7     
gb:AY307201_2526227 Neocossyphus poensis recombination-activatin...    35   1.7     
gb:AY307200_2526226 Mino anais recombination-activating protein ...    35   1.7     
gb:AY307199_2526225 Melanotis caerulescens recombination-activat...    35   1.7     
gb:AY307198_2526224 Melaenornis pallidus recombination-activatin...    35   1.7     
gb:AY307197_2526223 Margarops fuscatus recombination-activating ...    35   1.7     
gb:AY307196_2526222 Luscinia cyane recombination-activating prot...    35   1.7     
gb:AY307195_2526221 Lamprotornis superbus recombination-activati...    35   1.7     
gb:AY307194_2526220 Lamprotornis splendidus recombination-activa...    35   1.7     
gb:AY307193_2526219 Gracula religiosa recombination-activating p...    35   1.7     
gb:AY307192_2526218 Ficedula monileger recombination-activating ...    35   1.7     
gb:AY307191_2526217 Erithacus rubecula recombination-activating ...    35   1.7     
gb:AY307189_2526215 Creatophora cinerea recombination-activating...    35   1.7     
gb:AY307188_2526214 Copsychus malabaricus recombination-activati...    35   1.7     
gb:AY307187_2526213 Cinnyricinclus sharpii recombination-activat...    35   1.7     
gb:AY307185_2526211 Cercotrichas leucophrys recombination-activa...    35   1.7     
gb:AY307184_2526210 Catharus guttatus recombination-activating p...    35   1.7     
gb:AY307183_2526209 Buphagus erythrorhynchus recombination-activ...    35   1.7     
gb:AY307181_2526207 Ampeliceps coronatus recombination-activatin...    35   1.7     
gb:AY307180_2526206 Acridotheres fuscus recombination-activating...    35   1.7     
gb:AY057042_2510180 Zosterops senegalensis recombination activat...    35   1.7     
gb:AY057041_2510179 Vireo philadelphia recombination activating ...    35   1.7     
gb:AY057040_2510178 Vanga curvirostris recombination activating ...    35   1.7     
gb:AY057039_2510177 Turdus falklandii recombination activating p...    35   1.7     
gb:AY057038_2510176 Troglodytes aedon recombination activating p...    35   1.7     
gb:AY057035_2510173 Thraupis cyanocephala recombination activati...    35   1.7     
gb:AY057034_2510172 Thamnophilus nigrocinereus recombination act...    35   1.7     
gb:AY057033_2510171 Sylvia nana recombination activating protein...    35   1.7     
gb:AY057032_2510170 Sturnus vulgaris recombination activating pr...    35   1.7     
gb:AY057027_2510165 Pycnonotus barbatus recombination activating...    35   1.7     
gb:AY057026_2510164 Ptilonorhynchus violaceus recombination acti...    35   1.7     
gb:AY057024_2510162 Prunella collaris recombination activating p...    35   1.7     
gb:AY057023_2510161 Pomatostomus isidorei recombination activati...    35   1.7     
gb:AY057022_2510160 Ploceus cucullatus recombination activating ...    35   1.7     
gb:AY057017_2510155 Parus inornatus recombination activating pro...    35   1.7     
gb:AY057016_2510154 Parula americana recombination activating pr...    35   1.7     
gb:AY057015_2510153 Pardalotus striatus recombination activating...    35   1.7     
gb:AY057014_2510152 Paradisaea raggiana recombination activating...    35   1.7     
gb:AY057013_2510151 Pachycephala soror recombination activating ...    35   1.7     
gb:AY057012_2510150 Orthonyx spaldingii recombination activating...    35   1.7     
gb:AY057011_2510149 Oriolus larvatus recombination activating pr...    35   1.7     
gb:AY057009_2510147 Nectarinia olivacea recombination activating...    35   1.7     
gb:AY057008_2510146 Muscicapa strophiata recombination activatin...    35   1.7     
gb:AY057007_2510145 Motacilla cinerea recombination activating p...    35   1.7     
gb:AY057006_2510144 Monarcha axillaris recombination activating ...    35   1.7     
gb:AY057005_2510143 Mimus patagonicus recombination activating p...    35   1.7     
gb:AY057004_2510142 Menura novaehollandiae recombination activat...    35   1.7     
gb:AY057003_2510141 Meliphaga analoga recombination activating p...    35   1.7     
gb:AY057001_2510139 Malurus melanocephalus recombination activat...    35   1.7     
gb:AY056999_2510137 Irena cyanogaster recombination activating p...    35   1.7     
gb:AY056998_2510136 Icterus parisorum recombination activating p...    35   1.7     
gb:AY056994_2510132 Fringilla montifringilla recombination activ...    35   1.7     
gb:AY056992_2510130 Emberiza schoeniclus recombination activatin...    35   1.7     
gb:AY056991_2510129 Dicrurus adsimilis recombination activating ...    35   1.7     
gb:AY056989_2510127 Corvus corone recombination activating prote...    35   1.7     
gb:AY056988_2510126 Coracina lineata recombination activating pr...    35   1.7     
gb:AY056986_2510124 Cisticola anonymus recombination activating ...    35   1.7     
gb:AY056984_2510122 Chloropsis cochinchinensis recombination act...    35   1.7     
gb:AY056983_2510121 Certhia familiaris recombination activating ...    35   1.7     
gb:AY056981_2510119 Bombycilla garrulus recombination activating...    35   1.7     
gb:AY056980_2510118 Artamus leucorhynchus recombination activati...    35   1.7     
gb:AY056978_2510116 Alauda arvensis recombination activating pro...    35   1.7     
gb:AY056977_2510115 Aegithina tiphia recombination activating pr...    35   1.7     
gb:AY056976_2510114 Aegithalos iouschensis recombination activat...    35   1.7     
gb:AF143738_2477043 Passer montanus recombination activating pro...    35   1.7     
gb:AF270937_2224904 Plutella xylostella granulovirus genome, com...    35   1.7     
gb:MMU68174_2123200 Mus musculus breast/ovarian cancer susceptib...    35   1.7     
gb:MMU36475_2121000 Mus musculus breast and ovarian cancer susce...    35   1.7     
gb:MMU32446_2120860 Mus musculus putative breast/ovarian cancer ...    35   1.7     


>gb:AP003299_1827631 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0699H05.
          Length = 489

 Score =  112 bits (281), Expect = 9e-24
 Identities = 51/73 (69%), Positives = 61/73 (83%), Gaps = 1/73 (1%)
 Frame = +2

Query: 770 CPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCA-RRSLRDDPIFD 946
           CP  +G   II++TR VM C HRFCR+CIDKSMRLGNNECPACR HCA RRSLRDDP +D
Sbjct: 113 CPICLG---IIRKTRTVMECLHRFCRDCIDKSMRLGNNECPACRTHCASRRSLRDDPNYD 169

Query: 947 AIIQSIYPDVEKY 985
           A+I ++YPD++KY
Sbjct: 170 ALIAALYPDIDKY 182



>gb:AC130605_1740821 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0010D04, complete sequence.
          Length = 823

 Score =  112 bits (280), Expect = 1e-23
 Identities = 51/73 (69%), Positives = 61/73 (83%), Gaps = 1/73 (1%)
 Frame = +2

Query: 770 CPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCA-RRSLRDDPIFD 946
           CP  +G   II++TR VM C HRFCR+CIDKSMRLGNNECPACR HCA RRSLRDDP +D
Sbjct: 114 CPICLG---IIRKTRTVMECLHRFCRDCIDKSMRLGNNECPACRTHCASRRSLRDDPNYD 170

Query: 947 AIIQSIYPDVEKY 985
           A+I ++YPD++KY
Sbjct: 171 ALILALYPDIDKY 183



>gb:AB011475_1511369 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K9L2.
          Length = 486

 Score =  107 bits (266), Expect = 5e-22
 Identities = 50/73 (68%), Positives = 59/73 (80%), Gaps = 1/73 (1%)
 Frame = +2

Query: 770 CPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCA-RRSLRDDPIFD 946
           CP  +G   IIK+TR VM C HRFCRECIDKSMRLGNNECPACR HCA RRSLRDDP FD
Sbjct: 136 CPICLG---IIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRKHCASRRSLRDDPKFD 192

Query: 947 AIIQSIYPDVEKY 985
           A+I +++ +++ Y
Sbjct: 193 ALIAALFTNIDSY 205



>pir|B86168|B86168 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889396 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC003027_1530962 Arabidopsis thaliana
           chromosome I BAC F21M11 genomic sequence, complete
           sequence.
          Length = 439

 Score =  106 bits (265), Expect = 6e-22
 Identities = 48/76 (63%), Positives = 60/76 (78%), Gaps = 1/76 (1%)
 Frame = +2

Query: 761 APICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCA-RRSLRDDP 937
           A IC  +   + II++TR VM C HRFCRECIDKSMRLGNNECP CR HCA RRSLRDDP
Sbjct: 97  ADICKDVQCSIWIIRKTRTVMECLHRFCRECIDKSMRLGNNECPTCRKHCASRRSLRDDP 156

Query: 938 IFDAIIQSIYPDVEKY 985
            FDA+I +++ +++K+
Sbjct: 157 NFDALIAALFKNIDKF 172



>gb:BX883042_2111383 Rattus norvegicus chromosome 20, major
           histocompatibility complex, assembled from 40 BACs,
           strain Brown Norway (BN/ssNHsd), RT1n haplotype; segment
           1/11.
          Length = 377

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 36/75 (48%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K T     C HRFC +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 20  PIC------LDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPN 73

Query: 941 FDAIIQSIYPDVEKY 985
           FDA+I  IYP  E+Y
Sbjct: 74  FDALISKIYPSREEY 88



>gb:BC082771_2108440 Mus musculus ring finger protein 1, mRNA (cDNA
           clone IMAGE:6334539), complete cds.
          Length = 154

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 36/75 (48%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K T     C HRFC +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 20  PIC------LDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPN 73

Query: 941 FDAIIQSIYPDVEKY 985
           FDA+I  IYP  E+Y
Sbjct: 74  FDALISKIYPSREEY 88



>gb:AF100956_2054530 Mus musculus major histocompatibility locus
           class II region; Fas-binding protein Daxx (DAXX) gene,
           partial cds; Bing1 (BING1), tapasin (tapasin),
           RalGDS-like factor (RLF), KE2 (KE2), BING4 (BING4),
           beta1, 3-galactosyl transferase (beta1,3-galactosyl
           transferase), ribosomal protein subunit S18 (RPS18),
           Sacm21 (Sacm21), H2K1(b) (H2-K1(b)), RING1 (RING1), KE6a
           (KE6a), KE4 (KE4), RXRbeta (RXRbeta), collagen alpha-2
           (XI) (COLA11A2), H2-O alpha (H2-Oalpha), RING3 (RING3),
           H2-M alpha (H2-M alpha), H2-M beta 2 (H2-M beta2), and
           H2-M beta1 (H2-M beta1) genes, complete cds; and LMP 2
           gene, partial cds.>gb:MMY12881_2124445 Mus musculus mRNA
           for transcription repressor Ring1A.
          Length = 377

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 36/75 (48%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K T     C HRFC +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 20  PIC------LDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPN 73

Query: 941 FDAIIQSIYPDVEKY 985
           FDA+I  IYP  E+Y
Sbjct: 74  FDALISKIYPSREEY 88



>gb:MMU421778_2039431 Macaca mulatta znfl gene (partial), sacm2L
           gene (partial), htatsf1L gene (partial), ring1 gene,
           fabgl gene and ke4 gene (partial).
          Length = 377

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 36/75 (48%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K T     C HRFC +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 20  PIC------LDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPN 73

Query: 941 FDAIIQSIYPDVEKY 985
           FDA+I  IYP  E+Y
Sbjct: 74  FDALISKIYPSREEY 88



>gb:HS1033B10_1996561 Human DNA sequence from clone RP5-1033B10 on
           chromosome 6p21.2-21.31. Contains the C6ORF11 gene for
           chromosome 6 open reading frame 11 (BING4), the B3GALT4
           gene for UDP-Gal:betaGlcNAc beta
           1,3-galactosyltransferase polypeptide 4, the RPS18 gene
           for 40S ribosomal protein S18, the SACM2L gene for SAC2
           (suppressor of actin mutation 2, yeast, homolog)-like
           (ARE1), an HIV TAT specific factor 1 (HTATSF1)
           pseudogene, a zinc finger pseudogene, the RING1 gene for
           ring finger protein 1 (RNF1), the FABGL gene for FabG
           (beta-ketoacyl-[acyl-carrier-protein] reductase, E coli)
           like protein, the HKE4 gene for HLA class II region
           protein KE4, the RXRB gene for retinoid X receptor beta,
           the COL11A2 gene for collagen type XI alpha 2, an HLA
           class II histocompatability antigen D or S beta
           pseudogene and three novel genes. Contains seven CpG
           islands, ESTs, STSs, and GSSs, complete sequence.
          Length = 281

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 36/75 (48%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K T     C HRFC +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 49  PIC------LDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPN 102

Query: 941 FDAIIQSIYPDVEKY 985
           FDA+I  IYP  E+Y
Sbjct: 103 FDALISKIYPSREEY 117



>gb:AL844527_1933050 Human DNA sequence from clone DAQB-314F24 on
           chromosome 6, complete sequence.
          Length = 360

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 36/75 (48%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K T     C HRFC +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 3   PIC------LDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPN 56

Query: 941 FDAIIQSIYPDVEKY 985
           FDA+I  IYP  E+Y
Sbjct: 57  FDALISKIYPSREEY 71



>gb:AL645940_1931364 Human DNA sequence from clone XXbac-157A10 on
           chromosome 6 contains the 3' end of the gene for a novel
           protein similar to major histocompatibility complex,
           class II, DP beta 2 pseudogene, a major
           histocompatibility complex, class II, DP beta 1
           pseudogene, two putative novel transcripts, the COL11A2
           gene for collagen, type XI, alpha 2, the RXRB gene for
           retinoid X receptor, beta, the HKE4 gene for HLA-class
           II region expressed gene KE4, the FABGL gene for
           hydroxysteroid (17-beta) dehydrogenase 8, the RING1 gene
           for ring finger protein 1, a zinger finger protein
           pseudogene, a HIV TAT specific factor 1 (HTATSF1)
           pseudogene, a novel transcript, the SACM2L gene for SAC2
           suppressor of actin mutations 2-like (yeast), the 5' end
           of the RPS18 gene for ribosomal protein S18 and six CpG
           islands, complete sequence.>gb:AL713971_1932492 Human
           DNA sequence from clone XXbac-269C15 on chromosome 6
           contains the FABGL gene for hydroxysteroid (17-beta)
           dehydrogenase 8, the RING1 gene for ring finger protein
           1, a zinger finger protein pseudogene, a HIV TAT
           specific factor 1 (HTATSF1) pseudogene, a novel
           transcript, the SACML2 gene for SAC2 suppressor of actin
           mutations 2-like (yeast), the 5' end of the RPS18 gene
           for ribosomal protein S18 and four CpG islands, complete
           sequence.>gb:AL844527_1933049 Human DNA sequence from
           clone DAQB-314F24 on chromosome 6, complete
           sequence.>gb:BC002922_1968529 Homo sapiens ring finger
           protein 1, mRNA (cDNA clone MGC:11356 IMAGE:3954313),
           complete cds.>gb:BC051866_1984717 Homo sapiens ring
           finger protein 1, mRNA (cDNA clone MGC:60237
           IMAGE:6142438), complete cds.
          Length = 406

