BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig1965
         (862 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T51575|T51575 2-hydroxyphytanoyl-CoA lyase-like protein - Ar...   261   1e-68   Arabidopsis thaliana [mouse-ear cress]
gb:ATH278629_1552265 Arabidopsis thaliana mRNA for Oxalyl-CoA de...   260   2e-68   
gb:AK125241_1915864 Homo sapiens cDNA FLJ43251 fis, clone HEART2...   157   3e-37   
gb:BC078697_2106863 Rattus norvegicus 2-hydroxyphytanoyl-Coenzym...   149   9e-35   
gb:MMU132139_2118402 Mus musculus mRNA for 2-hydroxyphytanoyl-Co...   145   7e-34   
sp|Q9QXE0|HPCL_MOUSE|HPCL_MOUSE 2-hydroxyphytanoyl-CoA lyase (EC 4.1.-.-) (...   145   7e-34   Mus musculus [mouse]
gb:BC066580_2554455 Danio rerio zgc:76920, mRNA (cDNA clone MGC:...   144   2e-33   
gb:AB162349_1201682 Drosophila simulans genes, CG11099 to CG8900...   144   3e-33   
gb:AE013599_1132892 Drosophila melanogaster chromosome 2R, compl...   144   3e-33   
gb:AE016764_326903 Escherichia coli CFT073 section 10 of 18 of t...   143   5e-33   
gb:AE005674_72022 Shigella flexneri 2a str. 301, complete genome...   143   5e-33   
sp|P78093|OXC_ECOLI|OXC_ECOLI Probable oxalyl-CoA decarboxylase (EC 4.1.1....   143   5e-33   Escherichia coli [E. coli]
gb:HSA131753_2000229 Homo sapiens mRNA for 2-hydroxyphytanoyl-Co...   142   6e-33   
gb:BC077507_2560215 Xenopus laevis MGC82654 protein, mRNA (cDNA ...   142   8e-33   
gb:CR382131_1663760 Yarrowia lipolytica chromosome E of strain C...   142   8e-33   
gb:AF161397_1150290 Homo sapiens HSPC279 mRNA, partial cds.           142   8e-33   
sp|Q9UJ83|HPCL_HUMAN|HPCL_HUMAN 2-hydroxyphytanoyl-CoA lyase (EC 4.1.-.-) (...   142   8e-33   Homo sapiens [man]
gb:BX248334_757478 Mycobacterium bovis subsp. bovis AF2122/97 co...   142   1e-32   
pir|A70841|A70841 probable oxalyl-CoA decarboxylase - Mycobacter...   142   1e-32   Mycobacterium tuberculosis
gb:CR380959_1653790 Candida glabrata strain CBS138 chromosome M ...   137   2e-31   
gb:AE017239_414228 Mycobacterium avium subsp. paratuberculosis s...   137   2e-31   
sp|P39994|YEC0_YEAST|YEC0_YEAST Hypothetical 61.3 kDa protein in URA3-MMS21...   132   8e-30   Saccharomyces cerevisiae [brewer's yeast]
gb:AB163432_15898 Bifidobacterium animalis oxc gene for oxalyl-C...   130   2e-29   
sp|P40149|OXC_OXAFO|OXC_OXAFO Oxalyl-CoA decarboxylase (EC 4.1.1.8).>pir|A...   130   4e-29   Oxalobacter formigenes
pir|T18702|T18702 hypothetical protein B0334.3b - Caenorhabditis...   127   3e-28   Caenorhabditis elegans [roundworm]
pir|T18711|T18711 hypothetical protein B0334.3a - Caenorhabditis...   127   3e-28   Caenorhabditis elegans [roundworm]
gb:CP000033_88702 Lactobacillus acidophilus NCFM, complete genome.    125   8e-28   
pir|T40656|T40656 probable oxalyl-CoA decarboxylase - fission ye...   123   5e-27   Schizosaccharomyces pombe
gb:BA000040_731417 Bradyrhizobium japonicum USDA 110 DNA, comple...   119   6e-26   
gb:D90868_123682 E.coli genomic DNA, Kohara clone #414(53.8-54.2...   114   2e-24   
gb:AE016818_1748094 Ashbya gossypii (= Eremothecium gossypii) AT...   114   2e-24   
pir|E84032|E84032 acetolactate synthase large subunit BH3061 [im...    95   2e-18   Bacillus halodurans
gb:AP006840_568203 Symbiobacterium thermophilum DNA, complete ge...    94   3e-18   
gb:LMU50749_141671 Leuconostoc mesenteroides cremoris ilvBNCA op...    91   2e-17   
pir|G75044|G75044 acetolactate synthase, large chain (ilvb) PAB0...    90   6e-17   Pyrococcus abyssi
gb:BA000043_739238 Geobacillus kaustophilus HTA426 DNA, complete...    88   2e-16   
pir|B72362|B72362 acetolactate synthase, large subunit - Thermot...    88   2e-16   Thermotoga maritima
gb:AY083837_588254 Geobacillus stearothermophilus strain ATCC 79...    87   3e-16   
gb:AP006627_564964 Bacillus clausii KSM-K16 DNA, complete genome.      87   5e-16   
gb:AE010207_260502 Pyrococcus furiosus DSM 3638, section 82 of 1...    87   5e-16   
pir|C69059|C69059 acetolactate synthase (EC 4.1.3.18) large chai...    87   5e-16   Methanothermobacter thermautotrophicus str. Delta H
gb:AE004969_60924 Neisseria gonorrhoeae FA 1090, complete genome.      85   2e-15   
gb:AP008226_578670 Thermus thermophilus HB8 genomic DNA, complet...    85   2e-15   
gb:AE017304_436488 Thermus thermophilus HB27 section 4 of 7 of t...    85   2e-15   
gb:AP006618_559402 Nocardia farcinica IFM 10152 DNA, complete ge...    84   3e-15   
gb:AE015669_316658 Shewanella oneidensis MR-1 section 218 of 457...    84   3e-15   
gb:CP000031_86589 Silicibacter pomeroyi DSS-3, complete genome.        84   3e-15   
pir|F81801|F81801 acetolactate synthase (EC 4.1.3.18) III large ...    84   3e-15   Neisseria meningitidis serogroup A
pir|A81067|A81067 acetolactate synthase III, large chain NMB1577...    84   3e-15   Neisseria meningitidis serogroup B
sp|Q04789|ILVX_BACSU|ILVX_BACSU Acetolactate synthase (EC 2.2.1.6) (Acetohy...    84   3e-15   Bacillus subtilis
gb:AE017333_449625 Bacillus licheniformis DSM 13, complete genom...    84   3e-15   
gb:AE017320_441534 Desulfovibrio vulgaris subsp. vulgaris str. H...    84   3e-15   
gb:AE013291_291000 Methanosarcina mazei strain Goe1, section 73 ...    84   3e-15   
pir|AH1322|AH1322 acetolactate synthase (acetohydroxy-acid synth...    84   3e-15   Listeria monocytogenes
sp|Q89AP7|ILVI_BUCBP|ILVI_BUCBP Acetolactate synthase large subunit (EC 2.2...    84   3e-15   
gb:BC007440_1970733 Homo sapiens 2-hydroxyphytanoyl-CoA lyase, m...    84   5e-15   
gb:BA000028_697010 Oceanobacillus iheyensis HTE831 DNA, complete...    84   5e-15   
gb:AE017328_444428 Listeria monocytogenes str. 4b F2365, section...    84   5e-15   
gb:AE016799_335413 Vibrio vulnificus CMCP6 chromosome I section ...    84   5e-15   
gb:AE011091_269079 Methanosarcina acetivorans str. C2A, section ...    83   6e-15   
pir|S35138|S35138 acetolactate synthase (EC 4.1.3.18) - Lactococ...    83   6e-15   Lactococcus lactis subsp. lactis
gb:BX248357_762380 Corynebacterium diphtheriae gravis NCTC13129,...    83   8e-15   
sp|O85293|ILVI_BUCAP|ILVI_BUCAP Acetolactate synthase large subunit (EC 2.2...    83   8e-15   
sp|P57321|ILVI_BUCAI|ILVI_BUCAI Acetolactate synthase large subunit (EC 2.2...    83   8e-15   
gb:CP000020_872439 Vibrio fischeri ES114 chromosome I, complete ...    82   1e-14   
gb:CP000001_851901 Bacillus cereus ZK, complete genome.                82   1e-14   
gb:BA000040_732283 Bradyrhizobium japonicum USDA 110 DNA, comple...    82   1e-14   
gb:BA000031_705812 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    82   1e-14   
gb:AE017355_462591 Bacillus thuringiensis serovar konkukian str....    82   1e-14   
gb:AE017270_423157 Bacillus cereus ATCC 10987, section 7 of 18 o...    82   1e-14   
gb:AE017269_422745 Bacillus cereus ATCC 10987, section 6 of 18 o...    82   1e-14   
gb:AE017225_406704 Bacillus anthracis str. Sterne, complete genome.    82   1e-14   
gb:AE017028_381602 Bacillus anthracis str. Ames section 5 of 18 ...    82   1e-14   
gb:TTHILVB_198532 Thermus aquaticus DNA for acetolactate synthas...    82   1e-14   
pir|T45267|T45267 acetolactate synthase (EC 4.1.3.18) large chai...    82   1e-14   Thermus aquaticus
pir|T35772|T35772 probable TPP-requiring enzyme - Streptomyces c...    82   1e-14   Streptomyces coelicolor
pir|AI1693|AI1693 acetolactate synthase (acetohydroxy-acid synth...    82   1e-14   Listeria innocua
gb:AF129501_481674 Buchnera aphidicola natural-host Diuraphis no...    82   1e-14   
gb:AE014872_312675 Streptococcus mutans UA159 section 20 of 185 ...    82   1e-14   
pir|E95051|E95051 hypothetical protein SP0445 [imported] - Strep...    82   1e-14   Streptococcus pneumoniae
pir|A97922|A97922 acetolactate synthase (EC 4.1.3.18) [imported]...    82   1e-14   Streptococcus pneumoniae R6
gb:BX950851_839492 Erwinia carotovora subsp. atroseptica SCRI104...    82   2e-14   
gb:BA000012_671610 Mesorhizobium loti MAFF303099 DNA, complete g...    82   2e-14   
gb:AE017333_448791 Bacillus licheniformis DSM 13, complete genom...    81   2e-14   
gb:AE017003_376708 Bacillus cereus ATCC 14579 section 6 of 18 of...    81   2e-14   
gb:AE006125_215758 Pasteurella multocida subsp. multocida str. P...    81   2e-14   
pir|E82072|E82072 acetolactate synthase III, large chain VC2483 ...    81   2e-14   Vibrio cholerae
pir|B69644|B69644 acetolactate synthase (EC 4.1.3.18) large chai...    81   2e-14   Bacillus subtilis
sp|Q02137|ILVB_LACLA|ILVB_LACLA Acetolactate synthase large subunit (EC 2.2...    81   2e-14   Lactococcus lactis subsp. lactis
sp|P37251|ILVB_BACSU|ILVB_BACSU Acetolactate synthase large subunit (EC 2.2...    81   2e-14   Bacillus subtilis
gb:CP000001_852281 Bacillus cereus ZK, complete genome.                81   3e-14   
gb:AE017340_458339 Idiomarina loihiensis L2TR, complete genome.        81   3e-14   
gb:AE017329_444451 Listeria monocytogenes str. 4b F2365, section...    81   3e-14   
gb:AE017029_381996 Bacillus anthracis str. Ames section 6 of 18 ...    81   3e-14   
gb:AE016755_324161 Escherichia coli CFT073 section 1 of 18 of th...    81   3e-14   
gb:ECO110K_126890 Escherichia coli genomic DNA. (0.0 - 2.4 min).       81   3e-14   
gb:ECILVIH_126075 E. coli ilvIH operon for valine-sensitive acet...    81   3e-14   
gb:EC2MIN_124740 E. coli 2 minute region.                              81   3e-14   
gb:AE005674_69654 Shigella flexneri 2a str. 301, complete genome...    81   3e-14   
pir|AH1696|AH1696 alpha-acetolactate synthase protein, AlsS homo...    81   3e-14   Listeria innocua
pir|A90639|A90639 hypothetical protein ECs0081 [imported] - Esch...    81   3e-14   Escherichia coli O157:H7
pir|A85490|A85490 hypothetical protein ilvI [imported] - Escheri...    81   3e-14   Escherichia coli O157:H7
pir|E64729|YCEC3I acetolactate synthase (EC 4.1.3.18) III large ...    81   3e-14   
sp|P00893|ILVI_ECOLI|ILVI_ECOLI Acetolactate synthase isozyme III large sub...    81   3e-14   Escherichia coli [E. coli]
gb:CP000011_867652 Burkholderia mallei ATCC 23344 chromosome 2, ...    80   4e-14   
gb:BX571966_795145 Burkholderia pseudomallei strain K96243, chro...    80   4e-14   
gb:BX571871_788522 Photorhabdus luminescens subsp. laumondii TTO...    80   4e-14   
gb:BA000030_699706 Streptomyces avermitilis MA-4680 genomic DNA,...    80   5e-14   
gb:AE017355_462999 Bacillus thuringiensis serovar konkukian str....    80   5e-14   
gb:CP000026_75035 Salmonella enterica subsp. enterica serovar Pa...    80   5e-14   
pir|AI0516|AI0516 acetolactate synthase (EC 4.1.3.18) - Salmonel...    80   5e-14   Salmonella enterica subsp. enterica serovar Typhi
sp|P40811|ILVI_SALTY|ILVI_SALTY Acetolactate synthase isozyme III large sub...    80   5e-14   Salmonella enterica subsp. enterica serovar Typhimurium
gb:AY428947_1605829 Camelina microcarpa acetolactate synthase 2 ...    80   7e-14   
gb:AY428880_1605828 Camelina microcarpa acetolactate synthase 1 ...    80   7e-14   
gb:BX571874_789540 Photorhabdus luminescens subsp. laumondii TTO...    80   7e-14   
gb:AE017261_420092 Picrophilus torridus DSM 9790, complete genome.     80   7e-14   
gb:AE017180_400206 Geobacter sulfurreducens PCA, complete genome.      80   7e-14   
sp|P27868|ILVB_SPIPL|ILVB_SPIPL Acetolactate synthase (EC 2.2.1.6) (Acetohy...    80   7e-14   Arthrospira platensis
sp|P27696|ILVB_KLEPN|ILVB_KLEPN Acetolactate synthase, catabolic (EC 2.2.1....    80   7e-14   Klebsiella pneumoniae
gb:BX950851_842564 Erwinia carotovora subsp. atroseptica SCRI104...    79   9e-14   
gb:BX572593_799723 Rhodopseudomonas palustris CGA009 complete ge...    79   9e-14   
gb:AE017232_412237 Mycobacterium avium subsp. paratuberculosis s...    79   9e-14   
pir|AF1325|AF1325 alpha-acetolactate synthase protein, AlsS homo...    79   9e-14   Listeria monocytogenes
gb:AY428879_1605827 Camelina microcarpa acetolactate synthase 1 ...    79   1e-13   
gb:AP006618_560630 Nocardia farcinica IFM 10152 DNA, complete ge...    79   1e-13   
gb:CR522870_101614 Desulfotalea psychrophila LSv54 chromosome.         79   1e-13   
gb:AX885458_1480911 Sequence 1321 from Patent EP1033401.               79   1e-13   
gb:CP000024_877635 Streptococcus thermophilus CNRZ1066, complete...    79   1e-13   
gb:CP000023_875720 Streptococcus thermophilus LMG 18311, complet...    79   1e-13   
gb:AY552545_627820 Uncultured marine gamma proteobacterium EBAC2...    79   1e-13   
gb:AE012835_286102 Chlorobium tepidum TLS section 56 of 194 of t...    79   1e-13   
gb:AB104737_13127 Selenomonas ruminantium genes for 3-isopropylm...    79   1e-13   
pir|G69464|G69464 acetolactate synthase (EC 4.1.3.18) large chai...    79   1e-13   Archaeoglobus fulgidus
pir|C70341|C70341 acetolactate synthase (EC 4.1.3.18) large chai...    79   1e-13   Aquifex aeolicus
gb:BX251411_764760 Tropheryma whipplei TW08/27, complete genome;...    78   2e-13   
gb:AY596297_631844 Haloarcula marismortui ATCC 43049 chromosome ...    78   2e-13   
gb:AF279106_495032 Uncultured marine gamma proteobacterium EBAC3...    78   2e-13   
gb:AE010347_262163 Methanopyrus kandleri AV19 section 46 of 157 ...    78   2e-13   
pir|T44762|T44762 probable TPP-requiring enzyme [imported] - Myc...    78   2e-13   Mycobacterium leprae
sp|Q9RQ65|ILVI_BUCSC|ILVI_BUCSC Acetolactate synthase large subunit (EC 2.2...    78   2e-13   
sp|Q04524|ILVB_KLETE|ILVB_KLETE Acetolactate synthase, catabolic (EC 2.2.1....    78   2e-13   Raoultella terrigena
gb:BC068362_2555050 Danio rerio ilvB (bacterial acetolactate syn...    78   2e-13   
gb:BC057527_2552154 Danio rerio ilvB (bacterial acetolactate syn...    78   2e-13   
gb:RRA344994_1703956 Raphanus raphanistrum partial als gene for ...    78   2e-13   
gb:RRA344993_1703955 Raphanus raphanistrum partial als gene for ...    78   2e-13   
gb:RRA344989_1703951 Raphanus raphanistrum partial als gene for ...    78   2e-13   
gb:RRA344988_1703950 Raphanus raphanistrum partial als gene for ...    78   2e-13   
gb:RRA344987_1703949 Raphanus raphanistrum partial als gene for ...    78   2e-13   
gb:RRA344986_1703948 Raphanus raphanistrum partial als gene for ...    78   2e-13   
gb:AY124092_1580107 Arabidopsis thaliana acetolactate synthase (...    78   2e-13   
gb:AY042819_1560884 Arabidopsis thaliana acetolactate synthase (...    78   2e-13   
gb:CQ814638_1453499 Sequence 4 from Patent WO2004040012.               78   2e-13   
gb:CQ814636_1453497 Sequence 2 from Patent WO2004040012.               78   2e-13   
gb:CQ814635_1453496 Sequence 1 from Patent WO2004040012.               78   2e-13   
gb:CQ766590_1451736 Sequence 1 from Patent WO2004005516.>gb:CQ87...    78   2e-13   
gb:AE016827_342948 Mannheimia succiniciproducens MBEL55E, comple...    78   2e-13   
gb:AE006200_216516 Pasteurella multocida subsp. multocida str. P...    78   2e-13   
gb:SME591789_186132 Sinorhizobium meliloti 1021 complete chromos...    78   2e-13   
pir|S15004|S15004 acetolactate synthase (EC 4.1.3.18) 2 precurso...    78   2e-13   Brassica napus [oilseed rape]
pir|E97604|E97604 acetolactate synthase (EC 4.1.3.18) [imported]...    78   2e-13   Agrobacterium tumefaciens
sp|Q50613|ILVG_MYCTU|ILVG_MYCTU Probable acetolactate synthase (EC 2.2.1.6)...    78   2e-13   Mycobacterium tuberculosis
sp|P17597|ILVB_ARATH|ILVB_ARATH Acetolactate synthase, chloroplast precurso...    78   2e-13   Arabidopsis thaliana [mouse-ear cress]
sp|P27819|ILV3_BRANA|ILV3_BRANA Acetolactate synthase III, chloroplast prec...    78   2e-13   Brassica napus [oilseed rape]
sp|P27818|ILV1_BRANA|ILV1_BRANA Acetolactate synthase I, chloroplast precur...    78   2e-13   Brassica napus [oilseed rape]
gb:RRA344992_1703954 Raphanus raphanistrum partial als gene for ...    77   3e-13   
gb:AX537397_1470008 Sequence 11 from Patent WO02072855.>gb:AX546...    77   3e-13   
gb:AE005674_73427 Shigella flexneri 2a str. 301, complete genome...    77   3e-13   
pir|T35828|T35828 acetolactate synthase - Streptomyces coelicolo...    77   3e-13   Streptomyces coelicolor
pir|I40666|I40666 acetolactate synthase (EC 4.1.3.18) - Caulobac...    77   3e-13   Caulobacter vibrioides
pir|G86062|G86062 acetohydroxy acid synthase II [imported] - Esc...    77   3e-13   Escherichia coli O157:H7
pir|C87509|C87509 acetolactate synthase, large subunit [imported...    77   3e-13   Caulobacter vibrioides
pir|C97348|C97348 acetolactate synthase [imported] - Clostridium...    77   3e-13   Clostridium acetobutylicum
gb:BX640452_817616 Bordetella bronchiseptica strain RB50, comple...    77   4e-13   
gb:BX640436_812612 Bordetella parapertussis strain 12822, comple...    77   4e-13   
gb:BX640412_804910 Bordetella pertussis strain Tohama I, complet...    77   4e-13   
gb:AE017282_428985 Methylococcus capsulatus str. Bath, complete ...    77   4e-13   
gb:AE016850_348729 Tropheryma whipplei str. Twist, section 1 of ...    77   4e-13   
gb:AE016769_328660 Escherichia coli CFT073 section 15 of 18 of t...    77   4e-13   
gb:AE016749_323305 Staphylococcus epidermidis ATCC 12228, sectio...    77   4e-13   
gb:AE013966_301930 Yersinia pestis KIM section 366 of 415 of the...    77   4e-13   
gb:ECOUW85_131323 E. coli genomic sequence of the region from 84...    77   4e-13   
gb:ECORRNILV_130224 Escherichia coli acetolactate synthase II (i...    77   4e-13   
gb:ECOILVGMED_129150 E.coli ilvGMEDA operon encoding biosynthesi...    77   4e-13   
gb:CP000029_82259 Staphylococcus epidermidis RP62A, complete gen...    77   4e-13   
gb:CP000027_79821 Dehalococcoides ethenogenes 195, complete genome.    77   4e-13   
pir|AH2837|AH2837 acetolactate synthase large subunit [imported]...    77   4e-13   Agrobacterium tumefaciens
pir|AI0066|AI0066 acetolactate synthase (EC 4.1.3.18) isozyme II...    77   4e-13   Yersinia pestis Nepal516
pir|B97615|B97615 probable decarboxylase (PA2035) [imported] - A...    77   4e-13   Agrobacterium tumefaciens
sp|P00892|ILVG_ECOLI|ILVG_ECOLI Acetolactate synthase isozyme II large subu...    77   4e-13   Escherichia coli [E. coli]
gb:PRH507835_1701804 Papaver rhoeas partial ALS gene for acetola...    77   6e-13   
gb:BA000012_667095 Mesorhizobium loti MAFF303099 DNA, complete g...    77   6e-13   
gb:AE017162_394983 Prochlorococcus marinus subsp. marinus str. C...    77   6e-13   
gb:AE014978_313784 Streptococcus mutans UA159 section 126 of 185...    77   6e-13   
gb:AE012557_284452 Xylella fastidiosa Temecula1, section 5 of 9 ...    77   6e-13   
pir|D82634|D82634 acetolactate synthase isozyme II, large subuni...    77   6e-13   Xylella fastidiosa
pir|AF2826|AF2826 acetolactate synthase III, large subunit [impo...    77   6e-13   Agrobacterium tumefaciens
gb:XSU16280_1727863 Xanthium sp. wild type acetolactate synthase...    76   7e-13   
gb:XSU16279_1727862 Xanthium sp. Missouri field acetolactate syn...    76   7e-13   
gb:PRH577316_1701805 Papaver rhoeas mRNA for acetolactate syntha...    76   7e-13   
gb:PRH507834_1701803 Papaver rhoeas partial ALS gene for acetola...    76   7e-13   
gb:BX571856_781720 Staphylococcus aureus subsp. aureus strain MR...    76   7e-13   
gb:BA000033_712424 Staphylococcus aureus subsp. aureus MW2 DNA, ...    76   7e-13   
gb:AF129503_481682 Buchnera aphidicola natural-host Melaphis rho...    76   7e-13   
gb:AE017282_428571 Methylococcus capsulatus str. Bath, complete ...    76   7e-13   
gb:AE013598_294646 Xanthomonas oryzae pv. oryzae KACC10331, comp...    76   7e-13   
gb:AE012976_287763 Thermoanaerobacter tengcongensis MB4, section...    76   7e-13   
gb:AE012450_282550 Xanthomonas campestris pv. campestris str. AT...    76   7e-13   
gb:CR543861_104892 Acinetobacter sp. ADP1 complete genome.             76   7e-13   
gb:CP000029_82739 Staphylococcus epidermidis RP62A, complete gen...    76   7e-13   
gb:AB057421_8392 Staphylococcus aureus IS256, ORF5, ORF6, etd, O...    76   7e-13   
pir|S75115|S75115 acetohydroxy acid synthase - Synechocystis sp....    76   7e-13   Synechocystis sp. PCC 6803
pir|B90017|B90017 alpha-acetolactate synthase [imported] - Staph...    76   7e-13   Staphylococcus aureus subsp. aureus Mu50
sp|P45261|ILVI_HAEIN|ILVI_HAEIN Acetolactate synthase large subunit (EC 2.2...    76   7e-13   Haemophilus influenzae
gb:AF363370_1791526 Amaranthus powellii acetolactate synthase ge...    76   9e-13   
gb:AF363369_1791525 Amaranthus retroflexus acetolactate synthase...    76   9e-13   
gb:BPI514934_1634078 Bidens pilosa partial als gene for acetolac...    76   9e-13   
gb:AY094592S1_1575785 Amaranthus powellii acetolactate synthase ...    76   9e-13   
gb:AQU514935_1542023 Amaranthus quitensis partial als gene for a...    76   9e-13   
gb:CP000024_876755 Streptococcus thermophilus CNRZ1066, complete...    76   9e-13   
gb:CP000023_874837 Streptococcus thermophilus LMG 18311, complet...    76   9e-13   
gb:CP000001_851396 Bacillus cereus ZK, complete genome.                76   9e-13   
gb:BX569693_776648 Synechococcus sp. WH8102 complete genome; seg...    76   9e-13   
gb:AY619685_637078 Uncultured gamma proteobacterium eBACHOT4E07 ...    76   9e-13   
gb:AE017355_462091 Bacillus thuringiensis serovar konkukian str....    76   9e-13   
gb:AE017267_422186 Bacillus cereus ATCC 10987, section 4 of 18 o...    76   9e-13   
gb:AE017027_381107 Bacillus anthracis str. Ames section 4 of 18 ...    76   9e-13   
gb:AE017000_375826 Bacillus cereus ATCC 14579 section 3 of 18 of...    76   9e-13   
gb:AE014291_308815 Brucella suis 1330 chromosome I, complete seq...    76   9e-13   
gb:AE009923_257448 Pyrobaculum aerophilum strain IM2 section 178...    76   9e-13   
gb:AE008692_240877 Zymomonas mobilis subsp. mobilis ZM4, complet...    76   9e-13   
pir|H83392|H83392 probable decarboxylase PA2035 [imported] - Pse...    76   9e-13   Pseudomonas aeruginosa
pir|H86777|H86777 hypothetical protein ilvB [imported] - Lactoco...    76   9e-13   Lactococcus lactis subsp. lactis
sp|O53250|ILVB_MYCTU|ILVB_MYCTU Acetolactate synthase (EC 2.2.1.6) (Acetohy...    76   9e-13   Mycobacterium tuberculosis
gb:AF308649_1784819 Solanum ptychanthum biotype imidazolinone he...    75   1e-12   
gb:AF308648_1784818 Solanum ptychanthum biotype imidazolinone he...    75   1e-12   
gb:EFI491151_1676384 Endomyces fibuliger ilv2 gene for acetolact...    75   1e-12   
gb:CR380957_1652662 Candida glabrata strain CBS138 chromosome K ...    75   1e-12   
gb:AY541451_1612670 Helianthus annuus haplotype 1 acetohydroxyac...    75   1e-12   
gb:AX768081_1474716 Sequence 3 from Patent WO03044200.                 75   1e-12   
gb:BX936398_834779 Yersinia pseudotuberculosis IP32953 genome, c...    75   1e-12   
gb:AY785370_646010 Streptomyces cinnamonensis unknown gene, part...    75   1e-12   
gb:TACID3_196459 Thermoplasma acidophilum complete genome; segme...    75   1e-12   
pir|AC0475|AC0475 acetolactate synthase (EC 4.1.3.18) isozyme II...    75   1e-12   Yersinia pestis
pir|S39111|S39111 acetolactate synthase (EC 4.1.3.18) precursor ...    75   1e-12   Schizosaccharomyces pombe
sp|P36620|ILVB_SCHPO|ILVB_SCHPO Acetolactate synthase, mitochondrial precur...    75   1e-12   Schizosaccharomyces pombe
sp|P09114|ILV2_TOBAC|ILV2_TOBAC Acetolactate synthase II, chloroplast precu...    75   1e-12   Nicotiana tabacum [American tobacco]
sp|P09342|ILV1_TOBAC|ILV1_TOBAC Acetolactate synthase I, chloroplast precur...    75   1e-12   Nicotiana tabacum [American tobacco]
gb:RRA344990_1703952 Raphanus raphanistrum partial als gene for ...    75   2e-12   
gb:RRA344985_1703947 Raphanus raphanistrum partial als gene for ...    75   2e-12   
gb:RRA344984_1703946 Raphanus raphanistrum partial als gene for ...    75   2e-12   
gb:GHAHASA5_1680018 G.hirsutum gene for acetohydroxyacid synthas...    75   2e-12   
gb:AY541454_1612673 Helianthus annuus haplotype 4 acetohydroxyac...    75   2e-12   
gb:AY541452_1612671 Helianthus annuus haplotype 2 acetohydroxyac...    75   2e-12   
gb:AX768079_1474715 Sequence 1 from Patent WO03044200.                 75   2e-12   
gb:CP000010_867106 Burkholderia mallei ATCC 23344 chromosome 1, ...    75   2e-12   
gb:CP000009_863100 Gluconobacter oxydans 621H, complete genome.        75   2e-12   
gb:BX897699_827695 Bartonella henselae strain Houston-1, complet...    75   2e-12   
gb:BX571965_793167 Burkholderia pseudomallei strain K96243, chro...    75   2e-12   
gb:AE016827_343852 Mannheimia succiniciproducens MBEL55E, comple...    75   2e-12   
gb:AE011992_278366 Xanthomonas axonopodis pv. citri str. 306, se...    75   2e-12   
gb:CP000032_87946 Silicibacter pomeroyi DSS-3 plasmid megaplasmi...    75   2e-12   
gb:CP000026_78407 Salmonella enterica subsp. enterica serovar Pa...    75   2e-12   
gb:AE000516_23181 Mycobacterium tuberculosis CDC1551, complete g...    75   2e-12   
pir|G83059|G83059 acetolactate synthase large subunit PA4696 [im...    75   2e-12   Pseudomonas aeruginosa
pir|AC3329|AC3329 acetolactate synthase (EC 4.1.3.18) [imported]...    75   2e-12   Brucella melitensis
pir|AF0924|AF0924 acetolactate synthase large chain [imported] -...    75   2e-12   Salmonella enterica subsp. enterica serovar Typhi
gb:AF094326_1767723 Bassia scoparia herbicide resistant acetolac...    75   2e-12   
gb:RRA344991_1703953 Raphanus raphanistrum partial als gene for ...    75   2e-12   
gb:AY541457_1612676 Helianthus annuus haplotype 2 acetohydroxyac...    75   2e-12   
gb:AY541456_1612675 Helianthus annuus haplotype 1 acetohydroxyac...    75   2e-12   
gb:AY541455_1612674 Helianthus annuus haplotype 5 acetohydroxyac...    75   2e-12   
gb:BX950851_842583 Erwinia carotovora subsp. atroseptica SCRI104...    75   2e-12   
gb:BX321860_773653 Nitrosomonas europaea ATCC 19718, complete ge...    75   2e-12   
gb:BA000040_734763 Bradyrhizobium japonicum USDA 110 DNA, comple...    75   2e-12   
gb:AP008231_581061 Synechococcus elongatus PCC 6301 DNA, complet...    75   2e-12   
gb:STYSTMD1_194967 Salmonella typhimurium fragment STMD1.>gb:AE0...    75   2e-12   
gb:OSJN00244_1697285 Oryza sativa genomic DNA, chromosome 4, BAC...    74   3e-12   
gb:AY541453_1612672 Helianthus annuus haplotype 3 acetohydroxyac...    74   3e-12   
gb:ASU55852_1542619 Amaranthus sp. acetolactate synthase precurs...    74   3e-12   
gb:AX700699_1473367 Sequence 3 from Patent WO03012115.                 74   3e-12   
gb:AX700697_1473366 Sequence 1 from Patent WO03012115.                 74   3e-12   
gb:BX950851_842963 Erwinia carotovora subsp. atroseptica SCRI104...    74   3e-12   
gb:BX571856_781566 Staphylococcus aureus subsp. aureus strain MR...    74   3e-12   
gb:BX571657_777525 Wolinella succinogenes, complete genome; segm...    74   3e-12   
gb:BA000035_716148 Corynebacterium efficiens YS-314 DNA, complet...    74   3e-12   
gb:BA000033_712270 Staphylococcus aureus subsp. aureus MW2 DNA, ...    74   3e-12   
gb:BA000012_667235 Mesorhizobium loti MAFF303099 DNA, complete g...    74   3e-12   
gb:AP006840_569873 Symbiobacterium thermophilum DNA, complete ge...    74   3e-12   
gb:AE017238_413743 Mycobacterium avium subsp. paratuberculosis s...    74   3e-12   
gb:AE008699_241852 Salmonella typhimurium LT2, section 7 of 220 ...    74   3e-12   
gb:CP000046_92139 Staphylococcus aureus subsp. aureus COL, compl...    74   3e-12   
pir|T07941|T07941 acetolactate synthase (EC 4.1.3.18) - Chlamydo...    74   3e-12   
pir|D89997|D89997 acetolactate synthase large subunit [imported]...    74   3e-12   
pir|C69472|C69472 acetolactate synthase, large subunit (ilvB-2) ...    74   3e-12   
pir|AE2382|AE2382 acetohydroxy acid synthase [imported] - Nostoc...    74   3e-12   
pir|A75387|A75387 acetolactate synthase, large subunit - Deinoco...    74   3e-12   
gb:BT020804_1436162 Bos taurus ilvB (bacterial acetolactate synt...    74   4e-12   
gb:AY116644_589356 Streptomyces viridifaciens amino acid aminotr...    74   4e-12   
gb:AL646068_547005 Ralstonia solanacearum GMI1000 chromosome, co...    74   4e-12   
gb:AE010879_267297 Methanosarcina acetivorans str. C2A, section ...    74   4e-12   
pir|S60058|S60058 acetolactate synthase (EC 4.1.3.18) precursor ...    74   4e-12   
pir|T07968|T07968 acetolactate synthase (EC 4.1.3.18) - Volvox c...    74   4e-12   
pir|T07912|T07912 acetolactate synthase (EC 4.1.3.18) - Chlamydo...    74   4e-12   
pir|A82181|A82181 acetolactate synthase VC1590 [imported] - Vibr...    74   4e-12   
gb:AE016818_1747843 Ashbya gossypii (= Eremothecium gossypii) AT...    74   5e-12   
gb:CR382139_1672071 Debaryomyces hansenii chromosome G of strain...    74   5e-12   
gb:BX572098_798581 Prochlorococcus marinus MIT9313 complete geno...    74   5e-12   
gb:BA000023_692099 Sulfolobus tokodaii str. 7 DNA, complete genome.    74   5e-12   
gb:SPUAHASK_189705 Spirulina platensis acetohydroxy acid synthas...    74   5e-12   
pir|S22490|S22490 acetolactate synthase (EC 4.1.3.18) precursor ...    74   5e-12   
pir|G83123|G83123 probable acetolactate synthase large subunit P...    74   5e-12   
pir|A82375|A82375 acetolactate synthase II, large chain VC0031 [...    74   5e-12   
pir|A44857|A44857 acetolactate synthase (EC 4.1.3.18) - Spirulin...    74   5e-12   
gb:AY647954_1619979 Arabidopsis lyrata subsp. lyrata AT3G48560 g...    73   6e-12   
gb:CP000020_872732 Vibrio fischeri ES114 chromosome I, complete ...    73   6e-12   
gb:AE016912_355547 Chromobacterium violaceum ATCC 12472 section ...    73   6e-12   
gb:AE015868_318654 Shewanella oneidensis MR-1 section 417 of 457...    73   6e-12   
pir|G97289|G97289 acetolactate synthase large chain [imported] -...    73   6e-12   
gb:GHAHASA19_1680017 G.hirsutum gene for acetohydroxyacid syntha...    73   8e-12   
gb:AK087956_1175108 Mus musculus 2 days neonate thymus thymic ce...    73   8e-12   
gb:BX572599_801644 Rhodopseudomonas palustris CGA009 complete ge...    73   8e-12   
gb:BA000030_700619 Streptomyces avermitilis MA-4680 genomic DNA,...    73   8e-12   
gb:AF035772_471434 Leuconostoc lactis acetolactate synthase (als...    73   8e-12   
gb:AE010805_266706 Methanosarcina acetivorans str. C2A, section ...    73   8e-12   
gb:STMILVBCN_192923 Streptomyces avermitilis CU-18 acetolactate ...    73   8e-12   
gb:SME591789_186223 Sinorhizobium meliloti 1021 complete chromos...    73   8e-12   
pir|S22491|S22491 acetolactate synthase (EC 4.1.3.18) precursor ...    73   8e-12   
pir|A56684|A56684 acetohydroxy acid synthase large chain - Brevi...    73   8e-12   
sp|P14874|ILV2_BRANA|ILV2_BRANA Acetolactate synthase II, chloroplast precu...    73   8e-12   
gb:AY541458_1612677 Helianthus annuus haplotype 1 acetohydroxyac...    72   1e-11   
gb:BA000037_724066 Vibrio vulnificus YJ016 DNA, chromosome I, co...    72   1e-11   
gb:AE016800_335773 Vibrio vulnificus CMCP6 chromosome I section ...    72   1e-11   
gb:AE008692_240425 Zymomonas mobilis subsp. mobilis ZM4, complet...    72   1e-11   
gb:CR378664_93834 Photobacterium profundum SS9; segment 2/12.          72   1e-11   
pir|S60056|S60056 acetolactate synthase (EC 4.1.3.18) precursor ...    72   1e-11   
gb:AF487459_1804284 Bromus tectorum acetolactate synthase (ALS) ...    72   1e-11   
gb:AF310684_1785049 Lolium multiflorum acetolactate synthase pre...    72   1e-11   
gb:AB049823_1520919 Oryza sativa ALS mRNA for acetolactate synth...    72   1e-11   
gb:AX705283_1473551 Sequence 13 from Patent WO03014357.>gb:AB049...    72   1e-11   
gb:CP000025_878442 Campylobacter jejuni RM1221, complete genome.       72   1e-11   
gb:BX640424_808588 Bordetella parapertussis strain 12822, comple...    72   1e-11   
gb:BX640413_805207 Bordetella pertussis strain Tohama I, complet...    72   1e-11   
gb:AL646064_546281 Ralstonia solanacearum GMI1000 chromosome, co...    72   1e-11   
pir|E81404|E81404 acetolactate synthase (EC 4.1.3.18) large chai...    72   1e-11   
gb:AF488771_1804468 Bromus tectorum acetolactate synthase (ALS) ...    72   2e-11   
gb:AF059600_1765053 Hordeum vulgare acetohydroxyacid synthase (A...    72   2e-11   
gb:AY210408_1589683 Triticum aestivum cultivar TealIMI11A acetoh...    72   2e-11   
gb:AY210407_1589682 Triticum aestivum cultivar TealIMI10A acetoh...    72   2e-11   
gb:AY210406_1589681 Triticum aestivum cultivar CDC Teal acetohyd...    72   2e-11   
gb:AY210405_1589680 Triticum aestivum cultivar CDC Teal acetohyd...    72   2e-11   
gb:AX705303_1473561 Sequence 33 from Patent WO03014357.                72   2e-11   
gb:AX705301_1473560 Sequence 31 from Patent WO03014357.                72   2e-11   
gb:AX705299_1473559 Sequence 29 from Patent WO03014357.                72   2e-11   
gb:AX705297_1473558 Sequence 27 from Patent WO03014357.                72   2e-11   
gb:AX705295_1473557 Sequence 25 from Patent WO03014357.                72   2e-11   
gb:AX705293_1473556 Sequence 23 from Patent WO03014357.                72   2e-11   
gb:AX705291_1473555 Sequence 21 from Patent WO03014357.                72   2e-11   
gb:AX705289_1473554 Sequence 19 from Patent WO03014357.                72   2e-11   
gb:AX705287_1473553 Sequence 17 from Patent WO03014357.                72   2e-11   
gb:AX705285_1473552 Sequence 15 from Patent WO03014357.                72   2e-11   
gb:AX705273_1473550 Sequence 3 from Patent WO03014357.                 72   2e-11   
gb:AX705271_1473549 Sequence 1 from Patent WO03014357.                 72   2e-11   
gb:AE013477_292670 Methanosarcina mazei strain Goe1, section 259...    72   2e-11   
pir|D69512|D69512 acetolactate synthase, large subunit (ilvB-4) ...    72   2e-11   
sp|P07342|ILVB_YEAST|ILVB_YEAST Acetolactate synthase, mitochondrial precur...    72   2e-11   
gb:BX640441_814079 Bordetella bronchiseptica strain RB50, comple...    71   2e-11   
gb:BA000045_743354 Gloeobacter violaceus PCC 7421 DNA, complete ...    71   2e-11   
gb:BA000039_727080 Thermosynechococcus elongatus BP-1 DNA, compl...    71   2e-11   
gb:BA000031_708518 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    71   2e-11   
gb:SME591784_184585 Sinorhizobium meliloti 1021 complete chromos...    71   2e-11   
pir|F86051|F86051 hypothetical protein ilvB [imported] - Escheri...    71   2e-11   
pir|D91205|D91205 acetolactate synthase I large subunit [importe...    71   2e-11   
pir|E90204|E90204 hypothetical protein ilvB-2 [imported] - Sulfo...    71   2e-11   
gb:PSP224709_1702285 Porphyridium sp. chloroplast gene encoding ...    71   3e-11   
gb:AX065107_1459467 Sequence 233 from Patent WO0100844.                71   3e-11   
gb:AF067623_1238054 Caenorhabditis elegans cosmid T26C12, comple...    71   3e-11   
gb:CP000010_866065 Burkholderia mallei ATCC 23344 chromosome 1, ...    71   3e-11   
gb:BX571965_790979 Burkholderia pseudomallei strain K96243, chro...    71   3e-11   
gb:AE014246_306507 Streptococcus agalactiae 2603V/R section 56 o...    71   3e-11   
gb:SAG766849_170793 Streptococcus agalactiae NEM316 complete gen...    71   3e-11   
gb:CP000032_88186 Silicibacter pomeroyi DSS-3 plasmid megaplasmi...    71   3e-11   
pir|T33164|T33164 hypothetical protein T26C12.1 - Caenorhabditis...    71   3e-11   
sp|Q59498|ILVB_MYCAV|ILVB_MYCAV Acetolactate synthase (EC 2.2.1.6) (Acetohy...    71   3e-11   
sp|P42463|ILVB_CORGL|ILVB_CORGL Acetolactate synthase large subunit (EC 2.2...    71   3e-11   
gb:CQ980452_1455491 Sequence 1 from Patent WO2004111245.>gb:CQ98...    70   4e-11   
gb:BX640426_809464 Bordetella parapertussis strain 12822, comple...    70   4e-11   
gb:BX640415_805955 Bordetella pertussis strain Tohama I, complet...    70   4e-11   
gb:AE017313_439627 Desulfovibrio vulgaris subsp. vulgaris str. H...    70   4e-11   
gb:AE016859_350427 Pseudomonas syringae pv. tomato str. DC3000 s...    70   4e-11   
gb:AE016791_334067 Pseudomonas putida KT2440 section 18 of 21 of...    70   4e-11   
gb:AE016778_330596 Pseudomonas putida KT2440 section 5 of 21 of ...    70   4e-11   
gb:ECILVX_126078 E. coli genes ilvL, ilvG and ilvE'. ilvG is ace...    70   4e-11   
sp|O78518|ILVB_GUITH|ILVB_GUITH Acetolactate synthase large subunit (EC 2.2...    70   4e-11   
gb:CR382129_1661327 Yarrowia lipolytica chromosome C of strain C...    70   5e-11   
gb:BX640439_813576 Bordetella bronchiseptica strain RB50, comple...    70   5e-11   
gb:AY466441_621199 Saccharopolyspora spinosa NRLL 18395 obscurin...    70   5e-11   
gb:CR378674_96826 Photobacterium profundum SS9; segment 12/12.         70   5e-11   
gb:CP000026_78324 Salmonella enterica subsp. enterica serovar Pa...    70   5e-11   
gb:BC011761_1973191 Homo sapiens ilvB (bacterial acetolactate sy...    70   7e-11   
gb:AC003956_1874499 Homo sapiens DNA from chromosome 19, cosmid ...    70   7e-11   
gb:CR382122_1655353 Kluyveromyces lactis strain NRRL Y-1140 chro...    70   7e-11   
gb:BX640421_807844 Bordetella pertussis strain Tohama I, complet...    70   7e-11   
gb:BA000012_669982 Mesorhizobium loti MAFF303099 DNA, complete g...    70   7e-11   
gb:AF124757_481079 Zymomonas mobilis fosmid clone 43D2, complete...    70   7e-11   
gb:D89674_121218 Citrobacter freundii DNA for valine-sensitive a...    70   7e-11   
gb:BA000045_742879 Gloeobacter violaceus PCC 7421 DNA, complete ...    69   9e-11   
gb:BA000028_696668 Oceanobacillus iheyensis HTE831 DNA, complete...    69   9e-11   
gb:AE014295_311683 Bifidobacterium longum NCC2705, complete genome.    69   9e-11   
gb:CSALSGENE_119211 C.synechocystis als gene.                          69   9e-11   
pir|S75122|S75122 acetolactate synthase - Synechocystis sp. (str...    69   9e-11   
gb:BX571965_791242 Burkholderia pseudomallei strain K96243, chro...    69   1e-10   
gb:AE017310_438616 Desulfovibrio vulgaris subsp. vulgaris str. H...    69   1e-10   
gb:AE016991_373413 Shigella flexneri 2a str. 2457T section 14 of...    69   1e-10   
gb:AE016769_328568 Escherichia coli CFT073 section 15 of 18 of t...    69   1e-10   
sp|O33112|ILVB_MYCLE|ILVB_MYCLE Acetolactate synthase (EC 2.2.1.6) (Acetohy...    69   1e-10   
sp|P08142|ILVB_ECOLI|ILVB_ECOLI Acetolactate synthase isozyme I large subun...    69   1e-10   
gb:BX957220_843903 Methanococcus maripaludis S2 complete genome;...    69   2e-10   
gb:BX640413_805222 Bordetella pertussis strain Tohama I, complet...    69   2e-10   
gb:BX294155_772114 Pirellula sp. strain 1 complete genome; segme...    69   2e-10   
gb:AE016779_330831 Pseudomonas putida KT2440 section 6 of 21 of ...    69   2e-10   
sp|Q57725|ILVB_METJA|ILVB_METJA Probable acetolactate synthase large subuni...    69   2e-10   
gb:AE016790_333691 Pseudomonas putida KT2440 section 17 of 21 of...    68   2e-10   
gb:BX936398_836859 Yersinia pseudotuberculosis IP32953 genome, c...    68   3e-10   
gb:AL935254_550902 Lactobacillus plantarum strain WCFS1 complete...    68   3e-10   
gb:AF118061_480420 Methanococcus maripaludis acetohydroxyacid sy...    68   3e-10   
gb:CR555306_109449 Azoarcus sp. EbN1 complete genome.                  68   3e-10   
gb:AE005674_73374 Shigella flexneri 2a str. 301, complete genome.      68   3e-10   
pir|AF0279|AF0279 acetolactate synthase (EC 4.1.3.18) large chai...    68   3e-10   
pir|AB0963|AB0963 acetohydroxy acid synthase I, small chain [imp...    68   3e-10   
gb:AJ632117_1812812 Bidens pilosa partial orthologous als2 gene ...    67   3e-10   
gb:AJ632115_1812810 Bidens pilosa partial orthologous als2 gene ...    67   3e-10   
gb:AF394891_1795498 Filobasidiella neoformans acetolactate synth...    67   3e-10   
gb:AE017341_1754094 Cryptococcus neoformans var. neoformans JEC2...    67   3e-10   
gb:AY450850_1606671 Cryptococcus neoformans var. grubii acetolac...    67   3e-10   
gb:BX640425_809083 Bordetella parapertussis strain 12822, comple...    67   3e-10   
gb:BX248586_764185 Blochmannia floridanus complete genome; segme...    67   3e-10   
gb:BA000028_697796 Oceanobacillus iheyensis HTE831 DNA, complete...    67   3e-10   
gb:AE016950_365271 Enterococcus faecalis V583, section 4 of 11 o...    67   3e-10   
gb:AE016923_358850 Chromobacterium violaceum ATCC 12472 section ...    67   3e-10   
gb:HSU61263_2025267 Human acetolactate synthase homolog mRNA, co...    67   4e-10   
gb:AF013601_1761284 Magnaporthe grisea acetolactate synthase gen...    67   4e-10   
gb:BA000039_727608 Thermosynechococcus elongatus BP-1 DNA, compl...    67   4e-10   
gb:AE017146_390617 Helicobacter hepaticus ATCC 51449 section 3 o...    67   4e-10   
gb:AE011424_272807 Leptospira interrogans serovar lai str. 56601...    67   4e-10   
gb:CR378670_95638 Photobacterium profundum SS9; segment 8/12.          67   4e-10   
pir|G83024|G83024 probable acetolactate synthase large subunit P...    67   4e-10   
gb:BC077553_2560259 Xenopus laevis ilvB (bacterial acetolactate ...    67   6e-10   
gb:LOALSSDGN_141701 Oenococcus oeni alsS gene for alpha-acetolac...    67   6e-10   
pir|T08085|T08085 acetolactate synthase (EC 4.1.3.18) precursor ...    67   6e-10   
gb:BACALSRD_744803 Bacillus subtilis als operon regulatory prote...    66   7e-10   
gb:AE017298_434930 Leptospira interrogans serovar Copenhageni st...    66   7e-10   
gb:AE011271_271101 Leptospira interrogans serovar lai str. 56601...    66   7e-10   
gb:BX572605_803376 Rhodopseudomonas palustris CGA009 complete ge...    66   1e-09   
gb:BX572091_796152 Prochlorococcus marinus MED4 complete genome;...    66   1e-09   
pir|F69501|F69501 acetolactate synthase, large subunit (ilvB-3) ...    66   1e-09   
gb:AB002583_1508819 Cyanidioschyzon merolae chloroplast DNA, com...    65   1e-09   
pir|AD2250|AD2250 acetolactate synthase [imported] - Nostoc sp. ...    65   1e-09   
sp|P31594|ILVB_PORPU|ILVB_PORPU Acetolactate synthase large subunit (EC 2.2...    65   1e-09   
gb:AP006841_574281 Bacteroides fragilis YCH46 DNA, complete genome.    65   2e-09   
gb:AE017203_404335 Lactobacillus johnsonii NCC 533, section 4 of...    65   2e-09   
gb:AY673996_1621412 Gracilaria tenuistipitata var. liui chloropl...    65   2e-09   
gb:AY714843_1189409 Uncultured archaeon GZfos26G2 clone GZfos26G...    65   2e-09   
gb:AE014292_310494 Brucella suis 1330 chromosome II, complete se...    65   2e-09   
pir|AF3553|AF3553 acetolactate synthase (EC 4.1.3.18) [imported]...    65   2e-09   
gb:BA000028_697624 Oceanobacillus iheyensis HTE831 DNA, complete...    64   3e-09   
gb:AE016934_361445 Bacteroides thetaiotaomicron VPI-5482, sectio...    64   3e-09   
gb:AB115590_14012 Klebsiella pneumoniae genomic DNA, chromosomal...    64   3e-09   
gb:AY774470_2149183 Synthetic construct Francisella tularensis c...    64   4e-09   
gb:CP000001_852763 Bacillus cereus ZK, complete genome.                64   4e-09   
gb:BX572601_802374 Rhodopseudomonas palustris CGA009 complete ge...    64   4e-09   
gb:BA000030_698841 Streptomyces avermitilis MA-4680 genomic DNA,...    64   4e-09   
gb:AE017333_446438 Bacillus licheniformis DSM 13, complete genom...    64   4e-09   
gb:AE017272_423642 Bacillus cereus ATCC 10987, section 9 of 18 o...    64   4e-09   
gb:AE017005_377248 Bacillus cereus ATCC 14579 section 8 of 18 of...    64   4e-09   
gb:CR555306_108092 Azoarcus sp. EbN1 complete genome.                  64   4e-09   
gb:BX571966_793657 Burkholderia pseudomallei strain K96243, chro...    64   5e-09   
gb:MAU35458_142554 Methanococcus aeolicus acetohydroxyacid synth...    64   5e-09   
gb:CP000031_86891 Silicibacter pomeroyi DSS-3, complete genome.        64   5e-09   
gb:CP000031_86403 Silicibacter pomeroyi DSS-3, complete genome.        64   5e-09   
gb:BX572606_803667 Rhodopseudomonas palustris CGA009 complete ge...    63   6e-09   
gb:AE016757_324668 Escherichia coli CFT073 section 3 of 18 of th...    63   6e-09   
gb:AE008720_242243 Salmonella typhimurium LT2, section 28 of 220...    63   6e-09   
gb:ECU82664_134870 Escherichia coli minutes 9 to 11 genomic sequ...    63   6e-09   
gb:CP000026_76976 Salmonella enterica subsp. enterica serovar Pa...    63   6e-09   
pir|D96015|D96015 probable tartronate-semialdehyde synthase (EC ...    63   6e-09   
pir|AH0566|AH0566 tartronate-semialdehyde synthase (EC 4.1.1.47)...    63   6e-09   
pir|JT0742|JT0742 tartronate-semialdehyde synthase (EC 4.1.1.47)...    63   6e-09   
sp|P30146|GCL_ECOLI|GCL_ECOLI Glyoxylate carboligase (EC 4.1.1.47) (Tartro...    63   6e-09   
gb:AX349268_1465985 Sequence 1 from Patent WO0202753.                  63   8e-09   
gb:BA000040_731225 Bradyrhizobium japonicum USDA 110 DNA, comple...    63   8e-09   
gb:BA000012_666164 Mesorhizobium loti MAFF303099 DNA, complete g...    63   8e-09   
gb:AY007242_584470 Pseudomonas fluorescens biovar I benzaldehyde...    63   8e-09   
gb:AE016979_370423 Shigella flexneri 2a str. 2457T section 2 of ...    63   8e-09   
gb:AE005674_70028 Shigella flexneri 2a str. 301, complete genome.      63   8e-09   
gb:MGU39201_1686128 Magnaporthe grisea acetolactate synthase mRN...    62   1e-08   
gb:BA000040_735073 Bradyrhizobium japonicum USDA 110 DNA, comple...    62   1e-08   
gb:BA000040_731426 Bradyrhizobium japonicum USDA 110 DNA, comple...    62   1e-08   
gb:AE017324_443190 Listeria monocytogenes str. 4b F2365, section...    62   1e-08   
pir|AB1165|AB1165 pyruvate oxidase homolog lmo0722 [imported] - ...    62   1e-08   
pir|B83457|B83457 glyoxylate carboligase PA1502 [imported] - Pse...    62   2e-08   