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 36/75 (48%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K T     C HRFC +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 49  PIC------LDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPN 102

Query: 941 FDAIIQSIYPDVEKY 985
           FDA+I  IYP  E+Y
Sbjct: 103 FDALISKIYPSREEY 117



>gb:AJ630366_1422770 Canis familiaris MHC class II region on
           chromosome CFA12, partial sequence, BAC clone 21p19,
           containing partial col11a2 gene, RXRB, SLC39A7, HSD17B8,
           RING1, VPS52, RPS18 and B3GALT4 genes, C12H6orf11 ORF,
           KE2, RAB2L, TAPBP, ZNF297 and DAXX genes.
          Length = 377

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 36/75 (48%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K T     C HRFC +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 20  PIC------LDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPN 73

Query: 941 FDAIIQSIYPDVEKY 985
           FDA+I  IYP  E+Y
Sbjct: 74  FDALISKIYPSREEY 88



>gb:AJ630366_1422769 Canis familiaris MHC class II region on
           chromosome CFA12, partial sequence, BAC clone 21p19,
           containing partial col11a2 gene, RXRB, SLC39A7, HSD17B8,
           RING1, VPS52, RPS18 and B3GALT4 genes, C12H6orf11 ORF,
           KE2, RAB2L, TAPBP, ZNF297 and DAXX genes.
          Length = 406

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 36/75 (48%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K T     C HRFC +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 49  PIC------LDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPN 102

Query: 941 FDAIIQSIYPDVEKY 985
           FDA+I  IYP  E+Y
Sbjct: 103 FDALISKIYPSREEY 117



>sp|Q06587|RNG1_HUMAN Polycomb complex protein RING1
           (RNF1).>pir|A47380|A47380 RING finger-containing DNA
           binding protein RING1 - human>gb:AL645940_1931365 Human
           DNA sequence from clone XXbac-157A10 on chromosome 6
           contains the 3' end of the gene for a novel protein
           similar to major histocompatibility complex, class II,
           DP beta 2 pseudogene, a major histocompatibility
           complex, class II, DP beta 1 pseudogene, two putative
           novel transcripts, the COL11A2 gene for collagen, type
           XI, alpha 2, the RXRB gene for retinoid X receptor,
           beta, the HKE4 gene for HLA-class II region expressed
           gene KE4, the FABGL gene for hydroxysteroid (17-beta)
           dehydrogenase 8, the RING1 gene for ring finger protein
           1, a zinger finger protein pseudogene, a HIV TAT
           specific factor 1 (HTATSF1) pseudogene, a novel
           transcript, the SACM2L gene for SAC2 suppressor of actin
           mutations 2-like (yeast), the 5' end of the RPS18 gene
           for ribosomal protein S18 and six CpG islands, complete
           sequence.>gb:AL713971_1932493 Human DNA sequence from
           clone XXbac-269C15 on chromosome 6 contains the FABGL
           gene for hydroxysteroid (17-beta) dehydrogenase 8, the
           RING1 gene for ring finger protein 1, a zinger finger
           protein pseudogene, a HIV TAT specific factor 1
           (HTATSF1) pseudogene, a novel transcript, the SACML2
           gene for SAC2 suppressor of actin mutations 2-like
           (yeast), the 5' end of the RPS18 gene for ribosomal
           protein S18 and four CpG islands, complete
           sequence.>gb:BT007352_1990790 Homo sapiens ring finger
           protein 1 mRNA, complete cds.>gb:HS1033B10_1996560 Human
           DNA sequence from clone RP5-1033B10 on chromosome
           6p21.2-21.31. Contains the C6ORF11 gene for chromosome 6
           open reading frame 11 (BING4), the B3GALT4 gene for
           UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase
           polypeptide 4, the RPS18 gene for 40S ribosomal protein
           S18, the SACM2L gene for SAC2 (suppressor of actin
           mutation 2, yeast, homolog)-like (ARE1), an HIV TAT
           specific factor 1 (HTATSF1) pseudogene, a zinc finger
           pseudogene, the RING1 gene for ring finger protein 1
           (RNF1), the FABGL gene for FabG
           (beta-ketoacyl-[acyl-carrier-protein] reductase, E coli)
           like protein, the HKE4 gene for HLA class II region
           protein KE4, the RXRB gene for retinoid X receptor beta,
           the COL11A2 gene for collagen type XI alpha 2, an HLA
           class II histocompatability antigen D or S beta
           pseudogene and three novel genes. Contains seven CpG
           islands, ESTs, STSs, and GSSs, complete
           sequence.>gb:HSRING1_2020004 H.sapiens RING1 gene.
          Length = 377

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 36/75 (48%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K T     C HRFC +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 20  PIC------LDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPN 73

Query: 941 FDAIIQSIYPDVEKY 985
           FDA+I  IYP  E+Y
Sbjct: 74  FDALISKIYPSREEY 88



>gb:BC081039_2561947 Xenopus laevis MGC81738 protein, mRNA (cDNA
           clone MGC:81738 IMAGE:6865582), complete cds.
          Length = 344

 Score = 70.5 bits (171), Expect = 5e-11
 Identities = 35/75 (46%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K T     C HRFC +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 49  PIC------LDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPN 102

Query: 941 FDAIIQSIYPDVEKY 985
           FDA+I  IYP  ++Y
Sbjct: 103 FDALISKIYPSRDEY 117



>gb:BC067955_2554939 Xenopus tropicalis hypothetical protein
           MGC69339, mRNA (cDNA clone MGC:69339 IMAGE:5309042),
           complete cds.
          Length = 336

 Score = 70.5 bits (171), Expect = 5e-11
 Identities = 35/75 (46%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K T     C HRFC +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 52  PIC------LDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPN 105

Query: 941 FDAIIQSIYPDVEKY 985
           FDA+I  IYP  ++Y
Sbjct: 106 FDALISKIYPSRDEY 120



>gb:BC046935_2549803 Xenopus laevis similar to ring finger protein
           2, mRNA (cDNA clone IMAGE:5571554), partial cds.
          Length = 369

 Score = 70.5 bits (171), Expect = 5e-11
 Identities = 35/75 (46%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K T     C HRFC +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 74  PIC------LDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPN 127

Query: 941 FDAIIQSIYPDVEKY 985
           FDA+I  IYP  ++Y
Sbjct: 128 FDALISKIYPSRDEY 142



>gb:BC044472_2548776 Danio rerio ring finger protein 2, mRNA (cDNA
           clone MGC:55753 IMAGE:3816506), complete cds.
          Length = 336

 Score = 70.5 bits (171), Expect = 5e-11
 Identities = 35/75 (46%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K T     C HRFC +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 52  PIC------LDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPN 105

Query: 941 FDAIIQSIYPDVEKY 985
           FDA+I  IYP  ++Y
Sbjct: 106 FDALISKIYPSRDEY 120



>gb:AY576996_2538240 Danio rerio clone RK125A1A09 ring finger
           protein 2 mRNA, complete cds.
          Length = 338

 Score = 70.5 bits (171), Expect = 5e-11
 Identities = 35/75 (46%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K T     C HRFC +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 54  PIC------LDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPN 107

Query: 941 FDAIIQSIYPDVEKY 985
           FDA+I  IYP  ++Y
Sbjct: 108 FDALISKIYPSRDEY 122



>gb:AF196346_2479494 Danio rerio Ring finger protein 1b (ring1b)
           mRNA, partial cds.
          Length = 259

 Score = 70.5 bits (171), Expect = 5e-11
 Identities = 35/75 (46%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K T     C HRFC +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 52  PIC------LDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPN 105

Query: 941 FDAIIQSIYPDVEKY 985
           FDA+I  IYP  ++Y
Sbjct: 106 FDALISKIYPSRDEY 120



>gb:MMY12880_2124444 Mus musculus mRNA for polycomb-M33 interacting
           protein Ring1B.
          Length = 339

 Score = 70.5 bits (171), Expect = 5e-11
 Identities = 35/75 (46%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K T     C HRFC +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 52  PIC------LDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPN 105

Query: 941 FDAIIQSIYPDVEKY 985
           FDA+I  IYP  ++Y
Sbjct: 106 FDALISKIYPSRDEY 120



>gb:HSG120K12_2013315 Human DNA sequence from clone GS1-120K12 on
           chromosome 1q25.3-31.2 Contains the 5' end of the
           C1orf24 gene for chromosome 1 open reading frame 24, the
           RNF2 gene for ring finger protein 2, a ferritin heavy
           polypeptide (FTH) pseudogene and the 3' end of the
           C1orf25 gene for chromosome 1 open reading frame 25,
           complete sequence.
          Length = 246

 Score = 70.5 bits (171), Expect = 5e-11
 Identities = 35/75 (46%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K T     C HRFC +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 52  PIC------LDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPN 105

Query: 941 FDAIIQSIYPDVEKY 985
           FDA+I  IYP  ++Y
Sbjct: 106 FDALISKIYPSRDEY 120



>gb:AF141327_1885879 Homo sapiens ring finger protein BAP-1 mRNA,
           complete cds.>gb:BC012583_1973687 Homo sapiens ring
           finger protein 2, mRNA (cDNA clone MGC:13490
           IMAGE:4285715), complete cds.>gb:HSDING_2011891
           H.sapiens mRNA for dinG gene.>gb:HSG120K12_2013313 Human
           DNA sequence from clone GS1-120K12 on chromosome
           1q25.3-31.2 Contains the 5' end of the C1orf24 gene for
           chromosome 1 open reading frame 24, the RNF2 gene for
           ring finger protein 2, a ferritin heavy polypeptide
           (FTH) pseudogene and the 3' end of the C1orf25 gene for
           chromosome 1 open reading frame 25, complete sequence.
          Length = 336

 Score = 70.5 bits (171), Expect = 5e-11
 Identities = 35/75 (46%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K T     C HRFC +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 52  PIC------LDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPN 105

Query: 941 FDAIIQSIYPDVEKY 985
           FDA+I  IYP  ++Y
Sbjct: 106 FDALISKIYPSRDEY 120



>gb:CR859392_1183510 Pongo pygmaeus mRNA; cDNA DKFZp469E2020 (from
           clone DKFZp469E2020).
          Length = 336

 Score = 70.5 bits (171), Expect = 5e-11
 Identities = 35/75 (46%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K T     C HRFC +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 52  PIC------LDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPN 105

Query: 941 FDAIIQSIYPDVEKY 985
           FDA+I  IYP  ++Y
Sbjct: 106 FDALISKIYPSRDEY 120



>gb:AK090066_1176126 Mus musculus B lymphocyte B cells CRL-1702 WEHI
           231 cDNA, RIKEN full-length enriched library,
           clone:G430089K06 product:ring finger protein 2, full
           insert sequence.
          Length = 336

 Score = 70.5 bits (171), Expect = 5e-11
 Identities = 35/75 (46%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K T     C HRFC +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 52  PIC------LDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPN 105

Query: 941 FDAIIQSIYPDVEKY 985
           FDA+I  IYP  ++Y
Sbjct: 106 FDALISKIYPSRDEY 120



>gb:AK012358_1156912 Mus musculus 11 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2700043E10
           product:ring finger protein 2, full insert
           sequence.>gb:AK013124_1157339 Mus musculus 10, 11 days
           embryo whole body cDNA, RIKEN full-length enriched
           library, clone:2810421H23 product:ring finger protein 2,
           full insert sequence.>gb:AK030319_1161941 Mus musculus
           11 days pregnant adult female ovary and uterus cDNA,
           RIKEN full-length enriched library, clone:5031429P04
           product:ring finger protein 2, full insert
           sequence.>gb:BC020122_2093280 Mus musculus ring finger
           protein 2, mRNA (cDNA clone MGC:28374 IMAGE:4021046),
           complete cds.
          Length = 336

 Score = 70.5 bits (171), Expect = 5e-11
 Identities = 35/75 (46%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K T     C HRFC +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 52  PIC------LDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPN 105

Query: 941 FDAIIQSIYPDVEKY 985
           FDA+I  IYP  ++Y
Sbjct: 106 FDALISKIYPSRDEY 120



>gb:DMDRING_1378669 Drosophila melanogaster mRNA for DRING protein.
          Length = 435

 Score = 70.1 bits (170), Expect = 6e-11
 Identities = 35/75 (46%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K+T     C HRFC +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 47  PIC------LDMLKKTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRADPN 100

Query: 941 FDAIIQSIYPDVEKY 985
           FD +I  IYP  E+Y
Sbjct: 101 FDLLISKIYPSREEY 115



>gb:AE014297_1141757 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003762_1223750 Drosophila melanogaster
           chromosome 3R, section 100 of 118 of the complete
           sequence.>gb:AY058535_1291689 Drosophila melanogaster
           LD23953 full length cDNA.
          Length = 435

 Score = 70.1 bits (170), Expect = 6e-11
 Identities = 35/75 (46%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K+T     C HRFC +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 47  PIC------LDMLKKTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRADPN 100

Query: 941 FDAIIQSIYPDVEKY 985
           FD +I  IYP  E+Y
Sbjct: 101 FDLLISKIYPSREEY 115



>gb:BC009070_2090779 Mus musculus ring finger protein 1, mRNA (cDNA
           clone MGC:6870 IMAGE:2651194), complete cds.
          Length = 377

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 35/75 (46%), Positives = 44/75 (58%), Gaps = 1/75 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIH-CARRSLRDDPI 940
           PIC      L ++K T     C HR C +CI  ++R GN ECP CR    ++RSLR DP 
Sbjct: 20  PIC------LDMLKNTMTTKECLHRLCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPN 73

Query: 941 FDAIIQSIYPDVEKY 985
           FDA+I  IYP  E+Y
Sbjct: 74  FDALISKIYPSREEY 88



>gb:BC085530_2564433 Danio rerio zgc:103481, mRNA (cDNA clone
           MGC:103481 IMAGE:7237671), complete cds.
          Length = 381

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 1/68 (1%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNN-ECPACRIHCARRSLRDDPI 940
           P+C       C I +  VV+ C H FC+EC+ K     N  ECP CR    RRS RDDP 
Sbjct: 15  PVC-------CKIYKDPVVLSCSHSFCQECLQKFWITCNTLECPVCR----RRSSRDDPP 63

Query: 941 FDAIIQSI 964
            + +++++
Sbjct: 64  CNLVLKNL 71



>gb:AY081328_1568674 Arabidopsis thaliana unknown protein
           (At4g21070) mRNA, complete cds.>gb:BT010547_1640493
           Arabidopsis thaliana At4g21070 gene, complete
           cds.>gb:AF515728_1807482 Arabidopsis thaliana BRCA1
           mRNA, complete cds.
          Length = 941

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 27/75 (36%), Positives = 41/75 (54%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           +  PIC S+         + V + C H FC  CI KSM++ +  CP C+I   RR +R  
Sbjct: 14  LKCPICLSLYN-------SAVSLSCNHVFCNACIVKSMKM-DATCPVCKIPYHRREIRGA 65

Query: 935 PIFDAIIQSIYPDVE 979
           P  D+++ SIY ++E
Sbjct: 66  PHMDSLV-SIYKNME 79



>gb:ATF7J7_1550958 Arabidopsis thaliana DNA chromosome 4, BAC clone
           F7J7 (ESSA project).
          Length = 1331

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 27/75 (36%), Positives = 41/75 (54%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           +  PIC S+         + V + C H FC  CI KSM++ +  CP C+I   RR +R  
Sbjct: 379 LKCPICLSLYN-------SAVSLSCNHVFCNACIVKSMKM-DATCPVCKIPYHRREIRGA 430

Query: 935 PIFDAIIQSIYPDVE 979
           P  D+++ SIY ++E
Sbjct: 431 PHMDSLV-SIYKNME 444



>pir|T04938|T04938 hypothetical protein F7J7.10 - Arabidopsis
           thaliana  (fragment)
          Length = 1331

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 27/75 (36%), Positives = 41/75 (54%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           +  PIC S+         + V + C H FC  CI KSM++ +  CP C+I   RR +R  
Sbjct: 379 LKCPICLSLYN-------SAVSLSCNHVFCNACIVKSMKM-DATCPVCKIPYHRREIRGA 430

Query: 935 PIFDAIIQSIYPDVE 979
           P  D+++ SIY ++E
Sbjct: 431 PHMDSLV-SIYKNME 444



>pir|T10649|T10649 hypothetical protein T13K14.230 - Arabidopsis
           thaliana  (fragment)
          Length = 1495

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 27/75 (36%), Positives = 41/75 (54%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           +  PIC S+         + V + C H FC  CI KSM++ +  CP C+I   RR +R  
Sbjct: 596 LKCPICLSLYN-------SAVSLSCNHVFCNACIVKSMKM-DATCPVCKIPYHRREIRGA 647

Query: 935 PIFDAIIQSIYPDVE 979
           P  D+++ SIY ++E
Sbjct: 648 PHMDSLV-SIYKNME 661



>pir|A85240|A85240 hypothetical protein AT4g21070 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV54_1545945 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           54.>gb:ATT13K14_1554440 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T13K14 (ESSA project).
          Length = 1495

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 27/75 (36%), Positives = 41/75 (54%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           +  PIC S+         + V + C H FC  CI KSM++ +  CP C+I   RR +R  
Sbjct: 596 LKCPICLSLYN-------SAVSLSCNHVFCNACIVKSMKM-DATCPVCKIPYHRREIRGA 647

Query: 935 PIFDAIIQSIYPDVE 979
           P  D+++ SIY ++E
Sbjct: 648 PHMDSLV-SIYKNME 661



>gb:BC077164_2559882 Danio rerio zgc:91888, mRNA (cDNA clone
           MGC:91888 IMAGE:7039278), complete cds.
          Length = 450

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 1/71 (1%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGN-NECPACRIHCARRSLRD 931
           +  P+C  I        +T V++ C H FC+EC+ +  R  N  ECP CR    RRS +D
Sbjct: 9   LTCPVCQDIF-------KTPVILSCSHSFCKECLQQFWRNKNTQECPVCR----RRSSKD 57

Query: 932 DPIFDAIIQSI 964
            P+ +  +Q++
Sbjct: 58  RPLVNLALQNL 68



>gb:AC108873_1738586 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1005_B11, complete sequence.
          Length = 995

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 21/67 (31%), Positives = 39/67 (58%)
 Frame = +2

Query: 779 IVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDDPIFDAIIQ 958
           ++G L ++  + V + C H FC +C+ +SM+   + CP C++   RR +R  P  D ++ 
Sbjct: 18  VLGSLSLLS-SAVSISCNHVFCNDCLTESMK-STSSCPVCKVPFRRREMRPAPHMDNLV- 74

Query: 959 SIYPDVE 979
           SI+  +E
Sbjct: 75  SIFKSME 81



>gb:U39653_1403016 Caenorhabditis elegans cosmid T13H2, complete
           sequence.
          Length = 720

 Score = 44.3 bits (103), Expect = 0.004
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = +2

Query: 797 IIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC-ARRSLRDDPIFDAIIQSI 964
           +I+ + +   C HRFC +CI  +     N CP CR +  ++R L+ DP FD +I  +
Sbjct: 168 LIQGSIMTKKCGHRFCDQCILVAFMRSGNTCPTCRQNLGSKRELQQDPRFDQLIYQV 224



>pir|T16870|T16870 hypothetical protein T13H2.3 - Caenorhabditis
           elegans
          Length = 2447

 Score = 44.3 bits (103), Expect = 0.004
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = +2

Query: 797 IIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC-ARRSLRDDPIFDAIIQSI 964
           +I+ + +   C HRFC +CI  +     N CP CR +  ++R L+ DP FD +I  +
Sbjct: 168 LIQGSIMTKKCGHRFCDQCILVAFMRSGNTCPTCRQNLGSKRELQQDPRFDQLIYQV 224



>gb:AE017347_1757682 Cryptococcus neoformans var. neoformans JEC21
            chromosome 7, complete sequence.
          Length = 1025

 Score = 42.0 bits (97), Expect = 0.019
 Identities = 13/28 (46%), Positives = 21/28 (75%)
 Frame = +2

Query: 818  VMGCQHRFCRECIDKSMRLGNNECPACR 901
            ++GC+H F ++C+D+ +  G N CPACR
Sbjct: 972  ILGCRHAFHKDCVDQWLTTGKNSCPACR 999



>gb:AY662590_2542580 Phrynosoma mcallii recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 941

 Score = 41.2 bits (95), Expect = 0.032
 Identities = 22/52 (42%), Positives = 28/52 (53%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PA    SI   +C  I    V   C+H FCR CI KS+++  + CPACR  C
Sbjct: 249 PADFVKSISCQICEHILADPVETTCKHLFCRVCILKSLKIMGSYCPACRYPC 300



>gb:BC047945_1984070 Homo sapiens ring finger protein 36, mRNA (cDNA
           clone MGC:50818 IMAGE:5744224), complete cds.
          Length = 500

 Score = 40.8 bits (94), Expect = 0.041
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 2/55 (3%)
 Frame = +2

Query: 806 RTRVVMGCQHRFCRECIDKSMRLGNNE--CPACRIHCARRSLRDDPIFDAIIQSI 964
           R  +++ C H FC  CI    RL   E  CP C++ C   +   +P+ D +++ I
Sbjct: 49  RDPLMLSCGHNFCEACIQDFWRLQAKETFCPECKMLCQYNNCTFNPVLDKLVEKI 103



>gb:AX969481_1484790 Sequence 284 from Patent EP1104808.
          Length = 106

 Score = 40.8 bits (94), Expect = 0.041
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 2/55 (3%)
 Frame = +2

Query: 806 RTRVVMGCQHRFCRECIDKSMRLGNNE--CPACRIHCARRSLRDDPIFDAIIQSI 964
           R  +++ C H FC  CI    RL   E  CP C++ C   +   +P+ D +++ I
Sbjct: 49  RDPLMLSCGHNFCEACIQDFWRLQAKETFCPECKMLCQYNNCTFNPVLDKLVEKI 103



>gb:AF502391_1277433 Heterodera glycines putative gland protein
           G10A06 mRNA, complete cds.
          Length = 308

 Score = 40.8 bits (94), Expect = 0.041
 Identities = 23/49 (46%), Positives = 28/49 (57%), Gaps = 4/49 (8%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHCARRSL----RDDPIFDAIIQS 961
           C HRF REC+D   +  N+ CP CR   A R L    R D IFDA I++
Sbjct: 210 CHHRFHRECVDGWFK-NNDTCPYCRAVVASRYLPRPTRTDRIFDARIEN 257



>gb:AY305385_1177707 Homo sapiens HSD-34 mRNA, complete cds.
          Length = 500

 Score = 40.8 bits (94), Expect = 0.041
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 2/55 (3%)
 Frame = +2

Query: 806 RTRVVMGCQHRFCRECIDKSMRLGNNE--CPACRIHCARRSLRDDPIFDAIIQSI 964
           R  +++ C H FC  CI    RL   E  CP C++ C   +   +P+ D +++ I
Sbjct: 49  RDPLMLSCGHNFCEACIQDFWRLQAKETFCPECKMLCQYNNCTFNPVLDKLVEKI 103



>gb:BC070792_2555761 Xenopus laevis ring finger protein (C3HC4 type)
           8, mRNA (cDNA clone MGC:83839 IMAGE:6643302), complete
           cds.
          Length = 532

 Score = 40.4 bits (93), Expect = 0.054
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 2/57 (3%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDKSMRLGNNECPACR--IHCARRSLRDDPIFDAIIQSIYPDVE 979
           V + C H FC  CI KS R    ECP CR  I    RSL  D   D+++  + P+++
Sbjct: 388 VTLNCAHSFCSYCI-KSWRKRKEECPICRQEILSETRSLVLDNCIDSMVDKLSPEMK 443



>pir|T41364|T41364 hypothetical protein SPCC4G3.12c - fission yeast 
           (Schizosaccharomyces pombe)>gb:SPCC4G3_1721358 S.pombe
           chromosome III cosmid c4G3.
          Length = 821

 Score = 40.4 bits (93), Expect = 0.054
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = +2

Query: 812 RVVMGCQHRFCRECIDKSMRLGNNECPACRIH 907
           R +  C+H F + CID+ +  GNN CP CR H
Sbjct: 780 RKLQACKHFFHQACIDQWLTTGNNSCPLCRAH 811



>gb:AY662643_2542633 Cordylus polyzonus recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 941

 Score = 40.0 bits (92), Expect = 0.070
 Identities = 15/28 (53%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +R+  + CPACR  C
Sbjct: 265 CKHLFCRVCIFKCLRVMGSYCPACRYPC 292



>gb:AE017347_1757678 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 666

 Score = 40.0 bits (92), Expect = 0.070
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 4/50 (8%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRT----RVVMGCQHRFCRECIDKSMRLGNNECPACR 901
           PI PS+  + C+I  +     + + C H FC  C+ K  + G  +CP CR
Sbjct: 561 PILPSLDDYACLICTSIAFKPIRLACGHLFCVRCLVKMQKAGKGKCPLCR 610



>gb:AY294955_2081734 Mesocricetus auratus recombination activating
           gene 1 (RAG1) gene, partial cds.
          Length = 1002

 Score = 39.7 bits (91), Expect = 0.092
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PAP   SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C
Sbjct: 250 PAPFVKSISCQICEHILADPVETSCKHVFCRICILRCLKVMGSYCPSCRYPC 301



>gb:AF274046_2061190 Mus musculus nuclear zinc finger protein Np95
           (Uhrf1) mRNA, complete cds.>gb:D87908_2112599 Mus
           musculus mRNA for nuclear protein np95, complete cds.
          Length = 782

 Score = 39.7 bits (91), Expect = 0.092
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHCARRS-LRDDPIFDAIIQSIYP 970
           CQH  C++C+D+S R     CPACR      S  R +     I+  ++P
Sbjct: 728 CQHNVCKDCLDRSFRAQVFSCPACRFELDHSSPTRVNQPLQTILNQLFP 776



>gb:AK025578_1910333 Homo sapiens cDNA: FLJ21925 fis, clone
           HEP04126.
          Length = 189

 Score = 39.7 bits (91), Expect = 0.092
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHCARR-SLRDDPIFDAIIQSIYP 970
           CQH  C++C+D+S R     CPACR    R  +++ +     ++  ++P
Sbjct: 135 CQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFP 183



>gb:AF274048_1894211 Homo sapiens nuclear zinc finger protein Np95
           (UHRF1) mRNA, complete cds.>gb:AY787925_1964836 Homo
           sapiens ubiquitin-like, containing PHD and RING finger
           domains, 1 (UHRF1) gene, complete cds.
          Length = 793

 Score = 39.7 bits (91), Expect = 0.092
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHCARR-SLRDDPIFDAIIQSIYP 970
           CQH  C++C+D+S R     CPACR    R  +++ +     ++  ++P
Sbjct: 739 CQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFP 787



>gb:AX063422_1458763 Sequence 7 from Patent WO0078949.
          Length = 174

 Score = 39.7 bits (91), Expect = 0.092
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHCARR-SLRDDPIFDAIIQSIYP 970
           CQH  C++C+D+S R     CPACR    R  +++ +     ++  ++P
Sbjct: 120 CQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFP 168



>gb:AX063416_1458760 Sequence 1 from Patent
           WO0078949.>gb:AF129507_1885332 Homo sapiens
           transcription factor ICBP90 (ICBP90) mRNA, complete cds.
          Length = 793

 Score = 39.7 bits (91), Expect = 0.092
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHCARR-SLRDDPIFDAIIQSIYP 970
           CQH  C++C+D+S R     CPACR    R  +++ +     ++  ++P
Sbjct: 739 CQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFP 787



>gb:AK075819_1171033 Mus musculus adult male small intestine cDNA,
           RIKEN full-length enriched library, clone:2010107E01
           product:nuclear protein 95, full insert sequence.
          Length = 299

 Score = 39.7 bits (91), Expect = 0.092
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHCARRS-LRDDPIFDAIIQSIYP 970
           CQH  C++C+D+S R     CPACR      S  R +     I+  ++P
Sbjct: 245 CQHNVCKDCLDRSFRAQVFSCPACRFELDHSSPTRVNQPLQTILNQLFP 293



>gb:BC046256_2549602 Xenopus laevis ring finger protein (C3HC4 type)
           8, mRNA (cDNA clone MGC:53317 IMAGE:5570590), complete
           cds.
          Length = 540

 Score = 39.3 bits (90), Expect = 0.12
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 2/57 (3%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDKSMRLGNNECPACR--IHCARRSLRDDPIFDAIIQSIYPDVE 979
           V + C H FC  CI KS +    ECP CR  I    RSL  D   D+++  + P+++
Sbjct: 393 VTLNCAHSFCSYCI-KSWKKRKEECPICRQEIVTETRSLVLDNCIDSMVDKLSPEMK 448



>gb:AY662644_2542634 Zonosaurus sp. TMT-2004b recombination
           activating gene 1 (RAG-1) gene, partial cds.
          Length = 973

 Score = 39.3 bits (90), Expect = 0.12
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           V   C+H FCR CI K  R+  + CPACR  C
Sbjct: 273 VEAACKHLFCRVCILKCFRVMGSYCPACRYPC 304



>gb:AY662599_2542589 Basiliscus plumifrons recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 925

 Score = 39.3 bits (90), Expect = 0.12
 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PA    SI   +C  I    V   C+H FCR CI K +++  + CPACR  C
Sbjct: 253 PADFVKSISCQICEHILADPVETTCKHLFCRTCILKCLKVMGSYCPACRYPC 304



>gb:AY662596_2542586 Uracentron flaviceps recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 945

 Score = 39.3 bits (90), Expect = 0.12
 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PA    SI   +C  I    V   C+H FCR CI K +++  + CPACR  C
Sbjct: 253 PADFVKSISCQICEHILADPVETTCKHLFCRACILKCLKVMGSYCPACRYPC 304



>gb:AY662591_2542581 Sauromalus ater recombination activating gene 1
           (RAG-1) gene, partial cds.
          Length = 938

 Score = 39.3 bits (90), Expect = 0.12
 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PA    SI   +C  I    V   C+H FCR CI K +++  + CPACR  C
Sbjct: 238 PADFVKSISCQICEHILADPVETTCKHLFCRACILKCLKVMGSYCPACRYPC 289



>gb:AY662589_2542579 Anolis paternus recombination activating gene 1
           (RAG-1) gene, partial cds.
          Length = 945