>pir|T51575|T51575 2-hydroxyphytanoyl-CoA lyase-like protein -
           Arabidopsis thaliana>gb:ATT10B6_1554193 Arabidopsis
           thaliana DNA chromosome 5, BAC clone T10B6 (ESSA
           project).>gb:AY099774_1576799 Arabidopsis thaliana
           2-hydroxyphytanoyl-CoA lyase-like protein (At5g17380)
           mRNA, complete cds.>gb:BT000284_1634562 Arabidopsis
           thaliana 2-hydroxyphytanoyl-CoA lyase-like protein
           (At5g17380) mRNA, complete cds.
          Length = 572

 Score =  261 bits (667), Expect = 1e-68
 Identities = 127/179 (70%), Positives = 146/179 (81%)
 Frame = +2

Query: 323 VDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXL 502
           +D N+LVA SL+  GV  MFGVVGIPVTSLA+RA+ALGIRFIAFHNEQ           L
Sbjct: 12  IDGNVLVAKSLSHLGVTHMFGVVGIPVTSLASRAMALGIRFIAFHNEQSAGYAASAYGYL 71

Query: 503 TGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKP 682
           TG+PGILLTVSGPGCVHGLAGLSNA VNTWP+VMISGSCDQ+D GRGDFQELDQIEAVK 
Sbjct: 72  TGKPGILLTVSGPGCVHGLAGLSNAWVNTWPMVMISGSCDQRDVGRGDFQELDQIEAVKA 131

Query: 683 FSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEAERLIAEAQ 859
           FSK S KA D+ ++P CV  VLD A +GRPGGCYLD+P+DVL Q +SESEA++L+ E +
Sbjct: 132 FSKLSEKAKDVREIPDCVSRVLDRAVSGRPGGCYLDIPTDVLRQKISESEADKLVDEVE 190



>gb:ATH278629_1552265 Arabidopsis thaliana mRNA for Oxalyl-CoA
           decarboxylase (ocd gene).
          Length = 572

 Score =  260 bits (665), Expect = 2e-68
 Identities = 127/179 (70%), Positives = 145/179 (81%)
 Frame = +2

Query: 323 VDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXL 502
           +D N+LVA SL+  GV  MFGVVGIPVTSLA+RA+ALGIRFIAFHNEQ           L
Sbjct: 12  IDGNVLVAKSLSHLGVTHMFGVVGIPVTSLASRAMALGIRFIAFHNEQSAGYAASAYGYL 71

Query: 503 TGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKP 682
           TG+PGILLTVSGPGCVHGLAGLSN  VNTWPLVMISGSCDQ+D GRGDFQELDQIEAVK 
Sbjct: 72  TGKPGILLTVSGPGCVHGLAGLSNXWVNTWPLVMISGSCDQRDVGRGDFQELDQIEAVKA 131

Query: 683 FSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEAERLIAEAQ 859
           FSK S KA D+ ++P CV  VLD A +GRPGGCYLD+P+DVL Q +SESEA++L+ E +
Sbjct: 132 FSKLSEKAKDVREIPDCVSRVLDRAVSGRPGGCYLDIPTDVLRQKISESEADKLVDEVE 190



>gb:AK125241_1915864 Homo sapiens cDNA FLJ43251 fis, clone
           HEART2006131, weakly similar to Mus musculus
           2-hydroxyphytanoyl-CoA lyase (Hpcl-pending).
          Length = 569

 Score =  157 bits (396), Expect = 3e-37
 Identities = 72/165 (43%), Positives = 102/165 (61%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           L+A +L   GV  +FG+VGIPV  +A   VA GIRFI F NEQ           L+GRPG
Sbjct: 11  LIAQTLKNQGVQVIFGIVGIPVVEVAEACVAAGIRFIGFRNEQSAAYAASIYGYLSGRPG 70

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + L+V GPG VH LAGL N+ +N WPL+++SGSC+      G FQELDQ+EA + + K+S
Sbjct: 71  VCLSVGGPGVVHALAGLLNSKINCWPLILLSGSCETDQTDMGAFQELDQVEAARQYCKYS 130

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESE 832
           A+   + ++P  + +    A  GRPG  Y+DLP+D +   ++  +
Sbjct: 131 ARPASLEQLPFVIEKAFRTALYGRPGAAYVDLPADYIQYPITNKK 175



>gb:BC078697_2106863 Rattus norvegicus 2-hydroxyphytanoyl-Coenzyme A
           lyase, mRNA (cDNA clone MGC:93083 IMAGE:7110355),
           complete cds.>gb:RNO517469_2136029 Rattus norvegicus
           mRNA for 2-hydroxyphytanoyl-CoA lyase (2HPCL gene).
          Length = 581

 Score =  149 bits (375), Expect = 9e-35
 Identities = 72/164 (43%), Positives = 104/164 (63%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           ++A +L    V+ MFGVVGIPVT +A  A  LGI++I   NEQ           LTGRPG
Sbjct: 22  VIAQALKTQDVEYMFGVVGIPVTEIALAAQELGIKYIGMRNEQAACYAASAVGYLTGRPG 81

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + L VSGPG +H L G++NA +N WPL++I GS ++     G FQE  Q+EA + +SKFS
Sbjct: 82  VCLVVSGPGLIHALGGMANANMNCWPLIVIGGSSERNQEAMGAFQEFPQVEACRLYSKFS 141

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSES 829
           A+ + I  +P  + + +  +  GRPG CY+D+P+D++  T+ ES
Sbjct: 142 ARPSSIQHIPFVIEKAVRSSIYGRPGACYIDVPADLV--TLQES 183



>gb:MMU132139_2118402 Mus musculus mRNA for 2-hydroxyphytanoyl-CoA
           lyase, partial.
          Length = 581

 Score =  145 bits (367), Expect = 7e-34
 Identities = 68/155 (43%), Positives = 98/155 (63%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           ++A +L    V+ MFGVVGIPVT +A  A  LGI++I   NEQ           LTGRPG
Sbjct: 22  VIAQALKTQDVEYMFGVVGIPVTEIALAAQELGIKYIGMRNEQAACYAASAVGYLTGRPG 81

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + L VSGPG +H L G++NA +N WPL++I GS ++     G FQE  Q+EA + ++KFS
Sbjct: 82  VCLVVSGPGLIHALGGMANANMNCWPLIVIGGSSERNQEAMGAFQEFPQVEACRLYTKFS 141

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSD 802
           A+ + I  +P  + + +  +  GRPG CY+D+P+D
Sbjct: 142 ARPSTIELIPFIIEKAVRSSIYGRPGACYIDIPAD 176



>sp|Q9QXE0|HPCL_MOUSE 2-hydroxyphytanoyl-CoA lyase (EC 4.1.-.-)
           (2-HPCL).>gb:AK005505_1153072 Mus musculus adult female
           placenta cDNA, RIKEN full-length enriched library,
           clone:1600020H07 product:2-hydroxyphytanoyl-CoA lyase,
           full insert sequence.>gb:AK041686_1166077 Mus musculus 3
           days neonate thymus cDNA, RIKEN full-length enriched
           library, clone:A630030C09 product:2-hydroxyphytanoyl-CoA
           lyase, full insert sequence.>gb:AK050078_1169107 Mus
           musculus adult male liver tumor cDNA, RIKEN full-length
           enriched library, clone:C730010O16
           product:2-hydroxyphytanoyl-CoA lyase, full insert
           sequence.>gb:BC021360_2093394 Mus musculus RIKEN cDNA
           1600020H07 gene, mRNA (cDNA clone MGC:29195
           IMAGE:5011451), complete cds.
          Length = 581

 Score =  145 bits (367), Expect = 7e-34
 Identities = 68/155 (43%), Positives = 98/155 (63%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           ++A +L    V+ MFGVVGIPVT +A  A  LGI++I   NEQ           LTGRPG
Sbjct: 22  VIAQALKTQDVEYMFGVVGIPVTEIALAAQELGIKYIGMRNEQAACYAASAVGYLTGRPG 81

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + L VSGPG +H L G++NA +N WPL++I GS ++     G FQE  Q+EA + ++KFS
Sbjct: 82  VCLVVSGPGLIHALGGMANANMNCWPLIVIGGSSERNQEAMGAFQEFPQVEACRLYTKFS 141

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSD 802
           A+ + I  +P  + + +  +  GRPG CY+D+P+D
Sbjct: 142 ARPSTIELIPFIIEKAVRSSIYGRPGACYIDIPAD 176



>gb:BC066580_2554455 Danio rerio zgc:76920, mRNA (cDNA clone
           MGC:76920 IMAGE:6524397), complete cds.
          Length = 568

 Score =  144 bits (363), Expect = 2e-33
 Identities = 66/172 (38%), Positives = 103/172 (59%)
 Frame = +2

Query: 314 MADVDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXX 493
           M +V    L+A +L    V+ MFG+VG+P+  +A  A A GI+++   NEQ         
Sbjct: 1   MDEVTGAQLIAAALKDQNVEYMFGIVGVPIIEVAMAAQAAGIKYVGMRNEQAACYAASAI 60

Query: 494 XXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEA 673
             LTGRP + L VSGPG +H L G++NA VN WP++++ GS D+     G FQE  Q+EA
Sbjct: 61  GYLTGRPAVCLVVSGPGLIHALGGMANANVNCWPVIVLGGSSDRNQETTGAFQEFPQVEA 120

Query: 674 VKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSES 829
            + +SKFSA+ + +  +PA V + +  +  GRPG CY+D+  D+++  +  +
Sbjct: 121 CRLYSKFSARPSSLEMIPAVVEKAVRSSIYGRPGACYIDIAGDMVNAKIDRA 172



>gb:AB162349_1201682 Drosophila simulans genes, CG11099 to CG8900
           region, complete cds.>gb:AB162351_1201700 Drosophila
           sechellia genes, CG11099 to CG8914 region, complete cds.
          Length = 568

 Score =  144 bits (362), Expect = 3e-33
 Identities = 68/179 (37%), Positives = 106/179 (59%)
 Frame = +2

Query: 314 MADVDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXX 493
           MA+V+   ++A SL + GV+ +FG++GIPV  L+    A G+++I   NEQ         
Sbjct: 1   MAEVEAVQIIAESLKQQGVEYVFGIIGIPVIELSMAFQAAGLKYIGMRNEQAACYAAQAI 60

Query: 494 XXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEA 673
             LTG+PG+ L VSGPG +H   G++NA VN WPL++I G+ +Q   G G FQE  Q+E 
Sbjct: 61  GYLTGKPGVCLVVSGPGLLHVTGGMANAQVNCWPLIVIGGATNQDHEGIGGFQECPQVEL 120

Query: 674 VKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEAERLIA 850
            +P+ K++A+    + +P  V + + +A  GRPG  YLD P ++L     E+   + +A
Sbjct: 121 SRPYCKYAARPATAALIPLHVEKAVRYATYGRPGVAYLDFPGNILQSKAQEARIYKALA 179



>gb:AE013599_1132892 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003793_1224810 Drosophila melanogaster
           chromosome 2R, section 57 of 74 of the complete
           sequence.>gb:AY058683_1291837 Drosophila melanogaster
           LD40177 full length cDNA.
          Length = 568

 Score =  144 bits (362), Expect = 3e-33
 Identities = 68/179 (37%), Positives = 106/179 (59%)
 Frame = +2

Query: 314 MADVDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXX 493
           MA+V+   ++A SL + GV+ +FG++GIPV  L+    A G+++I   NEQ         
Sbjct: 1   MAEVEAVQIIAESLKQQGVEYVFGIIGIPVIELSMAFQAAGLKYIGMRNEQAACYAAQAI 60

Query: 494 XXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEA 673
             LTG+PG+ L VSGPG +H   G++NA VN WPL++I G+ +Q   G G FQE  Q+E 
Sbjct: 61  GYLTGKPGVCLVVSGPGLLHVTGGMANAQVNCWPLIVIGGATNQDHEGIGGFQECPQVEL 120

Query: 674 VKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEAERLIA 850
            +P+ K++A+    + +P  V + + +A  GRPG  YLD P ++L     E+   + +A
Sbjct: 121 SRPYCKYAARPATAALIPLHVEKAVRYATYGRPGVAYLDFPGNILQSKAQEASIYKALA 179



>gb:AE016764_326903 Escherichia coli CFT073 section 10 of 18 of the
           complete genome.>gb:AE014075_957487 Escherichia coli
           CFT073 complete genome.
          Length = 564

 Score =  143 bits (360), Expect = 5e-33
 Identities = 72/177 (40%), Positives = 110/177 (62%), Gaps = 2/177 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           ++  +L +  +D ++GVVGIPVT +A  A A GIR+I F +EQ           LT +PG
Sbjct: 13  IIVEALKQNNIDTIYGVVGIPVTDMARHAQAEGIRYIGFRHEQSAGYAAAASGFLTQKPG 72

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQK--DFGRGDFQELDQIEAVKPFSK 691
           I LTVS PG ++GL  L+NA VN +P++MISGS D+   D  +GD++ELDQ+ A KP++K
Sbjct: 73  ICLTVSAPGFLNGLTALANATVNGFPMIMISGSSDRAIVDLQQGDYEELDQMNAAKPYAK 132

Query: 692 FSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEAERLIAEAQD 862
            + +      +   +   +  + +GRPGG YLDLP++VL  T+ + EA   I + ++
Sbjct: 133 AAFRVNQPQDLGIALARAIRVSVSGRPGGVYLDLPANVLAATMEKDEALTTIVKVEN 189



>gb:AE005674_72022 Shigella flexneri 2a str. 301, complete
           genome.>gb:AE016986_372208 Shigella flexneri 2a str.
           2457T section 9 of 16 of the complete
           genome.>gb:AE014073_996958 Shigella flexneri 2a str.
           2457T complete genome.
          Length = 564

 Score =  143 bits (360), Expect = 5e-33
 Identities = 72/177 (40%), Positives = 110/177 (62%), Gaps = 2/177 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           ++  +L +  +D ++GVVGIPVT +A  A A GIR+I F +EQ           LT +PG
Sbjct: 13  IIVEALKQNNIDTIYGVVGIPVTDMARHAQAEGIRYIGFRHEQSAGYAAAASGFLTQKPG 72

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQK--DFGRGDFQELDQIEAVKPFSK 691
           I LTVS PG ++GL  L+NA VN +P++MISGS D+   D  +GD++ELDQ+ A KP++K
Sbjct: 73  ICLTVSAPGFLNGLTALANATVNGFPIIMISGSSDRAIVDLQQGDYEELDQMNAAKPYAK 132

Query: 692 FSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEAERLIAEAQD 862
            + +      +   +   +  + +GRPGG YLDLP++VL  T+ + EA   I + ++
Sbjct: 133 AAFRVNQPQDLGIALARAIRVSVSGRPGGVYLDLPANVLAATMEKDEALTTIVKVEN 189



>sp|P78093|OXC_ECOLI Probable oxalyl-CoA decarboxylase (EC
           4.1.1.8).>pir|B65011|B65011 Probable oxalyl-CoA
           decarboxylase (EC 4.1.1.8) - Escherichia coli (strain
           K-12)>pir|E91035|E91035 Probable oxalyl-CoA
           decarboxylase (EC 4.1.1.8) - Escherichia coli (strain
           O157:H7, substrain RIMD 0509952)>pir|G85879|G85879
           Probable oxalyl-CoA decarboxylase (EC 4.1.1.8) -
           Escherichia coli (strain O157:H7, substrain
           EDL933)>gb:AE005174_67498 Escherichia coli O157:H7
           EDL933, complete genome.>gb:U00096_201419 Escherichia
           coli K-12 MG1655 complete genome.>gb:BA000007_661265
           Escherichia coli O157:H7 DNA, complete genome.
          Length = 564

 Score =  143 bits (360), Expect = 5e-33
 Identities = 72/177 (40%), Positives = 110/177 (62%), Gaps = 2/177 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           ++  +L +  +D ++GVVGIPVT +A  A A GIR+I F +EQ           LT +PG
Sbjct: 13  IIVEALKQNNIDTIYGVVGIPVTDMARHAQAEGIRYIGFRHEQSAGYAAAASGFLTQKPG 72