 Score = 39.3 bits (90), Expect = 0.12
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CPACR  C
Sbjct: 277 CKHLFCRACILKCLKIMGSYCPACRYPC 304



>gb:BC022167_2093774 Mus musculus ubiquitin-like, containing PHD and
           RING finger domains, 1, mRNA (cDNA clone MGC:13771
           IMAGE:4017286), complete cds.
          Length = 782

 Score = 39.3 bits (90), Expect = 0.12
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHCARRS-LRDDPIFDAIIQSIYP 970
           CQH  C++C+D+S R     CPACR      S  R +     I+  ++P
Sbjct: 728 CQHNVCKDCLDRSFRAQVFSCPACRYELDHSSPTRVNQPLQTILNQLFP 776



>gb:AY249876_1427999 Tupaia tana recombination activating protein 1
           (RAG1) gene, partial cds.
          Length = 187

 Score = 39.3 bits (90), Expect = 0.12
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           V   C+H FCR CI + +R+  + CPACR  C
Sbjct: 120 VETACKHVFCRVCILRCLRVVGSHCPACRYPC 151



>gb:AY662642_2542632 Xantusia vigilis recombination activating gene
           1 (RAG-1) gene, partial cds.
          Length = 961

 Score = 38.9 bits (89), Expect = 0.16
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHCARRSLR 928
           C+H FCR CI K +R+  + CP+CR  C    L+
Sbjct: 277 CKHLFCRVCILKCLRVMGSYCPSCRYPCFPTDLK 310



>gb:AY662598_2542588 Leiocephalus carinatus recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 945

 Score = 38.9 bits (89), Expect = 0.16
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CPACR  C
Sbjct: 277 CKHLFCRTCILKCLKVMGSYCPACRYPC 304



>gb:AY662597_2542587 Stenocercus crassicaudatus recombination
           activating gene 1 (RAG-1) gene, partial cds.
          Length = 973

 Score = 38.9 bits (89), Expect = 0.16
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CPACR  C
Sbjct: 277 CKHLFCRTCILKCLKVMGSYCPACRYPC 304



>gb:AY662593_2542583 Enyalioides laticeps recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 930

 Score = 38.9 bits (89), Expect = 0.16
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CPACR  C
Sbjct: 262 CKHLFCRACILKCLKVMGSYCPACRYPC 289



>gb:AY662592_2542582 Hoplocercus spinosus recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 973

 Score = 38.9 bits (89), Expect = 0.16
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CPACR  C
Sbjct: 277 CKHLFCRACILKCLKVMGSYCPACRYPC 304



>gb:AY648713_2541541 Danio rerio NP95 mRNA, complete cds.
          Length = 776

 Score = 38.9 bits (89), Expect = 0.16
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 5/66 (7%)
 Frame = +2

Query: 788 FLCI----IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARR-SLRDDPIFDAI 952
           FLCI    +    +   CQH  CREC+ +S +     CPACR    +   +  +    AI
Sbjct: 704 FLCICCQEVVYQPITTECQHNVCRECLQRSFKAEVYTCPACRHDLGKNYQMAVNKPLQAI 763

Query: 953 IQSIYP 970
           +  ++P
Sbjct: 764 LTQLFP 769



>gb:AF355273_2489086 Gallus gallus breast and ovarian cancer
           susceptibility-like protein (BRCA1) mRNA, complete cds.
          Length = 1749

 Score = 38.9 bits (89), Expect = 0.16
 Identities = 19/80 (23%), Positives = 38/80 (47%), Gaps = 3/80 (3%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSM---RLGNNECPACRIHCARRSL 925
           +  P+C  ++       +  V   C H FCR C+ K +   + G  +CP C+    +RSL
Sbjct: 22  LECPVCLDVI-------KEPVSTKCDHVFCRFCMFKLLSRKKKGVIQCPLCKTEVTKRSL 74

Query: 926 RDDPIFDAIIQSIYPDVEKY 985
           +++  F  +I+ +   +  +
Sbjct: 75  KENSRFKQLIEGLLEAISAF 94



>gb:AY589041_1957235 Macaca mulatta breast cancer type 1 (BRCA1)
           gene, complete cds.
          Length = 1863

 Score = 38.9 bits (89), Expect = 0.16
 Identities = 19/72 (26%), Positives = 36/72 (50%), Gaps = 2/72 (2%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDK--SMRLGNNECPACRIHCARRSLR 928
           +  PIC  ++       +  V   C H FCR C+ K  + + G ++CP C+    +RSL+
Sbjct: 22  LECPICLELI-------KEPVSTKCDHIFCRFCMLKLLNQKKGPSQCPLCKNDITKRSLQ 74

Query: 929 DDPIFDAIIQSI 964
           +   F  +++ +
Sbjct: 75  ESTRFSQLVEEL 86



>gb:CAC20C1_1644753 C.albicans cosmid Ca20C1.
          Length = 378

 Score = 38.9 bits (89), Expect = 0.16
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDDPIFDAIIQS 961
           C H +C +CI +   L +N CP C+       L+ DP+ + I+ S
Sbjct: 44  CDHTYCSQCI-REFLLRDNRCPLCKTEVFESGLKRDPLLEEIVVS 87



>gb:AY312278_1428790 Bos taurus Ro52/SS-A autoantigen mRNA, complete
           cds.
          Length = 469

 Score = 38.9 bits (89), Expect = 0.16
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHCARRSLR 928
           C H FC+ECI +  + G + CP CR H   ++LR
Sbjct: 31  CGHSFCQECISEVGKEGGSVCPVCRRHFLLQNLR 64



>gb:AY239184_1427658 Equus grevyi recombination activating protein 1
           (RAG-1) gene, partial cds.
          Length = 298

 Score = 38.9 bits (89), Expect = 0.16
 Identities = 25/72 (34%), Positives = 38/72 (52%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    VV  C+H FCR CI + +++  + CP+CR  C    L + 
Sbjct: 126 PAHFVKSISCQICEHILADPVVTSCKHVFCRICILRCLKVMGSYCPSCRYPCFPTDL-ES 184

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 185 PVKSFLSILNSL 196



>gb:AY321334_1177780 Rattus norvegicus Ac2-121 mRNA, complete cds.
          Length = 829

 Score = 38.9 bits (89), Expect = 0.16
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHCARRS-LRDDPIFDAIIQSIYP 970
           CQH  C++C+D+S R     CPACR      S  R +     I+  ++P
Sbjct: 775 CQHNVCKDCLDRSFRAQVFSCPACRYDLDHSSPTRVNQPLQTILNQLFP 823



>sp|Q95153|BRC1_CANFA Breast cancer type 1 susceptibility protein
           homolog.>gb:CFU50709_1438756 Canis familiaris BRCA1
           homolog gene, complete cds.
          Length = 1878

 Score = 38.9 bits (89), Expect = 0.16
 Identities = 19/72 (26%), Positives = 36/72 (50%), Gaps = 2/72 (2%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDK--SMRLGNNECPACRIHCARRSLR 928
           +  PIC  ++       +  V   C H FC+ C+ K  + R G ++CP C+    +RSL+
Sbjct: 22  LECPICLELI-------KEPVSTKCDHIFCKFCMLKLLNQRKGPSQCPLCKNDITKRSLQ 74

Query: 929 DDPIFDAIIQSI 964
           +   F  +++ +
Sbjct: 75  ESTRFSQLVEEL 86



>gb:BC089632_2566182 Xenopus tropicalis cDNA clone MGC:107803
           IMAGE:7021088, complete cds.
          Length = 242

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 1/39 (2%)
 Frame = +2

Query: 791 LCIIKRTRVVMGCQHRFCRECIDK-SMRLGNNECPACRI 904
           +C+  R  +++ C H FC++CIDK S R  N  CP CR+
Sbjct: 167 ICMDGRADLILPCAHSFCQKCIDKWSDR--NRNCPICRL 203



>gb:BC058055_2552244 Danio rerio ubiquitin-like, containing PHD and
           RING finger domains, 1, mRNA (cDNA clone MGC:63539
           IMAGE:3815965), complete cds.
          Length = 775

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 4/42 (9%)
 Frame = +2

Query: 788 FLCI----IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACR 901
           FLCI    +    +   CQH  CREC+ +S +     CPACR
Sbjct: 703 FLCICCQEVVYQPITTECQHNVCRECLQRSFKAEVYTCPACR 744



>gb:AY662600_2542590 Gambelia wislizenii recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 925

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 26/72 (36%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    V   C+H FCR CI KS+++  + CPAC   C    L + 
Sbjct: 253 PADFVKSISCQICDHILADPVETTCKHLFCRTCILKSLKVMGSYCPACCYPCFPTDL-ES 311

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 312 PVKSFLSILNSL 323



>gb:AY662594_2542584 Phymaturus somuncurensis recombination
           activating gene 1 (RAG-1) gene, partial cds.
          Length = 945

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 14/28 (50%), Positives = 18/28 (64%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C H FCR CI K +++  + CPACR  C
Sbjct: 277 CSHLFCRACILKCLKVMGSYCPACRYPC 304



>gb:AY662588_2542578 Uromastyx acanthinura recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 945

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CPACR  C
Sbjct: 277 CRHLFCRACILKCIKVMGSYCPACRYPC 304



>gb:AY662583_2542573 Hydrosaurus sp. TMT-2004a recombination
           activating gene 1 (RAG-1) gene, partial cds.
          Length = 953

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CPACR  C
Sbjct: 277 CKHLFCRACILKCIKVMGSYCPACRYPC 304



>gb:AY662582_2542572 Physignathus cocincinus recombination
           activating gene 1 (RAG-1) gene, partial cds.
          Length = 945

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CPACR  C
Sbjct: 277 CKHLFCRACILKCIKVMGSYCPACRYPC 304



>gb:AY662581_2542571 Physignathus lesueurii recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 945

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CPACR  C
Sbjct: 277 CKHLFCRACILKCIKVMGSYCPACRYPC 304



>gb:AP005196_1849269 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0580A11.
          Length = 569

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 1/31 (3%)
 Frame = +2

Query: 815 VVMGCQHRFCREC-IDKSMRLGNNECPACRI 904
           VV  C+H FC+ C ID S  LGN  CP+C +
Sbjct: 327 VVTSCEHVFCKNCLIDYSATLGNVSCPSCSV 357



>gb:CR382131_1664644 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 716

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 19/49 (38%), Positives = 24/49 (48%), Gaps = 4/49 (8%)
 Frame = +2

Query: 767 ICPSIVGFLCIIKRTRVV----MGCQHRFCRECIDKSMRLGNNECPACR 901
           I P I  +LC I  +  V    + C H FC  C+ K  R G + CP CR
Sbjct: 613 IVPQIDDYLCPICSSIAVKPIRLSCNHVFCVRCLVKLQRKGEDRCPLCR 661



>gb:AY249881_1428001 Ochotona princeps recombination activating
           protein 1 (RAG1) gene, partial cds.
          Length = 268

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PAP   SI   +C  I    V   C+H FCR CI + +++  + CP+C+  C
Sbjct: 107 PAPFVKSISCQICEHILADPVETSCKHVFCRVCILRCLKVMGSYCPSCQYPC 158



>gb:BC071534_2556270 Danio rerio zgc:86917, mRNA (cDNA clone
           MGC:86917 IMAGE:6905814), complete cds.
          Length = 222

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 15/38 (39%), Positives = 23/38 (60%)
 Frame = +2

Query: 791 LCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRI 904
           +C+  +  +++ C H FC++CIDK      N CP CRI
Sbjct: 149 ICMDGKADLILPCAHSFCQKCIDKWSGQSRN-CPVCRI 185



>gb:AY662627_2542617 Crenadactylus ocellatus recombination
           activating gene 1 (RAG-1) gene, partial cds.
          Length = 944

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CPACR  C
Sbjct: 276 CKHLFCRLCIVKCLKVIGSYCPACRYPC 303



>gb:AY662622_2542612 Eublepharis turcmenicus recombination
           activating gene 1 (RAG-1) gene, partial cds.
          Length = 962

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PA    SI   +C  I    V   C+H FCR CI K +++  + CPACR  C
Sbjct: 242 PADFVKSISCQICEHILADPVETTCKHLFCRLCILKCLKVIGSYCPACRYPC 293



>gb:AY662608_2542598 Varanus griseus recombination activating gene 1
           (RAG-1) gene, partial cds.
          Length = 973

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           V   C+H FCR CI K +++  + CP+CR  C
Sbjct: 273 VEAACKHLFCRVCIFKCLKVMGSYCPSCRYPC 304



>gb:AY662605_2542595 Anniella pulchra recombination activating gene
           1 (RAG-1) gene, partial cds.
          Length = 946

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 2/48 (4%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDDPI--FDAIIQSI 964
           C+H FCR CI K +++  + CP+CR  C    L + P+  F +I+ S+
Sbjct: 278 CKHLFCRVCILKCLKVMGSYCPSCRYPCFPTDL-ESPVKSFMSILNSL 324



>gb:AY621088_2540693 Danio rerio RNF141 protein mRNA, partial cds.
          Length = 222

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 15/38 (39%), Positives = 23/38 (60%)
 Frame = +2

Query: 791 LCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRI 904
           +C+  +  +++ C H FC++CIDK      N CP CRI
Sbjct: 149 ICMDGKADLILPCAHSFCQKCIDKWSGQSRN-CPVCRI 185



>gb:AY428536_2532323 Tetraodon nigroviridis breast cancer 1 (BRCA1)
           mRNA, complete cds.
          Length = 1267

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 3/56 (5%)
 Frame = +2

Query: 827 CQHRFCRECIDKSM---RLGNNECPACRIHCARRSLRDDPIFDAIIQSIYPDVEKY 985
           C H+FCR C+ K +   +     CP C+    +RSL++ P F  ++  +   +  Y
Sbjct: 37  CDHQFCRFCMLKLLSNTKQNKANCPVCKSKITKRSLQESPGFQRLVSGLQEIILAY 92



>gb:BT007862_2150794 Synthetic construct Homo sapiens STRIN protein
           mRNA, partial cds.
          Length = 246

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 18/52 (34%), Positives = 24/52 (46%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARR 919
           P+C  +      +K       CQH FCR+C   +MR     CP CR +  RR
Sbjct: 19  PVCQEV------LKTPVRTTACQHVFCRKCFLTAMRESGAHCPLCRGNVTRR 64



>gb:AY241496_2080441 Protoxerus stangeri RAG1 protein (RAG1) gene,
           partial cds.
          Length = 701

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 25/72 (34%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    V   CQH FCR CI + +++  + CP+CR  C    L + 
Sbjct: 243 PAHFVKSISCQICEHILADPVETSCQHVFCRICILRCLKVMGSYCPSCRYPCFPTDL-ES 301

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 302 PVKSFLSILNSL 313



>gb:AY241464_2080409 Microtus irene RAG1 protein (RAG1) gene,
           partial cds.
          Length = 706

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PAP   +I   +C  I    V   C+H FCR CI + +++  + CP+CR  C    L + 
Sbjct: 246 PAPFVKAISCQICEHILADPVETTCKHVFCRICILRCLKVMGSYCPSCRYPCFPTDL-ES 304

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 305 PVKSFLSILNSL 316



>gb:BC018107_1976414 Homo sapiens ring finger protein 138,
           transcript variant 1, mRNA (cDNA clone MGC:8758
           IMAGE:3914953), complete cds.>gb:BT006878_1990316 Homo
           sapiens STRIN protein mRNA, complete
           cds.>gb:CR457150_1993357 Homo sapiens full open reading
           frame cDNA clone RZPDo834B048D for gene RNF138, ring
           finger protein 138; complete cds, incl. stopcodon.
          Length = 245

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 18/52 (34%), Positives = 24/52 (46%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARR 919
           P+C  +      +K       CQH FCR+C   +MR     CP CR +  RR
Sbjct: 19  PVCQEV------LKTPVRTTACQHVFCRKCFLTAMRESGAHCPLCRGNVTRR 64



>gb:AF162680_1887102 Homo sapiens HSD-4 protein (HSD-4) mRNA,
           complete cds.
          Length = 245

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 18/52 (34%), Positives = 24/52 (46%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARR 919
           P+C  +      +K       CQH FCR+C   +MR     CP CR +  RR
Sbjct: 19  PVCQEV------LKTPVRTTACQHVFCRKCFLTAMRESGAHCPLCRGNVTRR 64



>gb:AE017349_1758747 Cryptococcus neoformans var. neoformans JEC21
           chromosome 9, complete sequence.
          Length = 820

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 11/41 (26%), Positives = 26/41 (63%)
 Frame = +2

Query: 806 RTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLR 928
           + +V++ C H FC++C+++ +     +CPAC +  A+  ++
Sbjct: 775 KQQVIVKCMHTFCKQCLEQRIASRQRKCPACGLAFAKEDIQ 815



>gb:AY249882_1428002 Amblysomus hottentotus recombination activating
           protein 1 (RAG1) gene, partial cds.
          Length = 269

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           V   C+H FCR CI + +++  N CP+CR  C
Sbjct: 128 VETSCKHVFCRVCILRCLKVMGNYCPSCRYPC 159



>gb:AY662630_2542620 Ctenotus robustus recombination activating gene
           1 (RAG-1) gene, partial cds.
          Length = 973

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PA    SI   +C  I    V   C+H FCR CI K +++  + CP+CR  C
Sbjct: 253 PADFVKSISCQICEHILADPVETTCKHLFCRVCILKCLKVMGSYCPSCRYPC 304



>gb:AY662625_2542615 Gekko gecko recombination activating gene 1
           (RAG-1) gene, partial cds.
          Length = 941

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP+CR  C
Sbjct: 273 CKHLFCRHCILKCLKVIGSYCPSCRYPC 300



>gb:AY662618_2542608 Rhineura floridana recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 972

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP+CR  C
Sbjct: 276 CKHLFCRVCILKCLKIMGSYCPSCRYPC 303



>gb:AY662617_2542607 Trogonophis wiegmanni recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 973

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP+CR  C
Sbjct: 277 CKHLFCRVCILKCLKIMGSYCPSCRYPC 304



>gb:AY662607_2542597 Xenosaurus grandis recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 974

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 2/48 (4%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDDPI--FDAIIQSI 964
           C+H FCR CI K +++  + CP+CR  C    L + P+  F +I+ S+
Sbjct: 278 CKHLFCRVCILKCLKVMGSYCPSCRYPCFPTDL-ESPVKSFLSILNSL 324



>gb:AY662586_2542576 Phrynocephalus raddei recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 973

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR C+ K +++  + CPACR  C
Sbjct: 277 CKHLFCRACLLKCLKVMGSFCPACRYPC 304



>gb:AY662576_2542566 Sphenodon punctatus recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 941

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP+CR  C
Sbjct: 274 CKHLFCRTCILKCLKVMGSYCPSCRYPC 301



>gb:AF022391_2180250 Feline herpesvirus 1 immediate early protein,
           glycoprotein gL, and uracil DNA glycosylase genes,
           complete cds.
          Length = 498

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 3/58 (5%)
 Frame = +2

Query: 821 MGCQHRFCRECIDKSMRLGNNECPACR--IHCARRSLRDDPIFDAI-IQSIYPDVEKY 985
           M C H+FC  C+ + + L NN+CP C+  +     S+ DD IF+   + S + + E+Y
Sbjct: 22  MPCLHKFCYSCLSRWVGL-NNKCPLCKTSVTSLIHSIEDDKIFEETKLYSPHREEEEY 78



>gb:RNU60523_2137527 Rattus norvegicus Brca1 mRNA, partial
           cds.>gb:S82500_2139778 Rattus norvegicus Brca1 (Brca1)
           gene, partial cds.
          Length = 215

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 18/79 (22%), Positives = 38/79 (48%), Gaps = 2/79 (2%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDK--SMRLGNNECPACRIHCARRSLR 928
           +  PIC  ++       +  V   C H FC+ C+ K  + + G ++CP C+    +RSL+
Sbjct: 15  LECPICLELI-------KEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNEITKRSLQ 67

Query: 929 DDPIFDAIIQSIYPDVEKY 985
               F  +++ +   ++ +
Sbjct: 68  GSARFSQLVEELLKIIDAF 86



>gb:AY294953_2081732 Ondatra zibethicus recombination activating
           gene 1 (RAG1) gene, partial cds.
          Length = 992

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PAP   +I   +C  I    V   C+H FCR CI + +++  + CP+CR  C
Sbjct: 241 PAPFVKAISCQICEHILADPVETTCKHVFCRICILRCLKVMGSYCPSCRYPC 292



>gb:HSU64805_2025481 Homo sapiens Brca1-delta11b (Brca1) mRNA,
           complete cds.
          Length = 759

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 2/72 (2%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDK--SMRLGNNECPACRIHCARRSLR 928
           +  PIC  ++       +  V   C H FC+ C+ K  + + G ++CP C+    +RSL+
Sbjct: 22  LECPICLELI-------KEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQ 74

Query: 929 DDPIFDAIIQSI 964
           +   F  +++ +
Sbjct: 75  ESTRFSQLVEEL 86



>gb:BC085615_1989924 Homo sapiens breast cancer 1, early onset, mRNA
           (cDNA clone IMAGE:6042052), partial cds.
          Length = 624

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 2/72 (2%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDK--SMRLGNNECPACRIHCARRSLR 928
           +  PIC  ++       +  V   C H FC+ C+ K  + + G ++CP C+    +RSL+
Sbjct: 22  LECPICLELI-------KEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQ 74

Query: 929 DDPIFDAIIQSI 964
           +   F  +++ +
Sbjct: 75  ESTRFSQLVEEL 86



>gb:BC072418_1988987 Homo sapiens breast cancer 1, early onset, mRNA
           (cDNA clone IMAGE:6181860), complete cds.
          Length = 699

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 2/72 (2%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDK--SMRLGNNECPACRIHCARRSLR 928
           +  PIC  ++       +  V   C H FC+ C+ K  + + G ++CP C+    +RSL+
Sbjct: 22  LECPICLELI-------KEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQ 74

Query: 929 DDPIFDAIIQSI 964
           +   F  +++ +
Sbjct: 75  ESTRFSQLVEEL 86



>gb:BA000041_1966283 Pan troglodytes DNA, major histocompatibility
           complex class I region.
          Length = 420

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 8/48 (16%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDK--------SMRLGNNECPACRIHCARRSLRDD 934
           V++ C+H FCR C+ +                CP C + C RRSLR +
Sbjct: 99  VLLACEHSFCRACLARRWGTPPATGTEASPTACPCCGLPCPRRSLRSN 146



>gb:AY751490_1961698 Homo sapiens breast and ovarian cancer
           susceptibility protein (BRCA1) mRNA,
           BRCA1-2201T/2430C/2731T/3232G/3667G/4427C/4956G allele,
           partial cds.
          Length = 1841

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 2/72 (2%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDK--SMRLGNNECPACRIHCARRSLR 928
           +  PIC  ++       +  V   C H FC+ C+ K  + + G ++CP C+    +RSL+
Sbjct: 22  LECPICLELI-------KEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQ 74

Query: 929 DDPIFDAIIQSI 964
           +   F  +++ +
Sbjct: 75  ESTRFSQLVEEL 86



>gb:AY589042_1957236 Gorilla gorilla breast cancer type 1 (BRCA1)
           gene, complete cds.
          Length = 1863

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 2/72 (2%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDK--SMRLGNNECPACRIHCARRSLR 928
           +  PIC  ++       +  V   C H FC+ C+ K  + + G ++CP C+    +RSL+
Sbjct: 22  LECPICLELI-------KEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQ 74

Query: 929 DDPIFDAIIQSI 964
           +   F  +++ +
Sbjct: 75  ESTRFSQLVEEL 86



>gb:AY589040_1957234 Pongo pygmaeus breast cancer type 1 (BRCA1)
           gene, complete cds.
          Length = 1863

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 2/72 (2%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDK--SMRLGNNECPACRIHCARRSLR 928
           +  PIC  ++       +  V   C H FC+ C+ K  + + G ++CP C+    +RSL+
Sbjct: 22  LECPICLELI-------KEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQ 74

Query: 929 DDPIFDAIIQSI 964
           +   F  +++ +
Sbjct: 75  ESTRFSQLVEEL 86



>gb:AY365046_1948079 Pan troglodytes BRCA1 (BRCA1) gene, complete
           cds.
          Length = 1863

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 2/72 (2%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDK--SMRLGNNECPACRIHCARRSLR 928
           +  PIC  ++       +  V   C H FC+ C+ K  + + G ++CP C+    +RSL+
Sbjct: 22  LECPICLELI-------KEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQ 74

Query: 929 DDPIFDAIIQSI 964
           +   F  +++ +
Sbjct: 75  ESTRFSQLVEEL 86



>gb:AY354539_1946931 Homo sapiens IRIS mRNA, complete cds;
           alternatively spliced.
          Length = 1399

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 2/72 (2%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDK--SMRLGNNECPACRIHCARRSLR 928
           +  PIC  ++       +  V   C H FC+ C+ K  + + G ++CP C+    +RSL+
Sbjct: 22  LECPICLELI-------KEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQ 74

Query: 929 DDPIFDAIIQSI 964
           +   F  +++ +
Sbjct: 75  ESTRFSQLVEEL 86



>gb:AL845439_1933148 Human DNA sequence from clone DAQB-215D11 on
           chromosome 6, complete sequence.
          Length = 420

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 8/48 (16%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDK--------SMRLGNNECPACRIHCARRSLRDD 934
           V++ C+H FCR C+ +                CP C + C RRSLR +
Sbjct: 99  VLLACEHSFCRACLARRWGTPPATGTEASPTACPCCGLPCPRRSLRSN 146



>gb:AL845439_1933147 Human DNA sequence from clone DAQB-215D11 on
           chromosome 6, complete sequence.
          Length = 354

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 8/48 (16%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDK--------SMRLGNNECPACRIHCARRSLRDD 934
           V++ C+H FCR C+ +                CP C + C RRSLR +
Sbjct: 99  VLLACEHSFCRACLARRWGTPPATGTEASPTACPCCGLPCPRRSLRSN 146



>gb:AL845439_1933146 Human DNA sequence from clone DAQB-215D11 on
           chromosome 6, complete sequence.
          Length = 251

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 8/48 (16%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDK--------SMRLGNNECPACRIHCARRSLRDD 934
           V++ C+H FCR C+ +                CP C + C RRSLR +
Sbjct: 99  VLLACEHSFCRACLARRWGTPPATGTEASPTACPCCGLPCPRRSLRSN 146



>gb:AL671859_1932237 Human DNA sequence from clone XXbac-218N7 on
           chromosome 6 contains the 5' end of the gene for HTEX4,
           4.3 and 6, a eukaryotic translation termination factor 1
           (ETF1) pseudogene, the ZNRD1 gene for zinc ribbon domain
           containing 1, the PPP1R11 gene for protein phosphatase
           1, regulatory (inhibitor) subunit 11, the HZFW1 gene for
           HZFW1 protein, the TRIM31, TRIM40 and TRIM10 genes for
           tripartite motif-containing 31,40 and 10 and four CpG
           islands, complete sequence.
          Length = 251

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 8/48 (16%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDK--------SMRLGNNECPACRIHCARRSLRDD 934
           V++ C+H FCR C+ +                CP C + C RRSLR +
Sbjct: 99  VLLACEHSFCRACLARRWGTPPATGTEASPTACPCCGLPCPRRSLRSN 146



>gb:AL669914_1932060 Human DNA sequence from clone XXbac-250I8 on
           chromosome 6 contains a major histocompatibility
           complex, class I, J pseudogene, the gene for HCGVIII
           protein, the genes for HTEX4, 4.3 and 6, a eukaryotic
           translation termination factor 1 (ETF1) pseudogene, the
           ZNRD1 gene for zinc ribbon domain containing, 1 , the
           PPP1R11 gene for protein phosphatase 1, regulatory
           (inhibitor) subunit 11, the HZFW1 gene for HZFW1
           protein, the TRIM31 gene for tripartite motif containing
           31, the TRIM40 gene for tripartite morif-containing 40,
           the TRIM10 gene for tripartite motif containing 10, the
           5' end of the TRIM15 gene for tripartite
           motif-containing 15 and five CpG islands, complete
           sequence.>gb:AL671859_1932238 Human DNA sequence from
           clone XXbac-218N7 on chromosome 6 contains the 5' end of
           the gene for HTEX4, 4.3 and 6, a eukaryotic translation
           termination factor 1 (ETF1) pseudogene, the ZNRD1 gene
           for zinc ribbon domain containing 1, the PPP1R11 gene
           for protein phosphatase 1, regulatory (inhibitor)
           subunit 11, the HZFW1 gene for HZFW1 protein, the
           TRIM31, TRIM40 and TRIM10 genes for tripartite
           motif-containing 31,40 and 10 and four CpG islands,
           complete sequence.
          Length = 354

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 8/48 (16%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDK--------SMRLGNNECPACRIHCARRSLRDD 934
           V++ C+H FCR C+ +                CP C + C RRSLR +
Sbjct: 99  VLLACEHSFCRACLARRWGTPPATGTEASPTACPCCGLPCPRRSLRSN 146



>gb:AL669914_1932059 Human DNA sequence from clone XXbac-250I8 on
           chromosome 6 contains a major histocompatibility
           complex, class I, J pseudogene, the gene for HCGVIII
           protein, the genes for HTEX4, 4.3 and 6, a eukaryotic
           translation termination factor 1 (ETF1) pseudogene, the
           ZNRD1 gene for zinc ribbon domain containing, 1 , the
           PPP1R11 gene for protein phosphatase 1, regulatory
           (inhibitor) subunit 11, the HZFW1 gene for HZFW1
           protein, the TRIM31 gene for tripartite motif containing
           31, the TRIM40 gene for tripartite morif-containing 40,
           the TRIM10 gene for tripartite motif containing 10, the
           5' end of the TRIM15 gene for tripartite
           motif-containing 15 and five CpG islands, complete
           sequence.
          Length = 251

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 8/48 (16%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDK--------SMRLGNNECPACRIHCARRSLRDD 934
           V++ C+H FCR C+ +                CP C + C RRSLR +
Sbjct: 99  VLLACEHSFCRACLARRWGTPPATGTEASPTACPCCGLPCPRRSLRSN 146



>gb:AF238317_1892407 Homo sapiens HZFw3 protein mRNA, complete cds.
          Length = 256

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 8/48 (16%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDK--------SMRLGNNECPACRIHCARRSLRDD 934
           V++ C+H FCR C+ +                CP C + C RRSLR +
Sbjct: 99  VLLACEHSFCRACLARRWGTPPATGTEASPTACPCCGLPCPRRSLRSN 146