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQK--DFGRGDFQELDQIEAVKPFSK 691
           I LTVS PG ++GL  L+NA VN +P++MISGS D+   D  +GD++ELDQ+ A KP++K
Sbjct: 73  ICLTVSAPGFLNGLTALANATVNGFPMIMISGSSDRAIVDLQQGDYEELDQMNAAKPYAK 132

Query: 692 FSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEAERLIAEAQD 862
            + +      +   +   +  + +GRPGG YLDLP++VL  T+ + EA   I + ++
Sbjct: 133 AAFRVNQPQDLGIALARAIRVSVSGRPGGVYLDLPANVLAATMEKDEALTTIVKVEN 189



>gb:HSA131753_2000229 Homo sapiens mRNA for 2-hydroxyphytanoyl-CoA
           lyase.
          Length = 578

 Score =  142 bits (359), Expect = 6e-33
 Identities = 68/176 (38%), Positives = 105/176 (59%)
 Frame = +2

Query: 296 HFRDNLMADVDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXX 475
           +F +     V    ++A +L    V+ +FG+VGIPVT +A  A  LGI++I   NEQ   
Sbjct: 5   NFAERSEEQVSGAKVIAQALKTQDVEYIFGIVGIPVTEIAIAAQQLGIKYIGMRNEQAAC 64

Query: 476 XXXXXXXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQE 655
                   LT RPG+ L VSGPG +H L G++NA +N WPL++I GS ++     G FQE
Sbjct: 65  YAASAIGYLTSRPGVCLVVSGPGLIHALGGMANANMNCWPLLVIGGSSERNQETMGAFQE 124

Query: 656 LDQIEAVKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVS 823
             Q+EA + ++KFSA+ + I  +P  + + +  +  GRPG CY+D+P+D ++  V+
Sbjct: 125 FPQVEACRLYTKFSARXSSIEAIPFVIEKAVRSSIYGRPGACYVDIPADFVNLQVN 180



>gb:BC077507_2560215 Xenopus laevis MGC82654 protein, mRNA (cDNA
           clone MGC:82654 IMAGE:5072965), complete cds.
          Length = 577

 Score =  142 bits (358), Expect = 8e-33
 Identities = 64/165 (38%), Positives = 102/165 (61%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           ++A +L    V  MFG+VGIPV  +A  A A GI+++   NEQ           LTGRPG
Sbjct: 18  IIAEALVAQNVKYMFGIVGIPVIEIAVAAQAAGIKYVGMRNEQAACYAASAVGYLTGRPG 77

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + L VSGPG ++ L+G++N+ +N WPL++++GS D      G FQE  Q+E  + +SKFS
Sbjct: 78  VCLVVSGPGLINALSGMANSNMNCWPLIVLAGSSDTNQETMGAFQEFPQVETCRLYSKFS 137

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESE 832
           A+ + +  +P  + + +  +  GRPG CY+D+P D +++ V+ S+
Sbjct: 138 ARPSSLEAIPVVIEKAVRSSIYGRPGSCYVDIPGDFVNKMVNRSD 182



>gb:CR382131_1663760 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 562

 Score =  142 bits (358), Expect = 8e-33
 Identities = 66/159 (41%), Positives = 103/159 (64%)
 Frame = +2

Query: 332 NMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGR 511
           + ++A SL + GV+ +FG+VGIPV  +A+  +A GI+FI F NEQ           L+G+
Sbjct: 4   SQVIAESLVQLGVEHIFGIVGIPVIEVADACIARGIKFIGFRNEQSASYAASIYGYLSGK 63

Query: 512 PGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSK 691
           PG+ LTV GPG +H LAG+ NA  N +PL++++GS D  +  +G FQELDQ+ AV  ++K
Sbjct: 64  PGVCLTVGGPGVLHALAGVGNAQSNCFPLLLLAGSVDVHNTHKGGFQELDQVAAVTEYTK 123

Query: 692 FSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVL 808
           F+A+ +    +P  + +    A  GRPG  Y+DLP++++
Sbjct: 124 FAARPSSTDALPFLLEKAYRTAYFGRPGATYVDLPANII 162



>gb:AF161397_1150290 Homo sapiens HSPC279 mRNA, partial cds.
          Length = 581

 Score =  142 bits (358), Expect = 8e-33
 Identities = 68/176 (38%), Positives = 105/176 (59%)
 Frame = +2

Query: 296 HFRDNLMADVDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXX 475
           +F +     V    ++A +L    V+ +FG+VGIPVT +A  A  LGI++I   NEQ   
Sbjct: 8   NFAERSEEQVSGAKVIAQALKTQDVEYIFGIVGIPVTEIAIAAQQLGIKYIGMRNEQAAC 67

Query: 476 XXXXXXXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQE 655
                   LT RPG+ L VSGPG +H L G++NA +N WPL++I GS ++     G FQE
Sbjct: 68  YAASAIGYLTSRPGVCLVVSGPGLIHALGGMANANMNCWPLLVIGGSSERNQETMGAFQE 127

Query: 656 LDQIEAVKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVS 823
             Q+EA + ++KFSA+ + I  +P  + + +  +  GRPG CY+D+P+D ++  V+
Sbjct: 128 FPQVEACRLYTKFSARPSSIEAIPFVIEKAVRSSIYGRPGACYVDIPADFVNLQVN 183



>sp|Q9UJ83|HPCL_HUMAN 2-hydroxyphytanoyl-CoA lyase (EC 4.1.-.-)
           (2-HPCL) (HSPC279).>gb:BC001627_1967724 Homo sapiens
           2-hydroxyphytanoyl-CoA lyase, mRNA (cDNA clone MGC:1115
           IMAGE:3538159), complete cds.
          Length = 578

 Score =  142 bits (358), Expect = 8e-33
 Identities = 68/176 (38%), Positives = 105/176 (59%)
 Frame = +2

Query: 296 HFRDNLMADVDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXX 475
           +F +     V    ++A +L    V+ +FG+VGIPVT +A  A  LGI++I   NEQ   
Sbjct: 5   NFAERSEEQVSGAKVIAQALKTQDVEYIFGIVGIPVTEIAIAAQQLGIKYIGMRNEQAAC 64

Query: 476 XXXXXXXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQE 655
                   LT RPG+ L VSGPG +H L G++NA +N WPL++I GS ++     G FQE
Sbjct: 65  YAASAIGYLTSRPGVCLVVSGPGLIHALGGMANANMNCWPLLVIGGSSERNQETMGAFQE 124

Query: 656 LDQIEAVKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVS 823
             Q+EA + ++KFSA+ + I  +P  + + +  +  GRPG CY+D+P+D ++  V+
Sbjct: 125 FPQVEACRLYTKFSARPSSIEAIPFVIEKAVRSSIYGRPGACYVDIPADFVNLQVN 180



>gb:BX248334_757478 Mycobacterium bovis subsp. bovis AF2122/97
           complete genome; segment 1/14.
          Length = 582

 Score =  142 bits (357), Expect = 1e-32
 Identities = 75/172 (43%), Positives = 100/172 (58%), Gaps = 2/172 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           LV  +L    VD ++GVVGIP+T LA  A A GIR+I F +E            LT RPG
Sbjct: 18  LVVDALKANDVDTIYGVVGIPITDLARAAQASGIRYIGFRHEASAGNAAAAAGFLTARPG 77

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQK--DFGRGDFQELDQIEAVKPFSK 691
           + LT SGPG ++GL  L+NA  N +P++ ISGS  +   D  RGD+Q+LDQ+ A +PF K
Sbjct: 78  VCLTTSGPGFLNGLPALANATTNCFPMIQISGSSSRPMVDLQRGDYQDLDQLNAARPFVK 137

Query: 692 FSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEAERLI 847
            + +   +  +   V   +  A +GRPGG YLD+P DVL Q V  S A   I
Sbjct: 138 AAYRIGQVQDIGRGVARAIRTATSGRPGGVYLDIPGDVLGQAVEASAASGAI 189



>pir|A70841|A70841 probable oxalyl-CoA decarboxylase - Mycobacterium
           tuberculosis (strain H37RV)>gb:AE000516_20119
           Mycobacterium tuberculosis CDC1551, complete
           genome.>gb:BX842572_818157 Mycobacterium tuberculosis
           H37Rv complete genome; segment 1/13.
          Length = 582

 Score =  142 bits (357), Expect = 1e-32
 Identities = 75/172 (43%), Positives = 100/172 (58%), Gaps = 2/172 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           LV  +L    VD ++GVVGIP+T LA  A A GIR+I F +E            LT RPG
Sbjct: 18  LVVDALKANDVDTIYGVVGIPITDLARAAQASGIRYIGFRHEASAGNAAAAAGFLTARPG 77

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQK--DFGRGDFQELDQIEAVKPFSK 691
           + LT SGPG ++GL  L+NA  N +P++ ISGS  +   D  RGD+Q+LDQ+ A +PF K
Sbjct: 78  VCLTTSGPGFLNGLPALANATTNCFPMIQISGSSSRPMVDLQRGDYQDLDQLNAARPFVK 137

Query: 692 FSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEAERLI 847
            + +   +  +   V   +  A +GRPGG YLD+P DVL Q V  S A   I
Sbjct: 138 AAYRIGQVQDIGRGVARAIRTATSGRPGGVYLDIPGDVLGQAVEASAASGAI 189



>gb:CR380959_1653790 Candida glabrata strain CBS138 chromosome M
           complete sequence.
          Length = 562

 Score =  137 bits (346), Expect = 2e-31
 Identities = 67/155 (43%), Positives = 91/155 (58%)
 Frame = +2

Query: 368 VDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGILLTVSGPGC 547
           VD +FG+VGIPV   A    ++GIRFI F NEQ           LTG+PG+LL V GPG 
Sbjct: 21  VDVVFGIVGIPVVEFAQELQSVGIRFIGFRNEQAASYAASAYGYLTGKPGVLLVVGGPGV 80

Query: 548 VHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKATDISKVP 727
           +H LAG+ N+  N WPL++I+GS  + +  +G FQELDQ+  +KP+ KF+ + T   K  
Sbjct: 81  IHALAGVYNSMNNRWPLLIIAGSVPRDEKYQGGFQELDQVSLLKPYLKFAGELTGTKKDA 140

Query: 728 ACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESE 832
             VF   + A  G PG  Y+D P D++   V   E
Sbjct: 141 NIVFNAWNSATQGTPGVSYIDFPGDLITDVVEAIE 175



>gb:AE017239_414228 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 13 of 16 of the complete
           genome.>gb:AE016958_1057632 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 594

 Score =  137 bits (346), Expect = 2e-31
 Identities = 71/173 (41%), Positives = 101/173 (58%), Gaps = 2/173 (1%)
 Frame = +2

Query: 323 VDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXL 502
           +D   LV  +L    V  ++G+VGIP+T LA  A A GIR++ F  E            L
Sbjct: 32  IDGFHLVVQALRANDVATIYGIVGIPITDLARVAQASGIRYLGFRQEASAGNAAAAAGFL 91

Query: 503 TGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQK--DFGRGDFQELDQIEAV 676
           T RPG+ LT SGPG ++ L  L+NA  N +P++ ISGS D+   D  RGD+Q+LDQ++A 
Sbjct: 92  TRRPGVCLTTSGPGFLNALPALANATTNCFPMIQISGSSDRALVDLRRGDYQDLDQLDAA 151

Query: 677 KPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEA 835
           +PF+K + +   +  +   V   +  A +GRPGG YLD+P DVL Q +  S A
Sbjct: 152 RPFAKAAYRINRVDDIGRGVARAVRTAVSGRPGGVYLDIPGDVLGQAMDASAA 204



>sp|P39994|YEC0_YEAST Hypothetical 61.3 kDa protein in URA3-MMS21
           intergenic region.>pir|S50439|S50439 hypothetical
           protein YEL020c - yeast (Saccharomyces
           cerevisiae)>gb:SCE9871_1708241 Saccharomyces cerevisiae
           chromosome V cosmids 9871, 8199, 9867, 9495 and lambda
           clones 6693 and 5898.
          Length = 560

 Score =  132 bits (332), Expect = 8e-30
 Identities = 63/155 (40%), Positives = 92/155 (59%)
 Frame = +2

Query: 344 AMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGIL 523
           A  L + G+D +FG+VGIP+  LA+  VA GI+FI   NEQ           ++ +PG+L
Sbjct: 10  AQLLQKYGIDTVFGIVGIPIVQLADTMVANGIKFIPCRNEQAASYAASAYGYISDKPGVL 69

Query: 524 LTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAK 703
           L V GPG +H LAG+ N+  N WPL++I+GS  Q D  +G FQELDQ+  + PF KF+ K
Sbjct: 70  LIVGGPGLIHALAGIYNSMSNRWPLLVIAGSSSQSDIHKGGFQELDQVSLLSPFLKFTGK 129

Query: 704 ATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVL 808
            T    +     + L++   G  G  Y+D+P+D +
Sbjct: 130 LTP-DNIDMITQKALNYCIQGTAGVSYIDVPADFI 163



>gb:AB163432_15898 Bifidobacterium animalis oxc gene for oxalyl-CoA
           decarboxylase, complete cds.
          Length = 590

 Score =  130 bits (328), Expect = 2e-29
 Identities = 70/173 (40%), Positives = 97/173 (56%), Gaps = 2/173 (1%)
 Frame = +2

Query: 326 DTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLT 505
           D+   +A +L + GV  M+GVVGIPVT  A  A  +GIRFI   +E+           LT
Sbjct: 17  DSPHYLAETLIKNGVKHMYGVVGIPVTDFARIAQGMGIRFIGMRHEEDAVNAAAAEGFLT 76

Query: 506 GRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQK--DFGRGDFQELDQIEAVK 679
           GRP + LTVS PG ++GLA L  A  N +P++MI GS  +   D   G+++ LDQ+   K
Sbjct: 77  GRPAVALTVSAPGFLNGLAPLLEATTNGFPVIMIGGSSTRHVVDMHEGEYEGLDQMNYAK 136

Query: 680 PFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEAE 838
            F K S +   I  +P  V   +  A +GRPGG Y+D P D + QT+ +  AE
Sbjct: 137 QFCKESFRIDKIEDIPLAVARAMHIACSGRPGGVYIDFPDDAVAQTLDKDVAE 189



>sp|P40149|OXC_OXAFO Oxalyl-CoA decarboxylase (EC
           4.1.1.8).>pir|A55219|A55219 oxalyl-CoA decarboxylase (EC
           4.1.1.8) - Oxalobacter formigenes>gb:OXAOXA_156504
           Oxalobacter formigenes oxalyl-CoA decarboxylase gene,
           complete cds.
          Length = 568

 Score =  130 bits (326), Expect = 4e-29
 Identities = 62/167 (37%), Positives = 102/167 (61%), Gaps = 2/167 (1%)
 Frame = +2

Query: 368 VDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGILLTVSGPGC 547
           +D M+GVVGIP+T+LA      G RF +F +EQ           + G+PG+ LTVS PG 
Sbjct: 25  IDTMYGVVGIPITNLARMWQDDGQRFYSFRHEQHAGYAASIAGYIEGKPGVCLTVSAPGF 84

Query: 548 VHGLAGLSNAAVNTWPLVMISGSCDQK--DFGRGDFQELDQIEAVKPFSKFSAKATDISK 721
           ++G+  L++A  N +P++++SGS +++  D  +GD++E+DQ+   +P  K S +   I  
Sbjct: 85  LNGVTSLAHATTNCFPMILLSGSSEREIVDLQQGDYEEMDQMNVARPHCKASFRINSIKD 144

Query: 722 VPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEAERLIAEAQD 862
           +P  +   +  A +GRPGG Y+DLP+ +  QT+S  EA +L+ +  D
Sbjct: 145 IPIGIARAVRTAVSGRPGGVYVDLPAKLFGQTISVEEANKLLFKPID 191



>pir|T18702|T18702 hypothetical protein B0334.3b - Caenorhabditis
           elegans>gb:CEB0334_1359744 Caenorhabditis elegans cosmid
           B0334, complete sequence.
          Length = 634

 Score =  127 bits (319), Expect = 3e-28
 Identities = 67/170 (39%), Positives = 96/170 (56%)
 Frame = +2

Query: 317 ADVDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXX 496
           +++D   + A +L   GV+ MFGVVG PV  +   A A GI++I   NEQ          
Sbjct: 70  SNMDGASITAAALKSQGVEYMFGVVGFPVIEVGMAAQAHGIKYIGCRNEQAAAYAAQAMG 129

Query: 497 XLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAV 676
            LTG+P  LL VSGPG +H + GL+NA VN WP+V I G+ D     RG FQE  Q E+V
Sbjct: 130 YLTGKPVALLVVSGPGILHAIGGLANATVNCWPVVCIGGTADVDLENRGAFQEWSQQESV 189

Query: 677 KPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSE 826
           +   K  ++ T +  +PA + + +  A  GRPG  Y+DLP +++  +  E
Sbjct: 190 RNSCKHVSRPTSLHTIPAHIEKAVRCAMYGRPGAVYVDLPGNLVLTSTEE 239



>pir|T18711|T18711 hypothetical protein B0334.3a - Caenorhabditis
           elegans>gb:CEB0334_1359743 Caenorhabditis elegans cosmid
           B0334, complete sequence.
          Length = 634

 Score =  127 bits (319), Expect = 3e-28
 Identities = 67/170 (39%), Positives = 96/170 (56%)
 Frame = +2

Query: 317 ADVDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXX 496
           +++D   + A +L   GV+ MFGVVG PV  +   A A GI++I   NEQ          
Sbjct: 70  SNMDGASITAAALKSQGVEYMFGVVGFPVIEVGMAAQAHGIKYIGCRNEQAAAYAAQAMG 129

Query: 497 XLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAV 676
            LTG+P  LL VSGPG +H + GL+NA VN WP+V I G+ D     RG FQE  Q E+V
Sbjct: 130 YLTGKPVALLVVSGPGILHAIGGLANATVNCWPVVCIGGTADVDLENRGAFQEWSQQESV 189

Query: 677 KPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSE 826
           +   K  ++ T +  +PA + + +  A  GRPG  Y+DLP +++  +  E
Sbjct: 190 RNSCKHVSRPTSLHTIPAHIEKAVRCAMYGRPGAVYVDLPGNLVLTSTEE 239



>gb:CP000033_88702 Lactobacillus acidophilus NCFM, complete genome.
          Length = 569

 Score =  125 bits (315), Expect = 8e-28
 Identities = 69/174 (39%), Positives = 97/174 (55%), Gaps = 6/174 (3%)
 Frame = +2

Query: 323 VDTNMLVAMSLARA----GVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXX 490
           VDT++  A  L  A    G++ M+GVVGIPVT  A  A   G+++  F  E         
Sbjct: 2   VDTSLTGAALLIDALQANGLNNMYGVVGIPVTDFARLAQLKGMKYYGFRREDSAVDAAAG 61

Query: 491 XXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQK--DFGRGDFQELDQ 664
              +TG+PG+ LTVS PG ++GL  L+ A  N +PL+MISGS D+   D  RGD++ LDQ
Sbjct: 62  AGFITGKPGVALTVSAPGFLNGLTALAQATKNCFPLIMISGSSDRHIIDLDRGDYEGLDQ 121

Query: 665 IEAVKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSE 826
               KPF K + +      +   V   +  A +GRPGG YLDLP+  +  TV++
Sbjct: 122 YNVAKPFCKAAYRVDRAEDMGLAVARAVRTAVSGRPGGVYLDLPAATVTDTVAQ 175



>pir|T40656|T40656 probable oxalyl-CoA decarboxylase - fission yeast
            (Schizosaccharomyces pombe)>gb:SPBC725_1720389 S.pombe
           chromosome II cosmid c725.
          Length = 568

 Score =  123 bits (308), Expect = 5e-27
 Identities = 61/163 (37%), Positives = 88/163 (53%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           LVA +L    V  +FG+VGIPV  +     A GIRF+ F NEQ           LT RPG
Sbjct: 8   LVAKTLLDLEVKVVFGIVGIPVIEICEAIQASGIRFVGFRNEQSAAYAATAYGYLTQRPG 67

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + + V GPG VH +AG+ N+  N WPL++++GS +      G FQELDQ+  + P +K +
Sbjct: 68  VCVVVGGPGVVHAMAGVFNSKTNRWPLLLLAGSSETFQQNCGAFQELDQVSYLSPHTKLA 127

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSE 826
            +      V   +      +  G PG CY+DLP++ +  TV +
Sbjct: 128 VRPPSPKMVVDSIRRAYRVSMTGTPGTCYVDLPANYIESTVDD 170



>gb:BA000040_731417 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 577

 Score =  119 bits (299), Expect = 6e-26
 Identities = 60/177 (33%), Positives = 100/177 (56%), Gaps = 2/177 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           LV  +L   G++ ++ V GIP+T L   A A GIR I+F +EQ           LT +PG
Sbjct: 23  LVIDALKLNGINTIYNVPGIPITDLGRMAQAAGIRVISFRHEQNAGYAAGIAGYLTKKPG 82

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQK--DFGRGDFQELDQIEAVKPFSK 691
           + LTVS PG ++GL  L++A  N +P++++SGS +++  D  +GD++E+DQ+   KP  K
Sbjct: 83  VCLTVSAPGFLNGLTALAHATTNCYPMILVSGSSEREIVDLQQGDYEEMDQLAIAKPLCK 142

Query: 692 FSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEAERLIAEAQD 862
            + +      +       +  A +GRPGG YLDLP+ +  Q ++    ++ + +  D
Sbjct: 143 AAYRVLHAQDIGIGFARAIRAAVSGRPGGVYLDLPAKLFGQVMNAEAGQKSLVKVID 199



>gb:D90868_123682 E.coli genomic DNA, Kohara clone #414(53.8-54.2
           min.).
          Length = 142

 Score =  114 bits (286), Expect = 2e-24
 Identities = 56/120 (46%), Positives = 80/120 (66%), Gaps = 2/120 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           ++  +L +  +D ++GVVGIPVT +A  A A GIR+I F +EQ           LT +PG
Sbjct: 13  IIVEALKQNNIDTIYGVVGIPVTDMARHAQAEGIRYIGFRHEQSAGYAAAASGFLTQKPG 72

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQK--DFGRGDFQELDQIEAVKPFSK 691
           I LTVS PG ++GL  L+NA VN +P++MISGS D+   D  +GD++ELDQ+ A KP++K
Sbjct: 73  ICLTVSAPGFLNGLTALANATVNGFPMIMISGSSDRAIVDLQQGDYEELDQMNAAKPYAK 132



>gb:AE016818_1748094 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 545

 Score =  114 bits (285), Expect = 2e-24
 Identities = 62/157 (39%), Positives = 93/157 (59%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           +A++L + G++ +FG+VGIP+  LA +    G+RFIA  NEQ           LT +PG 
Sbjct: 9   IAIALKQHGIEVVFGIVGIPIVELAEKLAEHGVRFIACRNEQSCSYAASVYGYLTNKPGA 68

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
           LL V G G VH LAG+ NA VN WPL++I+GS +  D  +G FQELDQ+  V P++ F  
Sbjct: 69  LLVVGGSGVVHALAGIHNAWVNKWPLLVIAGSTE--DEYKGGFQELDQLRIVAPWTSFKG 126

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLH 811
           + + +  V   V+  +  A   + G  YLD+P  +++
Sbjct: 127 RLS-LDNVNYMVYTAVKTAVL-QHGVSYLDVPGRLIN 161



>pir|E84032|E84032 acetolactate synthase large subunit BH3061
           [imported] - Bacillus halodurans (strain
           C-125)>gb:BA000004_657007 Bacillus halodurans C-125 DNA,
           complete genome.
          Length = 268

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 50/162 (30%), Positives = 81/162 (50%)
 Frame = +2

Query: 320 DVDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXX 499
           ++  + ++  +LAR GVD +FG  G  +    +     GIR I   +EQ           
Sbjct: 20  EMSGSSMLIQALAREGVDVIFGYPGGAILPTYDEIYKTGIRHILARHEQGAIHAAEGYAR 79

Query: 500 LTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVK 679
           ++G+PG+ +  SGPG  + + G+++A +++ PLV+I+G       G   FQE D I    
Sbjct: 80  VSGKPGVCVVTSGPGATNVVTGIADAMIDSLPLVVITGQVATTLIGTDAFQEADMIGITM 139

Query: 680 PFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           P +K S +   I  +P  + E    A  GRPG   +DLP D+
Sbjct: 140 PITKHSYQVRTIEDLPRIIKEAFHIATTGRPGPVLIDLPKDI 181



>gb:AP006840_568203 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 551

 Score = 94.4 bits (233), Expect = 3e-18
 Identities = 51/165 (30%), Positives = 85/165 (51%)
 Frame = +2

Query: 314 MADVDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXX 493
           M+      LVA +L   GV+ +F + G  V S+ +  +  GIR +   +EQ         
Sbjct: 7   MSFAHAGKLVARALRNEGVEVVFTLCGGHVMSIYDGCLDEGIRVVDVRHEQTAAFAADAW 66

Query: 494 XXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEA 673
             LTGRPG+ +  +GPG  + + G++NA     P+V+I G   +   G+G  QE+D +  
Sbjct: 67  SRLTGRPGVAILTAGPGVTNAVTGIANAYRAQSPMVVIGGQGPRSLAGKGALQEMDVLSV 126

Query: 674 VKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVL 808
           ++P +K     +D +++P  V      A +G PG  YL++P D+L
Sbjct: 127 IRPITKGQVSISDPARIPEIVSWAFRTAMSGVPGPVYLEMPLDLL 171



>gb:LMU50749_141671 Leuconostoc mesenteroides cremoris ilvBNCA
           operon, complete cds, and adjacent nifA gene, complete
           cds, and leuC gene, partial cds.
          Length = 561

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 55/165 (33%), Positives = 83/165 (50%), Gaps = 2/165 (1%)
 Frame = +2

Query: 350 SLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRPGILL 526
           SL +AGV+ +FG  G  V  L +       I+ I   +EQ            TG+PG++L
Sbjct: 19  SLEKAGVNSLFGCPGGAVIPLYDALYESSHIKHILVRHEQAAAHAAEGYAKATGKPGVVL 78

Query: 527 TVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKA 706
             SGPG  + + G+++A  ++ PLV+ISG       G   FQELD +      +K S + 
Sbjct: 79  VTSGPGATNTVTGIADAFCDSVPLVVISGQVGSAAIGSDAFQELDILSITSSITKMSYQV 138

Query: 707 TDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV-LHQTVSESEAE 838
             + ++P  V E    A +GRPG   +DLP  V L +   ES+A+
Sbjct: 139 RTVGELPLIVEEAFKVAVSGRPGPVLIDLPKSVMLAKDTEESQAD 183



>pir|G75044|G75044 acetolactate synthase, large chain (ilvb) PAB0888
           - Pyrococcus abyssi (strain Orsay)>gb:CNSPAX05_850106
           Pyrococcus abyssi complete genome; segment 5/6.
          Length = 562

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 47/151 (31%), Positives = 77/151 (50%)
 Frame = +2

Query: 350 SLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGILLT 529
           +L + GV   FG++G  +  + +  +   IR I   +EQ           ++G+PG+ +T
Sbjct: 10  ALEKEGVKHTFGIIGGSIMPVFDELLESSIRHITTRHEQGAAHAADGYARVSGKPGVAIT 69

Query: 530 VSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKAT 709
            SGPG  + + G++NA +++ P+V I+G       G+  FQE D I   KP +K++ +  
Sbjct: 70  TSGPGATNLVTGIANAYMDSSPIVAITGQVPTHMIGKMAFQETDIISITKPITKWNYQIR 129

Query: 710 DISKVPACVFEVLDWAAAGRPGGCYLDLPSD 802
           +  +VP  V      A  GRPG   LD P D
Sbjct: 130 NPREVPKAVKMAFTIATLGRPGPTLLDFPKD 160



>gb:BA000043_739238 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 596

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 48/172 (27%), Positives = 86/172 (50%)
 Frame = +2

Query: 317 ADVDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXX 496
           A +  ++++  +L    V+ +FG  G  V  L +     G+  +   +EQ          
Sbjct: 33  ARMSGSLMLIEALKEEKVEVIFGYPGGAVLPLYDELYKAGVFHVLTRHEQGAIHAAEGYA 92

Query: 497 XLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAV 676
            ++G+PG+++  SGPG  + + GL++A +++ PLV+ +G       G   FQE D +   
Sbjct: 93  RISGKPGVVIATSGPGATNIVTGLTDAMMDSLPLVVFTGQVATSVIGSDAFQEADVVGIT 152

Query: 677 KPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESE 832
            P +K + +  DIS++P  + E    A  GRPG   +D+P D+   T +E E
Sbjct: 153 MPITKHNYQVRDISELPRIIKEAFHIATTGRPGPVLIDIPKDI---TTAEGE 201



>pir|B72362|B72362 acetolactate synthase, large subunit - Thermotoga
           maritima  (strain MSB8)>gb:AE001730_38461 Thermotoga
           maritima MSB8 section 42 of 136 of the complete
           genome.>gb:AE000512_1112934 Thermotoga maritima MSB8,
           complete genome.
          Length = 584

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 46/154 (29%), Positives = 78/154 (50%), Gaps = 2/154 (1%)
 Frame = +2

Query: 350 SLARAGVDRMFGVVGIPVTSLANRAVALG--IRFIAFHNEQXXXXXXXXXXXLTGRPGIL 523
           +L + GVD +FG+ G  + ++ +        I F  F +EQ           +TG+PG++
Sbjct: 15  ALLKEGVDTIFGIPGGAIINVYDELCNYEDKINFYLFRHEQGATHAADGYARVTGKPGVV 74

Query: 524 LTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAK 703
           +  SGPG  + + G++ A +++ P+V+I+G       G   FQE+D      P +K +  
Sbjct: 75  IVTSGPGATNTVTGIATAYMDSIPIVVITGQVPTSFIGTDAFQEVDVTGITMPITKHNHL 134

Query: 704 ATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
            T I ++P  + E+   A  GRPG   LD P D+
Sbjct: 135 VTSIEELPYAIKEMFYVATTGRPGPVLLDFPKDI 168



>gb:AY083837_588254 Geobacillus stearothermophilus strain ATCC 7954
           acetohydroxy acid synthase large subunit (ilvB),
           acetohydroxy acid synthase small subunit (ilvN),
           ketol-acid reductoisomerase (ilvC), and
           2-isopropylmalate synthase (leuA) genes, complete cds;
           and isopropylmalate dehydratase (leuC) gene, partial
           cds.
          Length = 572

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 48/167 (28%), Positives = 83/167 (49%)
 Frame = +2

Query: 332 NMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGR 511
           +M++  +L    V+ +FG  G  V  L +     G+  +   +EQ           ++G+
Sbjct: 17  SMMLIEALKAEQVEVIFGYPGGAVLPLYDELYKAGVFHVLTRHEQGAIHAAEGYARISGK 76

Query: 512 PGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSK 691
           PG ++  SGPG  + + GL++A +++ PLV+ +G       G   FQE D +    P +K
Sbjct: 77  PGFVIATSGPGATNIVTGLTDAMMDSLPLVVFTGQVATSVIGSDAFQEADVVGITMPITK 136

Query: 692 FSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESE 832
            + +  DIS++P  + E    A  GRPG   +D+P D+   T +E E
Sbjct: 137 HNYQVRDISELPKIIKEAFHIATTGRPGPVLIDIPKDI---TTAEGE 180



>gb:AP006627_564964 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 576

 Score = 86.7 bits (213), Expect = 5e-16
 Identities = 47/167 (28%), Positives = 82/167 (49%)
 Frame = +2

Query: 305 DNLMADVDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXX 484
           +N  A    + ++  +LA  GV+ +FG  G  +    +    LG+  I   +EQ      
Sbjct: 14  ENKQAVCTGSEILLKALASEGVEVIFGYPGGAILPTYDEIYKLGMNHILARHEQGAIHAA 73

Query: 485 XXXXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQ 664
                +T +PG+ +  SGPG  + + G+++A +++ P+V+I+G    K  G   FQE D 
Sbjct: 74  EGYARITQKPGVCIVTSGPGATNVVTGIADAMMDSLPMVVITGQVATKVIGTDAFQEADM 133

Query: 665 IEAVKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           +    P +K + +   I ++   V E    A +GRPG   +DLP D+
Sbjct: 134 LGITMPITKHNFQIRSIEELAQTVKEAFHIAVSGRPGPVLIDLPKDI 180



>gb:AE010207_260502 Pyrococcus furiosus DSM 3638, section 82 of 173
           of the complete genome.>gb:AE009950_901283 Pyrococcus
           furiosus DSM 3638, complete genome.
          Length = 564

 Score = 86.7 bits (213), Expect = 5e-16
 Identities = 45/151 (29%), Positives = 76/151 (50%)
 Frame = +2

Query: 350 SLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGILLT 529
           +L + GV   FG++G  +  + +  +   IR I   +EQ           ++GRPG+ +T
Sbjct: 12  ALEKEGVQHTFGIIGGSIMPVFDELLDSNIRHITTRHEQGAAHAADGYARVSGRPGVAIT 71

Query: 530 VSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKAT 709
            SGPG  + + G++ A +++ P+V ++G       G+  FQE D I   KP +K++ +  
Sbjct: 72  TSGPGATNLVTGIATAYMDSSPIVALTGQVPTYMVGKMAFQETDIINITKPITKWNYQVK 131

Query: 710 DISKVPACVFEVLDWAAAGRPGGCYLDLPSD 802
              ++P  V      A  GRPG   +DLP D
Sbjct: 132 RPREIPEAVKMAFTIATLGRPGPTLIDLPKD 162



>pir|C69059|C69059 acetolactate synthase (EC 4.1.3.18) large chain -
           Methanobacterium thermoautotrophicum (strain Delta
           H)>gb:AE000905_29115 Methanobacterium
           thermoautotrophicum from bases 1293944 to 1305586
           (section 111 of 148) of the complete
           genome.>gb:AE000666_926197 Methanobacterium
           thermoautotrophicum str. Delta H complete genome.
          Length = 577

 Score = 86.7 bits (213), Expect = 5e-16
 Identities = 49/162 (30%), Positives = 77/162 (47%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           +  SL   G D +FG  G  +  L +      ++ I   +EQ            +GR G+
Sbjct: 10  IIRSLLDQGADTVFGYPGGQLLPLYDMLYDSELKHILVRHEQCAAHAADGYARASGRVGV 69

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
            +  SGPG  + + G++ A +++ P+V I+G       G   FQE+D I    P +K S 
Sbjct: 70  CIATSGPGATNLVTGIATAYMDSAPIVAIAGQVPTHLIGNDAFQEVDMIGITMPITKHSF 129

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSE 826
           + +D S++PA V      A  GRPG   +DLP D+  Q + E
Sbjct: 130 QPSDASEIPAIVRASFHIAKTGRPGPVVIDLPKDIQEQEIME 171



>gb:AE004969_60924 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 575

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/157 (30%), Positives = 78/157 (49%), Gaps = 1/157 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           ++  SL   GV+ +FG  G  V  + +    L   + I   +EQ           ++G+ 
Sbjct: 8   IIVQSLKAEGVEYVFGYPGGAVIEIYDALFQLNKFKHILTRHEQAAVHAADAYARVSGKV 67

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G+ L  SGPG  + L G++ A  ++ P+V+ISG       G   FQE+D +   +P  K 
Sbjct: 68  GVALVTSGPGVTNALTGIATAYTDSIPMVVISGQVGNSLIGTDAFQEVDTVGITRPCVKH 127

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           +   TDI+++   + +    AA+GRPG   LD+P DV
Sbjct: 128 NFLVTDINELVETIKKAFQIAASGRPGPVVLDVPKDV 164



>gb:AP008226_578670 Thermus thermophilus HB8 genomic DNA, complete
           genome.
          Length = 562

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 47/152 (30%), Positives = 77/152 (50%)
 Frame = +2

Query: 350 SLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGILLT 529
           +L R GV+ +FG  G  +    +      IR I   +EQ            +GR G+++ 
Sbjct: 10  ALEREGVEVIFGHPGGAIMPTYDALYDSPIRHILVRHEQGGVHAATAYARASGRVGVVMA 69

Query: 530 VSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKAT 709
            SGPG ++ + GL++A +++ P+V I+G+  +   G   FQE D      P +K +    
Sbjct: 70  TSGPGALNLVTGLADAMMDSTPVVAITGNVPRALIGTDAFQEADVTGVTMPITKHNYLVQ 129

Query: 710 DISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           D++++P  V E    AA GRPG   +D+P DV
Sbjct: 130 DVNEIPRVVKEAFHIAATGRPGPVLIDIPKDV 161



>gb:AE017304_436488 Thermus thermophilus HB27 section 4 of 7 of the
           complete genome.>gb:AE017221_1078466 Thermus
           thermophilus HB27 complete genome.
          Length = 562

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 47/152 (30%), Positives = 77/152 (50%)
 Frame = +2

Query: 350 SLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGILLT 529
           +L R GV+ +FG  G  +    +      IR I   +EQ            +GR G+++ 
Sbjct: 10  ALEREGVEVIFGHPGGAIMPTYDALYDSPIRHILVRHEQGGVHAATAYARASGRVGVVMA 69

Query: 530 VSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKAT 709
            SGPG ++ + GL++A +++ P+V I+G+  +   G   FQE D      P +K +    
Sbjct: 70  TSGPGALNLVTGLADAMMDSTPVVAITGNVPRALIGTDAFQEADVTGVTMPITKHNYLVQ 129

Query: 710 DISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           D++++P  V E    AA GRPG   +D+P DV
Sbjct: 130 DVNEIPRVVKEAFHIAATGRPGPVLIDIPKDV 161



>gb:AP006618_559402 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 621

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 51/160 (31%), Positives = 78/160 (48%), Gaps = 1/160 (0%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAV-ALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           V  SL   GV+ +FG+ G  +  + +  + +  IR +   +EQ            TGR G
Sbjct: 43  VVRSLEELGVEVVFGIPGGAILPVYDPLLDSRRIRHVLVRHEQGAGHAATGYAQATGRVG 102

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + L  SGPG  + +  L++A  ++ P+V I+G       G   FQE D    V P +K +
Sbjct: 103 VCLATSGPGATNLVTPLADAHADSVPVVAITGQVPLPMMGTDAFQEADITGIVAPITKHT 162

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQT 817
           A  T  + +P  + E    AA+GRPG   +D+P DVL  T
Sbjct: 163 ALVTHAADIPRVLAEAFHLAASGRPGAVLVDIPKDVLRAT 202



>gb:AE015669_316658 Shewanella oneidensis MR-1 section 218 of 457 of
           the complete genome.>gb:AE014299_952255 Shewanella
           oneidensis MR-1 complete genome.
          Length = 572

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 49/159 (30%), Positives = 77/159 (48%), Gaps = 1/159 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVAL-GIRFIAFHNEQXXXXXXXXXXXLTGRP 514
           ++  SL   GV  +FG  G  V  + +    + GI  I   +EQ            TG+ 
Sbjct: 9   MIVRSLIDEGVKHIFGYPGGSVLDIYDALHLIPGIEHILVRHEQAAVHMADGYARATGKV 68

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G++ A +++ PLV++SG       G   FQE D I   +P  K 
Sbjct: 69  GVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVPSNLIGNDAFQECDMIGISRPVVKH 128

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLH 811
           S    D +++P  + +    A+ GRPG   +DLP D L+
Sbjct: 129 SFLVQDPTQIPEIIKKAFYIASTGRPGPVVVDLPKDCLN 167



>gb:CP000031_86589 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 583

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 49/161 (30%), Positives = 78/161 (48%), Gaps = 1/161 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  +L   GVD +FG  G  V  + +       IR I   +EQ            TG+P
Sbjct: 10  MVVQALKDQGVDTVFGYPGGAVLPIYDEIFLQNDIRHILVRHEQGAVHAAEGYARSTGKP 69

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + GL++A +++ PLV+++G       G   FQE D +   +P +K 
Sbjct: 70  GVVLVTSGPGATNAVTGLTDALLDSIPLVVLTGQVPTFMIGSDAFQEADTVGITRPCTKH 129

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQT 817
           +    +  K+   + E    A +GRPG   +D+P DV   T
Sbjct: 130 NWLVKETDKLAKTIHEGFHVATSGRPGPVLIDIPKDVQFAT 170



>pir|F81801|F81801 acetolactate synthase (EC 4.1.3.18) III large
           chain NMA1766 [imported] - Neisseria meningitidis
           (strain Z2491 serogroup A)>gb:NMA6Z2491_154650 Neisseria
           meningitidis serogroup A strain Z2491 complete genome;
           segment 6/7.>gb:AX300203_1465389 Sequence 29 from Patent
           WO0185772.>gb:AX300269_1465422 Sequence 95 from Patent
           WO0185772.
          Length = 575

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 47/157 (29%), Positives = 78/157 (49%), Gaps = 1/157 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           ++  SL   GV+ +FG  G  V  + +    L   + I   +EQ           ++G+ 
Sbjct: 8   IIVQSLKAEGVEYVFGYPGGAVIEIYDALFQLNKFKHILTRHEQAAVHAADAYARVSGKV 67

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G+ L  SGPG  + L G++ A  ++ P+V+ISG       G   FQE+D +   +P  K 
Sbjct: 68  GVALVTSGPGVTNALTGIATAYTDSIPMVVISGQVGNSLIGTDAFQEVDTVGITRPCVKH 127

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           +   TDI+++   + +    AA+GRPG   +D+P DV
Sbjct: 128 NFLVTDINELAETIKKAFQIAASGRPGPVVVDVPKDV 164



>pir|A81067|A81067 acetolactate synthase III, large chain NMB1577
           [imported] - Neisseria meningitidis (strain MC58
           serogroup B)>gb:AE002508_46981 Neisseria meningitidis
           serogroup B strain MC58 section 150 of 206 of the
           complete genome.>gb:AE002098_897094 Neisseria
           meningitidis serogroup B strain MC58 complete genome.
          Length = 575

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 47/157 (29%), Positives = 78/157 (49%), Gaps = 1/157 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           ++  SL   GV+ +FG  G  V  + +    L   + I   +EQ           ++G+ 
Sbjct: 8   IIVQSLKAEGVEYVFGYPGGAVIEIYDALFQLNKFKHILTRHEQAAVHAADAYARVSGKV 67

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G+ L  SGPG  + L G++ A  ++ P+V+ISG       G   FQE+D +   +P  K 
Sbjct: 68  GVALVTSGPGVTNALTGIATAYTDSIPMVVISGQVGNSLIGTDAFQEVDTVGITRPCVKH 127

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           +   TDI+++   + +    AA+GRPG   +D+P DV
Sbjct: 128 NFLVTDINELAETIKKAFQIAASGRPGPVVVDVPKDV 164



>sp|Q04789|ILVX_BACSU Acetolactate synthase (EC 2.2.1.6)
           (Acetohydroxy-acid synthase) (ALS).>pir|H69584|H69584
           acetolactate synthase (EC 4.1.3.18) - Bacillus
           subtilis>gb:BSUB0019_755566 Bacillus subtilis complete
           genome (section 19 of 21): from 3608981 to
           3809670.>gb:BSZ93767_756624 B.subtilis DNA; 15.2 kb
           fragment, from ywqN gene to ywrO gene.
          Length = 571

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 46/171 (26%), Positives = 78/171 (45%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           LV   L   GV  +FG+ G  + ++ +     G   I   +EQ           LTG+PG
Sbjct: 20  LVVDCLVEQGVTHVFGIPGAKIDAVFDALQDKGPEIIVARHEQNAAFMAQAVGRLTGKPG 79

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           ++L  SGPG  +   GL  A     P+V ++G+  + D  +   Q LD     +P +K+S
Sbjct: 80  VVLVTSGPGASNLATGLLTANTEGDPVVALAGNVIRADRLKRTHQSLDNAALFQPITKYS 139

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEAERLIA 850
            +  D+  +P  V      A+AG+ G  ++  P DV+++  +      + A
Sbjct: 140 VEVQDVKNIPEAVTNAFRIASAGQAGAAFVSFPQDVVNEVTNTKNVRAVAA 190



>gb:AE017333_449625 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_859413 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 572

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 47/156 (30%), Positives = 74/156 (47%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           LV  SL + GV  +FG+ G  + ++ +     G   I   +EQ           LTG+PG
Sbjct: 18  LVVDSLIQQGVTHVFGIPGAKIDAVFDVLKDKGPELIVCRHEQNAAFMAAAVGRLTGKPG 77

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + L  SGPG  +   GL  A     P+V ++G+  + D  +   Q +D     +P +K+S
Sbjct: 78  VCLVTSGPGASNLATGLVTANTEGDPVVALAGAVKRADRLKKTHQSMDNAALFQPITKYS 137

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           A+  D + +P  V      AA+G+ G  +L  P DV
Sbjct: 138 AEVEDANNIPEAVTNAFRAAASGQAGAAFLSFPQDV 173



>gb:AE017320_441534 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 12 of 12 of the complete
           genome.>gb:AE017285_1074695 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 547

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 47/162 (29%), Positives = 78/162 (48%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           L    L   GVD +FG+ G    +         IR +   +EQ           LTGRPG
Sbjct: 6   LFVRCLEAEGVDHIFGIPGEENLAFLEALRTSSIRLVLTRHEQAAGFMAATYGRLTGRPG 65

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + L+  GPG  + +  ++ A +   PL++I+G    K   +G FQ LD +  ++P +K +
Sbjct: 66  VCLSTLGPGATNLVTAVAYARLGGMPLIVITGQKPIKHSKQGRFQILDVVRMMEPITKST 125

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVS 823
            +    S +P+ V E    AA  +PG  +++LP D+  + V+
Sbjct: 126 RQVASGSAIPSLVREAFRLAAKEKPGPVHIELPEDIAAEEVA 167



>gb:AE013291_291000 Methanosarcina mazei strain Goe1, section 73 of
           379 of the complete genome.>gb:AE008384_965109
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 564

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 47/164 (28%), Positives = 76/164 (46%)
 Frame = +2

Query: 353 LARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGILLTV 532
           L + GVD +FG  G  +    N      +R I   +EQ            TG+ G+ ++ 
Sbjct: 19  LEKEGVDTLFGYPGGQIIPFYNELYDSDLRHILVRHEQAAAHAADGYARATGKTGVCVST 78

Query: 533 SGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKATD 712
           SGPG  + + G++ A +++ P+V ++G   +   G   FQE D      P +K +    D
Sbjct: 79  SGPGATNLVTGIATAYMDSVPIVALTGQVPRSLIGNDAFQEADITGITMPITKHNYLVQD 138

Query: 713 ISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEAERL 844
             ++P  V E    A+ GRPG   +DLP DV +  +     ER+
Sbjct: 139 PQEIPRIVKEAFHIASTGRPGPVLIDLPKDVQNIEIDLHYPERV 182



>pir|AH1322|AH1322 acetolactate synthase (acetohydroxy-acid
           synthase) (large chain) homolog ilvB [imported] -
           Listeria monocytogenes  (strain
           EGD-e)>gb:AL591981_536475 Listeria monocytogenes strain
           EGD, complete genome, segment 9/12.
          Length = 573

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 47/156 (30%), Positives = 77/156 (49%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           L+  +L +  VD +FG  G  V  L +      I  I   +EQ           +TG+PG
Sbjct: 22  LLIDALKKQQVDMIFGYPGGAVLPLYDAFYDCDIPHILTRHEQGAIHAAEGYARVTGKPG 81

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           +++  SGPG  + L G+++A  ++ PLV+ +G       G+  FQE D I    P +K++
Sbjct: 82  VVVVTSGPGATNVLTGIADAMSDSIPLVIFTGQVHTPGIGKDAFQEADMIGLTIPITKYN 141

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
            +  D+  +P  V E    A+ GR G   +D+P D+
Sbjct: 142 YQVRDVRDLPKIVNEAFHIASTGRKGPVVVDIPKDM 177



>sp|Q89AP7|ILVI_BUCBP Acetolactate synthase large subunit (EC
           2.2.1.6) (AHAS) (Acetohydroxy- acid synthase large
           subunit) (ALS).>gb:AE014016_302624 Buchnera aphidicola
           str. Bp (Baizongia pistaciae), section 1 of 2 of the
           complete genome.>gb:AE016826_981225 Buchnera aphidicola
           str. Bp (Baizongia pistaciae), complete genome.
          Length = 576

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 51/165 (30%), Positives = 82/165 (49%), Gaps = 2/165 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVAL-GIRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  SL   G+  +FG  G  V  + +    + GI+ I   +EQ            TG+ 
Sbjct: 9   MVIRSLIDQGIKYIFGYPGGAVLDIYDSLKQMHGIKHILVRHEQSATHMADGYARATGKI 68

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G++ A +++ PLV+ISG       G   FQE D I   +P  K 
Sbjct: 69  GVVLVTSGPGATNSITGIATAYMDSIPLVVISGQVASSLIGYDAFQECDMIGISRPIVKH 128

Query: 695 SAKATDISKVPACVFEVLDW-AAAGRPGGCYLDLPSDVLHQTVSE 826
           S    +   +P  +F+   W A++GRPG   +DLP D+L+  + +
Sbjct: 129 SFLVKNTEDIPK-IFKKAFWLASSGRPGPIVIDLPKDILNPLIKK 172



>gb:BC007440_1970733 Homo sapiens 2-hydroxyphytanoyl-CoA lyase, mRNA
           (cDNA clone IMAGE:2959666), complete cds.
          Length = 119

 Score = 83.6 bits (205), Expect = 5e-15
 Identities = 40/99 (40%), Positives = 56/99 (56%)
 Frame = +2

Query: 296 HFRDNLMADVDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXX 475
           +F +     V    ++A +L    V+ +FG+VGIPVT +A  A  LGI++I   NEQ   
Sbjct: 5   NFAERSEEQVSGAKVIAQALKTQDVEYIFGIVGIPVTEIAIAAQQLGIKYIGMRNEQAAC 64

Query: 476 XXXXXXXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTW 592
                   LT RPG+ L VSGPG +H L G++NA +N W
Sbjct: 65  YAASAIGYLTSRPGVCLVVSGPGLIHALGGMANANMNCW 103



>gb:BA000028_697010 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 573

 Score = 83.6 bits (205), Expect = 5e-15
 Identities = 50/183 (27%), Positives = 93/183 (50%), Gaps = 4/183 (2%)
 Frame = +2

Query: 302 RDNLMADVDTNMLVAMSLARAGVDRMFGVVG---IPVTSLANRAVALGIRFIAFHNEQXX 472
           + NL+   D   L   +L RA V+ +FG  G   +P+    +R        +   +EQ  
Sbjct: 12  KSNLVTGAD---LFVQALERANVEVVFGYPGGAVLPIYDALHRNQT-SFEHVLSRHEQGS 67

Query: 473 XXXXXXXXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQ 652
                    ++G+PG+++  SGPG  + + G+++A +++ PLV+ +G   +   G   FQ
Sbjct: 68  IHAAEGYARVSGKPGVVIATSGPGATNLITGITDAMMDSIPLVIFTGQVAKGVIGTDAFQ 127

Query: 653 ELDQIEAVKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ-TVSES 829
           E D +    P +K++ +  +I+++P  V E    A  GRPG   +D+P ++    TV++ 
Sbjct: 128 EADVMGITTPITKYNYQVNEIAELPRIVNEAFHIATTGRPGPVVVDIPKNISSTVTVNDY 187

Query: 830 EAE 838
           EA+
Sbjct: 188 EAD 190



>gb:AE017328_444428 Listeria monocytogenes str. 4b F2365, section 7
           of 10 of the complete genome.>gb:AE017262_1076784
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 573

 Score = 83.6 bits (205), Expect = 5e-15
 Identities = 47/156 (30%), Positives = 77/156 (49%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           L+  SL +  V+ +FG  G  V  L +      I  I   +EQ           +TG+PG
Sbjct: 22  LLIDSLKKQQVEMIFGYPGGAVLPLYDAFYDCDIPHILTRHEQGAIHAAEGYARVTGKPG 81

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           +++  SGPG  + L G+++A  ++ PLV+ +G       G+  FQE D I    P +K++
Sbjct: 82  VVVVTSGPGATNVLTGIADAMSDSIPLVIFTGQVHTPGIGKDAFQEADMIGLTIPITKYN 141

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
            +  D+  +P  V E    A+ GR G   +D+P D+
Sbjct: 142 YQVRDVRDLPKIVNEAFHIASTGRKGPVVVDIPKDM 177



>gb:AE016799_335413 Vibrio vulnificus CMCP6 chromosome I section 3
           of 11 of the complete sequence.>gb:BA000037_721321
           Vibrio vulnificus YJ016 DNA, chromosome I, complete
           sequence.>gb:AE016795_1045137 Vibrio vulnificus CMCP6
           chromosome I complete sequence.
          Length = 574

 Score = 83.6 bits (205), Expect = 5e-15
 Identities = 47/163 (28%), Positives = 78/163 (47%), Gaps = 2/163 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSL--ANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGR 511
           +V  SL    V+++FG  G  V  +  A  A    I+ +   +EQ            TG+
Sbjct: 10  MVVQSLIEENVEQIFGYPGGSVLDIYDALHAKTEQIKHVLVRHEQAATHMADGYARATGK 69

Query: 512 PGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSK 691
           PG++L  SGPG  + + G++ A +++ P+++ISG+      G   FQE D +   +P  K
Sbjct: 70  PGVVLVCSGPGATNTITGIATAYMDSIPMIVISGNVPNSLIGNDAFQECDIVGVSRPVVK 129

Query: 692 FSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTV 820
            S        +P  + +    A  GRPG   +DLP DV++  +
Sbjct: 130 HSFLVKRAEDIPETIKKAFYIATTGRPGPVVIDLPKDVMNPLI 172



>gb:AE011091_269079 Methanosarcina acetivorans str. C2A, section 436
           of 534 of the complete genome.>gb:AE010299_909638
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 564

 Score = 83.2 bits (204), Expect = 6e-15
 Identities = 45/151 (29%), Positives = 71/151 (47%)
 Frame = +2

Query: 353 LARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGILLTV 532
           L + GVD +FG  G  +    N      +R I   +EQ            TG+ G+ ++ 
Sbjct: 19  LEKEGVDTLFGYPGGQIIPFYNELYDSDLRHILVRHEQAAAHAADGYARATGKTGVCVST 78

Query: 533 SGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKATD 712
           SGPG  + + G++ A +++ P+V ++G   +   G   FQE D      P +K +    D
Sbjct: 79  SGPGATNLVTGIATAYMDSVPIVALTGQVPRPLIGNDAFQEADITGITLPITKHNYLVQD 138

Query: 713 ISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
             ++P  V E    A+ GRPG   +DLP DV
Sbjct: 139 AEEIPRIVKEAFHIASTGRPGPVLIDLPKDV 169



>pir|S35138|S35138 acetolactate synthase (EC 4.1.3.18) - Lactococcus
           lactis subsp. lactis>gb:LLU92974_141276 Lactococcus
           lactis unknown gene, partial cds, and HisC (hisC),
           unknown, HisG (hisG), unknown, HisB (hisB), unknown,
           HisH (hish), HisA (hisA), HisF (hisF), HisIE (hisIE),
           unknown, unknown, LeuA (leuA), LeuB (leuB), LeuC (leuC),
           LeuD (leuD), unknown, IlvD (ilvD), IlvB (ilvB), IlvN,
           IlvC (ilvC), IlvA (ilvA), AldB (aldB) and aldR (aldR)
           genes, complete cds.
          Length = 575

 Score = 83.2 bits (204), Expect = 6e-15
 Identities = 47/166 (28%), Positives = 84/166 (50%), Gaps = 1/166 (0%)
 Frame = +2

Query: 332 NMLVAMSLARAGVDRMFGVVGIPVTSLANRAVAL-GIRFIAFHNEQXXXXXXXXXXXLTG 508
           + LV  +L   GV+ +FG  G  +  L +      GI+ I   +EQ            +G
Sbjct: 13  SQLVLQTLKELGVEIIFGYPGGAMLPLYDAIHNFEGIQHILARHEQGATHEAEGYAKSSG 72

Query: 509 RPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFS 688
           + G+++  SGPG  + + G+++A +++ PL++ +G   ++  G+  FQE D +    P +
Sbjct: 73  KVGVVVVTSGPGATNAVTGIADAYLDSVPLLVFTGQVGRQSIGKDAFQEADTVGITAPIT 132

Query: 689 KFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSE 826
           K++ +  + + +P  V E    A  GRPG   +DLP DV    V+E
Sbjct: 133 KYNYQIRETADIPRIVTEAYYLARTGRPGPVEIDLPKDVSTLEVTE 178



>gb:BX248357_762380 Corynebacterium diphtheriae gravis NCTC13129,
           complete genome; segment 4/8.
          Length = 652

 Score = 82.8 bits (203), Expect = 8e-15
 Identities = 46/156 (29%), Positives = 77/156 (49%), Gaps = 1/156 (0%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVA-LGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           +  SL   G+D +FG+ G  V  L +   A   +R +   +EQ            TG+ G
Sbjct: 49  IVRSLEELGIDMVFGLPGGAVLPLYDSLYASTKLRHVLVRHEQGAGHAATGYAQATGKVG 108

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + +  SGPG  + +  +++A +++ PLV I+G   +   G   FQE D      P +K +
Sbjct: 109 VCIATSGPGATNLVTPIADAHLDSVPLVAITGQVGRSLLGSDAFQEADIRGITMPVTKHN 168

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
              TD++ +P  + E    AA+GRPG   +D+P D+
Sbjct: 169 FMVTDVNMIPQAIAEAFYLAASGRPGPVLVDIPKDI 204



>sp|O85293|ILVI_BUCAP Acetolactate synthase large subunit (EC
           2.2.1.6) (AHAS) (Acetohydroxy- acid synthase large
           subunit) (ALS).>gb:AE014098_303140 Buchnera aphidicola
           str. Sg (Schizaphis graminum) section 23 of 57 of the
           complete genome.>gb:AF060492_474642 Buchnera aphidicola
           succinyl-diaminopimelate aminotransferase (dapD) gene,
           partial cds; periplasmic serine protease (htrA),
           hypothetical protein, acetohydroxy acid synthase large
           subunit (ilvI), acetohydroxy acid synthase small subunit
           (ilvH), hypothetical protein, cell division protein
           (ftsL), and penicillin binding protein 3 precursor
           (ftsI) genes, complete cds; and meso-diaminopimelate
           adding enzyme (murE) gene, partial
           cds.>gb:AE013218_935118 Buchnera aphidicola str. Sg
           (Schizaphis graminum) complete genome.
          Length = 571

 Score = 82.8 bits (203), Expect = 8e-15
 Identities = 50/162 (30%), Positives = 78/162 (48%), Gaps = 2/162 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  SL   G+  +FG  G  V  + +    +G +  I   +EQ            TG+ 
Sbjct: 9   MVIRSLINQGIQHIFGYPGGAVLDIYDALKTVGGVEHILVRHEQAATHMADGYARSTGKI 68

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G++ A +++ P+V+ISG       G   FQE D I   +P  K 
Sbjct: 69  GVVLVTSGPGATNAITGIATAYMDSIPMVVISGQVASSLIGYDAFQECDMIGISRPIVKH 128

Query: 695 SAKATDISKVPACVFEVLDW-AAAGRPGGCYLDLPSDVLHQT 817
           S        +P  +F+   W A+ GRPG   +DLP D+L +T
Sbjct: 129 SFLVKRTEDIPI-IFKKAFWLASTGRPGPVVIDLPKDILKKT 169



>sp|P57321|ILVI_BUCAI Acetolactate synthase large subunit (EC
           2.2.1.6) (AHAS) (Acetohydroxy- acid synthase large
           subunit) (ALS).>pir|F84956|F84956 acetolactate synthase
           (EC 4.1.3.18) large chain [imported] - Buchnera sp.
           (strain APS)>gb:BA000003_653596 Buchnera aphidicola str.
           APS (Acyrthosiphon pisum) genomic DNA, complete
           sequence.
          Length = 571

 Score = 82.8 bits (203), Expect = 8e-15
 Identities = 51/159 (32%), Positives = 77/159 (48%), Gaps = 2/159 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  SL   G+  +FG  G  V  + +    +G I  I   +EQ            TG+ 
Sbjct: 9   MVVRSLIDQGIQHIFGYPGGAVLDIYDALKTVGGIEHILVRHEQAATHMADGYSRSTGKT 68

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G++ A +++ P+V+ISG       G   FQE D I   +P  K 
Sbjct: 69  GVVLVTSGPGATNAITGIATAYMDSIPMVVISGQVASSLIGYDAFQECDMIGISRPIVKH 128

Query: 695 SAKATDISKVPACVFEVLDW-AAAGRPGGCYLDLPSDVL 808
           S        +P  VF+   W A++GRPG   +DLP D+L
Sbjct: 129 SFLVKKTEDIPI-VFKKAFWLASSGRPGPIVIDLPKDIL 166



>gb:CP000020_872439 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 573

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 46/166 (27%), Positives = 80/166 (48%), Gaps = 2/166 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSL--ANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGR 511
           ++  SL   GV+ +FG  G  V  +  A    +  I+ +   +EQ            TG+
Sbjct: 9   MIVQSLIDEGVEHIFGYPGGSVLDIYDALHMKSDVIQHVLVRHEQAATHMADGYARATGK 68

Query: 512 PGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSK 691
           PG++L  SGPG  + + G++ A +++ P+V++SG+      G   FQE D +   +P  K
Sbjct: 69  PGVVLVCSGPGATNTITGIATAYMDSIPMVVLSGNVPTNMIGNDAFQECDMVGVSRPVVK 128

Query: 692 FSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSES 829
            S        +P  + +    A+ GRPG   +D+P DV++  +  S
Sbjct: 129 HSFLVKKAEDIPETLKKAFYIASTGRPGPVVIDIPKDVMNPAIKFS 174



>gb:CP000001_851901 Bacillus cereus ZK, complete genome.
          Length = 566

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 47/157 (29%), Positives = 76/157 (48%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           L+  +L + GV+ +FG  G  V  L +      I  I   +EQ           +TG PG
Sbjct: 15  LLLEALEKEGVEVIFGYPGGAVLPLYDALYDCEIPHILTRHEQGAIHAAEGYARITGNPG 74

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           +++  SGPG  + + GL++A +++ PLV+ +G       G   FQE D +    P +K +
Sbjct: 75  VVIATSGPGATNVITGLADAMIDSLPLVVFTGQVATTLIGSDAFQEADIMGLTMPVTKHN 134

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVL 808
            +    S +P  + E    A  GRPG   +DLP D++
Sbjct: 135 YQVRKASDLPRIIKEAFHIARTGRPGPVVIDLPKDMV 171



>gb:BA000040_732283 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 554

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 47/156 (30%), Positives = 72/156 (46%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           L   +L   GVDR+FGV G     L        I  I   +EQ           LTG+PG
Sbjct: 13  LFVAALENEGVDRIFGVPGEENLDLVESLRTSKIELILTRHEQAAAFMAATHGRLTGKPG 72

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + L+  GPG ++   G + A +   P+++I+G        +  FQ +D +  +KP +K S
Sbjct: 73  VCLSTLGPGALNLSTGAAYAHLGAMPMILITGQKPIMSSRQARFQIVDVVATMKPLTKLS 132

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
            +    S +P  V +    A   RPG  +L+LP D+
Sbjct: 133 RQIISASSIPTVVRDAFRVAMEERPGPVHLELPEDI 168



>gb:BA000031_705812 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 574

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 46/163 (28%), Positives = 78/163 (47%), Gaps = 2/163 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSL--ANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGR 511
           +V  SL    V+++FG  G  V  +  A  A    I+ +   +EQ            TG+
Sbjct: 10  MVVQSLIEENVEQIFGYPGGSVLDIYDALHAKTDQIKHVLVRHEQAATHMADGYARATGK 69

Query: 512 PGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSK 691
           PG++L  SGPG  + + G++ A +++ P+++ISG+      G   FQE D +   +P  K
Sbjct: 70  PGVVLVCSGPGATNTITGIATAYMDSIPMIVISGNVPNSLIGNDAFQECDIVGVSRPVVK 129

Query: 692 FSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTV 820
            S        +P  + +    +  GRPG   +DLP DV++  +
Sbjct: 130 HSFLVKKAEDIPETIKKAFYISTTGRPGPVVIDLPKDVMNPQI 172



>gb:AE017355_462591 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 569

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 47/157 (29%), Positives = 76/157 (48%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           L+  +L + GV+ +FG  G  V  L +      I  I   +EQ           +TG PG
Sbjct: 18  LLLEALEKEGVEVIFGYPGGAVLPLYDALYDCEIPHILTRHEQGAIHAAEGYARITGNPG 77

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           +++  SGPG  + + GL++A +++ PLV+ +G       G   FQE D +    P +K +
Sbjct: 78  VVIATSGPGATNVITGLADAMIDSLPLVVFTGQVATTLIGSDAFQEADIMGLTMPVTKHN 137

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVL 808
            +    S +P  + E    A  GRPG   +DLP D++
Sbjct: 138 YQVRKASDLPRIIKEAFHIARTGRPGPVVIDLPKDMV 174



>gb:AE017270_423157 Bacillus cereus ATCC 10987, section 7 of 18 of
           the complete genome.>gb:AE017194_1061576 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 571

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 43/161 (26%), Positives = 81/161 (50%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           V   L + GV  +FG  G  +  + +     G++ +   +EQ            +G+ G+
Sbjct: 22  VIQCLKKLGVTTVFGYPGGAILPVYDALYGSGLKHVLTRHEQAAIHAAEGYARASGKVGV 81

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
           +   SGPG  + + GL++A +++ PLV+I+G   +   G+  FQE D +    P +K + 
Sbjct: 82  VFATSGPGATNLVTGLADAYMDSIPLVVITGQVAKSLIGKDGFQEADVVGITVPVTKHNY 141

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVS 823
           +  D++ +   V E    A +GRPG   +D+P D+ ++ V+
Sbjct: 142 QIRDVNHLSRIVQEAFYIAESGRPGPVLIDIPKDIQNENVT 182



>gb:AE017269_422745 Bacillus cereus ATCC 10987, section 6 of 18 of
           the complete genome.>gb:AE017194_1061164 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 566

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 47/157 (29%), Positives = 76/157 (48%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           L+  +L + GV+ +FG  G  V  L +      I  I   +EQ           +TG PG
Sbjct: 15  LLLEALEKEGVEVIFGYPGGAVLPLYDALYDCEIPHILTRHEQGAIHAAEGYARITGNPG 74

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           +++  SGPG  + + GL++A +++ PLV+ +G       G   FQE D +    P +K +
Sbjct: 75  VVIATSGPGATNVITGLADAMIDSLPLVVFTGQVATTLIGSDAFQEADIMGLTMPVTKHN 134

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVL 808
            +    S +P  + E    A  GRPG   +DLP D++
Sbjct: 135 YQVRKASDLPRIIKEAFHIARTGRPGPVVIDLPKDMV 171



>gb:AE017225_406704 Bacillus anthracis str. Sterne, complete genome.
          Length = 578

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 47/157 (29%), Positives = 76/157 (48%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           L+  +L + GV+ +FG  G  V  L +      I  I   +EQ           +TG PG
Sbjct: 27  LLLEALEKEGVEVIFGYPGGAVLPLYDALYDCEIPHILTRHEQGAIHAAEGYARITGNPG 86

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           +++  SGPG  + + GL++A +++ PLV+ +G       G   FQE D +    P +K +
Sbjct: 87  VVIATSGPGATNVITGLADAMIDSLPLVVFTGQVATTLIGSDAFQEADIMGLTMPVTKHN 146

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVL 808
            +    S +P  + E    A  GRPG   +DLP D++
Sbjct: 147 YQVRKASDLPRIIKEAFHIARTGRPGPVVIDLPKDMV 183



>gb:AE017028_381602 Bacillus anthracis str. Ames section 5 of 18 of
           the complete genome.>gb:AE017334_451450 Bacillus
           anthracis str. 'Ames Ancestor', complete
           genome.>gb:AE016879_1011307 Bacillus anthracis str. Ames
           complete genome.
          Length = 566

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 47/157 (29%), Positives = 76/157 (48%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           L+  +L + GV+ +FG  G  V  L +      I  I   +EQ           +TG PG
Sbjct: 15  LLLEALEKEGVEVIFGYPGGAVLPLYDALYDCEIPHILTRHEQGAIHAAEGYARITGNPG 74

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           +++  SGPG  + + GL++A +++ PLV+ +G       G   FQE D +    P +K +
Sbjct: 75  VVIATSGPGATNVITGLADAMIDSLPLVVFTGQVATTLIGSDAFQEADIMGLTMPVTKHN 134

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVL 808
            +    S +P  + E    A  GRPG   +DLP D++
Sbjct: 135 YQVRKASDLPRIIKEAFHIARTGRPGPVVIDLPKDMV 171



>gb:TTHILVB_198532 Thermus aquaticus DNA for acetolactate synthase
           (ilvB), fumarase, manganese superoxide dismutase,
           partial cds and complete cds.
          Length = 439

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 46/152 (30%), Positives = 76/152 (50%)
 Frame = +2

Query: 350 SLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGILLT 529
           +L R GV+ +FG  G  +    +      IR I   +EQ            +GR G+++ 
Sbjct: 10  ALEREGVEVIFGHPGGAIMPTYDALYDSPIRHILVRHEQGGIHAATAYARASGRVGVVMA 69

Query: 530 VSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKAT 709
            SGPG ++ + GL++A +++ P+V I+G+  +   G   FQE D      P +  +    
Sbjct: 70  TSGPGALNLVTGLADALMDSTPVVAITGNVPRALIGTDAFQEADVTGVTMPITNHNYLVQ 129

Query: 710 DISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           D++++P  V E    A+ GRPG   +DLP DV
Sbjct: 130 DVNEIPRVVKEAFHIASTGRPGPVLIDLPKDV 161



>pir|T45267|T45267 acetolactate synthase (EC 4.1.3.18) large chain
           [imported] - Thermus aquaticus (fragment)
          Length = 439

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 46/152 (30%), Positives = 76/152 (50%)
 Frame = +2

Query: 350 SLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGILLT 529
           +L R GV+ +FG  G  +    +      IR I   +EQ            +GR G+++ 
Sbjct: 10  ALEREGVEVIFGHPGGAIMPTYDALYDSPIRHILVRHEQGGIHAATAYARASGRVGVVMA 69

Query: 530 VSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKAT 709
            SGPG ++ + GL++A +++ P+V I+G+  +   G   FQE D      P +  +    
Sbjct: 70  TSGPGALNLVTGLADALMDSTPVVAITGNVPRALIGTDAFQEADVTGVTMPITNHNYLVQ 129

Query: 710 DISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           D++++P  V E    A+ GRPG   +DLP DV
Sbjct: 130 DVNEIPRVVKEAFHIASTGRPGPVLIDLPKDV 161



>pir|T35772|T35772 probable TPP-requiring enzyme - Streptomyces
           coelicolor>gb:SCO939128_180251 Streptomyces coelicolor
           A3(2) complete genome; segment 25/29.
          Length = 560

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 46/166 (27%), Positives = 77/166 (46%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           LVA +L   GVDR++ + G  +  + +  V  GI  +   +EQ           +TG+PG
Sbjct: 14  LVAKALKAEGVDRIYTLCGGHIIDIYDGCVDEGIEVVDVRHEQVAAHAADGYARITGKPG 73

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
             +  +GPG    + G++NA     P+++I G         G  Q+L  ++ + P +KF+
Sbjct: 74  CAVVTAGPGTTDAVTGVANAFRAESPMLLIGGQGAHTQHKMGSLQDLPHVDMMTPITKFA 133