>gb:AF238316_1892406 Homo sapiens HZFw2 protein mRNA, complete cds.
          Length = 354

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 8/48 (16%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDK--------SMRLGNNECPACRIHCARRSLRDD 934
           V++ C+H FCR C+ +                CP C + C RRSLR +
Sbjct: 99  VLLACEHSFCRACLARRWGTPPATGTEASPTACPCCGLPCPRRSLRSN 146



>gb:AF238315_1892405 Homo sapiens HZFw1 protein mRNA, complete cds.
          Length = 420

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 8/48 (16%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDK--------SMRLGNNECPACRIHCARRSLRDD 934
           V++ C+H FCR C+ +                CP C + C RRSLR +
Sbjct: 99  VLLACEHSFCRACLARRWGTPPATGTEASPTACPCCGLPCPRRSLRSN 146



>gb:AF207822_1889989 Pan troglodytes BRCA1 (BRCA1) mRNA, partial
           cds.
          Length = 1863

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 2/72 (2%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDK--SMRLGNNECPACRIHCARRSLR 928
           +  PIC  ++       +  V   C H FC+ C+ K  + + G ++CP C+    +RSL+
Sbjct: 22  LECPICLELI-------KEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQ 74

Query: 929 DDPIFDAIIQSI 964
           +   F  +++ +
Sbjct: 75  ESTRFSQLVEEL 86



>gb:AB128049_1873990 Macaca mulatta genes, MHC class I region,
           partial and complete cds.
          Length = 420

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 8/48 (16%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDK--------SMRLGNNECPACRIHCARRSLRDD 934
           V++ C+H FCR C+ +                CP C + C RRSLR +
Sbjct: 99  VLLACEHSFCRACLARRWGTPPATDTEASPTACPCCGLPCPRRSLRSN 146



>gb:AB088087_1872099 Homo sapiens HCGVII, HTEX4,HTEX6A, HCGV, HZFW1,
           HZFC2 genes.>gb:AL669914_1932061 Human DNA sequence from
           clone XXbac-250I8 on chromosome 6 contains a major
           histocompatibility complex, class I, J pseudogene, the
           gene for HCGVIII protein, the genes for HTEX4, 4.3 and
           6, a eukaryotic translation termination factor 1 (ETF1)
           pseudogene, the ZNRD1 gene for zinc ribbon domain
           containing, 1 , the PPP1R11 gene for protein phosphatase
           1, regulatory (inhibitor) subunit 11, the HZFW1 gene for
           HZFW1 protein, the TRIM31 gene for tripartite motif
           containing 31, the TRIM40 gene for tripartite
           morif-containing 40, the TRIM10 gene for tripartite
           motif containing 10, the 5' end of the TRIM15 gene for
           tripartite motif-containing 15 and five CpG islands,
           complete sequence.>gb:AL671859_1932239 Human DNA
           sequence from clone XXbac-218N7 on chromosome 6 contains
           the 5' end of the gene for HTEX4, 4.3 and 6, a
           eukaryotic translation termination factor 1 (ETF1)
           pseudogene, the ZNRD1 gene for zinc ribbon domain
           containing 1, the PPP1R11 gene for protein phosphatase
           1, regulatory (inhibitor) subunit 11, the HZFW1 gene for
           HZFW1 protein, the TRIM31, TRIM40 and TRIM10 genes for
           tripartite motif-containing 31,40 and 10 and four CpG
           islands, complete sequence.>gb:BA000025_1966205 Homo
           sapiens genomic DNA, chromosome 6p21.3, HLA Class I
           region.
          Length = 420

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 8/48 (16%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDK--------SMRLGNNECPACRIHCARRSLRDD 934
           V++ C+H FCR C+ +                CP C + C RRSLR +
Sbjct: 99  VLLACEHSFCRACLARRWGTPPATGTEASPTACPCCGLPCPRRSLRSN 146



>gb:AY085755_1570822 Arabidopsis thaliana clone 17759 mRNA, complete
           sequence.
          Length = 365

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 11/28 (39%), Positives = 20/28 (71%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDKSMRLGNNECPAC 898
           V++ C H FC++CI +S+ + + +CP C
Sbjct: 324 VIVKCYHLFCQQCIQRSLEIRHRKCPGC 351



>gb:AY249872_1427996 Scalopus aquaticus recombination activating
           protein 1 (RAG1) gene, partial cds.
          Length = 269

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 25/72 (34%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP CR  C    L D 
Sbjct: 110 PAHFVKSISCQICEHILADPVETSCKHVFCRICILRCLKVMGSYCPCCRYPCFPTDL-DS 168

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 169 PVKSFLSILNSL 180



>gb:AY077732_1424730 Bos taurus breast and ovarian cancer
           susceptibility protein (BRCA1) mRNA, complete cds.
          Length = 1849

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 2/72 (2%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDK--SMRLGNNECPACRIHCARRSLR 928
           +  PIC  ++       +  V   C H FC+ C+ K  + + G ++CP C+    +RSL+
Sbjct: 22  LECPICLELI-------KEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQ 74

Query: 929 DDPIFDAIIQSI 964
           +   F  +++ +
Sbjct: 75  ESTRFSQLVEEL 86



>gb:AF479649_1420917 Bos taurus breast and ovarian cancer
           susceptibility protein variant BRCA1-delta 11b (BRCA1)
           mRNA, complete cds, alternatively spliced.
          Length = 752

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 2/72 (2%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDK--SMRLGNNECPACRIHCARRSLR 928
           +  PIC  ++       +  V   C H FC+ C+ K  + + G ++CP C+    +RSL+
Sbjct: 22  LECPICLELI-------KEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQ 74

Query: 929 DDPIFDAIIQSI 964
           +   F  +++ +
Sbjct: 75  ESTRFSQLVEEL 86



>gb:AF479648_1420916 Bos taurus breast and ovarian cancer
           susceptibility protein variant BRCA1-delta 11 (BRCA1)
           mRNA, complete cds, alternatively spliced.
          Length = 715

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 2/72 (2%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDK--SMRLGNNECPACRIHCARRSLR 928
           +  PIC  ++       +  V   C H FC+ C+ K  + + G ++CP C+    +RSL+
Sbjct: 22  LECPICLELI-------KEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQ 74

Query: 929 DDPIFDAIIQSI 964
           +   F  +++ +
Sbjct: 75  ESTRFSQLVEEL 86



>gb:CR858870_1183014 Pongo pygmaeus mRNA; cDNA DKFZp469H0810 (from
           clone DKFZp469H0810).
          Length = 495

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 14/50 (28%), Positives = 27/50 (54%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDDPIFDAIIQSI 964
           ++  C H +C  CI K +     +CP CR+      L+++ I D +++S+
Sbjct: 37  IIPQCSHNYCSLCIRKFLSY-KTQCPTCRVTVTEPDLKNNRILDELVKSL 85



>pir|D96594|D96594 unknown protein, 71207-66119 [imported] -
           Arabidopsis thaliana>gb:AE005173_893408 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC027034_1539778 Arabidopsis thaliana
           chromosome 1 BAC F7A10 genomic sequence, complete
           sequence.
          Length = 899

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 11/28 (39%), Positives = 20/28 (71%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDKSMRLGNNECPAC 898
           V++ C H FC++CI +S+ + + +CP C
Sbjct: 858 VIVKCYHLFCQQCIQRSLEIRHRKCPGC 885



>sp|O54952|BRC1_RAT Breast cancer type 1 susceptibility protein
           homolog.>gb:AF036760_2051819 Rattus norvegicus BRCA1
           mRNA, complete cds.
          Length = 1817

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 18/79 (22%), Positives = 38/79 (48%), Gaps = 2/79 (2%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDK--SMRLGNNECPACRIHCARRSLR 928
           +  PIC  ++       +  V   C H FC+ C+ K  + + G ++CP C+    +RSL+
Sbjct: 22  LECPICLELI-------KEPVSTQCDHIFCKFCMLKLLNQKKGPSQCPLCKNEITKRSLQ 74

Query: 929 DDPIFDAIIQSIYPDVEKY 985
               F  +++ +   ++ +
Sbjct: 75  GSARFSQLVEELLKIIDAF 93



>sp|Q9GKK8|BRC1_PANTR Breast cancer type 1 susceptibility protein
           homolog.
          Length = 1863

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 2/72 (2%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDK--SMRLGNNECPACRIHCARRSLR 928
           +  PIC  ++       +  V   C H FC+ C+ K  + + G ++CP C+    +RSL+
Sbjct: 22  LECPICLELI-------KEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQ 74

Query: 929 DDPIFDAIIQSI 964
           +   F  +++ +
Sbjct: 75  ESTRFSQLVEEL 86



>sp|P38398|BRC1_HUMAN Breast cancer type 1 susceptibility
           protein.>pir|A58881|A58881 breast/ovarian cancer
           susceptibility protein BRCA1 - human>gb:AY273801_1941567
           Homo sapiens breast cancer 1, early onset (BRCA1) gene,
           complete cds.>gb:HSU14680_2022394 Homo sapiens breast
           and ovarian cancer susceptibility (BRCA1) mRNA, complete
           cds.>gb:HUMBRCA1_2029659 Human BRCA1, Rho7 and vatI
           genes, complete cds, and ipf35 gene, partial cds.
          Length = 1863

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 2/72 (2%)
 Frame = +2

Query: 755 MPAPICPSIVGFLCIIKRTRVVMGCQHRFCRECIDK--SMRLGNNECPACRIHCARRSLR 928
           +  PIC  ++       +  V   C H FC+ C+ K  + + G ++CP C+    +RSL+
Sbjct: 22  LECPICLELI-------KEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQ 74

Query: 929 DDPIFDAIIQSI 964
           +   F  +++ +
Sbjct: 75  ESTRFSQLVEEL 86



>gb:AY662645_2542635 Dibamus sp. TMT-2004c recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 939

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP+CR  C
Sbjct: 271 CKHLFCRVCILKCLKVMGSYCPSCRYPC 298



>gb:AY662629_2542619 Euprepis auratus recombination activating gene
           1 (RAG-1) gene, partial cds.
          Length = 931

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP+CR  C
Sbjct: 277 CKHLFCRVCILKCLKVMGSYCPSCRYPC 304



>gb:AY662628_2542618 Lialis jicari recombination activating gene 1
           (RAG-1) gene, partial cds.
          Length = 919

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PA    SI   +C  I    V   C+H FCR CI K +++  + CP+CR  C
Sbjct: 227 PADFVKSISCQICEHILADPVETTCKHLFCRLCILKCLKVVGSYCPSCRYPC 278



>gb:AY662620_2542610 Aspidoscelis tigris recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 967

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP+CR  C
Sbjct: 277 CKHLFCRVCILKCLKVMGSYCPSCRYPC 304



>gb:AY662613_2542603 Cylindrophis ruffus recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 972

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP+CR  C
Sbjct: 276 CKHLFCRVCILKCLKVMGSYCPSCRYPC 303



>gb:AY662611_2542601 Dinodon sp. TMT-2004a recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 972

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP+CR  C
Sbjct: 276 CKHLFCRVCILKCLKVMGSYCPSCRYPC 303



>gb:AY662609_2542599 Lanthanotus borneensis recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 974

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP+CR  C
Sbjct: 278 CKHLFCRVCILKCLKVMGSYCPSCRYPC 305



>gb:AY662606_2542596 Heloderma suspectum recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 946

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP+CR  C
Sbjct: 278 CKHLFCRVCILKCLKVMGSYCPSCRYPC 305



>gb:AY662604_2542594 Celestus enneagrammus recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 946

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP+CR  C
Sbjct: 278 CKHLFCRVCILKCLKVMGSYCPSCRYPC 305



>gb:AY662603_2542593 Elgaria panamintina recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 946

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP+CR  C
Sbjct: 278 CKHLFCRVCILKCLKVMGSYCPSCRYPC 305



>gb:AY662602_2542592 Ophisaurus attenuatus recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 974

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP+CR  C
Sbjct: 278 CKHLFCRVCILKCLKVMGSYCPSCRYPC 305



>gb:AY662584_2542574 Calotes calotes recombination activating gene 1
           (RAG-1) gene, partial cds.
          Length = 953

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H +CR CI K +++  + CPACR  C
Sbjct: 277 CKHLYCRACILKCIKVMGSYCPACRYPC 304



>gb:AY662580_2542570 Ctenophorus salinarum recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 945

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR C+ K ++   + CPACR  C
Sbjct: 277 CKHLFCRACVLKCIKAMGSYCPACRYPC 304



>gb:AY228782_2520927 Chionis minor recombination activating protein
           1 (RAG-1) gene, partial cds.
          Length = 957

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP+CR  C
Sbjct: 272 CRHLFCRTCILKCIKVMGSYCPSCRYPC 299



>gb:BT008042_2150974 Synthetic construct Homo sapiens C3HC4-like
           zinc finger protein mRNA, partial cds.
          Length = 231

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 15/38 (39%), Positives = 23/38 (60%)
 Frame = +2

Query: 791 LCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRI 904
           +C+  R  +++ C H FC++CIDK      N CP CR+
Sbjct: 157 ICMDGRADLILPCAHSFCQKCIDKWSDRHRN-CPICRL 193



>gb:AY621087_2086904 Rattus norvegicus RNF141 protein mRNA, complete
           cds.
          Length = 230

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 15/38 (39%), Positives = 23/38 (60%)
 Frame = +2

Query: 791 LCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRI 904
           +C+  R  +++ C H FC++CIDK      N CP CR+
Sbjct: 157 ICMDGRADLILPCAHSFCQKCIDKWSDRHRN-CPICRL 193



>gb:AJ421479_2068272 Mus musculus X-inactivation center region;
           segment 2/3.
          Length = 194

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 6/76 (7%)
 Frame = +2

Query: 773 PSIVGFLC--IIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACR--IHCAR--RSLRDD 934
           P I  F+C   +     +  C H FC+ CI K     +N CP C   +H A+  ++LR D
Sbjct: 81  PYISCFICKGYLIDAATITECLHSFCKSCIVKHFE-HSNRCPKCNLIVHQAKPHKNLRMD 139

Query: 935 PIFDAIIQSIYPDVEK 982
           P   +I+  +   +E+
Sbjct: 140 PQLQSIVYKLVAGLEE 155



>gb:AF214680_1890389 Homo sapiens C3HC4-like zinc finger protein
           (ZNF230) mRNA, complete cds.
          Length = 230

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 15/38 (39%), Positives = 23/38 (60%)
 Frame = +2

Query: 791 LCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRI 904
           +C+  R  +++ C H FC++CIDK      N CP CR+
Sbjct: 157 ICMDGRADLILPCAHSFCQKCIDKWSDRHRN-CPICRL 193



>gb:AY249883_1428003 Tenrec ecaudatus recombination activating
           protein 1 (RAG1) gene, partial cds.
          Length = 268

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 13/32 (40%), Positives = 20/32 (62%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           V   CQH FCR CI + +++  + CP+C+  C
Sbjct: 127 VETSCQHVFCRICILRCLKIMGSHCPSCKYPC 158



>gb:AY239186_1427660 Tapirus indicus recombination activating
           protein 1 (RAG-1) gene, partial cds.
          Length = 298