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEA 835
           A   D ++    V         G PG  +L++P DVL   V   +A
Sbjct: 134 ATVPDTARAADMVSMAFRECYHGAPGPSFLEIPRDVLDAKVPAEKA 179



>pir|AI1693|AI1693 acetolactate synthase (acetohydroxy-acid
           synthase) (large chain) homolog ilvB [imported] -
           Listeria innocua (strain Clip11262)>gb:AL596171_539435
           Listeria innocua Clip11262 complete genome, segment
           9/12.
          Length = 573

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 47/156 (30%), Positives = 76/156 (48%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           L+  SL +  V+ +FG  G  V  L +      I  I   +EQ           +TG+PG
Sbjct: 22  LLIDSLKKQQVEMIFGYPGGAVLPLYDAFYDCDIPHILTRHEQGAIHAAEGYARVTGKPG 81

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           +++  SGPG  + L G+++A  ++ PLV+ +G       G+  FQE D I    P +K++
Sbjct: 82  VVVVTSGPGATNVLTGIADAMSDSIPLVIFTGQVHTPGIGKDAFQEADMIGLTIPITKYN 141

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
            +  D+  +P  V E    A  GR G   +D+P D+
Sbjct: 142 YQVRDVRDLPKIVNEAFHIANTGRKGPVVVDIPKDM 177



>gb:AF129501_481674 Buchnera aphidicola natural-host Diuraphis noxia
           acetohydroxy acid synthase large subunit (ilvI) and
           acetohydroxy acid synthase small subunit (ilvH) genes,
           complete cds; and unknown genes.
          Length = 571

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 48/158 (30%), Positives = 73/158 (46%), Gaps = 1/158 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  SL   G+  +FG  G  V  + +    +G I  I   +EQ            TG+ 
Sbjct: 9   MVVRSLINQGIQHIFGYPGGAVLDIYDALKTIGGIEHILVRHEQAATHMADGYARSTGKT 68

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G++ A +++ P+V+ISG       G   FQE D I   +P  K 
Sbjct: 69  GVVLVTSGPGATNAITGIATAYMDSIPMVVISGQVASLLIGYDAFQECDMIGVSRPIVKH 128

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVL 808
           S        +P    +    A +GRPG   +DLP D+L
Sbjct: 129 SFLVKKTEDIPITFKKAFWLAESGRPGPIVIDLPKDIL 166



>gb:AE014872_312675 Streptococcus mutans UA159 section 20 of 185 of
           the complete genome.>gb:AE014133_939676 Streptococcus
           mutans UA159 complete genome.
          Length = 567

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 48/159 (30%), Positives = 77/159 (48%), Gaps = 1/159 (0%)
 Frame = +2

Query: 350 SLARAGVDRMFGVVGIPVTSLANRAVAL-GIRFIAFHNEQXXXXXXXXXXXLTGRPGILL 526
           +LA  GV  +FG  G  V  L +       IR I   +EQ            TG+ G+ +
Sbjct: 19  TLANLGVKTIFGYPGGAVLPLYDAIYKQDNIRHILARHEQGAVHEAEGFAKSTGKLGVAI 78

Query: 527 TVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKA 706
             SGPG  + + G+++A  ++ P+++ +G       G+  FQE D I    P +K++ + 
Sbjct: 79  VTSGPGATNAITGIADAMSDSVPMLVFTGQVATPGIGKDAFQEADIIGITMPITKYNYQI 138

Query: 707 TDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVS 823
            + + +P  V E +  A  GRPG   +DLP DV  + VS
Sbjct: 139 RETADIPRIVTEAVHIATTGRPGPVVIDLPKDVSEKRVS 177



>pir|E95051|E95051 hypothetical protein SP0445 [imported] -
           Streptococcus pneumoniae (strain
           TIGR4)>gb:AE007355_225667 Streptococcus pneumoniae TIGR4
           section 38 of 194 of the complete
           genome.>gb:AE005672_1103435 Streptococcus pneumoniae
           TIGR4, complete genome.
          Length = 566

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 46/157 (29%), Positives = 77/157 (49%), Gaps = 1/157 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVAL-GIRFIAFHNEQXXXXXXXXXXXLTGRP 514
           LV  +L   GVD +FG  G  V    +      GIR I   +EQ            TG+ 
Sbjct: 15  LVLETLRDLGVDTIFGYPGGAVLPFYDAIYNFKGIRHILGRHEQGCLHEAEGYAKSTGKL 74

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G+ +  SGPG  + + G+++A  ++ PL++ +G   +   G+  FQE D +    P +K+
Sbjct: 75  GVAVVTSGPGATNAITGIADAMSDSVPLLVFTGQVARAGIGKDAFQEADIVGITMPITKY 134

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           + +  + + +P  + E +  A  GRPG   +DLP D+
Sbjct: 135 NYQVRETADIPRIITEAVHIATTGRPGPVVIDLPKDI 171



>pir|A97922|A97922 acetolactate synthase (EC 4.1.3.18) [imported] -
           Streptococcus pneumoniae (strain R6)>gb:AE008420_236722
           Streptococcus pneumoniae R6 section 36 of 184 of the
           complete genome.>gb:AE007317_942880 Streptococcus
           pneumoniae R6, complete genome.
          Length = 566

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 46/157 (29%), Positives = 77/157 (49%), Gaps = 1/157 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVAL-GIRFIAFHNEQXXXXXXXXXXXLTGRP 514
           LV  +L   GVD +FG  G  V    +      GIR I   +EQ            TG+ 
Sbjct: 15  LVLETLRDLGVDTIFGYPGGAVLPFYDAIYNFKGIRHILGRHEQGCLHEAEGYAKSTGKL 74

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G+ +  SGPG  + + G+++A  ++ PL++ +G   +   G+  FQE D +    P +K+
Sbjct: 75  GVAVVTSGPGATNAITGIADAMSDSVPLLVFTGQVARAGIGKDAFQEADIVGITMPITKY 134

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           + +  + + +P  + E +  A  GRPG   +DLP D+
Sbjct: 135 NYQVRETADIPRIITEAVHIATTGRPGPVVIDLPKDI 171



>gb:BX950851_839492 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 559

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 46/161 (28%), Positives = 76/161 (47%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           L+   L   GV  +FG+ G  +  + +      I+ I   +E            LTG+ G
Sbjct: 16  LIVKHLEAQGVKHIFGIPGAKIDRVFDELEDSTIQTIPVRHEANGAFMAAAIGRLTGKAG 75

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + L  SGPGC + + GL+ A      +V + G+  + D  +   Q LD +   +P SKFS
Sbjct: 76  VTLVTSGPGCSNLVTGLATATAEGDAVVALGGAVKRADKLKLTHQSLDTVSLFQPVSKFS 135

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTV 820
           A+ T  S +   +      A +GRPG  ++ LP D++++ V
Sbjct: 136 AEITASSAISEVLANAFRAAESGRPGAAFVSLPQDIVNEPV 176



>gb:BA000012_671610 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 548

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 46/156 (29%), Positives = 73/156 (46%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           L   +L   GVDR+FG+ G     +        I+ I   +EQ           LTG+ G
Sbjct: 7   LFVAALENEGVDRIFGIPGEENLDIVESIRRSSIQLILTRHEQAAAFMAATYGRLTGKAG 66

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + +T  GPG ++   G + A +   P++MI+G        +  FQ +D + A+KP +K S
Sbjct: 67  VCITTLGPGALNLTTGAAYALLGAMPMIMITGQKGILSSRQARFQIVDIVAAMKPLTKLS 126

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
            +      +P+ V E    A   RPG  +L+LP D+
Sbjct: 127 RQIVSPKMIPSLVREAFRVAQEERPGPVHLELPEDI 162



>gb:AE017333_448791 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_858592 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 574

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 41/152 (26%), Positives = 75/152 (49%)
 Frame = +2

Query: 350 SLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGILLT 529
           +L +  V+ ++G  G  V  + ++    G+  +   +EQ           ++G+PG+++ 
Sbjct: 27  ALKQENVEVIYGYPGGAVLPIYDKLYGSGMFHVLTRHEQGAIHAAEGYARISGKPGVVIA 86

Query: 530 VSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKAT 709
            SGPG  + + GL++A +++ PLV+ +G       G   FQE D I    P +K S +  
Sbjct: 87  TSGPGATNLVTGLADAMIDSLPLVVFTGQVATSVIGSDAFQEADVIGITMPITKHSYQVR 146

Query: 710 DISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           +   +P  + E    A  GRPG   +D+P D+
Sbjct: 147 NAEDLPRIIKEAFHIATTGRPGPVLIDIPKDI 178



>gb:AE017003_376708 Bacillus cereus ATCC 14579 section 6 of 18 of
           the complete genome.>gb:AE016877_1016958 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 573

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 45/161 (27%), Positives = 79/161 (49%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           V   L + GV  +FG  G  +  + +     G++ +   +EQ            +G+ G+
Sbjct: 24  VIQCLKKLGVTTVFGYPGGAILPVYDALYESGLKHVLTRHEQAAIHAAEGYARASGKVGV 83

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
           +   SGPG  + + GL++A +++ PLV+I+G       G+  FQE D +    P +K + 
Sbjct: 84  VFATSGPGATNLVTGLADAYMDSIPLVVITGQVATPLIGKDGFQEADVVGITVPVTKHNY 143

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVS 823
           +  D++ V   V E    A +GRPG   +D+P DV +  V+
Sbjct: 144 QVRDVNHVSRIVQEAFYIAKSGRPGPVLIDIPKDVQNAKVT 184



>gb:AE006125_215758 Pasteurella multocida subsp. multocida str. Pm70
           section 92 of 204 of the complete
           genome.>gb:AE004439_1118488 Pasteurella multocida subsp.
           multocida str. Pm70, complete genome.
          Length = 574

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 48/159 (30%), Positives = 77/159 (48%), Gaps = 1/159 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  SL   GV+ +FG  G  V  + +    LG I  I   +EQ            TG+ 
Sbjct: 9   MVVQSLRDEGVEFLFGYPGGSVLDIYDAIHTLGGIEHILVRHEQAAVHMADGYARATGKV 68

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G +L  SGPG  + + G++ A +++ PL+++SG       G   FQE D +   +P  K 
Sbjct: 69  GCVLVTSGPGATNTITGIATAYMDSVPLIILSGQVMSGLIGSDAFQECDMVGISRPVVKH 128

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLH 811
           S      +++P  + +    A+ GRPG   +DLP DV++
Sbjct: 129 SFLVKSAAEIPETIKKAFYIASTGRPGPVVIDLPKDVVN 167



>pir|E82072|E82072 acetolactate synthase III, large chain VC2483
           [imported] - Vibrio cholerae (strain N16961 serogroup
           O1)>gb:AE004317_52855 Vibrio cholerae O1 biovar eltor
           str. N16961 chromosome I, section 225 of 251 of the
           complete chromosome.>gb:AE003852_1053629 Vibrio cholerae
           O1 biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 573

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 45/159 (28%), Positives = 77/159 (48%), Gaps = 2/159 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSL--ANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGR 511
           ++  SL   GV+++FG  G  V  +  A       I+ +   +EQ            TG+
Sbjct: 9   MIVQSLINEGVEQIFGYPGGSVLDIYDALHEKTDQIKHVLVRHEQAATHMADGYARATGK 68

Query: 512 PGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSK 691
           PG++L  SGPG  + + G++ A +++ P+++ISG+      G   FQE D +   +P  K
Sbjct: 69  PGVVLVCSGPGATNTVTGIATAYMDSIPMIVISGNVATNLIGNDAFQECDIVGVSRPIVK 128

Query: 692 FSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVL 808
            S        +P  + +    A+ GRPG   +D+P DV+
Sbjct: 129 HSFLVKKAEDIPETIKKAFYIASTGRPGPVVIDVPKDVM 167



>pir|B69644|B69644 acetolactate synthase (EC 4.1.3.18) large chain -
           Bacillus subtilis>gb:BSUB0015_754796 Bacillus subtilis
           complete genome (section 15 of 21): from 2812801 to
           3013507.>gb:BSZ75208_756492 B.subtilis genomic sequence
           89009bp.>gb:AX100787_1461232 Sequence 31 from Patent
           WO0121772.
          Length = 574

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 44/157 (28%), Positives = 77/157 (49%)
 Frame = +2

Query: 335 MLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +++  SL +  V+ +FG  G  V  + ++    G+  I   +EQ           ++G+P
Sbjct: 22  LMLIESLKKEKVEMIFGYPGGAVLPIYDKLYNSGLVHILPRHEQGAIHAAEGYARVSGKP 81

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G+++  SGPG  + + GL++A +++ PLV+ +G       G   FQE D +    P +K 
Sbjct: 82  GVVIATSGPGATNLVTGLADAMIDSLPLVVFTGQVATSVIGSDAFQEADILGITMPVTKH 141

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           S +      +P  + E    A  GRPG   +D+P DV
Sbjct: 142 SYQVRQPEDLPRIIKEAFHIATTGRPGPVLIDIPKDV 178



>sp|Q02137|ILVB_LACLA Acetolactate synthase large subunit (EC
           2.2.1.6) (AHAS) (Acetohydroxy- acid synthase large
           subunit) (ALS).
          Length = 575

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 47/166 (28%), Positives = 82/166 (49%), Gaps = 1/166 (0%)
 Frame = +2

Query: 332 NMLVAMSLARAGVDRMFGVVGIPVTSLANRAVAL-GIRFIAFHNEQXXXXXXXXXXXLTG 508
           + LV  +L   GV+ +FG  G  +  L +      GI+ I   +EQ            +G
Sbjct: 13  SQLVLQTLKELGVEIIFGYPGGAMLPLYDAIHNFEGIQHILARHEQGATHEAEGYAKSSG 72

Query: 509 RPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFS 688
           + G+++  SGPG  + + G+++A +++ PL++ +G       G+  FQE D +    P +
Sbjct: 73  KVGVVVVTSGPGATNAVTGIADAYLDSVPLLVFTGQVGPLSIGKDAFQEADTVGITAPIT 132

Query: 689 KFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSE 826
           K++ +  + + +P  V E    A  GRPG   +DLP DV    V+E
Sbjct: 133 KYNYQIRETADIPRIVTEAYYLARTGRPGPVEIDLPKDVSTLEVTE 178



>sp|P37251|ILVB_BACSU Acetolactate synthase large subunit (EC
           2.2.1.6) (AHAS) (Acetohydroxy- acid synthase large
           subunit) (ALS) (Vegetative protein 105) (VEG105).
          Length = 573

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 44/157 (28%), Positives = 77/157 (49%)
 Frame = +2

Query: 335 MLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +++  SL +  V+ +FG  G  V  + ++    G+  I   +EQ           ++G+P
Sbjct: 21  LMLIESLKKEKVEMIFGYPGGAVLPIYDKLYNSGLVHILPRHEQGAIHAAEGYARVSGKP 80

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G+++  SGPG  + + GL++A +++ PLV+ +G       G   FQE D +    P +K 
Sbjct: 81  GVVIATSGPGATNLVTGLADAMIDSLPLVVFTGQVATSVIGSDAFQEADILGITMPVTKH 140

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           S +      +P  + E    A  GRPG   +D+P DV
Sbjct: 141 SYQVRQPEDLPRIIKEAFHIATTGRPGPVLIDIPKDV 177



>gb:CP000001_852281 Bacillus cereus ZK, complete genome.
          Length = 570

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 45/161 (27%), Positives = 80/161 (49%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           V   L + GV  +FG  G  +  + +     G++ I   +EQ            +G+ G+
Sbjct: 21  VIQCLKKLGVTTVFGYPGGAILPVYDALYESGLKHILTRHEQAAIHAAEGYARASGKVGV 80

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
           +   SGPG  + + GL++A +++ PLV+I+G       G+  FQE D +    P +K + 
Sbjct: 81  VFATSGPGATNLVTGLADAYMDSIPLVVITGQVATPLIGKDGFQEADVVGITVPVTKHNY 140

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVS 823
           +  D++++   V E    A +GRPG   +D+P DV  + V+
Sbjct: 141 QVRDVNQLSRIVQEAFYIAESGRPGPVLIDIPKDVQIEKVT 181



>gb:AE017340_458339 Idiomarina loihiensis L2TR, complete genome.
          Length = 552

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 47/167 (28%), Positives = 77/167 (46%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           L   +L   GV  +FG+ G     L        I  I   +EQ           LTG+PG
Sbjct: 6   LFVKALENEGVKYIFGIPGEENLDLLESLSKSSIELILTRHEQGAGFMAATYGRLTGKPG 65

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + L+  GPG  + +  ++ A +   P+V+I+G    K+  +G FQ +D ++ + P +K++
Sbjct: 66  VCLSTLGPGATNLVTPVAYAQLGAMPMVVITGQKPIKERHQGQFQIIDVVDMMTPITKYT 125

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEAE 838
                 S +PA + E    A   RPG  +L+L  D+  + VS    E
Sbjct: 126 QAIISASSIPAHIREAFRRAEDERPGASHLELSDDISREEVSSLPIE 172



>gb:AE017329_444451 Listeria monocytogenes str. 4b F2365, section 8
           of 10 of the complete genome.>gb:AE017262_1076807
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 565

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 46/175 (26%), Positives = 80/175 (45%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           LV  SL   GV  +FG+ G  +  + +     G   I   +EQ           LTG+PG
Sbjct: 21  LVVDSLINQGVTHVFGIPGAKIDKVFDVMEERGPELIVSRHEQNAAFMAAAIGRLTGKPG 80

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           ++L  SGPG  +   GL  A     P+V I+G+  ++D  +   Q +D     +P +K+S
Sbjct: 81  VVLVTSGPGASNLATGLVTATAEGDPVVAIAGNVTRQDRLKKTHQSMDNAALFRPITKYS 140

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEAERLIAEAQD 862
            +      +P  +      AA    G  ++ LP D++++     +A R +A+ ++
Sbjct: 141 EEVVHAESIPEAITNAFRSAAEPNQGAAFVSLPQDIVNEPNVPVKAIRPLAKPEN 195



>gb:AE017029_381996 Bacillus anthracis str. Ames section 6 of 18 of
           the complete genome.>gb:AE017225_407106 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_451844 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE016879_1011701 Bacillus
           anthracis str. Ames complete genome.
          Length = 570

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 45/161 (27%), Positives = 80/161 (49%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           V   L + GV  +FG  G  +  + +     G++ I   +EQ            +G+ G+
Sbjct: 21  VIQCLKKLGVTTVFGYPGGAILPVYDALYESGLKHILTRHEQAAIHAAEGYARASGKVGV 80

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
           +   SGPG  + + GL++A +++ PLV+I+G       G+  FQE D +    P +K + 
Sbjct: 81  VFATSGPGATNLVTGLADAYMDSIPLVVITGQVATPLIGKDGFQEADVVGITVPVTKHNY 140

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVS 823
           +  D++++   V E    A +GRPG   +D+P DV  + V+
Sbjct: 141 QVRDVNQLSRIVQEAFYIAESGRPGPVLIDIPKDVQIEKVT 181



>gb:AE016755_324161 Escherichia coli CFT073 section 1 of 18 of the
           complete genome.>gb:AE014075_954745 Escherichia coli
           CFT073 complete genome.
          Length = 604

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 48/159 (30%), Positives = 76/159 (47%), Gaps = 1/159 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  SL   GV ++FG  G  V  + +    +G I  +   +EQ            TG  
Sbjct: 39  MVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDHVLVRHEQAAVHMADGLARATGEV 98

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G++ A +++ PLV++SG       G   FQE D +   +P  K 
Sbjct: 99  GVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVATSLIGYDAFQECDMVGISRPVVKH 158

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLH 811
           S        +P  + +    AA+GRPG   +DLP D+L+
Sbjct: 159 SFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPKDILN 197



>gb:ECO110K_126890 Escherichia coli genomic DNA. (0.0 - 2.4 min).
          Length = 566

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 48/159 (30%), Positives = 76/159 (47%), Gaps = 1/159 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  SL   GV ++FG  G  V  + +    +G I  +   +EQ            TG  
Sbjct: 9   MVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDHVLVRHEQAAVHMADGLARATGEV 68

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G++ A +++ PLV++SG       G   FQE D +   +P  K 
Sbjct: 69  GVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVATSLIGYDAFQECDMVGISRPVVKH 128

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLH 811
           S        +P  + +    AA+GRPG   +DLP D+L+
Sbjct: 129 SFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPKDILN 167



>gb:ECILVIH_126075 E. coli ilvIH operon for valine-sensitive
           acetohydroxy acid synthase (AHASIII).
          Length = 566

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 48/159 (30%), Positives = 76/159 (47%), Gaps = 1/159 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  SL   GV ++FG  G  V  + +    +G I  +   +EQ            TG  
Sbjct: 9   MVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDHVLVRHEQAAVHMADGLARATGEV 68

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G++ A +++ PLV++SG       G   FQE D +   +P  K 
Sbjct: 69  GVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVATSLIGYDAFQECDMVGISRPVVKH 128

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLH 811
           S        +P  + +    AA+GRPG   +DLP D+L+
Sbjct: 129 SFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPKDILN 167



>gb:EC2MIN_124740 E. coli 2 minute region.
          Length = 566

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 48/159 (30%), Positives = 76/159 (47%), Gaps = 1/159 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  SL   GV ++FG  G  V  + +    +G I  +   +EQ            TG  
Sbjct: 9   MVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDHVLVRHEQAAVHMADGLARATGEV 68

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G++ A +++ PLV++SG       G   FQE D +   +P  K 
Sbjct: 69  GVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVATSLIGYDAFQECDMVGISRPVVKH 128

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLH 811
           S        +P  + +    AA+GRPG   +DLP D+L+
Sbjct: 129 SFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPKDILN 167



>gb:AE005674_69654 Shigella flexneri 2a str. 301, complete
           genome.>gb:AE016978_370066 Shigella flexneri 2a str.
           2457T section 1 of 16 of the complete
           genome.>gb:AE014073_994816 Shigella flexneri 2a str.
           2457T complete genome.
          Length = 602

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 48/159 (30%), Positives = 76/159 (47%), Gaps = 1/159 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  SL   GV ++FG  G  V  + +    +G I  +   +EQ            TG  
Sbjct: 37  MVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDHVLVRHEQAAVHMADGLARATGEV 96

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G++ A +++ PLV++SG       G   FQE D +   +P  K 
Sbjct: 97  GVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVATSLIGYDAFQECDMVGISRPVVKH 156

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLH 811
           S        +P  + +    AA+GRPG   +DLP D+L+
Sbjct: 157 SFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPKDILN 195



>pir|AH1696|AH1696 alpha-acetolactate synthase protein, AlsS homolog
           alsS [imported] - Listeria innocua (strain
           Clip11262)>gb:AL596171_539458 Listeria innocua Clip11262
           complete genome, segment 9/12.
          Length = 564

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 46/175 (26%), Positives = 80/175 (45%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           LV  SL   GV  +FG+ G  +  + +     G   I   +EQ           LTG+PG
Sbjct: 20  LVVDSLINQGVTHVFGIPGAKIDKVFDVMEERGPELIVSRHEQNAAFMAAAIGRLTGKPG 79

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           ++L  SGPG  +   GL  A     P+V I+G+  ++D  +   Q +D     +P +K+S
Sbjct: 80  VVLVTSGPGASNLATGLVTATAEGDPVVAIAGNVTRQDRLKRTHQSMDNAALFRPITKYS 139

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEAERLIAEAQD 862
            +      +P  +      AA    G  ++ LP D++++     +A R +A+ ++
Sbjct: 140 EEVVHAESIPEAITNAFRSAAEPNQGAAFVSLPQDIVNEPNVPVKAIRPLAKPEN 194



>pir|A90639|A90639 hypothetical protein ECs0081 [imported] -
           Escherichia coli  (strain O157:H7, substrain RIMD
           0509952)>gb:BA000007_658093 Escherichia coli O157:H7
           DNA, complete genome.
          Length = 588

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 48/159 (30%), Positives = 76/159 (47%), Gaps = 1/159 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  SL   GV ++FG  G  V  + +    +G I  +   +EQ            TG  
Sbjct: 23  MVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIGHVLVRHEQAAVHMADGLARATGEV 82

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G++ A +++ PLV++SG       G   FQE D +   +P  K 
Sbjct: 83  GVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVATSLIGYDAFQECDMVGISRPVVKH 142

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLH 811
           S        +P  + +    AA+GRPG   +DLP D+L+
Sbjct: 143 SFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPKDILN 181



>pir|A85490|A85490 hypothetical protein ilvI [imported] -
           Escherichia coli  (strain O157:H7, substrain
           EDL933)>gb:AE005174_64314 Escherichia coli O157:H7
           EDL933, complete genome.
          Length = 602

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 48/159 (30%), Positives = 76/159 (47%), Gaps = 1/159 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  SL   GV ++FG  G  V  + +    +G I  +   +EQ            TG  
Sbjct: 37  MVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIGHVLVRHEQAAVHMADGLARATGEV 96

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G++ A +++ PLV++SG       G   FQE D +   +P  K 
Sbjct: 97  GVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVATSLIGYDAFQECDMVGISRPVVKH 156

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLH 811
           S        +P  + +    AA+GRPG   +DLP D+L+
Sbjct: 157 SFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPKDILN 195



>pir|E64729|YCEC3I acetolactate synthase (EC 4.1.3.18) III large
           chain - Escherichia coli (strain K-12)>gb:U00096_199183
           Escherichia coli K-12 MG1655 complete genome.
          Length = 604

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 48/159 (30%), Positives = 76/159 (47%), Gaps = 1/159 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  SL   GV ++FG  G  V  + +    +G I  +   +EQ            TG  
Sbjct: 39  MVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDHVLVRHEQAAVHMADGLARATGEV 98

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G++ A +++ PLV++SG       G   FQE D +   +P  K 
Sbjct: 99  GVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVATSLIGYDAFQECDMVGISRPVVKH 158

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLH 811
           S        +P  + +    AA+GRPG   +DLP D+L+
Sbjct: 159 SFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPKDILN 197



>sp|P00893|ILVI_ECOLI Acetolactate synthase isozyme III large
           subunit (EC 2.2.1.6) (AHAS- III) (Acetohydroxy-acid
           synthase III large subunit) (ALS-III).
          Length = 574

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 48/159 (30%), Positives = 76/159 (47%), Gaps = 1/159 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  SL   GV ++FG  G  V  + +    +G I  +   +EQ            TG  
Sbjct: 9   MVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDHVLVRHEQAAVHMADGLARATGEV 68

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G++ A +++ PLV++SG       G   FQE D +   +P  K 
Sbjct: 69  GVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVATSLIGYDAFQECDMVGISRPVVKH 128

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLH 811
           S        +P  + +    AA+GRPG   +DLP D+L+
Sbjct: 129 SFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPKDILN 167



>gb:CP000011_867652 Burkholderia mallei ATCC 23344 chromosome 2,
           complete sequence.
          Length = 546

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 49/177 (27%), Positives = 80/177 (45%), Gaps = 5/177 (2%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           L   +L   GV  +FG+ G     L        I+ +   +EQ           LTG+ G
Sbjct: 6   LFVKALEAEGVQYVFGIPGEENLDLLESLRRSRIKLVLTRHEQAAGFMAATYGRLTGKTG 65

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + L   GPG  + +   + A +   P++MI+G    K   +G FQ +D +  ++P +K +
Sbjct: 66  VCLATLGPGATNFVTAAAYAQLGGMPMLMITGQKPIKSSKQGHFQIVDVVGMMQPLTKLT 125

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ-----TVSESEAERLIAE 853
            +   I  +P+ V E    A   RPG  +L+LP D+ H+      +  S + R IAE
Sbjct: 126 RQIVSIGNIPSAVREAFRRAEEERPGATHLELPEDIAHEEGDGKPIPASYSRRPIAE 182



>gb:BX571966_795145 Burkholderia pseudomallei strain K96243,
           chromosome 2, complete sequence.
          Length = 546

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 49/177 (27%), Positives = 80/177 (45%), Gaps = 5/177 (2%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           L   +L   GV  +FG+ G     L        I+ +   +EQ           LTG+ G
Sbjct: 6   LFVKALEAEGVQYVFGIPGEENLDLLESLRRSRIKLVLTRHEQAAGFMAATYGRLTGKTG 65

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + L   GPG  + +   + A +   P++MI+G    K   +G FQ +D +  ++P +K +
Sbjct: 66  VCLATLGPGATNFVTAAAYAQLGGMPMLMITGQKPIKSSKQGHFQIVDVVGMMQPLTKLT 125

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ-----TVSESEAERLIAE 853
            +   I  +P+ V E    A   RPG  +L+LP D+ H+      +  S + R IAE
Sbjct: 126 RQIVSIGNIPSAVREAFRRAEEERPGATHLELPEDIAHEEGDGKPIPASYSRRPIAE 182



>gb:BX571871_788522 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 13/17.
          Length = 575

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 53/165 (32%), Positives = 80/165 (48%), Gaps = 4/165 (2%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  SL   GV  +FG  G  V  + +    +G I  I   +EQ            TG+ 
Sbjct: 9   MVVRSLIDQGVKHIFGYPGGAVLDIYDALHTVGGIEHILVRHEQGAVHMADGYARSTGKV 68

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G++ A +++ P+V++SG       G   FQE D +   +P  K 
Sbjct: 69  GVVLITSGPGATNAITGIATAYMDSIPMVVLSGQVASSLIGNDAFQECDMVGISRPIVKH 128

Query: 695 S---AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTV 820
           S    KA DI KV    F +   A++GRPG   +DLP D ++  V
Sbjct: 129 SFLVKKAEDIPKVLKKAFYL---ASSGRPGPVVIDLPKDTVNPAV 170



>gb:BA000030_699706 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 564

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 47/177 (26%), Positives = 81/177 (45%)
 Frame = +2

Query: 305 DNLMADVDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXX 484
           DN    +    LVA +L   GV+ ++ + G  +  + +  V  GI+ +   +EQ      
Sbjct: 7   DNNSDLISGGHLVAKALKAEGVEVIYTLCGGHIIDIYDGCVDEGIKVVDVRHEQVAAHAA 66

Query: 485 XXXXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQ 664
                +TG+PG  +  +GPG    + G++NA     P+++I G         G  Q+L  
Sbjct: 67  DGYARITGKPGCAVVTAGPGTTDAVTGVANAFRAESPMLLIGGQGAHTQHKMGSLQDLPH 126

Query: 665 IEAVKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEA 835
           ++ + P +KF+A   D ++    V         G PG  +L++P DVL   V  S+A
Sbjct: 127 VDMMTPITKFAATVPDTARAADMVSMAFRECYHGAPGPSFLEIPRDVLDARVPVSKA 183



>gb:AE017355_462999 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 570

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 44/155 (28%), Positives = 77/155 (49%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           V   L + GV  +FG  G  +  + +     G++ I   +EQ            +G+ G+
Sbjct: 21  VIQCLKKLGVTTVFGYPGGAILPVYDALYESGLKHILTRHEQAAIHAAEGYARASGKVGV 80

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
           +   SGPG  + + GL++A +++ PLV+I+G       G+  FQE D +    P +K + 
Sbjct: 81  VFATSGPGATNLVTGLADAYMDSIPLVVITGQVATPLIGKDGFQEADIVGITVPVTKHNY 140

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           +  D++++   V E    A +GRPG   +D+P DV
Sbjct: 141 QVRDVNQLSRIVQEAFYIAESGRPGPVLIDIPKDV 175



>gb:CP000026_75035 Salmonella enterica subsp. enterica serovar
           Paratypi A str. ATCC 9150.
          Length = 574

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 48/159 (30%), Positives = 76/159 (47%), Gaps = 1/159 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  SL   GV ++FG  G  V  + +    +G I  +   +EQ            TG  
Sbjct: 9   MVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDHVLVRHEQAAVHMADGLARATGDV 68

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G++ A +++ PLV++SG       G   FQE D +   +P  K 
Sbjct: 69  GVVLVASGPGATNAITGIATAYMDSIPLVILSGQVATSLIGYDAFQECDMVGISRPVVKH 128

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLH 811
           S        +P  + +    AA+GRPG   +DLP D+L+
Sbjct: 129 SFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPKDILN 167



>pir|AI0516|AI0516 acetolactate synthase (EC 4.1.3.18) - Salmonella
           enterica subsp. enterica serovar Typhi (strain
           CT18)>gb:AE016834_344319 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, section 1 of 16 of the
           complete genome.>gb:AL627265_540448 Salmonella enterica
           serovar Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 1/20.>gb:AE014613_981651 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, complete
           genome.
          Length = 574

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 48/159 (30%), Positives = 76/159 (47%), Gaps = 1/159 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  SL   GV ++FG  G  V  + +    +G I  +   +EQ            TG  
Sbjct: 9   MVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDHVLVRHEQAAVHMADGLARATGDV 68

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G++ A +++ PLV++SG       G   FQE D +   +P  K 
Sbjct: 69  GVVLVTSGPGATNAITGIATAYMDSIPLVILSGQVATSLIGYDAFQECDMVGISRPVVKH 128

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLH 811
           S        +P  + +    AA+GRPG   +DLP D+L+
Sbjct: 129 SFLVKQTEDIPLVLKKAFWLAASGRPGPVVVDLPKDILN 167



>sp|P40811|ILVI_SALTY Acetolactate synthase isozyme III large
           subunit (EC 2.2.1.6) (AHAS- III) (Acetohydroxy-acid
           synthase III large subunit) (ALS-III).
          Length = 574

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 48/159 (30%), Positives = 76/159 (47%), Gaps = 1/159 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  SL   GV ++FG  G  V  + +    +G I  +   +EQ            TG  
Sbjct: 9   MVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDHVLVRHEQAAVHMADGLARATGDV 68

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G++ A +++ PLV++SG       G   FQE D +   +P  K 
Sbjct: 69  GVVLVTSGPGATNAITGIATAYMDSIPLVILSGQVATSLIGYDAFQECDMVGISRPVVKH 128

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLH 811
           S        +P  + +    AA+GRPG   +DLP D+L+
Sbjct: 129 SFLVKQTEDIPLVLKKAFWLAASGRPGPVVVDLPKDILN 167



>gb:AY428947_1605829 Camelina microcarpa acetolactate synthase 2
           (ALS2) mRNA, complete cds.
          Length = 665

 Score = 79.7 bits (195), Expect = 7e-14
 Identities = 46/160 (28%), Positives = 78/160 (48%), Gaps = 1/160 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAV-ALGIRFIAFHNEQXXXXXXXXXXXLTGRP 514
           ++  +L R GV+ +F   G     +      +  IR +   +EQ            TG+P
Sbjct: 97  ILVEALERQGVETVFAYPGGASMEIHQALTRSSSIRNVLPRHEQGGVFAAEGYARSTGKP 156

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           GI +  SGPG  + ++GL++A +++ PLV I+G   ++  G   FQE   +E  +  +K 
Sbjct: 157 GICIATSGPGATNLVSGLADALLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITKH 216

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ 814
           +    D+  +P  V E    A +GRPG   +D+P D+  Q
Sbjct: 217 NYLVMDVEDIPRIVEEAFFLATSGRPGPVLVDVPKDIQQQ 256



>gb:AY428880_1605828 Camelina microcarpa acetolactate synthase 1
           mRNA, complete cds.
          Length = 668

 Score = 79.7 bits (195), Expect = 7e-14
 Identities = 46/160 (28%), Positives = 78/160 (48%), Gaps = 1/160 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAV-ALGIRFIAFHNEQXXXXXXXXXXXLTGRP 514
           ++  +L R GV+ +F   G     +      +  IR +   +EQ            TG+P
Sbjct: 100 ILVEALERQGVETVFAYPGGASMEIHQALTRSSSIRNVLPRHEQGGVFAAEGYARSTGKP 159