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 2/52 (3%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDDPI--FDAIIQSI 964
           VV  C+H FCR CI + +++  + CP+CR  C    L + P+  F +I+ S+
Sbjct: 146 VVTTCKHVFCRICILRCLKVLGSYCPSCRYPCFPTDL-ESPVKSFLSILNSL 196



>gb:AY239179_1427653 Lagenorhynchus obscurus recombination
           activating protein 1 (RAG-1) gene, partial cds.
          Length = 298

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 2/52 (3%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDDPI--FDAIIQSI 964
           V   C+H FCR CI +  ++  N CP+CR  C    L + P+  F +I+ S+
Sbjct: 146 VETSCKHVFCRICILRCFKVMGNYCPSCRYPCFPTDL-ESPVKSFLSILNSL 196



>gb:CR860107_1184197 Pongo pygmaeus mRNA; cDNA DKFZp459N103 (from
           clone DKFZp459N103).>gb:BC018104_1976412 Homo sapiens
           ring finger protein 141, mRNA (cDNA clone MGC:8715
           IMAGE:3883540), complete cds.>gb:BT006662_1990100 Homo
           sapiens C3HC4-like zinc finger protein mRNA, complete
           cds.
          Length = 230

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 15/38 (39%), Positives = 23/38 (60%)
 Frame = +2

Query: 791 LCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRI 904
           +C+  R  +++ C H FC++CIDK      N CP CR+
Sbjct: 157 ICMDGRADLILPCAHSFCQKCIDKWSDRHRN-CPICRL 193



>gb:AK015505_1158408 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4930465J21
           product:hypothetical RING finger containing protein,
           full insert sequence.>gb:BC018553_2092775 Mus musculus
           ring finger protein 141, mRNA (cDNA clone MGC:19457
           IMAGE:3582546), complete cds.
          Length = 230

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 15/38 (39%), Positives = 23/38 (60%)
 Frame = +2

Query: 791 LCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRI 904
           +C+  R  +++ C H FC++CIDK      N CP CR+
Sbjct: 157 ICMDGRADLILPCAHSFCQKCIDKWSDRHRN-CPICRL 193



>gb:AK011839_1156620 Mus musculus 10 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2610110L04
           product:hypothetical RING finger containing protein,
           full insert sequence.
          Length = 230

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 15/38 (39%), Positives = 23/38 (60%)
 Frame = +2

Query: 791 LCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRI 904
           +C+  R  +++ C H FC++CIDK      N CP CR+
Sbjct: 157 ICMDGRADLILPCAHSFCQKCIDKWSDRHRN-CPICRL 193



>gb:AK006791_1153719 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:1700055B19
           product:hypothetical RING finger containing protein,
           full insert sequence.
          Length = 230

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 15/38 (39%), Positives = 23/38 (60%)
 Frame = +2

Query: 791 LCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRI 904
           +C+  R  +++ C H FC++CIDK      N CP CR+
Sbjct: 157 ICMDGRADLILPCAHSFCQKCIDKWSDRHRN-CPICRL 193



>pir|JC7972|JC7972 spermatogenesis-related ring finger protein,
           ZNF230 - mouse>gb:AF353167_2063967 Mus musculus ring
           finger protein (Znf230) mRNA, complete cds.
          Length = 230

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 15/38 (39%), Positives = 23/38 (60%)
 Frame = +2

Query: 791 LCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRI 904
           +C+  R  +++ C H FC++CIDK      N CP CR+
Sbjct: 157 ICMDGRADLILPCAHSFCQKCIDKWSDRHRN-CPICRL 193



>gb:AY687907_2544158 Chelonia mydas recombination activating gene 1
           (RAG-1) gene, partial cds.
          Length = 930

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 13/28 (46%), Positives = 17/28 (60%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C H FCR CI K +++  + CP CR  C
Sbjct: 262 CSHLFCRTCILKCLKVMGSYCPTCRYPC 289



>gb:AY662640_2542630 Typhlosaurus gariepensis recombination
           activating gene 1 (RAG-1) gene, partial cds.
          Length = 961

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP CR  C
Sbjct: 277 CKHLFCRVCILKCLKVMGSYCPCCRYPC 304



>gb:AY662639_2542629 Acontias meleagris recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 966

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP CR  C
Sbjct: 270 CKHLFCRVCILKCLKVMGSYCPCCRYPC 297



>gb:AY662638_2542628 Chalcides ocellatus recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 973

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP CR  C
Sbjct: 277 CKHLFCRVCILKCLKVMGSYCPCCRYPC 304



>gb:AY662637_2542627 Feylinia polylepis recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 956

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP CR  C
Sbjct: 272 CKHLFCRVCILKCLKVMGSYCPCCRYPC 299



>gb:AY662635_2542625 Scelotes anguina recombination activating gene
           1 (RAG-1) gene, partial cds.
          Length = 913

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP CR  C
Sbjct: 269 CKHLFCRVCILKCLKVMGSYCPCCRYPC 296



>gb:AY662626_2542616 Pseudothecadactylus lindneri recombination
           activating gene 1 (RAG-1) gene, partial cds.
          Length = 944

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PA    SI   +C  I    V   C+H FCR CI K +++  + CP+CR  C
Sbjct: 252 PADFVKSISCQICEHILADPVETTCKHLFCRLCILKCLKVLGSYCPSCRYPC 303



>gb:AY662624_2542614 Teratoscincus przewalskii recombination
           activating gene 1 (RAG-1) gene, partial cds.
          Length = 941

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PA    SI   +C  I    V   C+H FCR CI K +++  + CP+CR  C
Sbjct: 249 PADFVKSISCQICEHILADPVETTCKHLFCRLCILKCLKVIGSYCPSCRYPC 300



>gb:AY662621_2542611 Leposoma parietale recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 973

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP+CR  C
Sbjct: 277 CKHLFCRICILKCLKVMGSYCPSCRYPC 304



>gb:AY662615_2542605 Eremias sp. TMT-2004a recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 951

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP+CR  C
Sbjct: 277 CRHLFCRVCILKCLKVLGSYCPSCRYPC 304



>gb:AY662610_2542600 Shinisaurus crocodilurus recombination
           activating gene 1 (RAG-1) gene, partial cds.
          Length = 974

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP+CR  C
Sbjct: 278 CKHLFCRICILKCLKVMGSYCPSCRYPC 305



>gb:AY294957_2081736 Peromyscus leucopus recombination activating
           gene 1 (RAG1) gene, partial cds.
          Length = 991

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C
Sbjct: 240 PAHFVKSISCQICEHILADPVETSCKHXFCRICILRCLKVMGSYCPSCRYPC 291



>gb:AY294945_2081724 Mastomys hildebrandtii recombination activating
           gene 1 (RAG1) gene, partial cds.
          Length = 998

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C    L + 
Sbjct: 245 PAHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDL-ES 303

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 304 PVKSFLSILNSL 315



>gb:AY294944_2081723 Rhynchomys isarogensis recombination activating
           gene 1 (RAG1) gene, partial cds.
          Length = 995

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C    L + 
Sbjct: 243 PAHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDL-ES 301

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 302 PVKSFLSILNSL 313



>gb:AY294943_2081722 Chrotomys gonzalesi recombination activating
           gene 1 (RAG1) gene, partial cds.
          Length = 982

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C    L + 
Sbjct: 230 PAHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDL-ES 288

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 289 PVKSFLSILNSL 300



>gb:AY294940_2081719 Rhabdomys pumilio recombination activating gene
           1 (RAG1) gene, partial cds.
          Length = 708

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C    L + 
Sbjct: 244 PAHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDL-ES 302

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 303 PVKSFLSILNSL 314



>gb:AY294939_2081718 Parotomys sp. H656 recombination activating
           gene 1 (RAG1) gene, partial cds.
          Length = 713

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C    L + 
Sbjct: 250 PAHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDL-ES 308

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 309 PVKSFLSILNSL 320



>gb:AY241499_2080444 Paraxerus ochraceus RAG1 protein (RAG1) gene,
           partial cds.
          Length = 708

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PA +  SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C
Sbjct: 248 PAHLVKSISCQICEHILADPVETSCKHVFCRICILRCLKVMGSYCPSCRYPC 299



>gb:AY241474_2080419 Tamiasciurus hudsonicus RAG1 protein (RAG1)
           gene, partial cds.
          Length = 458

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C    L + 
Sbjct: 249 PAHFVKSISCQICEHILADPVETSCKHVFCRICILRCLKVMGSYCPSCRYPCFPTDL-ES 307

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 308 PVKSFVSILNSL 319



>gb:AY241461_2080406 Batomys granti RAG1 protein (RAG1) gene,
           partial cds.
          Length = 442

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C
Sbjct: 247 PAHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKIMGSYCPSCRYPC 298



>gb:AF315468_2062620 Rattus norvegicus RSD-4 mRNA, complete
           cds.>gb:BC061821_2104681 Rattus norvegicus ring finger
           protein 138, mRNA (cDNA clone MGC:72355 IMAGE:5599087),
           complete cds.
          Length = 209

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 18/52 (34%), Positives = 23/52 (44%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARR 919
           P+C  +      +K       CQH FCR+C   +MR     CP CR    RR
Sbjct: 19  PVCQEV------LKTPVRTAACQHVFCRKCFLTAMRESGIHCPLCRGSVTRR 64



>gb:AB025011_2044350 Mus musculus mRNA for Trif-d, complete cds.
          Length = 95

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 18/52 (34%), Positives = 23/52 (44%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARR 919
           P+C  +      +K       CQH FCR+C   +MR     CP CR    RR
Sbjct: 19  PVCQEV------LKTPVRTAACQHVFCRKCFLTAMRESGIHCPLCRGSVTRR 64



>gb:AB025010_2044349 Mus musculus mRNA for Trif, complete
           cds.>gb:BC003712_2089273 Mus musculus ring finger
           protein 138, transcript variant 2, mRNA (cDNA clone
           MGC:5701 IMAGE:3593899), complete cds.
          Length = 209

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 18/52 (34%), Positives = 23/52 (44%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARR 919
           P+C  +      +K       CQH FCR+C   +MR     CP CR    RR
Sbjct: 19  PVCQEV------LKTPVRTAACQHVFCRKCFLTAMRESGIHCPLCRGSVTRR 64



>gb:AY239185_1427659 Diceros bicornis recombination activating
           protein 1 (RAG-1) gene, partial cds.
          Length = 297

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 2/52 (3%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDDPI--FDAIIQSI 964
           VV  C+H FCR CI + +++  + CP+C+  C    L + P+  F +I+ S+
Sbjct: 143 VVTSCKHVFCRICILRCLKVMGSYCPSCQYPCFPTDL-ESPVKSFLSILNSL 193



>gb:AY239177_1427651 Ovis canadensis recombination activating
           protein 1 (RAG-1) gene, partial cds.
          Length = 267

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C    L + 
Sbjct: 107 PAHFVKSISCQICEHILADPVETNCKHVFCRICILRCLKIMGSYCPSCRYPCFPTDL-ES 165

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 166 PVKSFLSILNSL 177



>gb:AK013419_1157508 Mus musculus 10, 11 days embryo whole body
           cDNA, RIKEN full-length enriched library,
           clone:2810480D20 product:Trif gene, full insert
           sequence.
          Length = 178

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 18/52 (34%), Positives = 23/52 (44%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARR 919
           P+C  +      +K       CQH FCR+C   +MR     CP CR    RR
Sbjct: 7   PVCQEV------LKTPVRTAACQHVFCRKCFLTAMRESGIHCPLCRGSVTRR 52



>gb:AK004238_1152284 Mus musculus 18-day embryo whole body cDNA,
           RIKEN full-length enriched library, clone:1110053K18
           product:Trif gene, full insert
           sequence.>gb:AK010486_1155798 Mus musculus ES cells
           cDNA, RIKEN full-length enriched library,
           clone:2410015A17 product:Trif gene, full insert
           sequence.
          Length = 245

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 18/52 (34%), Positives = 23/52 (44%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARR 919
           P+C  +      +K       CQH FCR+C   +MR     CP CR    RR
Sbjct: 19  PVCQEV------LKTPVRTAACQHVFCRKCFLTAMRESGIHCPLCRGSVTRR 64



>gb:AY662634_2542624 Eumeces anthracinus recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 966

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP+CR  C
Sbjct: 270 CKHVFCRICILKCLKVMGSYCPSCRYPC 297



>gb:AY662632_2542622 Eumeces inexpectatus recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 945

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP+CR  C
Sbjct: 277 CKHVFCRICILKCLKVMGSYCPSCRYPC 304



>gb:AY662623_2542613 Sphaerodactylus shrevei recombination
           activating gene 1 (RAG-1) gene, partial cds.
          Length = 941

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CP+CR  C
Sbjct: 273 CKHLFCRLCILKCLKVIGSYCPSCRYPC 300



>gb:AY662616_2542606 Bipes biporus recombination activating gene 1
           (RAG-1) gene, partial cds.
          Length = 944

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C H FCR CI K +++  + CP+CR  C
Sbjct: 276 CTHLFCRVCILKCLKVMGSYCPSCRYPC 303



>gb:AY662595_2542585 Liolaemus pictus recombination activating gene
           1 (RAG-1) gene, partial cds.
          Length = 962

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 13/28 (46%), Positives = 17/28 (60%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K ++   + CP CR  C
Sbjct: 266 CRHLFCRACILKCLKAMGSYCPTCRYPC 293



>gb:AY662585_2542575 Japalura tricarinata recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 951

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H +CR CI K ++   + CPACR  C
Sbjct: 277 CKHLYCRACILKCIKAMGSYCPACRYPC 304



>gb:AY662578_2542568 Chamaeleo rudis recombination activating gene 1
           (RAG-1) gene, partial cds.
          Length = 939

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           V   C+H FCR CI K +++  + CPAC   C
Sbjct: 267 VETACKHLFCRACILKCIKVKGSYCPACYYPC 298



>gb:AY524961_2536222 Rhampholeon nchisiensis isolate 8 recombination
           activating protein 1 (RAG1) gene, partial cds.
          Length = 926

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CPAC   C
Sbjct: 271 CKHLFCRACILKCIKVMGSHCPACYYPC 298



>gb:AY524957_2536218 Rhampholeon nchisiensis isolate 13
           recombination activating protein 1 (RAG1) gene, partial
           cds.
          Length = 926

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CPAC   C
Sbjct: 271 CKHLFCRACILKCIKVMGSHCPACYYPC 298



>gb:AY524956_2536217 Rhampholeon chapmanorum isolate 9 recombination
           activating protein 1 (RAG1) gene, partial cds.
          Length = 908

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CPAC   C
Sbjct: 253 CKHLFCRACILKCIKVMGSHCPACYYPC 280



>gb:AY524955_2536216 Rhampholeon platyceps isolate 14 recombination
           activating protein 1 (RAG1) gene, partial cds.
          Length = 926

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CPAC   C
Sbjct: 271 CKHLFCRACILKCIKVMGSHCPACYYPC 298



>gb:AY524954_2536215 Rhampholeon platyceps isolate 11 recombination
           activating protein 1 (RAG1) gene, partial cds.
          Length = 926

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CPAC   C
Sbjct: 271 CKHLFCRACILKCIKVMGSHCPACYYPC 298



>gb:AY524953_2536214 Rhampholeon boulengeri isolate 25 recombination
           activating protein 1 (RAG1) gene, partial cds.
          Length = 926

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CPAC   C
Sbjct: 271 CKHLFCRACILKCIKVMGSHCPACYYPC 298