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           GI +  SGPG  + ++GL++A +++ PLV I+G   ++  G   FQE   +E  +  +K 
Sbjct: 160 GICIATSGPGATNLVSGLADALLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITKH 219

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ 814
           +    D+  +P  V E    A +GRPG   +D+P D+  Q
Sbjct: 220 NYLVMDVEDIPRIVEEAFFLATSGRPGPVLVDVPKDIQQQ 259



>gb:BX571874_789540 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 16/17.
          Length = 548

 Score = 79.7 bits (195), Expect = 7e-14
 Identities = 41/155 (26%), Positives = 75/155 (48%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           V  +L   G+D++FG  G  +  + +     G+  +   +EQ            +G+PG+
Sbjct: 7   VVKALRTQGIDKVFGYPGGTIMPVYDALYDGGVEHLLCRHEQGAAMAAIGYARASGKPGV 66

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
            +  SGPG  + + GL++A +++ P+V I+G    +  G   FQE+D +      +K S 
Sbjct: 67  CIATSGPGATNLITGLADALLDSVPIVAITGQVGSELIGTDAFQEVDVLGLSLACTKHSF 126

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
               +  +P  + E    A +GRPG   +D+P D+
Sbjct: 127 LVDSLEDLPQIMAEAFSIATSGRPGPVLIDIPKDI 161



>gb:AE017261_420092 Picrophilus torridus DSM 9790, complete genome.
          Length = 573

 Score = 79.7 bits (195), Expect = 7e-14
 Identities = 47/167 (28%), Positives = 80/167 (47%), Gaps = 4/167 (2%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGI---PVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLT 505
           L+  SL + GV  +FG+ G+   PV       V  G +R I   +EQ            T
Sbjct: 5   LIVESLKKQGVKDIFGIPGLYNMPVYDAFLEDVESGQLRHILMRHEQAAAHAADAYARAT 64

Query: 506 GRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPF 685
           G PG+    SGPG  + + GL  A  ++ P+V I+G  +    G+  FQE D    + P 
Sbjct: 65  GFPGVCTATSGPGVTNLVTGLITAYQDSSPVVAITGQVNSSSIGKMSFQESDTPGIMFPV 124

Query: 686 SKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSE 826
           +K++ +   + ++P  + +    A+ GRPG   +D+P D+ +  + +
Sbjct: 125 TKYTVQLRSVDEIPFWIEKAFYIASTGRPGPVVVDIPRDLQNTKIDD 171



>gb:AE017180_400206 Geobacter sulfurreducens PCA, complete genome.
          Length = 566

 Score = 79.7 bits (195), Expect = 7e-14
 Identities = 45/148 (30%), Positives = 74/148 (50%), Gaps = 1/148 (0%)
 Frame = +2

Query: 365 GVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRPGILLTVSGP 541
           GVD +FG  G  V ++ +   +   IR I   +EQ            TGR G+ +  SGP
Sbjct: 17  GVDTVFGYPGGTVINIYDELFSFKEIRHILPRHEQAGVHAADGFARATGRVGVAIATSGP 76

Query: 542 GCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKATDISK 721
           G  + + G++ A +++ P+V+I+G       G   FQE+D +   +P +K +    D+  
Sbjct: 77  GATNTVTGIATAYMDSIPVVVITGQVPTALIGNDAFQEVDIVGITRPCTKHNFLVKDVKD 136

Query: 722 VPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           +P+ + +    A  GRPG   +DLP DV
Sbjct: 137 IPSIIKKAFYIARTGRPGPVLVDLPKDV 164



>sp|P27868|ILVB_SPIPL Acetolactate synthase (EC 2.2.1.6)
           (Acetohydroxy-acid synthase) (ALS)
           (Fragment).>pir|B44857|B44857 acetolactate synthase (EC
           4.1.3.18) (ilvY) - Spirulina
           platensis>gb:SPUAHASL_189706 Spirulina platensis
           acetohycroxy acid synthase (ilvY), 5' end.
          Length = 579

 Score = 79.7 bits (195), Expect = 7e-14
 Identities = 50/156 (32%), Positives = 74/156 (47%), Gaps = 4/156 (2%)
 Frame = +2

Query: 350 SLARAGVDRMFGVVG---IPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           SL R GV  +FG  G   +P+     RA   G I+     +EQ            TG+ G
Sbjct: 20  SLRRHGVQHIFGYPGGSNLPIYDEIYRAEQAGEIKHYLVRHEQGAAHAADGYARSTGKVG 79

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + L  SGPG  + + GL+ A +++ P++ I+G   +   G   FQE+D      P  K S
Sbjct: 80  VCLATSGPGATNLVTGLATAYLDSVPVLAITGQVPRSALGTDAFQEIDIFGITLPIVKHS 139

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
               + S++P  V E    A +GRPG   +D+P DV
Sbjct: 140 YLVREPSELPRIVVEAFHLAMSGRPGPVLIDIPKDV 175



>sp|P27696|ILVB_KLEPN Acetolactate synthase, catabolic (EC 2.2.1.6)
           (ALS).>pir|JC1218|JC1218 acetolactate synthase (EC
           4.1.3.18), FAD-independent - Klebsiella
           pneumoniae>gb:KPNILUK_139506 Klebsiella pneumoniae
           acetolactate synthase (iluk) gene, complete cds.
          Length = 559

 Score = 79.7 bits (195), Expect = 7e-14
 Identities = 44/162 (27%), Positives = 74/162 (45%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           LV   L   GV ++FG+ G  +  + +  +   IR I   +E            +TG+ G
Sbjct: 16  LVVSQLEAQGVRQVFGIPGAKIDKVFDSLLDSSIRIIPVRHEANAAFMAAAVGRITGKAG 75

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + L  SGPGC + + G++ A     P+V + G+  + D  +   Q +D +    P +K++
Sbjct: 76  VALVTSGPGCSNLITGMATANSEGDPVVALGGAVKRADKAKQVHQSMDTVAMFSPVTKYA 135

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVS 823
            + T    +   V      A  GRPG  ++ LP DV+   VS
Sbjct: 136 IEVTAPDALAEVVSNAFRAAEQGRPGSAFVSLPQDVVDGPVS 177



>gb:BX950851_842564 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 572

 Score = 79.3 bits (194), Expect = 9e-14
 Identities = 47/158 (29%), Positives = 73/158 (46%), Gaps = 1/158 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  SL   GV  +FG  G  V  + +    +G I  I   +EQ            TG  
Sbjct: 9   MVVRSLIDQGVKHVFGYPGGAVLDIYDALHTVGGIEHILVRHEQGAVHMADGYARATGEV 68

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G++ A +++ P+V++SG       G   FQE D +   +P  K 
Sbjct: 69  GVVLVTSGPGATNAITGIATAYMDSIPMVVLSGQVATSLIGYDSFQECDTVGISRPIVKH 128

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVL 808
           S        VP  + +    A+ GRPG   +DLP D++
Sbjct: 129 SFLVKKAEDVPTILKKAFYLASTGRPGPVVVDLPKDIM 166



>gb:BX572593_799723 Rhodopseudomonas palustris CGA009 complete
           genome; segment 1/16.
          Length = 582

 Score = 79.3 bits (194), Expect = 9e-14
 Identities = 47/166 (28%), Positives = 79/166 (47%), Gaps = 1/166 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           L+A +L  AGVD +F + G  + S     +A  IR + F +E             TG+ G
Sbjct: 17  LLARTLRDAGVDTVFALHGGHLESFYRGCIANDIRLVDFRHESSAGHAADGYARATGKLG 76

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQ-ELDQIEAVKPFSKF 694
           + +  +GPG  +G+  + NA +++ P + I GS   ++      Q  +DQI    P  K+
Sbjct: 77  VCVITAGPGFTNGVTAILNAQLDSIPTLFIVGSPPLREAETNALQGGVDQIAVTLPMVKY 136

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESE 832
           + + T+  ++P      +  A  GR G   LD+P DVLH    + +
Sbjct: 137 AHRITNTERIPDLTALAIRKATTGRRGAVLLDVPIDVLHMRAHKDD 182



>gb:AE017232_412237 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 6 of 16 of the complete
           genome.>gb:AE016958_1055641 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 212

 Score = 79.3 bits (194), Expect = 9e-14
 Identities = 49/156 (31%), Positives = 77/156 (49%), Gaps = 1/156 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           LVA  L   GVD +F + G  + S+ +     GIR I   +EQ           +T  PG
Sbjct: 16  LVARRLRAGGVDTVFTLSGGHLFSIYDGCRDEGIRLIDTRHEQTATFAAEGWSKVTRLPG 75

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           +    +GPG  +G++ ++ A  N+ PLV++ G    + +G G  QE+D +  V P ++F+
Sbjct: 76  VAALTAGPGVTNGMSAMAAAQQNSSPLVVLGGRAPAQRWGMGSLQEIDHVPFVAPLARFA 135

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGC-YLDLPSD 802
           A A   +     V + L  AA G P G  ++D P D
Sbjct: 136 ATAQSAADAGRLVDDALR-AAVGAPSGVGFVDFPMD 170



>pir|AF1325|AF1325 alpha-acetolactate synthase protein, AlsS homolog
           alsS [imported] - Listeria monocytogenes (strain
           EGD-e)>gb:AL591981_536497 Listeria monocytogenes strain
           EGD, complete genome, segment 9/12.
          Length = 565

 Score = 79.3 bits (194), Expect = 9e-14
 Identities = 45/175 (25%), Positives = 79/175 (45%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           LV  SL   GV  +FG+ G  +  + +     G   I   +EQ           LTG+PG
Sbjct: 21  LVVDSLINQGVTHVFGIPGAKIDKVFDVMEERGPELIVSRHEQNAAFMAAAIGRLTGKPG 80

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           ++L  SGPG  +   GL  A     P+V I+G+  ++D  +   Q +D     +P +K+S
Sbjct: 81  VVLVTSGPGASNLATGLVTATAEGDPVVAIAGNVTRQDRLKRTHQSMDNAALFRPITKYS 140

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEAERLIAEAQD 862
            +      +P  +      A     G  ++ LP D++++     +A R +A+ ++
Sbjct: 141 EEVVHAESIPEAITNAFRSATEPNQGAAFVSLPQDIVNEPNVPVKAIRPLAKPEN 195



>gb:AY428879_1605827 Camelina microcarpa acetolactate synthase 1
           mRNA, complete cds.
          Length = 668

 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 46/160 (28%), Positives = 77/160 (48%), Gaps = 1/160 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAV-ALGIRFIAFHNEQXXXXXXXXXXXLTGRP 514
           ++  +L R GV+  F   G     +      +  IR +   +EQ            TG+P
Sbjct: 100 ILVEALERQGVETAFAYPGGASMEIHQALTRSSSIRNVLPRHEQGGVFAAEGYARSTGKP 159

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           GI +  SGPG  + ++GL++A +++ PLV I+G   ++  G   FQE   +E  +  +K 
Sbjct: 160 GICIATSGPGATNLVSGLADALLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITKH 219

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ 814
           +    D+  +P  V E    A +GRPG   +D+P D+  Q
Sbjct: 220 NYLVMDVEDIPRIVEEAFFLATSGRPGPVLVDVPKDIQQQ 259



>gb:AP006618_560630 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 647

 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 46/157 (29%), Positives = 76/157 (48%), Gaps = 1/157 (0%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAV-ALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           V  SL   GVD +FG+ G  +  + +    +  +R +   +EQ            TG+ G
Sbjct: 47  VVRSLEELGVDTVFGIPGGAILPVYDPLFDSTKVRHVLVRHEQGAGHAATGYAQATGKVG 106

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + +  SGPG  + +  +++A +++ P+V I+G   +   G   FQE D      P +K +
Sbjct: 107 VCMATSGPGATNLVTPIADAQMDSVPIVAITGQVGRGLIGTDAFQEADISGITMPITKHN 166

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVL 808
              TD   +P  + E    AA+GRPG   +D+P DVL
Sbjct: 167 FLITDGIDIPRIIAEAFYLAASGRPGAVLVDIPKDVL 203



>gb:CR522870_101614 Desulfotalea psychrophila LSv54 chromosome.
          Length = 612

 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 46/169 (27%), Positives = 79/169 (46%), Gaps = 1/169 (0%)
 Frame = +2

Query: 305 DNLMADVDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAV-ALGIRFIAFHNEQXXXXX 481
           + LM  +  +  +   L   GV  +FG  G  V  L +  + +  I  +   +EQ     
Sbjct: 43  NGLMGKITGSRAIVQCLKEEGVQTIFGYPGGAVIDLYDALMDSTDIEHVLVRHEQGAVHA 102

Query: 482 XXXXXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELD 661
                 +TG  G+ L  SGPG  +G+ G++ A +++ PLV+++G   +   G   FQE+D
Sbjct: 103 ADAFARVTGEVGVALLTSGPGATNGVTGIATAYLDSIPLVVLTGQVPRALIGNDAFQEVD 162

Query: 662 QIEAVKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVL 808
            +   +P +K +   +    +   + E    A  GRPG   +DLP D+L
Sbjct: 163 IVGITRPCTKHNYLVSKPEDLVPVLREAFHVAKTGRPGPVLVDLPKDIL 211



>gb:AX885458_1480911 Sequence 1321 from Patent EP1033401.
          Length = 100

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 38/94 (40%), Positives = 53/94 (56%)
 Frame = +2

Query: 296 HFRDNLMADVDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXX 475
           +F +     V    ++A +L    V+ +FG+VGIPVT +A  A  LGI++I   NEQ   
Sbjct: 5   NFAERXXEQVSGAKVIAQALKTQDVEYIFGIVGIPVTEIAIAAQQLGIKYIGMRNEQAAC 64

Query: 476 XXXXXXXXLTGRPGILLTVSGPGCVHGLAGLSNA 577
                   LT RPG+ L VSGPG +H L G++NA
Sbjct: 65  YAASAIGYLTSRPGVCLVVSGPGLIHALGGMANA 98



>gb:CP000024_877635 Streptococcus thermophilus CNRZ1066, complete
           genome.
          Length = 572

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 45/158 (28%), Positives = 75/158 (47%), Gaps = 1/158 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           L+  +L   G+  +FG  G  V  L +       I  I   +EQ            TG+ 
Sbjct: 21  LILDTLLELGISTIFGYPGGAVLPLYDAIYKNEEINHILSRHEQGSLHEAEGYAKSTGKL 80

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G+ L  SGPG  + + G+++A  ++ PL++ +G       G+  FQE D +    P +K+
Sbjct: 81  GVALVTSGPGATNAITGIADAMSDSVPLLVFTGQVATSGIGKDAFQEADIVGITMPITKY 140

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVL 808
           + +  D + +P  + E +  A  GRPG   +DLP DV+
Sbjct: 141 NYQIRDTADIPRIIREAVHIATTGRPGPVVIDLPKDVV 178



>gb:CP000023_875720 Streptococcus thermophilus LMG 18311, complete
           genome.
          Length = 572

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 45/158 (28%), Positives = 75/158 (47%), Gaps = 1/158 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           L+  +L   G+  +FG  G  V  L +       I  I   +EQ            TG+ 
Sbjct: 21  LILDTLLELGISTIFGYPGGAVLPLYDAIYKNEEINHILSRHEQGSLHEAEGYAKSTGKL 80

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G+ L  SGPG  + + G+++A  ++ PL++ +G       G+  FQE D +    P +K+
Sbjct: 81  GVALVTSGPGATNAITGIADAMSDSVPLLVFTGQVATSGIGKDAFQEADIVGITMPITKY 140

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVL 808
           + +  D + +P  + E +  A  GRPG   +DLP DV+
Sbjct: 141 NYQIRDTADIPRIIREAVHIATTGRPGPVVIDLPKDVV 178



>gb:AY552545_627820 Uncultured marine gamma proteobacterium
           EBAC20E09 clone EBAC20E09, complete sequence.
          Length = 571

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 45/157 (28%), Positives = 73/157 (46%), Gaps = 1/157 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           ++  SL   GV+ +FG  G     + +       ++ I   +EQ            TG+P
Sbjct: 1   MLIQSLINEGVEYIFGYPGGAALHIYDSIFKQSEMQHILVRHEQGATHAADGYARATGKP 60

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G+++  SGPG  + + G++ A +++ P+V+ISG       G   FQE D I   +P  K 
Sbjct: 61  GVVMVTSGPGATNAITGIATAFMDSIPMVVISGQVQSHLIGTDAFQETDMIGISRPIVKH 120

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           S      S +P  V E    A +GR G   +D+P D+
Sbjct: 121 SFTVDHQSNIPQIVKEAFHIATSGRQGPVVIDIPKDL 157



>gb:AE012835_286102 Chlorobium tepidum TLS section 56 of 194 of the
           complete genome.>gb:AE006470_933270 Chlorobium tepidum
           TLS complete genome.
          Length = 573

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 45/154 (29%), Positives = 74/154 (48%), Gaps = 1/154 (0%)
 Frame = +2

Query: 353 LARAGVDRMFGVVGIPVTSLANRAVAL-GIRFIAFHNEQXXXXXXXXXXXLTGRPGILLT 529
           L R  V+ +FG  G  +  +      +  I  I   +EQ            TGRPG++L 
Sbjct: 18  LRRENVEYIFGYPGGALLKVYETLHDVEDIEHILARHEQGATHMAEGYARATGRPGVVLV 77

Query: 530 VSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKAT 709
            SGPG  + + G++NA +++ PLV+ +G       G   FQE D +   +P +K +    
Sbjct: 78  TSGPGATNTVTGITNAYMDSTPLVVFTGQVPSSLIGNDAFQEADIVGITRPITKHNFLVK 137

Query: 710 DISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLH 811
           D+ ++   + +    A  GRPG   +D+P DVL+
Sbjct: 138 DVRELATTIRKAFYLATNGRPGPVLVDMPKDVLN 171



>gb:AB104737_13127 Selenomonas ruminantium genes for
           3-isopropylmalate dehydratase small subunit,
           3-isopropylmalate dehydrogenase, acetolactate synthase
           large chain, recombinase XerD, ribosomal protein L28,
           lysine decarboxylase, membrane subunits homolog of NADH
           dehydrogenase, partial and complete cds.
          Length = 554

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 48/165 (29%), Positives = 78/165 (47%), Gaps = 1/165 (0%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAV-ALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           V   L   GVD +FG  G  +  L +    +  I+ +   +EQ            +G+ G
Sbjct: 7   VVACLREQGVDTVFGYPGGMILPLYDALYDSKEIKQVLVTHEQNAAHAADGYARASGKVG 66

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + +  SGPG  + + GL+ A +++ P+V I+G  D    GR  FQE D ++   P +K +
Sbjct: 67  VCIATSGPGATNLVTGLATAFMDSIPVVAITGQVDTTLLGRDAFQETDILDVTMPITKHN 126

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESE 832
            K  D   + + + E    A  GRPG   +D+P D+  Q V+  E
Sbjct: 127 YKIKDARHLLSTIREAFTLAKKGRPGPVLVDVPRDLFFQEVAWEE 171



>pir|G69464|G69464 acetolactate synthase (EC 4.1.3.18) large chain -
           Archaeoglobus fulgidus>gb:AE000985_30204 Archaeoglobus
           fulgidus DSM 4304 section 122 of 172 of the complete
           genome.>gb:AE000782_975601 Archaeoglobus fulgidus DSM
           4304 complete genome.
          Length = 552

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 42/155 (27%), Positives = 71/155 (45%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           +  +L   G++ +FG+ G  +  + +     GIR I   +EQ            +G+ G+
Sbjct: 7   IVKALEMEGIEVVFGIPGGAIIEVYDALYDSGIRHITTRHEQGATHAADGYARASGKVGV 66

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
               SGPG  + + G++ A +++ PLV+ +G       G   FQE D      P +K + 
Sbjct: 67  AFATSGPGATNTVTGIATAYMDSSPLVVFTGQVPTSMIGNDAFQEADITGITMPITKHNY 126

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
             TD   +   + E    A+ GRPG   +DLP D+
Sbjct: 127 LVTDTKDLLGTIKEAFHIASTGRPGPVLVDLPKDI 161



>pir|C70341|C70341 acetolactate synthase (EC 4.1.3.18) large chain -
           Aquifex aeolicus>gb:AE000690_26110 Aquifex aeolicus VF5
           section 22 of 109 of the complete
           genome.>gb:AE000657_976641 Aquifex aeolicus VF5 complete
           genome.
          Length = 585

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 47/160 (29%), Positives = 79/160 (49%), Gaps = 1/160 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  +L   GV+ +FG+ G  +  + +    LG I+ I   +EQ            TG+ 
Sbjct: 9   IVIETLKAEGVEVVFGLPGGAIMEVYDALYRLGGIKHILARHEQGAGHMAEGYAKATGKV 68

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G+++  SGPG  + +  +++A +++ PLV I+G       G   FQE+D +   +P +K 
Sbjct: 69  GVVMVTSGPGATNLVTPIADAYMDSVPLVAITGQVPTHLIGNDAFQEVDIVGITRPITKH 128

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ 814
           +     I ++P  + E    A  GRPG   +DLP DV  Q
Sbjct: 129 NFLVKSIEELPLILREAFYIARTGRPGPVLVDLPKDVTQQ 168



>gb:BX251411_764760 Tropheryma whipplei TW08/27, complete genome;
           segment 2/3.
          Length = 581

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 45/163 (27%), Positives = 74/163 (45%)
 Frame = +2

Query: 314 MADVDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXX 493
           M  +     V  SL   G+D +FG+ G  +  + N   +  IR I   +EQ         
Sbjct: 1   MVRISGAQAVIKSLEELGIDLVFGIPGGAILEVYNSLFSSSIRHILVRHEQGAGHAAEGY 60

Query: 494 XXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEA 673
              +GR G+ L  SGPG  + +  +++A +++ P++ I+G       G   FQE D I  
Sbjct: 61  ACSSGRLGVCLATSGPGATNLVTAIADAYMDSVPILAITGQVYSHLLGSDAFQESDIIGI 120

Query: 674 VKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSD 802
             P +K +      +++PA +F     A  GRPG   +D+  D
Sbjct: 121 TMPITKHAFSVKRATEIPAAIFAGAKIATTGRPGPVLIDITKD 163



>gb:AY596297_631844 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 585

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 50/166 (30%), Positives = 77/166 (46%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           V  +L  A  D +FGV G  +  + +      I  +   +EQ           +TG PG+
Sbjct: 30  VIRALENAETDYVFGVQGGAIMPVYDALYDSDINHVTMAHEQGASHAADAYGVVTGDPGV 89

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
               SGPG  + + G+++A +++ P++ ++G    +  G   FQE D +   +P +K S 
Sbjct: 90  CFATSGPGATNLVTGIADANMDSDPVIALTGQVPTEFVGNDAFQETDTVGITQPITKESY 149

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEAE 838
            A D   V   V E    A AGR G   +DLP DV   T  E+E E
Sbjct: 150 FAADSDTVGDDVSEAFALADAGRQGPTLVDLPKDV---TQGETEVE 192



>gb:AF279106_495032 Uncultured marine gamma proteobacterium
           EBAC31A08 BAC sequence.
          Length = 570

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 45/157 (28%), Positives = 74/157 (47%), Gaps = 1/157 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           ++  +L   GV+ +FG  G     + +       I  I   +EQ            TG+P
Sbjct: 1   MLMQALHDEGVELIFGYPGGAALHIYDAIFRQDKIDHILVRHEQGATHAADGYSRATGKP 60

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G++ A +++ P+V+ISG       G   FQE D I   +P  K 
Sbjct: 61  GVVLVTSGPGATNAITGIATAFMDSIPMVVISGQVASHLIGTDAFQETDMIGVSRPIVKH 120

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           S    +  ++P  + E    A +GRPG   +D+P D+
Sbjct: 121 SYTVFNAEEIPKIIKEAFYVATSGRPGPVVIDIPKDM 157



>gb:AE010347_262163 Methanopyrus kandleri AV19 section 46 of 157 of
           the complete genome.>gb:AE009439_902944 Methanopyrus
           kandleri AV19, complete genome.
          Length = 565

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 45/166 (27%), Positives = 80/166 (48%), Gaps = 2/166 (1%)
 Frame = +2

Query: 314 MADVDTNMLVAMS-LARAGVDRMFGVVGIPVTSLANRAV-ALGIRFIAFHNEQXXXXXXX 487
           M+++ T   V +  L   GV+ +FG  G  V  + +     + I  I   +EQ       
Sbjct: 1   MSELPTGARVLVECLKEEGVEHIFGYPGGAVLPIYDEIYDEVSIEHILVRHEQGAAHAAD 60

Query: 488 XXXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQI 667
               + G+PG+ +  SGPG  + + G++ A +++ P++ I+G       G+  FQE+D +
Sbjct: 61  GYARVKGKPGVCMATSGPGATNLVTGIATAYMDSSPVIAITGQVPTTMIGKDAFQEVDAV 120

Query: 668 EAVKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
               P +K + +     ++P  V E    A  GRPG  ++D+P DV
Sbjct: 121 GVFMPITKHNYQIGKPEEIPEVVKEAFKIAITGRPGPVHIDVPKDV 166



>pir|T44762|T44762 probable TPP-requiring enzyme [imported] -
           Mycobacterium leprae>gb:MLCB1788_144680 Mycobacterium
           leprae cosmid B1788.>gb:MLEPRTN8_147887 Mycobacterium
           leprae strain TN complete genome; segment 8/10.
          Length = 548

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 46/164 (28%), Positives = 75/164 (45%)
 Frame = +2

Query: 311 LMADVDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXX 490
           L   +    LV   L  +GVD +F + G  + S+ +   +  IR I   +EQ        
Sbjct: 7   LTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIRLIDTRHEQTAAFAAEG 66

Query: 491 XXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIE 670
              +T +PG+ +  +GPG  +G++ ++ A  N  PLV++ G      +G G  QE+D + 
Sbjct: 67  WSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQSPLVVLGGRAPALRWGMGSLQEIDHVP 126

Query: 671 AVKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSD 802
            V P ++F+A A         V E L  A     G  ++D P D
Sbjct: 127 FVAPLARFAATAQSADAAGRLVDEALQAAVVAPSGVGFVDFPMD 170



>sp|Q9RQ65|ILVI_BUCSC Acetolactate synthase large subunit (EC
           2.2.1.6) (AHAS) (Acetohydroxy- acid synthase large
           subunit) (ALS).>gb:AF129502_481678 Buchnera aphidicola
           natural-host Schlechtendalia chinensis acetohydroxy acid
           synthase large subunit (ilvI) and acetohydroxy acid
           synthase small subunit (ilvH) genes, complete cds; and
           unknown genes.
          Length = 574

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 46/159 (28%), Positives = 75/159 (47%), Gaps = 1/159 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           ++  SL   G+  +FG  G  V  + +   +   I+ I   +EQ            TG+ 
Sbjct: 9   MIIQSLIDQGIKYIFGYPGGAVLDIYDSLKSTKKIKHILVRHEQGATHMADGYARATGKI 68

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G++ A +++ P+V+ISG       G   FQE D I   +P  K 
Sbjct: 69  GVVLVTSGPGATNSITGIATAYMDSIPIVVISGQVSSSLIGYDAFQECDMIGISRPIVKH 128

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLH 811
           S        +P    +    A++GRPG   +DLP D+L+
Sbjct: 129 SFLVKKTEDIPITFKKAFWLASSGRPGPIVIDLPKDILN 167



>sp|Q04524|ILVB_KLETE Acetolactate synthase, catabolic (EC 2.2.1.6)
           (ALS).>pir|D47069|D47069 alpha-acetolactate synthase -
           Klebsiella terrigena>gb:KPNBUDOPRN_139394 Klebsiella
           terrigena budABC operon, including alpha-acetolactate
           decarboxylase (budA), alpha-acetolactate synthase
           (budB), and acetoin(diacetyl)reductase (budC) genes,
           complete coding regions.
          Length = 559

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 42/164 (25%), Positives = 74/164 (45%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           L+   L   GV ++FG+ G  +  + +  +   IR I   +E            +TG+ G
Sbjct: 16  LIVSQLEAQGVRQVFGIPGAKIDKVFDSLLDSSIRIIPVRHEANAAFMAAAVGRITGKAG 75

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + L  SGPGC + + G++ A     P+V + G+  + D  +   Q +D +    P +K++
Sbjct: 76  VALVTSGPGCSNLITGMATANSEGDPVVALGGAVKRADKAKLVHQSMDTVAMFSPVTKYA 135

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSES 829
            + T    +   V      A  GRPG  ++ LP D++    S S
Sbjct: 136 VEVTASDALAEVVSNAFRAAEQGRPGSAFVSLPQDIVDGPASGS 179



>gb:BC068362_2555050 Danio rerio ilvB (bacterial acetolactate
           synthase)-like, mRNA (cDNA clone MGC:85697
           IMAGE:6962500), complete cds.
          Length = 621

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 45/157 (28%), Positives = 74/157 (47%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           VA  L   GV  +F +VG  ++ +      LGIR +   +E            L+G  G+
Sbjct: 47  VAEVLRSHGVKFVFTLVGGHISPILVACEKLGIRIVDTRHEATAVFAADAVARLSGTVGV 106

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
               +GPG  + +  + NA +   PL++I G+      GRG  Q++DQ+   KP  KF A
Sbjct: 107 AAVTAGPGLTNTVTAVKNAQMAESPLLLIGGAAATLLQGRGALQDIDQMSLFKPLCKFCA 166

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLH 811
               + ++   V + L  A +G PG  +++ P D L+
Sbjct: 167 SVRTVREIVPTVRKALAIAQSGTPGPVFIEFPIDTLY 203



>gb:BC057527_2552154 Danio rerio ilvB (bacterial acetolactate
           synthase)-like, mRNA (cDNA clone MGC:66376
           IMAGE:5612706), complete cds.
          Length = 346

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 45/157 (28%), Positives = 74/157 (47%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           VA  L   GV  +F +VG  ++ +      LGIR +   +E            L+G  G+
Sbjct: 47  VAEVLRSHGVKFVFTLVGGHISPILVACEKLGIRIVDTRHEATAVFAADAVARLSGTVGV 106

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
               +GPG  + +  + NA +   PL++I G+      GRG  Q++DQ+   KP  KF A
Sbjct: 107 AAVTAGPGLTNTVTAVKNAQMAESPLLLIGGAAATLLQGRGALQDIDQMSLFKPLCKFCA 166

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLH 811
               + ++   V + L  A +G PG  +++ P D L+
Sbjct: 167 SVRTVREIVPTVRKALAIAQSGTPGPVFIEFPIDTLY 203



>gb:RRA344994_1703956 Raphanus raphanistrum partial als gene for
           putative acetolactate synthase, specimen voucher
           161855R0.
          Length = 585

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 46/162 (28%), Positives = 80/162 (49%), Gaps = 3/162 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVG---IPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTG 508
           ++  +L R GV+ +F   G   + +     R+    IR +   +EQ            +G
Sbjct: 17  ILVEALERQGVETVFAYPGGASMEIHQALTRSST--IRNVLPRHEQGGVFAAEGYARSSG 74

Query: 509 RPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFS 688
           +PGI +  SGPG  + ++GL++A +++ PLV I+G   ++  G   FQE   +E  +  +
Sbjct: 75  KPGICIATSGPGATNLVSGLADAMLDSVPLVAITGQVXRRMIGTDAFQETPIVEVTRSIT 134

Query: 689 KFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ 814
           K +    D+  +P  V E    A +GRPG   +D+P D+  Q
Sbjct: 135 KHNYLVMDVDDIPRIVQEAFFLATSGRPGPVLVDVPKDIQQQ 176



>gb:RRA344993_1703955 Raphanus raphanistrum partial als gene for
           putative acetolactate synthase, specimen voucher
           161829R1.
          Length = 585

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 46/162 (28%), Positives = 80/162 (49%), Gaps = 3/162 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVG---IPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTG 508
           ++  +L R GV+ +F   G   + +     R+    IR +   +EQ            +G
Sbjct: 17  ILVEALERQGVETVFAYPGGASMEIHQALTRSST--IRNVLPRHEQGGVFAAEGYARSSG 74

Query: 509 RPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFS 688
           +PGI +  SGPG  + ++GL++A +++ PLV I+G   ++  G   FQE   +E  +  +
Sbjct: 75  KPGICIATSGPGATNLVSGLADAMLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSIT 134

Query: 689 KFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ 814
           K +    D+  +P  V E    A +GRPG   +D+P D+  Q
Sbjct: 135 KHNYLVMDVDDIPRIVQEAFFLATSGRPGPVLVDVPKDIQQQ 176



>gb:RRA344989_1703951 Raphanus raphanistrum partial als gene for
           putative acetolactate synthase, specimen voucher
           161654R1.
          Length = 585

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 46/162 (28%), Positives = 80/162 (49%), Gaps = 3/162 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVG---IPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTG 508
           ++  +L R GV+ +F   G   + +     R+    IR +   +EQ            +G
Sbjct: 17  ILVEALERQGVETVFAYPGGASMEIHQALTRSST--IRNVLPRHEQGGVFAAEGYARSSG 74

Query: 509 RPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFS 688
           +PGI +  SGPG  + ++GL++A +++ PLV I+G   ++  G   FQE   +E  +  +
Sbjct: 75  KPGICIATSGPGATNLVSGLADAMLDSVPLVAITGQVXRRMIGTDAFQETPIVEVTRSIT 134

Query: 689 KFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ 814
           K +    D+  +P  V E    A +GRPG   +D+P D+  Q
Sbjct: 135 KHNYLVMDVDDIPRIVQEAFFLATSGRPGPVLVDVPKDIQQQ 176



>gb:RRA344988_1703950 Raphanus raphanistrum partial als gene for
           putative acetolactate synthase, specimen voucher
           161654R0.
          Length = 585

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 46/162 (28%), Positives = 80/162 (49%), Gaps = 3/162 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVG---IPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTG 508
           ++  +L R GV+ +F   G   + +     R+    IR +   +EQ            +G
Sbjct: 17  ILVEALERQGVETVFAYPGGASMEIHQALTRSST--IRNVLPRHEQGGVFAAEGYARSSG 74

Query: 509 RPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFS 688
           +PGI +  SGPG  + ++GL++A +++ PLV I+G   ++  G   FQE   +E  +  +
Sbjct: 75  KPGICIATSGPGATNLVSGLADAMLDSVPLVAITGQVXRRMIGTDAFQETPIVEVTRSIT 134

Query: 689 KFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ 814
           K +    D+  +P  V E    A +GRPG   +D+P D+  Q
Sbjct: 135 KHNYLVMDVDDIPRIVQEAFFLATSGRPGPVLVDVPKDIQQQ 176



>gb:RRA344987_1703949 Raphanus raphanistrum partial als gene for
           putative acetolactate synthase, specimen voucher
           161789S2.
          Length = 585

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 46/162 (28%), Positives = 80/162 (49%), Gaps = 3/162 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVG---IPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTG 508
           ++  +L R GV+ +F   G   + +     R+    IR +   +EQ            +G
Sbjct: 17  ILVEALERQGVETVFAYPGGASMEIHQALTRSST--IRNVLPRHEQGGVFAAEGYARSSG 74

Query: 509 RPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFS 688
           +PGI +  SGPG  + ++GL++A +++ PLV I+G   ++  G   FQE   +E  +  +
Sbjct: 75  KPGICIATSGPGATNLVSGLADAMLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSIT 134

Query: 689 KFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ 814
           K +    D+  +P  V E    A +GRPG   +D+P D+  Q
Sbjct: 135 KHNYLVMDVDDIPRIVQEAFFLATSGRPGPVLVDVPKDIQQQ 176



>gb:RRA344986_1703948 Raphanus raphanistrum partial als gene for
           putative acetolactate synthase, specimen voucher
           161789S1.
          Length = 585

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 46/162 (28%), Positives = 80/162 (49%), Gaps = 3/162 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVG---IPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTG 508
           ++  +L R GV+ +F   G   + +     R+    IR +   +EQ            +G
Sbjct: 17  ILVEALERQGVETVFAYPGGASMEIHQALTRSST--IRNVLPRHEQGGVFAAEGYARSSG 74

Query: 509 RPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFS 688
           +PGI +  SGPG  + ++GL++A +++ PLV I+G   ++  G   FQE   +E  +  +
Sbjct: 75  KPGICIATSGPGATNLVSGLADAMLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSIT 134

Query: 689 KFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ 814
           K +    D+  +P  V E    A +GRPG   +D+P D+  Q
Sbjct: 135 KHNYLVMDVDDIPRIVQEAFFLATSGRPGPVLVDVPKDIQQQ 176



>gb:AY124092_1580107 Arabidopsis thaliana acetolactate synthase
           (CSR1) gene, complete cds.
          Length = 670

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 44/160 (27%), Positives = 78/160 (48%), Gaps = 1/160 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAV-ALGIRFIAFHNEQXXXXXXXXXXXLTGRP 514
           ++  +L R GV+ +F   G     +      +  IR +   +EQ            +G+P
Sbjct: 102 ILVEALERQGVETVFAYPGGASMEIHQALTRSSSIRNVLPRHEQGGVFAAEGYARSSGKP 161

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           GI +  SGPG  + ++GL++A +++ PLV I+G   ++  G   FQE   +E  +  +K 
Sbjct: 162 GICIATSGPGATNLVSGLADALLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITKH 221

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ 814
           +    D+  +P  + E    A +GRPG   +D+P D+  Q
Sbjct: 222 NYLVMDVEDIPRIIEEAFFLATSGRPGPVLVDVPKDIQQQ 261



>gb:AY042819_1560884 Arabidopsis thaliana acetolactate synthase
           (T8P19.70) mRNA, complete cds.
          Length = 670

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 44/160 (27%), Positives = 78/160 (48%), Gaps = 1/160 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAV-ALGIRFIAFHNEQXXXXXXXXXXXLTGRP 514
           ++  +L R GV+ +F   G     +      +  IR +   +EQ            +G+P
Sbjct: 102 ILVEALERQGVETVFAYPGGASMEIHQALTRSSSIRNVLPRHEQGGVFAAEGYARSSGKP 161

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           GI +  SGPG  + ++GL++A +++ PLV I+G   ++  G   FQE   +E  +  +K 
Sbjct: 162 GICIATSGPGATNLVSGLADALLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITKH 221

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ 814
           +    D+  +P  + E    A +GRPG   +D+P D+  Q
Sbjct: 222 NYLVMDVEDIPRIIEEAFFLATSGRPGPVLVDVPKDIQQQ 261



>gb:CQ814638_1453499 Sequence 4 from Patent WO2004040012.
          Length = 652

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 46/162 (28%), Positives = 80/162 (49%), Gaps = 3/162 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVG---IPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTG 508
           ++  +L R GV+ +F   G   + +     R+    IR +   +EQ            +G
Sbjct: 84  ILVEALERQGVETVFAYPGGASMEIHQALTRSST--IRNVLPRHEQGGVFAAEGYARSSG 141

Query: 509 RPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFS 688
           +PGI +  SGPG  + ++GL++A +++ PLV I+G   ++  G   FQE   +E  +  +
Sbjct: 142 KPGICIATSGPGATNLVSGLADAMLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSIT 201

Query: 689 KFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ 814
           K +    D+  +P  V E    A +GRPG   +D+P D+  Q
Sbjct: 202 KHNYLVMDVDDIPRIVQEAFFLATSGRPGPVLVDVPKDIQQQ 243



>gb:CQ814636_1453497 Sequence 2 from Patent WO2004040012.
          Length = 652

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 46/162 (28%), Positives = 80/162 (49%), Gaps = 3/162 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVG---IPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTG 508
           ++  +L R GV+ +F   G   + +     R+    IR +   +EQ            +G
Sbjct: 84  ILVEALERQGVETVFAYPGGASMEIHQALTRSST--IRNVLPRHEQGGVFAAEGYARSSG 141

Query: 509 RPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFS 688
           +PGI +  SGPG  + ++GL++A +++ PLV I+G   ++  G   FQE   +E  +  +
Sbjct: 142 KPGICIATSGPGATNLVSGLADAMLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSIT 201

Query: 689 KFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ 814
           K +    D+  +P  V E    A +GRPG   +D+P D+  Q
Sbjct: 202 KHNYLVMDVDDIPRIVQEAFFLATSGRPGPVLVDVPKDIQQQ 243



>gb:CQ814635_1453496 Sequence 1 from Patent WO2004040012.
          Length = 655

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 46/162 (28%), Positives = 80/162 (49%), Gaps = 3/162 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVG---IPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTG 508
           ++  +L R GV+ +F   G   + +     R+    IR +   +EQ            +G
Sbjct: 87  ILVEALERQGVETVFAYPGGASMEIHQALTRSST--IRNVLPRHEQGGVFAAEGYARSSG 144

Query: 509 RPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFS 688
           +PGI +  SGPG  + ++GL++A +++ PLV I+G   ++  G   FQE   +E  +  +
Sbjct: 145 KPGICIATSGPGATNLVSGLADAMLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSIT 204

Query: 689 KFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ 814
           K +    D+  +P  V E    A +GRPG   +D+P D+  Q
Sbjct: 205 KHNYLVMDVDDIPRIVQEAFFLATSGRPGPVLVDVPKDIQQQ 246



>gb:CQ766590_1451736 Sequence 1 from Patent
           WO2004005516.>gb:CQ871364_1454696 Sequence 16 from
           Patent WO2004078983.>gb:AX683004_1473069 Sequence 7 from
           Patent WO03006660.>gb:AX695992_1473186 Sequence 4 from
           Patent WO03008596.>gb:ATCSR12_1548025 Arabidopsis
           thaliana Csr 1.2 gene for acetolactate synthase (EC
           4.1.3.18).
          Length = 670

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 44/160 (27%), Positives = 78/160 (48%), Gaps = 1/160 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAV-ALGIRFIAFHNEQXXXXXXXXXXXLTGRP 514
           ++  +L R GV+ +F   G     +      +  IR +   +EQ            +G+P
Sbjct: 102 ILVEALERQGVETVFAYPGGASMEIHQALTRSSSIRNVLPRHEQGGVFAAEGYARSSGKP 161

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           GI +  SGPG  + ++GL++A +++ PLV I+G   ++  G   FQE   +E  +  +K 
Sbjct: 162 GICIATSGPGATNLVSGLADALLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITKH 221

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ 814
           +    D+  +P  + E    A +GRPG   +D+P D+  Q
Sbjct: 222 NYLVMDVEDIPRIIEEAFFLATSGRPGPVLVDVPKDIQQQ 261



>gb:AE016827_342948 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 574

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 48/159 (30%), Positives = 72/159 (45%), Gaps = 1/159 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  SL   GV  +FG  G  V  + +    LG I  +   +EQ            TG  
Sbjct: 11  MVVQSLRDQGVKYLFGYPGGSVLDIYDAIHTLGGIEHVLVRHEQAAVHMADGYARSTGEV 70

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G +L  SGPG  + + G+  A  ++ PLV+I+G       G   FQE D I   +P  K 
Sbjct: 71  GCVLVTSGPGSTNAVTGILTAYTDSVPLVIITGQVRSNLIGTDAFQECDTIGLTRPVVKH 130

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLH 811
           S        +P  + +    A++GRPG   +D+P DV++
Sbjct: 131 SFMVKHAEDIPETIKKAFYIASSGRPGPVVIDIPKDVVN 169



>gb:AE006200_216516 Pasteurella multocida subsp. multocida str. Pm70
           section 167 of 204 of the complete
           genome.>gb:AE004439_1119246 Pasteurella multocida subsp.
           multocida str. Pm70, complete genome.
          Length = 549

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 45/156 (28%), Positives = 73/156 (46%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           LV  SL   GV  +FG  G  +  + +     GI  +   NEQ            +G+ G
Sbjct: 6   LVTESLKTHGVTTVFGYPGGAIMPVYDALYDAGIEHLLCRNEQGAAMAAIGYARSSGKVG 65

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + +  SGPG  + + GL +A +++ P+V I+G       G   FQE D +      +K S
Sbjct: 66  VCIATSGPGAANLITGLGDALMDSIPVVAITGQVASPLIGTDAFQEADVLGLSLACTKHS 125

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
                I ++P  + +  + AA+GRPG   +D+P D+
Sbjct: 126 FLVQSIEELPDVIAKAFEIAASGRPGPVLIDIPKDI 161



>gb:SME591789_186132 Sinorhizobium meliloti 1021 complete
           chromosome; segment 8/12.
          Length = 592

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 48/161 (29%), Positives = 76/161 (47%), Gaps = 1/161 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVAL-GIRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  +L   GV+ +FG  G  V  + +       I+ I   +EQ            TG+ 
Sbjct: 13  IVLQALKDNGVEHIFGYPGGAVLPIYDEIFQQEDIQHILVRHEQGAGHMAEGYARSTGKV 72

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + +  L +A +++ PLV ISG       G   FQE D I   +P +K 
Sbjct: 73  GVMLVTSGPGATNAVTPLQDALMDSIPLVCISGQVPTSLIGSDAFQECDTIGITRPCTKH 132

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQT 817
           +    D++++   + E    A +GRPG   +D+P DV   T
Sbjct: 133 NWLVRDVNELARVIHEAFRVAQSGRPGPVVVDIPKDVQFAT 173



>pir|S15004|S15004 acetolactate synthase (EC 4.1.3.18) 2 precursor -
           rape>gb:BNAALS2_1633378 B.napa acetolactate synthase
           mRNA, complete cds.
          Length = 599

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 46/162 (28%), Positives = 80/162 (49%), Gaps = 3/162 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVG---IPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTG 508
           ++  +L R GV+ +F   G   + +     R+    IR +   +EQ            +G
Sbjct: 31  ILVEALERQGVETVFAYPGGASMEIHQALTRSST--IRNVLPRHEQGGVFAAEGYARSSG 88

Query: 509 RPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFS 688
           +PGI +  SGPG  + ++GL++A +++ PLV I+G   ++  G   FQE   +E  +  +
Sbjct: 89  KPGICIATSGPGATNLVSGLADAMLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSIT 148

Query: 689 KFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ 814
           K +    D+  +P  V E    A +GRPG   +D+P D+  Q
Sbjct: 149 KHNYLVMDVDDIPRIVQEAFFLATSGRPGPVLVDVPKDIQQQ 190



>pir|E97604|E97604 acetolactate synthase (EC 4.1.3.18) [imported] -
           Agrobacterium tumefaciens (strain C58,
           Cereon)>gb:AE008120_233730 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 178 of 254 of the
           complete sequence.>gb:AE007869_1083399 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 618

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 53/196 (27%), Positives = 84/196 (42%), Gaps = 10/196 (5%)
 Frame = +2

Query: 260 SNPSGSESSVVVHFRDNLMADVDTNM---------LVAMSLARAGVDRMFGVVGIPVTSL 412
           + PSGS  S         M D D            +V  +L   GV+ +FG  G  V  +
Sbjct: 4   NRPSGSSISKAKAGWKQAMTDKDNTENSNRMTGAEIVLQALKDNGVEHIFGYPGGAVLPI 63

Query: 413 ANRAVAL-GIRFIAFHNEQXXXXXXXXXXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNT 589
            +       I+ I   +EQ            TG+ G++L  SGPG  + +  L +A +++
Sbjct: 64  YDEIFQQEDIQHILVRHEQGAGHAAEGYARSTGKVGVMLVTSGPGATNAVTPLQDALMDS 123

Query: 590 WPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKATDISKVPACVFEVLDWAAAGR 769
            PLV +SG       G   FQE D +   +P +K +    D++++   + E    A  GR
Sbjct: 124 IPLVCLSGQVPTSLIGSDAFQECDTVGITRPCTKHNWLVKDVNELAGIIHEAFRIAQTGR 183

Query: 770 PGGCYLDLPSDVLHQT 817
           PG   +D+P D+   T
Sbjct: 184 PGPVVVDIPKDIQFAT 199



>sp|Q50613|ILVG_MYCTU Probable acetolactate synthase (EC 2.2.1.6)
           (Acetohydroxy-acid synthase) (ALS).>pir|E70720|E70720
           probable ilvG protein - Mycobacterium tuberculosis
           (strain H37RV)>gb:AE000516_21914 Mycobacterium
           tuberculosis CDC1551, complete
           genome.>gb:BX248340_759208 Mycobacterium bovis subsp.
           bovis AF2122/97 complete genome; segment
           7/14.>gb:BX842577_819892 Mycobacterium tuberculosis
           H37Rv complete genome; segment 6/13.
          Length = 547

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 44/155 (28%), Positives = 73/155 (47%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           L+A  L  +G+D +F + G  + S+ +     GIR I   +EQ           +T  PG
Sbjct: 16  LIARRLKASGIDTVFTLSGGHLFSIYDGCREEGIRLIDTRHEQTAAFAAEGWSKVTRVPG 75

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           +    +GPG  +G++ ++ A  N  PLV++ G      +G G  QE+D +  V P ++F+
Sbjct: 76  VAALTAGPGITNGMSAMAAAQQNQSPLVVLGGRAPALRWGMGSLQEIDHVPFVAPVARFA 135

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSD 802
           A A         V + L  A +   G  ++D P D
Sbjct: 136 ATAQSAENAGLLVDQALQAAVSAPSGVAFVDFPMD 170



>sp|P17597|ILVB_ARATH Acetolactate synthase, chloroplast precursor
           (EC 2.2.1.6) (Acetohydroxy-acid synthase)
           (ALS).>pir|S09502|YCMU acetolactate synthase (EC
           4.1.3.18) precursor - Arabidopsis
           thaliana>gb:ATT8P19_1556531 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T8P19.>gb:BT020540_1642934
           Arabidopsis thaliana At3g48560 gene, complete cds.
          Length = 670

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 44/160 (27%), Positives = 78/160 (48%), Gaps = 1/160 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAV-ALGIRFIAFHNEQXXXXXXXXXXXLTGRP 514
           ++  +L R GV+ +F   G     +      +  IR +   +EQ            +G+P
Sbjct: 102 ILVEALERQGVETVFAYPGGASMEIHQALTRSSSIRNVLPRHEQGGVFAAEGYARSSGKP 161

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           GI +  SGPG  + ++GL++A +++ PLV I+G   ++  G   FQE   +E  +  +K 
Sbjct: 162 GICIATSGPGATNLVSGLADALLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITKH 221

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ 814
           +    D+  +P  + E    A +GRPG   +D+P D+  Q
Sbjct: 222 NYLVMDVEDIPRIIEEAFFLATSGRPGPVLVDVPKDIQQQ 261



>sp|P27819|ILV3_BRANA Acetolactate synthase III, chloroplast
           precursor (EC 2.2.1.6) (Acetohydroxy-acid synthase III)
           (ALS III).>pir|S29838|S29838 acetolactate synthase (EC
           4.1.3.18) 3 precursor - rape>gb:BNAHSYIII_1633442
           B.napus gene for acetohydroxyacid synthase III.
          Length = 652

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 46/162 (28%), Positives = 80/162 (49%), Gaps = 3/162 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVG---IPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTG 508
           ++  +L R GV+ +F   G   + +     R+    IR +   +EQ            +G
Sbjct: 84  ILVEALERQGVETVFAYPGGASMEIHQALTRSST--IRNVLPRHEQGGVFAAEGYARSSG 141

Query: 509 RPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFS 688
           +PGI +  SGPG  + ++GL++A +++ PLV I+G   ++  G   FQE   +E  +  +
Sbjct: 142 KPGICIATSGPGATNLVSGLADAMLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSIT 201

Query: 689 KFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ 814
           K +    D+  +P  V E    A +GRPG   +D+P D+  Q
Sbjct: 202 KHNYLVMDVDDIPRIVQEAFFLATSGRPGPVLVDVPKDIQQQ 243



>sp|P27818|ILV1_BRANA Acetolactate synthase I, chloroplast precursor
           (EC 2.2.1.6) (Acetohydroxy-acid synthase I) (ALS
           I).>pir|S17691|S17691 acetolactate synthase (EC
           4.1.3.18) 1 precursor - rape>gb:CQ814637_1453498
           Sequence 3 from Patent WO2004040012.>gb:BNAHSYI_1633440
           B.napus gene for actohydroxyacid synthase I.
          Length = 655

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 46/162 (28%), Positives = 80/162 (49%), Gaps = 3/162 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVG---IPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTG 508
           ++  +L R GV+ +F   G   + +     R+    IR +   +EQ            +G
Sbjct: 87  ILVEALERQGVETVFAYPGGASMEIHQALTRSST--IRNVLPRHEQGGVFAAEGYARSSG 144

Query: 509 RPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFS 688
           +PGI +  SGPG  + ++GL++A +++ PLV I+G   ++  G   FQE   +E  +  +
Sbjct: 145 KPGICIATSGPGATNLVSGLADAMLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSIT 204

Query: 689 KFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ 814
           K +    D+  +P  V E    A +GRPG   +D+P D+  Q
Sbjct: 205 KHNYLVMDVDDIPRIVQEAFFLATSGRPGPVLVDVPKDIQQQ 246



>gb:RRA344992_1703954 Raphanus raphanistrum partial als gene for
           putative acetolactate synthase, specimen voucher
           161829R0.
          Length = 585

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 46/162 (28%), Positives = 80/162 (49%), Gaps = 3/162 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVG---IPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTG 508
           ++  +L R GV+ +F   G   + +     R+    IR +   +EQ            +G
Sbjct: 17  ILVEALERQGVETVFAYPGGASMEIHQALTRSST--IRNVLPRHEQGGVFAAEGYARSSG 74

Query: 509 RPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFS 688
           +PGI +  SGPG  + ++GL++A +++ PLV I+G   ++  G   FQE   +E  +  +
Sbjct: 75  KPGICIATSGPGATNLVSGLADAMLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSIT 134

Query: 689 KFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ 814
           K +    D+  +P  V E    A +GRPG   +D+P D+  Q
Sbjct: 135 KHNYLVMDVDDIPRIVQEAFFLATSGRPGPVLVDVPKDIQXQ 176



>gb:AX537397_1470008 Sequence 11 from Patent
           WO02072855.>gb:AX546236_1470145 Sequence 11 from Patent
           WO02072854.>gb:AX743063_1473971 Sequence 7 from Patent
           WO03029476.
          Length = 548

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 42/155 (27%), Positives = 75/155 (48%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           V  +L   GV+ +FG  G  +  + +     G+  +   +EQ            TG+ G+
Sbjct: 7   VVHALRAQGVNTVFGYPGGAIMPVYDALYDGGVEHLLCRHEQGAAMAAIGYARATGKTGV 66

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
            +  SGPG  + + GL++A +++ P+V I+G       G   FQE+D +      +K S 
Sbjct: 67  CIATSGPGATNLITGLADALLDSIPVVAITGQVSAPFIGTDAFQEVDVLGLSLACTKHSF 126

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
               + ++P  + E  D A++GRPG   +D+P D+
Sbjct: 127 LVQSLEELPRIMAEAFDVASSGRPGPVLVDIPKDI 161



>gb:AE005674_73427 Shigella flexneri 2a str. 301, complete
           genome.>gb:AE016991_373364 Shigella flexneri 2a str.
           2457T section 14 of 16 of the complete
           genome.>gb:AE014073_998114 Shigella flexneri 2a str.
           2457T complete genome.
          Length = 548

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 42/155 (27%), Positives = 75/155 (48%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           V  +L   GV+ +FG  G  +  + +     G+  +   +EQ            TG+ G+
Sbjct: 7   VVHALRAQGVNTVFGYPGGAIMPVYDALYDGGVEHLLCRHEQGAAMAAIGYARATGKTGV 66

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
            +  SGPG  + + GL++A +++ P+V I+G       G   FQE+D +      +K S 
Sbjct: 67  CIATSGPGATNLITGLADALLDSIPVVAITGQVSAPFIGTDAFQEVDVLGLSLACTKHSF 126

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
               + ++P  + E  D A++GRPG   +D+P D+
Sbjct: 127 LVQSLEELPRIMAEAFDVASSGRPGPVLVDIPKDI 161



>pir|T35828|T35828 acetolactate synthase - Streptomyces
           coelicolor>gb:SCO939124_179183 Streptomyces coelicolor
           A3(2) complete genome; segment 21/29.
          Length = 613

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 43/161 (26%), Positives = 75/161 (46%), Gaps = 1/161 (0%)
 Frame = +2

Query: 350 SLARAGVDRMFGVVGIPVTSLANRAV-ALGIRFIAFHNEQXXXXXXXXXXXLTGRPGILL 526
           SL   G D +FG+ G  +    +  + +  +R +   +EQ            TG+ G+ +
Sbjct: 34  SLEEVGADTVFGIPGGTILPAYDPLMDSTRVRHVLVRHEQGAGHAATGYAQATGKVGVCM 93

Query: 527 TVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKA 706
             SGPG  + +  +++A +++ PLV I+G       G   FQE D +    P +K S   
Sbjct: 94  ATSGPGATNLVTPIADANLDSVPLVAITGQVVSSAIGTDAFQEADIVGITMPITKHSFLV 153

Query: 707 TDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSES 829
           T    +P  + +    A+ GRPG   +D+P D+L +  + S
Sbjct: 154 TKAEDIPRVIAQAFHIASTGRPGPVLVDIPKDILQKKTTFS 194



>pir|I40666|I40666 acetolactate synthase (EC 4.1.3.18) - Caulobacter
           crescentus>gb:CCRILVBN_845620 Caulobacter crescentus
           leader peptide, acetolactate synthase (ilvB), and
           acetohydroxy acid synthase (ilvN) genes, complete cds.
          Length = 601

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 43/157 (27%), Positives = 74/157 (47%), Gaps = 1/157 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAV-ALGIRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V   L   GV+ +FG  G  V  + +       ++ I   +EQ            +G+P
Sbjct: 25  IVVRGLVDQGVEVLFGYPGGAVLPIYDALFHEPRLQHILVRHEQGAAHAAEGYARSSGKP 84

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G+ +A +++ P+V+I+G       G   FQE D +   +  +K 
Sbjct: 85  GVVLVTSGPGATNAITGIMDALMDSIPMVVITGQVPTHLIGTDAFQEADTVGMTRSCTKH 144

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           +    D+  +P  + E    A  GRPG   +D+P DV
Sbjct: 145 NYLVKDVRDLPQIIHEAFKIATTGRPGPVLIDIPKDV 181



>pir|G86062|G86062 acetohydroxy acid synthase II [imported] -
           Escherichia coli  (strain O157:H7, substrain
           EDL933)>pir|F91216|F91216 acetolactate synthase II large
           subunit [imported] - Escherichia coli (strain O157:H7,
           substrain RIMD 0509952)>gb:AE005174_68962 Escherichia
           coli O157:H7 EDL933, complete genome.>gb:BA000007_662714
           Escherichia coli O157:H7 DNA, complete genome.
          Length = 548

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 42/155 (27%), Positives = 75/155 (48%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           V  +L   GV+ +FG  G  +  + +     G+  +   +EQ            TG+ G+
Sbjct: 7   VVHALRAQGVNTVFGYPGGAIMPVYDALYDGGVEHLLCRHEQGAAMAAIGYARATGKTGV 66

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
            +  SGPG  + + GL++A +++ P+V I+G       G   FQE+D +      +K S 
Sbjct: 67  CIATSGPGATNLITGLADALLDSIPVVAITGQVSAPFIGTDAFQEVDVLGLSLACTKHSF 126

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
               + ++P  + E  D A++GRPG   +D+P D+
Sbjct: 127 LVQSLEELPRIMAEAFDVASSGRPGPVLVDIPKDI 161



>pir|C87509|C87509 acetolactate synthase, large subunit [imported] -
           Caulobacter crescentus>gb:AE005883_213234 Caulobacter
           crescentus CB15 section 209 of 359 of the complete
           genome.>gb:AE005673_923133 Caulobacter crescentus CB15
           complete genome.
          Length = 582

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 43/157 (27%), Positives = 74/157 (47%), Gaps = 1/157 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAV-ALGIRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V   L   GV+ +FG  G  V  + +       ++ I   +EQ            +G+P
Sbjct: 6   IVVRGLVDQGVEVLFGYPGGAVLPIYDALFHEPRLQHILVRHEQGAAHAAEGYARSSGKP 65

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G+ +A +++ P+V+I+G       G   FQE D +   +  +K 
Sbjct: 66  GVVLVTSGPGATNAITGIMDALMDSIPMVVITGQVPTHLIGTDAFQEADTVGMTRSCTKH 125

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           +    D+  +P  + E    A  GRPG   +D+P DV
Sbjct: 126 NYLVKDVRDLPQIIHEAFKIATTGRPGPVLIDIPKDV 162



>pir|C97348|C97348 acetolactate synthase [imported] - Clostridium
           acetobutylicum>gb:AE007860_230935 Clostridium
           acetobutylicum ATCC 824 section 348 of 356 of the
           complete genome.>gb:AF047822_473005 Clostridium
           acetobutylicum catabolic acetolactate synthase (alsS)
           gene, complete cds.>gb:AE001437_1093890 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 563

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 45/168 (26%), Positives = 76/168 (45%)
 Frame = +2

Query: 317 ADVDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXX 496
           + ++T  LV   L    V+ +FG+ G    +L        I+FI   +EQ          
Sbjct: 21  SSMNTAELVVKCLENENVEYIFGIPGEENLALIKALTKSPIKFITTRHEQGAAFMADVYG 80

Query: 497 XLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAV 676
            LTGRPG+ L+  GPG  + + G+++A ++  PL+ I+G            Q LD +   
Sbjct: 81  RLTGRPGVCLSTLGPGATNLMTGVADANLDGAPLIAITGQVGTDRMHIESHQHLDLVAMF 140

Query: 677 KPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTV 820
            P +K++ +       P  V +    A   +PG C++DLP ++    V
Sbjct: 141 APVTKWNKQIVRPDTAPEIVRKAFKTAVDEKPGACHIDLPQNIADMPV 188



>gb:BX640452_817616 Bordetella bronchiseptica strain RB50, complete
           genome; segment 16/16.
          Length = 616

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 51/174 (29%), Positives = 79/174 (45%), Gaps = 1/174 (0%)
 Frame = +2

Query: 317 ADVDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXX 493
           A V+   ++  +L   GVD +FG  G  V  L +   A   +R +   +EQ         
Sbjct: 23  AAVNGAKILLHTLIERGVDTVFGYPGGAVLPLYDALYAEPRLRHVLVRHEQAAVHAAEGY 82

Query: 494 XXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEA 673
              TGRPG++   SGPG  +  +GL +A  ++ P++ ISG       G   FQE D I  
Sbjct: 83  ARTTGRPGVVFVTSGPGMANTTSGLLDAMCDSVPVLCISGQVSTAAIGTDAFQECDAIGI 142

Query: 674 VKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEA 835
            +  +K++ +   +  V   V    D    GRPG   +D P D+  Q  S ++A
Sbjct: 143 SRSVTKWNTQIRAVQDVAEVVGRAFDLTRQGRPGPVLVDFPKDI--QLASPADA 194



>gb:BX640436_812612 Bordetella parapertussis strain 12822, complete
           genome; segment 14/14.
          Length = 616

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 51/174 (29%), Positives = 79/174 (45%), Gaps = 1/174 (0%)
 Frame = +2

Query: 317 ADVDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXX 493
           A V+   ++  +L   GVD +FG  G  V  L +   A   +R +   +EQ         
Sbjct: 23  AAVNGAKILLHTLIERGVDTVFGYPGGAVLPLYDALYAEPRLRHVLVRHEQAAVHAAEGY 82

Query: 494 XXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEA 673
              TGRPG++   SGPG  +  +GL +A  ++ P++ ISG       G   FQE D I  
Sbjct: 83  ARTTGRPGVVFVTSGPGMANTTSGLLDAMCDSVPVLCISGQVSTAAIGTDAFQECDAIGI 142

Query: 674 VKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEA 835
            +  +K++ +   +  V   V    D    GRPG   +D P D+  Q  S ++A
Sbjct: 143 SRSVTKWNTQIRAVQDVAEVVGRAFDLTRQGRPGPVLVDFPKDI--QLASPADA 194



>gb:BX640412_804910 Bordetella pertussis strain Tohama I, complete
           genome; segment 2/12.
          Length = 616

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 51/174 (29%), Positives = 79/174 (45%), Gaps = 1/174 (0%)
 Frame = +2

Query: 317 ADVDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXX 493
           A V+   ++  +L   GVD +FG  G  V  L +   A   +R +   +EQ         
Sbjct: 23  AAVNGAKILLHTLIERGVDTVFGYPGGAVLPLYDALYAEPRLRHVLVRHEQAAVHAAEGY 82

Query: 494 XXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEA 673
              TGRPG++   SGPG  +  +GL +A  ++ P++ ISG       G   FQE D I  
Sbjct: 83  ARTTGRPGVVFVTSGPGMANTTSGLLDAMCDSVPVLCISGQVSTAAIGTDAFQECDAIGI 142

Query: 674 VKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEA 835
            +  +K++ +   +  V   V    D    GRPG   +D P D+  Q  S ++A
Sbjct: 143 SRSVTKWNTQIRAVQDVAEVVGRAFDLTRQGRPGPVLVDFPKDI--QLASPADA 194



>gb:AE017282_428985 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 576

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 47/162 (29%), Positives = 74/162 (45%), Gaps = 1/162 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V   L   GV+ +FG  G  V  + +       ++ I   +EQ            TG+P
Sbjct: 8   IVVQCLKDEGVEYIFGYPGGAVLHIYDALFKQDDVKHILVRHEQGATHAADGYARSTGKP 67

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G++ A +++ PLV+I+G       G   FQE D +   +P  K 
Sbjct: 68  GVVLVTSGPGATNAVTGIATAYMDSIPLVVITGQVPLPVIGSDAFQEADIVGITRPCVKH 127

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTV 820
           +    DI K+     +    A  GRPG   +D+P DV    V
Sbjct: 128 NFLVKDIHKLAETFKKAFYIATTGRPGPVVIDIPKDVTDPNV 169



>gb:AE016850_348729 Tropheryma whipplei str. Twist, section 1 of 3
           of the complete genome.>gb:AE014184_1028925 Tropheryma
           whipplei str. Twist, complete genome.
          Length = 581

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 44/163 (26%), Positives = 74/163 (45%)
 Frame = +2

Query: 314 MADVDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXX 493
           M  +     V  SL   G+D +FG+ G  +  + N   +  IR I   +EQ         
Sbjct: 1   MVRISGAQAVIKSLEELGIDLVFGIPGGAILEVYNSLFSSSIRHILVRHEQGAGHAAEGY 60

Query: 494 XXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEA 673
              +G+ G+ L  SGPG  + +  +++A +++ P++ I+G       G   FQE D I  
Sbjct: 61  ACSSGKLGVCLATSGPGATNLVTAIADAYMDSVPILAITGQVYSHLLGSDAFQESDIIGI 120

Query: 674 VKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSD 802
             P +K +      +++PA +F     A  GRPG   +D+  D
Sbjct: 121 TMPITKHAFSVKRATEIPAAIFAGAKIATTGRPGPVLIDITKD 163



>gb:AE016769_328660 Escherichia coli CFT073 section 15 of 18 of the
           complete genome.>gb:AE014075_959244 Escherichia coli
           CFT073 complete genome.
          Length = 548

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 42/155 (27%), Positives = 75/155 (48%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           V  +L   GV+ +FG  G  +  + +     G+  +   +EQ            TG+ G+
Sbjct: 7   VVHALRAQGVNTVFGYPGGAIMPVYDALYDGGVEHLLCRHEQGAAMAAIGYARATGKTGV 66

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
            +  SGPG  + + GL++A +++ P+V I+G       G   FQE+D +      +K S 
Sbjct: 67  CIATSGPGATNLITGLADALLDSIPVVAITGQVSAPFIGTDAFQEVDILGLSLACTKHSF 126

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
               + ++P  + E  D A++GRPG   +D+P D+
Sbjct: 127 LVQSLEELPRIMAEAFDVASSGRPGPVLVDIPKDI 161



>gb:AE016749_323305 Staphylococcus epidermidis ATCC 12228, section 6
           of 9 of the complete genome.>gb:AE015929_1147974
           Staphylococcus epidermidis ATCC 12228, complete genome.
          Length = 583

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 43/158 (27%), Positives = 74/158 (46%)
 Frame = +2

Query: 332 NMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGR 511
           + L+  +L +  VD +FG  G  V  L +      I+ I   +EQ           ++G+
Sbjct: 32  SQLLVEALQQEDVDFIFGYPGGAVLPLYDTFYDGKIKHILARHEQGATHAAEGYARVSGK 91

Query: 512 PGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSK 691
            G+++  SGPG  + + G+++A  ++ PLV+ +G       G+  FQE D +    P +K
Sbjct: 92  TGVVVVTSGPGATNAITGITDAYSDSLPLVVFTGQVATPGIGKDAFQEADLLSMTTPITK 151

Query: 692 FSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
            + +   I  +P  V E    A  GR G   +D P D+
Sbjct: 152 HNYQVKKIEDIPRIVHEAFHLANTGRKGPVVIDFPKDM 189



>gb:AE013966_301930 Yersinia pestis KIM section 366 of 415 of the
           complete genome.>gb:AE017141_389371 Yersinia pestis
           biovar Medievalis str. 91001 section 15 of 16 of the
           complete genome.>gb:AE009952_932113 Yersinia pestis KIM
           complete genome.>gb:AE017042_1145937 Yersinia pestis
           biovar Medievalis str. 91001 complete genome.
          Length = 593

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 46/162 (28%), Positives = 74/162 (45%), Gaps = 1/162 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  SL   GV  +FG  G  V  + +    +G I  +   +EQ            TG  
Sbjct: 27  MVVRSLIDQGVKHVFGYPGGAVLDIYDALHTVGGIDHVLVRHEQGAVHMADGYARATGEV 86

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G++ A +++ P+V++SG       G   FQE D +   +P  K 
Sbjct: 87  GVVLVTSGPGATNAITGIATAYMDSVPMVVLSGQVPSSLIGFDAFQECDMVGISRPVVKH 146

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTV 820
           S        +P  + +    A+ GRPG   +DLP D++   V
Sbjct: 147 SFLVKRTEDIPMVLKKAFYLASTGRPGPVVIDLPKDIVGPAV 188



>gb:ECOUW85_131323 E. coli genomic sequence of the region from 84.5
           to 86.5 minutes.
          Length = 327

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 42/155 (27%), Positives = 74/155 (47%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           V  +L   GV+ +FG  G  +  + +     G+  +   +EQ            TG+ G+
Sbjct: 7   VVHALRAQGVNTVFGYPGGAIMPVYDALYDGGVEHLLCRHEQGAAMAAIGYARATGKTGV 66

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
            +  SGPG  + + GL++A +++ P+V I+G       G   FQE+D +      +K S 
Sbjct: 67  CIATSGPGATNLITGLADALLDSIPVVAITGQVSAPFIGTDAFQEVDVLGLSLACTKHSF 126

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
               + ++P  + E  D A +GRPG   +D+P D+
Sbjct: 127 LVQSLEELPRIMAEAFDVACSGRPGPVLVDIPKDI 161



>gb:ECORRNILV_130224 Escherichia coli acetolactate synthase II
           (ilvG) gene, 5' end; ribosomal protein (rrnC) gene,
           complete cds.
          Length = 402

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 42/155 (27%), Positives = 74/155 (47%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           V  +L   GV+ +FG  G  +  + +     G+  +   +EQ            TG+ G+
Sbjct: 7   VVHALRAQGVNTVFGYPGGAIMPVYDALYDGGVEHLLCRHEQGAAMAAIGYARATGKTGV 66

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
            +  SGPG  + + GL++A +++ P+V I+G       G   FQE+D +      +K S 
Sbjct: 67  CIATSGPGATNLITGLADALLDSIPVVAITGQVSAPFIGTDAFQEVDVLGLSLACTKHSF 126