>gb:AY524952_2536213 Rhampholeon moyeri isolate 29 recombination
           activating protein 1 (RAG1) gene, partial cds.
          Length = 926

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CPAC   C
Sbjct: 271 CKHLFCRACILKCIKVMGSHCPACYYPC 298



>gb:AY524951_2536212 Rhampholeon moyeri isolate 28 recombination
           activating protein 1 (RAG1) gene, partial cds.
          Length = 926

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +++  + CPAC   C
Sbjct: 271 CKHLFCRACILKCIKVMGSHCPACYYPC 298



>gb:AY443332_2532946 Sitta carolinensis recombination activating
           protein 1 (RAG1) gene, partial cds.
          Length = 957

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +R+  + CP+C   C
Sbjct: 272 CRHLFCRTCIHKCIRVMGSYCPSCWYPC 299



>gb:AY443310_2532924 Pachycephala hyperthra recombination activating
           protein 1 (RAG1) gene, partial cds.
          Length = 957

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 14/28 (50%), Positives = 18/28 (64%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +R+  + CPAC   C
Sbjct: 272 CRHLFCRTCILKCIRVMGSYCPACWYPC 299



>gb:AY057030_2510168 Sitta pygmaea recombination activating protein
           1 (RAG-1) gene, partial cds.
          Length = 957

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K +R+  + CP+C   C
Sbjct: 272 CRHLFCRTCIHKCIRVMGSYCPSCWYPC 299



>gb:AY509253_2354457 Ostreid herpesvirus 1, complete
           genome.>gb:AY509253_2354468 Ostreid herpesvirus 1,
           complete genome.
          Length = 222

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +2

Query: 791 LCIIKRTRV-VMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           +C+ K  R   + CQH  CR+C  K MR   N CP C +    R  +DD
Sbjct: 80  ICMAKNNRKEALPCQHNVCRDCYYKPMR---NNCPVCNMEWPMR--KDD 123



>gb:AB042275_2161697 Canine herpesvirus CICP0 gene for infected cell
           protein 0, complete cds.
          Length = 333

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 2/52 (3%)
 Frame = +2

Query: 803 KRTRVVMGCQHRFCRECIDKSMRLGNNECPACR--IHCARRSLRDDPIFDAI 952
           K   V M C H+FC +C+ +  ++ +N CP C+  I     S+ DD  F  I
Sbjct: 16  KNMTVTMSCLHKFCYDCLSEWTKV-SNTCPLCKSIIQSMIHSINDDKEFKEI 66



>gb:AY294958_2081737 Reithrodontomys fulvescens recombination
           activating gene 1 (RAG1) gene, partial cds.
          Length = 997

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C
Sbjct: 253 PAQFVKSISCQICEHILADPVETSCKHVFCRICILRCLKVMGSYCPSCRYPC 304



>gb:AY294951_2081730 Acomys ignitus recombination activating gene 1
           (RAG1) gene, partial cds.
          Length = 900

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C
Sbjct: 245 PAHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPC 296



>gb:AY294949_2081728 Tatera robusta recombination activating gene 1
           (RAG1) gene, partial cds.
          Length = 952

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C
Sbjct: 200 PAHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPC 251



>gb:AY294947_2081726 Meriones shawi recombination activating gene 1
           (RAG1) gene, partial cds.
          Length = 926

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C
Sbjct: 176 PAHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPC 227



>gb:AY294946_2081725 Arvicanthis somalicus recombination activating
           gene 1 (RAG1) gene, partial cds.
          Length = 993

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C
Sbjct: 246 PAHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPC 297



>gb:AY294942_2081721 Apomys hylocoetes recombination activating gene
           1 (RAG1) gene, partial cds.
          Length = 1003

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C
Sbjct: 250 PAHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPC 301



>gb:AY294936_2081715 Cricetomys gambianus recombination activating
           gene 1 (RAG1) gene, partial cds.
          Length = 998

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C    L + 
Sbjct: 245 PAHFVKSISCQICEHILADPVETSCKHVFCRICILRCLKVMGSYCPSCRYPCFPTDL-ES 303

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 304 PVKSFLSILNSL 315



>gb:AY294934_2081713 Graphiurus murinus recombination activating
           gene 1 (RAG1) gene, partial cds.
          Length = 1010

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C    L + 
Sbjct: 252 PAHFVKSISCQICKHILADPVETSCKHVFCRICILRCLKVMGSYCPSCRYPCFPTDL-ES 310

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 311 PVKSFLSILNSL 322



>gb:AY241493_2080438 Marmota sibirica RAG1 protein (RAG1) gene,
           partial cds.
          Length = 425

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C    L + 
Sbjct: 239 PAHFVKSISCQICEHILADPVETSCKHVFCRICILRCLKVMGSYCPSCRYPCFPTDL-ES 297

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 298 PVKSFLSILNSL 309



>gb:AY241489_2080434 Tamias sibiricus RAG1 protein (RAG1) gene,
           partial cds.
          Length = 343

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C    L + 
Sbjct: 200 PAHFVKSISCQICEHILADPVETSCKHVFCRICILRCLKVMGSYCPSCRYPCFPTDL-ES 258

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 259 PVKSFLSILNSL 270



>gb:AY241488_2080433 Sciurotamias davidianus RAG1 protein (RAG1)
           gene, partial cds.
          Length = 702

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C    L + 
Sbjct: 249 PAHFVKSISCQICEHILADPVETSCKHVFCRICILRCLKVMGSYCPSCRYPCFPTDL-ES 307

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 308 PVKSFLSILNSL 319



>gb:AY241487_2080432 Spermophilopsis leptodactylus RAG1 protein
           (RAG1) gene, partial cds.
          Length = 711

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C    L + 
Sbjct: 251 PAHFVKSISCQICEHILADPVETNCKHVFCRICILRCLKVMGSYCPSCRYPCFPTDL-ES 309

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 310 PVKSFLSILNSL 321



>gb:AY241483_2080428 Sundasciurus philippinensis RAG1 protein (RAG1)
           gene, partial cds.
          Length = 432

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C    L + 
Sbjct: 248 PAHFVKSISCQICEHILADPVETSCKHVFCRICILRCLKVMGSYCPSCRYPCFPTDL-ES 306

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 307 PVKSFLSILNSL 318



>gb:AY241482_2080427 Dremomys pernyi RAG1 protein (RAG1) gene,
           partial cds.
          Length = 649

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C    L + 
Sbjct: 253 PAHFVKSISCQICEHILADPVETSCKHVFCRICILRCLKVMGSYCPSCRYPCFPTDL-ES 311

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 312 PVKSFLSILNSL 323



>gb:AY241480_2080425 Callosciurus prevostii RAG1 protein (RAG1)
           gene, partial cds.
          Length = 584

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C    L + 
Sbjct: 124 PAHFVKSISCQICEHILADPVETSCKHVFCRICILRCLKVMGSYCPSCRYPCFPTDL-ES 182

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 183 PVKSFLSILNSL 194



>gb:AY241479_2080424 Callosciurus erythraeus RAG1 protein (RAG1)
           gene, partial cds.
          Length = 705

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C    L + 
Sbjct: 253 PAHFVKSISCQICEHILADPVETSCKHVFCRICILRCLKVMGSYCPSCRYPCFPTDL-ES 311

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 312 PVKSFLSILNSL 323



>gb:AY241478_2080423 Microsciurus flaviventer RAG1 protein (RAG1)
           gene, partial cds.
          Length = 713

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C    L + 
Sbjct: 253 PAHFVKSISCQICEHILADPVETSCKHVFCRICILRCLKVMGSYCPSCRYPCFPTDL-ES 311

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 312 PVKSFLSILNSL 323



>gb:AY241476_2080421 Sciurus stramineus RAG1 protein (RAG1) gene,
           partial cds.
          Length = 386

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C    L + 
Sbjct: 226 PAHFVKSISCQICEHILADPVETSCKHVFCRICILRCLKVMGSYCPSCRYPCFPTDL-ES 284

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 285 PVKSFLSILNSL 296



>gb:AY241468_2080413 Aplodontia rufa RAG1 protein (RAG1) gene,
           partial cds.
          Length = 528

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDDPI--FDAIIQSI 964
           V   C+H FCR CI + +++  + CP+CR  C    L + P+  F +I+ S+
Sbjct: 244 VETSCKHVFCRICILRCLKVMGSYCPSCRYPCFSTDL-ESPVKSFLSILNSL 294



>gb:AY241462_2080407 Mus musculus RAG1 protein (RAG1) gene, partial
           cds.
          Length = 444

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C
Sbjct: 249 PAHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPC 300



>gb:AY241460_2080405 Deomys ferrugineus RAG1 protein (RAG1) gene,
           partial cds.
          Length = 416

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C
Sbjct: 240 PAHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPC 291



>gb:AY241459_2080404 Beamys hindei RAG1 protein (RAG1) gene, partial
           cds.
          Length = 418

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C    L + 
Sbjct: 240 PAHFMKSISCQICEHILADPVETSCKHVFCRICILRCLKVMGSYCPSCRYPCFPTDL-ES 298

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 299 PVKSFLSILNSL 310



>gb:AP004460_1841337 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0438H08.
          Length = 176

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 21/56 (37%), Positives = 25/56 (44%), Gaps = 4/56 (7%)
 Frame = +2

Query: 746 RCRMPAPI----CPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACR 901
           RCR  A      C   +G L    R R +  C H F + CIDK +  G   CP CR
Sbjct: 95  RCRRAAAAAAASCVVCLGALEARHRVRELGNCAHAFHKACIDKWVDKGQATCPLCR 150



>gb:AY249868_1427992 Myotis velifer recombination activating protein
           1 (RAG1) gene, partial cds.
          Length = 268

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDD 934
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C    L + 
Sbjct: 107 PAHFVKSISCQICEHILADPVETNCKHVFCRICILRCLKVMGSYCPSCRYPCFPTDL-ES 165

Query: 935 PI--FDAIIQSI 964
           P+  F +I+ S+
Sbjct: 166 PVKSFLSILNSL 177



>gb:AY239194_1427668 Trichechus manatus recombination activating
           protein 1 (RAG-1) gene, partial cds.
          Length = 267

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDDPI--FDAIIQSI 964
           V   C+H FCR CI + +++  + CP+CR  C    L + P+  F +I+ S+
Sbjct: 126 VETSCKHVFCRICILRCLKVTGSYCPSCRYPCFPTDL-ESPVKSFLSILNSL 176



>gb:AY239193_1427667 Dugong dugon recombination activating protein 1
           (RAG-1) gene, partial cds.
          Length = 266

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%)
 Frame = +2

Query: 815 VVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDDPI--FDAIIQSI 964
           V   C+H FCR CI + +++  + CP+CR  C    L + P+  F +I+ S+
Sbjct: 126 VETSCKHVFCRICILRCLKVTGSYCPSCRYPCFPTDL-ESPVKSFLSILNSL 176



>gb:CR382398_1374863 Plasmodium falciparum chromosome 6, complete
            sequence; segment 1/5.
          Length = 1103

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 11/41 (26%), Positives = 24/41 (58%)
 Frame = +2

Query: 806  RTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLR 928
            R  +++ C H +C  CI  +++  N +CP C++   ++ L+
Sbjct: 1058 RNYIIIKCGHIYCNNCIFNNLKTRNRKCPQCKVPFDKKDLQ 1098



>gb:AK006700_1153685 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:1700045I19
           product:similar to HSD-4 PROTEIN [Homo sapiens], full
           insert sequence.
          Length = 248

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 18/52 (34%), Positives = 24/52 (46%)
 Frame = +2

Query: 764 PICPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARR 919
           PIC  +       K    V  C+H FCR+C   +M+     CP CR +  RR
Sbjct: 20  PICQEV------FKTPVRVAACKHVFCRKCFLSAMKESRLHCPLCRGNVTRR 65



>pir|B33754|B33754 recombination-activating protein 1 - mouse
          Length = 1043

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C
Sbjct: 284 PAHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPC 335



>sp|P15919|RAG1_MOUSE V(D)J recombination activating protein 1
           (RAG-1).>gb:AY215075_2079634 Mus musculus recombinase
           activating gene 1 (Rag1) and recombinase activating gene
           2 (Rag2) genes, complete cds.>gb:MUSRAG1A_2129828 Mouse
           recombination activating protein (RAG-1) mRNA, complete
           cds.
          Length = 1040

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 758 PAPICPSIVGFLCI-IKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHC 910
           PA    SI   +C  I    V   C+H FCR CI + +++  + CP+CR  C
Sbjct: 281 PAHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPC 332



>gb:PWA010258_2578601 Pleurodeles waltl rag1 gene for V(D)J
           recombinase subunit.
          Length = 1079

 Score = 36.2 bits (82), Expect = 1.0
 Identities = 12/28 (42%), Positives = 19/28 (67%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR C+ K ++L  + CP+C+  C
Sbjct: 342 CKHLFCRICLLKCLKLMGSYCPSCKYPC 369



>gb:BC053149_2550541 Danio rerio protein inhibitor of activated
           STAT, 4 -like, mRNA (cDNA clone MGC:63923
           IMAGE:6790809), complete cds.
          Length = 455

 Score = 36.2 bits (82), Expect = 1.0
 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 8/75 (10%)
 Frame = +2

Query: 782 VGFLCIIKRTRVVMGCQHRFCR--ECIDKSMRLGNNE------CPACRIHCARRSLRDDP 937
           V  +C + + R+ + C+ R C   +C D S  L  NE      CP C  +     LR D 
Sbjct: 283 VSLICPLVKLRMSVPCRSRGCAHLQCFDASFYLHMNEKKPRWSCPVCHRYAPFDELRIDS 342

Query: 938 IFDAIIQSIYPDVEK 982
           +   +++S   DVE+
Sbjct: 343 LLRDVLESSGEDVEE 357



>gb:BC044430_2548737 Danio rerio zgc:55577, mRNA (cDNA clone
           MGC:55577 IMAGE:2643277), complete cds.
          Length = 426

 Score = 36.2 bits (82), Expect = 1.0
 Identities = 21/64 (32%), Positives = 29/64 (45%)
 Frame = +2

Query: 770 CPSIVGFLCIIKRTRVVMGCQHRFCRECIDKSMRLGNNECPACRIHCARRSLRDDPIFDA 949
           CP    FL I   T+    C H FC  CI K +      CP C      + LR++ + D 
Sbjct: 25  CPICFEFLNISMMTQ----CSHNFCSLCIRKFLSY-KLLCPVCNSPSTEQDLRNNRLLDD 79

Query: 950 IIQS 961
           ++QS
Sbjct: 80  LVQS 83



>gb:AY524950_2536211 Rhampholeon gorongosae isolate 19 recombination
           activating protein 1 (RAG1) gene, partial cds.
          Length = 892

 Score = 36.2 bits (82), Expect = 1.0
 Identities = 14/28 (50%), Positives = 18/28 (64%)
 Frame = +2

Query: 827 CQHRFCRECIDKSMRLGNNECPACRIHC 910
           C+H FCR CI K ++L  + CPAC   C
Sbjct: 237 CKHLFCRTCILKCIKLMGSFCPACCYPC 264


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 837,638,568
Number of Sequences: 1806583
Number of extensions: 16046559
Number of successful extensions: 61189
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 58035
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 60890
length of database: 581,917,975
effective HSP length: 125
effective length of database: 356,095,100
effective search space used: 71931210200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)