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
               + ++P  + E  D A +GRPG   +D+P D+
Sbjct: 127 LVQSLEELPRIMAEAFDVACSGRPGPVLVDIPKDI 161



>gb:ECOILVGMED_129150 E.coli ilvGMEDA operon encoding biosynthesis
           of isoleucine and valine, complete cds.
          Length = 548

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 42/155 (27%), Positives = 74/155 (47%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           V  +L   GV+ +FG  G  +  + +     G+  +   +EQ            TG+ G+
Sbjct: 7   VVHALRAQGVNTVFGYPGGAIMPVYDALYDGGVEHLLCRHEQGAAMAAIGYARATGKTGV 66

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
            +  SGPG  + + GL++A +++ P+V I+G       G   FQE+D +      +K S 
Sbjct: 67  CIATSGPGATNLITGLADALLDSIPVVAITGQVSAPFIGTDAFQEVDVLGLSLACTKHSF 126

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
               + ++P  + E  D A +GRPG   +D+P D+
Sbjct: 127 LVQSLEELPRIMAEAFDVACSGRPGPVLVDIPKDI 161



>gb:CP000029_82259 Staphylococcus epidermidis RP62A, complete
           genome.
          Length = 567

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 43/158 (27%), Positives = 74/158 (46%)
 Frame = +2

Query: 332 NMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGR 511
           + L+  +L +  VD +FG  G  V  L +      I+ I   +EQ           ++G+
Sbjct: 16  SQLLVEALQQEDVDFIFGYPGGAVLPLYDTFYDGKIKHILARHEQGATHAAEGYARVSGK 75

Query: 512 PGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSK 691
            G+++  SGPG  + + G+++A  ++ PLV+ +G       G+  FQE D +    P +K
Sbjct: 76  TGVVVVTSGPGATNAITGITDAYSDSLPLVVFTGQVATPGIGKDAFQEADLLSMTTPITK 135

Query: 692 FSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
            + +   I  +P  V E    A  GR G   +D P D+
Sbjct: 136 HNYQVKKIEDIPRIVHEAFHLANTGRKGPVVIDFPKDM 173



>gb:CP000027_79821 Dehalococcoides ethenogenes 195, complete genome.
          Length = 569

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 49/159 (30%), Positives = 77/159 (48%), Gaps = 3/159 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVG---IPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTG 508
           +V  SL + G D +FG  G   +P+     +  AL  R I   +EQ           +TG
Sbjct: 8   IVCESLLKEGADVIFGYPGGVLLPLYDTFPQYPAL--RHILTRHEQGAAHAADGFARVTG 65

Query: 509 RPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFS 688
           + G+ L  SGPG  + + G++NA +++ P+V I+G   +   G+  FQE+D      P +
Sbjct: 66  KVGVCLATSGPGATNLITGIANAYMDSIPMVAITGQVTRNLIGKDAFQEIDITGITLPIT 125

Query: 689 KFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           K +   T  S +   + E    A  GRPG   +D+P DV
Sbjct: 126 KQNYLVTRASALADTIKEAFYLARTGRPGPVLIDIPKDV 164



>pir|AH2837|AH2837 acetolactate synthase large subunit [imported] -
           Agrobacterium tumefaciens (strain C58,
           Dupont)>gb:AE009163_249145 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 189 of 256 of the
           complete sequence.>gb:AE008688_1086988 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 550

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 48/167 (28%), Positives = 75/167 (44%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           L+  +L   GV R+  V G    ++ +     GI  +    E            LTG PG
Sbjct: 8   LIVEALKANGVSRVSCVPGESYLAVLDALYESGIETVVCRQEGGAAMMADTWGRLTGEPG 67

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           I +   GPG  +  AGL  A  ++ P+++  G   ++   R  FQE++   A   F+K+ 
Sbjct: 68  ICMVTRGPGATNASAGLHIARQDSIPMILFIGQVQREAREREAFQEVEYRRAFTEFAKWV 127

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEAE 838
            +  D  ++P  V      A +GRPG   L LP D+L + V   EA+
Sbjct: 128 GEIDDARRIPEFVTRAFAVATSGRPGPVVLTLPEDMLVEEVEAPEAK 174



>pir|AI0066|AI0066 acetolactate synthase (EC 4.1.3.18) isozyme III
           large chain [imported] - Yersinia pestis (strain
           CO92)>gb:AJ414143_522389 Yersinia pestis strain CO92
           complete genome; segment 3/20.>gb:BX936398_835320
           Yersinia pseudotuberculosis IP32953 genome, complete
           sequence.
          Length = 575

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 46/162 (28%), Positives = 74/162 (45%), Gaps = 1/162 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  SL   GV  +FG  G  V  + +    +G I  +   +EQ            TG  
Sbjct: 9   MVVRSLIDQGVKHVFGYPGGAVLDIYDALHTVGGIDHVLVRHEQGAVHMADGYARATGEV 68

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + + G++ A +++ P+V++SG       G   FQE D +   +P  K 
Sbjct: 69  GVVLVTSGPGATNAITGIATAYMDSVPMVVLSGQVPSSLIGFDAFQECDMVGISRPVVKH 128

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTV 820
           S        +P  + +    A+ GRPG   +DLP D++   V
Sbjct: 129 SFLVKRTEDIPMVLKKAFYLASTGRPGPVVIDLPKDIVGPAV 170



>pir|B97615|B97615 probable decarboxylase (PA2035) [imported] -
           Agrobacterium tumefaciens (strain C58,
           Cereon)>gb:AE008129_233815 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 187 of 254 of the
           complete sequence.>gb:AE007869_1083484 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 554

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 48/167 (28%), Positives = 75/167 (44%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           L+  +L   GV R+  V G    ++ +     GI  +    E            LTG PG
Sbjct: 12  LIVEALKANGVSRVSCVPGESYLAVLDALYESGIETVVCRQEGGAAMMADTWGRLTGEPG 71

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           I +   GPG  +  AGL  A  ++ P+++  G   ++   R  FQE++   A   F+K+ 
Sbjct: 72  ICMVTRGPGATNASAGLHIARQDSIPMILFIGQVQREAREREAFQEVEYRRAFTEFAKWV 131

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEAE 838
            +  D  ++P  V      A +GRPG   L LP D+L + V   EA+
Sbjct: 132 GEIDDARRIPEFVTRAFAVATSGRPGPVVLTLPEDMLVEEVEAPEAK 178



>sp|P00892|ILVG_ECOLI Acetolactate synthase isozyme II large subunit
           (EC 2.2.1.6) (AHAS-II) (Acetohydroxy-acid synthase II
           large subunit) (ALS-II).>pir|A26570|YCEC acetolactate
           synthase (EC 4.1.3.18) II large chain, ilv0 phenotype -
           Escherichia coli (strain K-12)>gb:ECILVGMED_126070
           E.coli ilvGMEDA operon.>gb:ECOILVGE_129143 E.coli ilv
           gene cluster encoding ilvD and ilvA peptides,
           acetohydroxy acid synthase II, and branched-chain amino
           acid aminotransferase, complete cds.
          Length = 548

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 42/155 (27%), Positives = 74/155 (47%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           V  +L   GV+ +FG  G  +  + +     G+  +   +EQ            TG+ G+
Sbjct: 7   VVHALRAQGVNTVFGYPGGAIMPVYDALYDGGVEHLLCRHEQGAAMAAIGYARATGKTGV 66

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
            +  SGPG  + + GL++A +++ P+V I+G       G   FQE+D +      +K S 
Sbjct: 67  CIATSGPGATNLITGLADALLDSIPVVAITGQVSAPFIGTDAFQEVDVLGLSLACTKHSF 126

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
               + ++P  + E  D A +GRPG   +D+P D+
Sbjct: 127 LVQSLEELPRIMAEAFDVACSGRPGPVLVDIPKDI 161



>gb:PRH507835_1701804 Papaver rhoeas partial ALS gene for
           acetolactate synthase, herbicide resistant biotype.
          Length = 240

 Score = 76.6 bits (187), Expect = 6e-13
 Identities = 44/158 (27%), Positives = 75/158 (47%), Gaps = 1/158 (0%)
 Frame = +2

Query: 350 SLARAGVDRMFGVVGIPVTSLANRAV-ALGIRFIAFHNEQXXXXXXXXXXXLTGRPGILL 526
           +L R GV  +F   G     +      +  IR +   +EQ            +G PG+ +
Sbjct: 2   ALEREGVTNVFAYPGGASMEIHQALTRSSSIRNVLPRHEQGGIFSAEGYARASGLPGVCI 61

Query: 527 TVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKA 706
             SGPG  + ++GL++A +++ P+V ++G   ++  G   FQE   +E  +  +K +   
Sbjct: 62  ATSGPGATNLVSGLADALLDSIPIVAVTGQVSRRMIGTDAFQETPIVEVTRSITKHNYLV 121

Query: 707 TDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTV 820
            D+  +P  V E    A +GRPG   +D+P DV  Q V
Sbjct: 122 LDVEDIPRVVKEAFFLATSGRPGPVLIDVPKDVQQQLV 159



>gb:BA000012_667095 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 593

 Score = 76.6 bits (187), Expect = 6e-13
 Identities = 44/157 (28%), Positives = 73/157 (46%), Gaps = 1/157 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  +L   GV  +FG  G  V  + +       +  I   +EQ            TG+ 
Sbjct: 16  MVVQALKDNGVKHVFGYPGGAVLPIYDEIFQQDDVEHILVRHEQGAGHAAEGYARSTGKA 75

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + +  L +A +++ PLV ++G       G   FQE D +   +P +K 
Sbjct: 76  GVMLVTSGPGATNAVTPLQDALMDSIPLVCLTGQVPTSLIGSDAFQECDTVGITRPCTKH 135

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           +    D++++ A + E    A  GRPG   +D+P DV
Sbjct: 136 NWLVKDVNELAATIHEAFHVATTGRPGPVVVDIPKDV 172



>gb:AE017162_394983 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 2 of 6 of the complete
           genome.>gb:AE017126_1030652 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 584

 Score = 76.6 bits (187), Expect = 6e-13
 Identities = 47/156 (30%), Positives = 75/156 (48%), Gaps = 4/156 (2%)
 Frame = +2

Query: 350 SLARAGVDRMFGVVG---IPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           SL   GVD +FG  G   +P+     +A   G ++ I   +EQ            TG+ G
Sbjct: 30  SLKNHGVDTIFGYPGGAILPIYDAVYKAEKAGWVKHILVRHEQGGAHAADGYARSTGKVG 89

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           +    SGPG  + + G++ A +++ PLV+I+G   +   G   FQE D      P  K S
Sbjct: 90  VCFGTSGPGATNLVTGIATAQMDSVPLVVITGQVPRPAIGTDAFQETDIFGITLPIVKHS 149

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
               D S++ + + +    A++GRPG   +D+P DV
Sbjct: 150 WVVRDPSEIASVIAQAFFIASSGRPGPVLVDIPKDV 185



>gb:AE014978_313784 Streptococcus mutans UA159 section 126 of 185 of
           the complete genome.>gb:AE014133_940785 Streptococcus
           mutans UA159 complete genome.
          Length = 559

 Score = 76.6 bits (187), Expect = 6e-13
 Identities = 42/162 (25%), Positives = 75/162 (46%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           L+  SL    V+ +FG+ G  +  + +     G   I   +EQ           +TG PG
Sbjct: 13  LIVDSLINHDVNYVFGIPGAKIDRVFDTLEDKGPELIVARHEQNAAFMAQGIGRITGEPG 72

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           +++T SGPG  + + GL  A     P++ I G   + D  +   Q ++ +  + P +K+S
Sbjct: 73  VVITTSGPGVSNLVTGLVTATAEGDPVLAIGGQVKRADLLKRAHQSMNNVAMLDPITKYS 132

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVS 823
           A+  D + +   +      A AG+PG  +L +P D+    V+
Sbjct: 133 AEIQDPATLSENIANAYRLAKAGKPGASFLSIPQDITDSPVT 174



>gb:AE012557_284452 Xylella fastidiosa Temecula1, section 5 of 9 of
           the complete genome.>gb:AE009442_961028 Xylella
           fastidiosa Temecula1, complete genome.
          Length = 583

 Score = 76.6 bits (187), Expect = 6e-13
 Identities = 45/152 (29%), Positives = 69/152 (45%)
 Frame = +2

Query: 350 SLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGILLT 529
           +L   GVD +FG  G  +    +  V   +  I   +EQ            +GR G+ + 
Sbjct: 19  ALEAEGVDTLFGYPGGTIMPFYDALVDSRLTHILVRHEQGAALAANGYARASGRVGVCVA 78

Query: 530 VSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKAT 709
            SGPG  + + G+++A +++ P+V ++G       G   FQELD      P  K S    
Sbjct: 79  TSGPGASNLITGIADAMLDSVPMVCLTGQVASSLLGTDAFQELDVFGLTMPIVKHSFLVR 138

Query: 710 DISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
            I  +P+ V +    A  GRPG   +DLP DV
Sbjct: 139 SIQDLPSMVQDAFRIAREGRPGPVLIDLPKDV 170



>pir|D82634|D82634 acetolactate synthase isozyme II, large subunit
           XF1821 [imported] - Xylella fastidiosa (strain
           9a5c)>gb:AE004003_49456 Xylella fastidiosa 9a5c, section
           149 of 229 of the complete genome.>gb:AE003849_1116666
           Xylella fastidiosa 9a5c, complete genome.
          Length = 583

 Score = 76.6 bits (187), Expect = 6e-13
 Identities = 45/152 (29%), Positives = 69/152 (45%)
 Frame = +2

Query: 350 SLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGILLT 529
           +L   GVD +FG  G  +    +  V   +  I   +EQ            +GR G+ + 
Sbjct: 19  ALEAEGVDTLFGYPGGTIMPFYDALVDSRLTHILVRHEQGAALAANGYARASGRVGVCVA 78

Query: 530 VSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKAT 709
            SGPG  + + G+++A +++ P+V ++G       G   FQELD      P  K S    
Sbjct: 79  TSGPGASNLITGIADAMLDSVPMVCLTGQVASSLLGTDAFQELDVFGLTMPIVKHSFLVR 138

Query: 710 DISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
            I  +P+ V +    A  GRPG   +DLP DV
Sbjct: 139 SIQDLPSMVQDAFRIAREGRPGPVLIDLPKDV 170



>pir|AF2826|AF2826 acetolactate synthase III, large subunit
           [imported] - Agrobacterium tumefaciens (strain C58,
           Dupont)>gb:AE009154_249055 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 180 of 256 of the
           complete sequence.>gb:AE008688_1086898 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 597

 Score = 76.6 bits (187), Expect = 6e-13
 Identities = 45/161 (27%), Positives = 75/161 (46%), Gaps = 1/161 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVAL-GIRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  +L   GV+ +FG  G  V  + +       I+ I   +EQ            TG+ 
Sbjct: 18  IVLQALKDNGVEHIFGYPGGAVLPIYDEIFQQEDIQHILVRHEQGAGHAAEGYARSTGKV 77

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + +  L +A +++ PLV +SG       G   FQE D +   +P +K 
Sbjct: 78  GVMLVTSGPGATNAVTPLQDALMDSIPLVCLSGQVPTSLIGSDAFQECDTVGITRPCTKH 137

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQT 817
           +    D++++   + E    A  GRPG   +D+P D+   T
Sbjct: 138 NWLVKDVNELAGIIHEAFRIAQTGRPGPVVVDIPKDIQFAT 178



>gb:XSU16280_1727863 Xanthium sp. wild type acetolactate synthase
           precursor mRNA, complete cds.
          Length = 648

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 45/160 (28%), Positives = 78/160 (48%), Gaps = 3/160 (1%)
 Frame = +2

Query: 350 SLARAGVDRMFGVVG---IPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           +L R GV  +F   G   + +     R+    IR +   +EQ            +G PG+
Sbjct: 84  ALEREGVTDVFAYPGGASMEIHQALTRSTT--IRNVLPRHEQGGVFAAEGYARASGLPGV 141

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
            +  SGPG  + ++GL++A +++ P+V I+G   ++  G   FQE   +E  +  +K + 
Sbjct: 142 CIATSGPGATNLVSGLADALLDSVPMVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNY 201

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTV 820
              D+  +P  V E    A++GRPG   +D+P D+  Q V
Sbjct: 202 LVLDVEDIPRIVREAFYLASSGRPGPVLIDVPKDIQQQLV 241



>gb:XSU16279_1727862 Xanthium sp. Missouri field acetolactate
           synthase precursor mRNA, complete cds.
          Length = 648

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 45/160 (28%), Positives = 78/160 (48%), Gaps = 3/160 (1%)
 Frame = +2

Query: 350 SLARAGVDRMFGVVG---IPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           +L R GV  +F   G   + +     R+    IR +   +EQ            +G PG+
Sbjct: 84  ALEREGVTDVFAYPGGASMEIHQALTRSTT--IRNVLPRHEQGGVFAAEGYARASGLPGV 141

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
            +  SGPG  + ++GL++A +++ P+V I+G   ++  G   FQE   +E  +  +K + 
Sbjct: 142 CIATSGPGATNLVSGLADALLDSVPMVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNY 201

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTV 820
              D+  +P  V E    A++GRPG   +D+P D+  Q V
Sbjct: 202 LVLDVEDIPRIVREAFYLASSGRPGPVLIDVPKDIQQQLV 241



>gb:PRH577316_1701805 Papaver rhoeas mRNA for acetolactate synthase
           (als gene), herbicide sensitive biotype 98-07.
          Length = 662

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 44/158 (27%), Positives = 75/158 (47%), Gaps = 1/158 (0%)
 Frame = +2

Query: 350 SLARAGVDRMFGVVGIPVTSLANRAV-ALGIRFIAFHNEQXXXXXXXXXXXLTGRPGILL 526
           +L R GV  +F   G     +      +  IR +   +EQ            +G PG+ +
Sbjct: 98  ALEREGVTNVFAYPGGASMEIHQALTRSSSIRNVLPRHEQGGIFSAEGYARASGLPGVCI 157

Query: 527 TVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKA 706
             SGPG  + ++GL++A +++ P+V ++G   ++  G   FQE   +E  +  +K +   
Sbjct: 158 ATSGPGATNLVSGLADALLDSIPIVAVTGQVPRRMIGTDAFQETPIVEVTRSITKHNYLV 217

Query: 707 TDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTV 820
            D+  +P  V E    A +GRPG   +D+P DV  Q V
Sbjct: 218 LDVEDIPRVVKEAFFLATSGRPGPVLIDVPKDVQQQLV 255



>gb:PRH507834_1701803 Papaver rhoeas partial ALS gene for
           acetolactate synthase, herbicide sensitive biotype.
          Length = 240

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 44/158 (27%), Positives = 75/158 (47%), Gaps = 1/158 (0%)
 Frame = +2

Query: 350 SLARAGVDRMFGVVGIPVTSLANRAV-ALGIRFIAFHNEQXXXXXXXXXXXLTGRPGILL 526
           +L R GV  +F   G     +      +  IR +   +EQ            +G PG+ +
Sbjct: 2   ALEREGVTNVFAYPGGASMEIHQALTRSSSIRNVLPRHEQGGIFSAEGYARASGLPGVCI 61

Query: 527 TVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKA 706
             SGPG  + ++GL++A +++ P+V ++G   ++  G   FQE   +E  +  +K +   
Sbjct: 62  ATSGPGATNLVSGLADALLDSIPIVAVTGQVPRRMIGTDAFQETPIVEVTRSITKHNYLV 121

Query: 707 TDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTV 820
            D+  +P  V E    A +GRPG   +D+P DV  Q V
Sbjct: 122 LDVEDIPRVVKEAFFLATSGRPGPVLIDVPKDVQQQLV 159



>gb:BX571856_781720 Staphylococcus aureus subsp. aureus strain
           MRSA252, complete genome.
          Length = 554

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 47/166 (28%), Positives = 77/166 (46%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           +V  +L   GV+ +FG+ G  +  L N  +  G   I   +EQ           LTG+PG
Sbjct: 11  MVIDTLKNNGVEYVFGIPGAKIDYLFNALIDDGPELIVTRHEQNAAMMAQGIGRLTGKPG 70

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           ++L  SGPG  +   GL  A     P++ + G   + D  R   Q +D    +K  SK+S
Sbjct: 71  VVLVTSGPGVSNLTTGLLTATSEGDPVLALGGQVKRNDLLRLTHQSIDNAALLKYSSKYS 130

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEA 835
            +  D   +   +   +  A +G+ G  ++ +P DV+   V ES+A
Sbjct: 131 EEVQDPESLSEVMTNAIRIATSGKNGASFISIPQDVISSPV-ESKA 175



>gb:BA000033_712424 Staphylococcus aureus subsp. aureus MW2 DNA,
           complete genome, strain:MW2.>gb:BX571857_784335
           Staphylococcus aureus strain MSSA476, complete genome.
          Length = 554

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 47/166 (28%), Positives = 77/166 (46%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           +V  +L   GV+ +FG+ G  +  L N  +  G   I   +EQ           LTG+PG
Sbjct: 11  MVIDTLKNNGVEYVFGIPGAKIDYLFNALIDDGPELIVTRHEQNAAMMAQGIGRLTGKPG 70

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           ++L  SGPG  +   GL  A     P++ + G   + D  R   Q +D    +K  SK+S
Sbjct: 71  VVLVTSGPGVSNLTTGLLTATSEGDPVLALGGQVKRNDLLRLTHQSIDNAALLKYSSKYS 130

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEA 835
            +  D   +   +   +  A +G+ G  ++ +P DV+   V ES+A
Sbjct: 131 EEVQDPESLSEVMTNAIRIATSGKNGASFISIPQDVISSPV-ESKA 175



>gb:AF129503_481682 Buchnera aphidicola natural-host Melaphis rhois
           acetohydroxy acid synthase large subunit (ilvI) gene,
           complete cds; acetohydroxy acid synthase small subunit
           (ilvH) gene, partial cds; and unknown gene.
          Length = 573

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 46/155 (29%), Positives = 73/155 (47%), Gaps = 1/155 (0%)
 Frame = +2

Query: 350 SLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRPGILL 526
           SL   G+  +FG  G  V  + +   +   I+ I   +EQ            TG+ G++L
Sbjct: 13  SLIDQGIKYIFGYPGGAVLDIYDSLKSTNKIKHILVRHEQGATHMADGYARATGKVGVVL 72

Query: 527 TVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKA 706
             SGPG  + + G++ A +++ P+V+ISG       G   FQE D I   +P  K S   
Sbjct: 73  VTSGPGATNAITGIATAYMDSIPIVVISGQVASYLIGYDAFQECDMIGISRPIVKHSFLV 132

Query: 707 TDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLH 811
                +P    +    A++GRPG   +DLP D+L+
Sbjct: 133 KKTEDIPITFKKAFWLASSGRPGPIVIDLPKDILN 167



>gb:AE017282_428571 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 553

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 45/162 (27%), Positives = 77/162 (47%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           L+  SL   GV+ +FGV G  +  + N     G RFI   +E            +TGRPG
Sbjct: 13  LLVDSLQALGVEYVFGVPGGAILPILNVLADRGPRFIVCRDETGAAFMAQSWGRITGRPG 72

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           ++LT SGPG ++ + G++ A  +  PLV+I+G   +    +     LD +    P +K+S
Sbjct: 73  VVLTTSGPGLINAVCGVATATEDRDPLVVITGQVPRAVQFKQSHMNLDSVGLFAPITKWS 132

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVS 823
            +  + + V   +      A     G  ++ +P+D+L   V+
Sbjct: 133 VEVEEPNTVSEILVNAFRTAQTPCAGAVHVSVPNDMLTAPVT 174



>gb:AE013598_294646 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 573

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 45/155 (29%), Positives = 71/155 (45%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           +  +L   GV+ +FG  G  +    +  V   ++ I   +EQ            +GR G+
Sbjct: 16  LTQALEAEGVETLFGYPGGTIMPFYDALVDSRLKHILVRHEQGAALAANGYARASGRVGV 75

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
            +  SGPG  + + G+++A +++ P+V ++G       G   FQELD      P  K S 
Sbjct: 76  CVATSGPGASNLVTGIADAMLDSVPMVCLTGQVATPLLGTDAFQELDVFGMTMPIVKHSF 135

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
            A  +  +P  V E    A  GRPG   +DLP DV
Sbjct: 136 LARRVEDLPEMVREAFRIAREGRPGPVLIDLPKDV 170



>gb:AE012976_287763 Thermoanaerobacter tengcongensis MB4, section 3
           of 244 of the complete genome.>gb:AE008691_1109828
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 552

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 48/163 (29%), Positives = 77/163 (47%)
 Frame = +2

Query: 353 LARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGILLTV 532
           L   GVD +FG+ G  V  + +      IR I   +EQ            TG+ G+ +  
Sbjct: 13  LKEMGVDNVFGIPGGAVIPIYDALYDSDIRHILATHEQMAAHMADGYARATGKVGVCIAT 72

Query: 533 SGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKATD 712
           SGPG  + + G++NA +++ P+V I+G       G+  FQE+D      P +K +     
Sbjct: 73  SGPGATNLVTGIANAYMDSVPVVAITGQVPTYLIGKDAFQEVDITGITMPITKHNFVVKS 132

Query: 713 ISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEAER 841
             K+   + E    A +GRPG   +D+P D+ +   +E E ER
Sbjct: 133 PEKLADTLREAFAIAKSGRPGPVLVDIPKDIQN---AEIEYER 172



>gb:AE012450_282550 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 358 of 460 of the complete
           genome.>gb:AE008922_915832 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 573

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 44/155 (28%), Positives = 71/155 (45%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           +  +L   GV+ +FG  G  +    +  V   ++ I   +EQ            +GR G+
Sbjct: 16  LTQALEAEGVETLFGYPGGTIMPFYDALVDSKLKHILVRHEQGAALAANGFARASGRVGV 75

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
            +  SGPG  + + G+++A +++ P+V ++G       G   FQELD      P  K S 
Sbjct: 76  CVATSGPGASNLVTGIADAMLDSVPMVCLTGQVATPLLGTDAFQELDVFGMTMPIVKHSF 135

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
               + ++P  V E    A  GRPG   +DLP DV
Sbjct: 136 LVRSVDELPEMVREAFRIAREGRPGPVLIDLPKDV 170



>gb:CR543861_104892 Acinetobacter sp. ADP1 complete genome.
          Length = 574

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 43/156 (27%), Positives = 76/156 (48%), Gaps = 1/156 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           ++  +LA  GV+ +FG  G  V  + +       I      +EQ           +TG+ 
Sbjct: 9   MLVRALADEGVEHVFGYPGGAVLHIYDALFQQDKINHYLVRHEQAAGHMADAYSRVTGKT 68

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + +  ++ A +++ P+V++SG       G   FQE D +   +P  K 
Sbjct: 69  GVVLVTSGPGATNTVTPIATAYMDSIPMVILSGQVASHLIGEDAFQETDMVGISRPIVKH 128

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSD 802
           S +    S++PA + +    A++GRPG   +D+P D
Sbjct: 129 SFQVRHASEIPAIIKKAFYIASSGRPGPVVIDIPKD 164



>gb:CP000029_82739 Staphylococcus epidermidis RP62A, complete
           genome.>gb:AE016751_323794 Staphylococcus epidermidis
           ATCC 12228, section 8 of 9 of the complete
           genome.>gb:AE015929_1148463 Staphylococcus epidermidis
           ATCC 12228, complete genome.
          Length = 554

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 43/161 (26%), Positives = 73/161 (45%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           +V  +L   GV+ +FG+ G  +  L N      I  +   +EQ           LTG+PG
Sbjct: 11  MVIDTLKNNGVEYVFGIPGAKIDYLFNALEDDDIELVVTRHEQNAAMIAQGIGRLTGKPG 70

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + +T SGPG  +   GL  A     P++ I G   + D  R   Q +D    ++  +K+S
Sbjct: 71  VAITTSGPGVSNLTTGLLTATSEGDPVLAIGGQVKRNDLLRLTHQSIDNASLLRSSTKYS 130

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTV 820
           A+  D   +   +   +  A +G+ G  ++ +P DV+   V
Sbjct: 131 AEVQDPESLSEVITNAMRTATSGKNGASFISIPQDVISSPV 171



>gb:AB057421_8392 Staphylococcus aureus IS256, ORF5, ORF6, etd,
           ORF2, edin-B, ORF7, ORF8, ORF9, ORF10, ORF11 genes,
           complete cds.
          Length = 554

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 47/166 (28%), Positives = 77/166 (46%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           +V  +L   GV+ +FG+ G  +  L N  +  G   I   +EQ           LTG+PG
Sbjct: 11  MVIDTLKNNGVEYVFGIPGAKIDYLFNALIDDGPELIVTRHEQNAAMMAQGIGRLTGKPG 70

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           ++L  SGPG  +   GL  A     P++ + G   + D  R   Q +D    +K  SK+S
Sbjct: 71  VVLVTSGPGVSNLTTGLLTATSEGDPVLALGGQVKRNDLLRLTHQSIDNAALLKYSSKYS 130

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEA 835
            +  D   +   +   +  A +G+ G  ++ +P DV+   V ES+A
Sbjct: 131 EEVQDPESLSEVMTNAIRIATSGKNGASFISIPQDVISSPV-ESKA 175



>pir|S75115|S75115 acetohydroxy acid synthase - Synechocystis sp.
           (strain PCC 6803)>gb:BA000022_688756 Synechocystis sp.
           PCC 6803 DNA, complete genome.
          Length = 621

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 49/156 (31%), Positives = 72/156 (46%), Gaps = 4/156 (2%)
 Frame = +2

Query: 350 SLARAGVDRMFGVVG---IPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           SL R GV  +FG  G   +P+     R  A G I  I   +EQ            TG+ G
Sbjct: 30  SLKRHGVKHIFGYPGGAILPIYDELYRFEAAGEIEHILVRHEQGASHAADGYARATGKVG 89

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           +    SGPG  + + G++NA +++ P+V+I+G   +   G   FQE+D      P  K S
Sbjct: 90  VCFGTSGPGATNLVTGIANAHLDSVPMVVITGQVGRAMIGSDAFQEIDIFGITLPIVKHS 149

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
                 + +   V E    A+ GRPG   +D+P DV
Sbjct: 150 YVVRSAADMARIVTEAFHLASTGRPGPVLIDIPKDV 185



>pir|B90017|B90017 alpha-acetolactate synthase [imported] -
           Staphylococcus aureus (strain N315)>gb:CP000046_92289
           Staphylococcus aureus subsp. aureus COL, complete
           genome.>gb:BA000017_677892 Staphylococcus aureus subsp.
           aureus Mu50 DNA, complete genome.>gb:BA000018_680481
           Staphylococcus aureus subsp. aureus N315 genomic DNA,
           complete genome.
          Length = 554

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 47/166 (28%), Positives = 77/166 (46%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           +V  +L   GV+ +FG+ G  +  L N  +  G   I   +EQ           LTG+PG
Sbjct: 11  MVIDTLKNNGVEYVFGIPGAKIDYLFNALIDDGPELIVTRHEQNAAMMAQGIGRLTGKPG 70

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           ++L  SGPG  +   GL  A     P++ + G   + D  R   Q +D    +K  SK+S
Sbjct: 71  VVLVTSGPGVSNLTTGLLTATSEGDPVLALGGQVKRNDLLRLTHQSIDNAALLKYSSKYS 130

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEA 835
            +  D   +   +   +  A +G+ G  ++ +P DV+   V ES+A
Sbjct: 131 EEVQDPESLSEVMTNAIRIATSGKNGASFISIPQDVISSPV-ESKA 175



>sp|P45261|ILVI_HAEIN Acetolactate synthase large subunit (EC
           2.2.1.6) (AHAS) (Acetohydroxy- acid synthase large
           subunit) (ALS).>pir|C64131|C64131 acetolactate synthase
           (EC 4.1.3.18) III large chain - Haemophilus influenzae
           (strain Rd KW20)>gb:U32832_205244 Haemophilus influenzae
           Rd KW20 section 147 of 163 of the complete
           genome.>gb:L42023_1097793 Haemophilus influenzae Rd KW20
           complete genome.
          Length = 573

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 47/159 (29%), Positives = 73/159 (45%), Gaps = 1/159 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  SL   GV+ +FG  G  V  + +    LG I  I   +EQ            TG+ 
Sbjct: 9   MVVQSLRDEGVEYVFGYPGGAVLDIYDAIHTLGGIEHILVRHEQAAVHMADGYARSTGKV 68

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G +L  SGPG  + + G+  A  ++ P+V+ISG       G   FQE D +   +P  K 
Sbjct: 69  GCVLVTSGPGATNAITGILTAYTDSVPMVIISGQVMSNLIGSDAFQECDMLGISRPVVKH 128

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLH 811
           S        +P+ + +    A+ GRPG   +D+P D ++
Sbjct: 129 SFIVKKAEDIPSTLKKAFYIASTGRPGPVVVDIPKDTVN 167



>gb:AF363370_1791526 Amaranthus powellii acetolactate synthase gene,
           complete cds.
          Length = 669

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 40/128 (31%), Positives = 65/128 (50%)
 Frame = +2

Query: 437 IRFIAFHNEQXXXXXXXXXXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGS 616
           IR +   +EQ            TGR G+ +  SGPG  + ++GL++A +++ PLV I+G 
Sbjct: 131 IRNVLPRHEQGGVFAAEGYARATGRVGVCIATSGPGATNLVSGLADALLDSVPLVAITGQ 190

Query: 617 CDQKDFGRGDFQELDQIEAVKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLP 796
             ++  G   FQE   +E  +  +K +    D+  +P  V E    A +GRPG   +D+P
Sbjct: 191 VPRRMIGTDAFQETPIVEVTRSITKHNYLVLDVEDIPRIVKEAFFLANSGRPGPVLIDIP 250

Query: 797 SDVLHQTV 820
            D+  Q V
Sbjct: 251 KDIQQQLV 258



>gb:AF363369_1791525 Amaranthus retroflexus acetolactate synthase
           gene, complete cds.
          Length = 669

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 40/128 (31%), Positives = 65/128 (50%)
 Frame = +2

Query: 437 IRFIAFHNEQXXXXXXXXXXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGS 616
           IR +   +EQ            TGR G+ +  SGPG  + ++GL++A +++ PLV I+G 
Sbjct: 131 IRNVLPRHEQGGVFAAEGYARATGRVGVCIATSGPGATNLVSGLADALLDSVPLVAITGQ 190

Query: 617 CDQKDFGRGDFQELDQIEAVKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLP 796
             ++  G   FQE   +E  +  +K +    D+  +P  V E    A +GRPG   +D+P
Sbjct: 191 VPRRMIGTDAFQETPIVEVTRSITKHNYLVLDVEDIPRIVKEAFFLANSGRPGPVLIDIP 250

Query: 797 SDVLHQTV 820
            D+  Q V
Sbjct: 251 KDIQQQLV 258



>gb:BPI514934_1634078 Bidens pilosa partial als gene for
           acetolactate synthase, domains C, A and D.
          Length = 241

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 40/128 (31%), Positives = 65/128 (50%)
 Frame = +2

Query: 437 IRFIAFHNEQXXXXXXXXXXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGS 616
           IR +   +EQ            TGR G+ +  SGPG  + ++GL++A +++ PLV I+G 
Sbjct: 29  IRNVLPRHEQGGVFAAEGYARATGRVGVCIATSGPGATNLVSGLADALLDSVPLVAITGQ 88

Query: 617 CDQKDFGRGDFQELDQIEAVKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLP 796
             ++  G   FQE   +E  +  +K +    D+  +P  V E    A +GRPG   +D+P
Sbjct: 89  VPRRMIGTDAFQETPIVEVTRSITKHNYLVLDVEDIPRIVKEAFFLANSGRPGPVLIDIP 148

Query: 797 SDVLHQTV 820
            D+  Q V
Sbjct: 149 KDIQQQLV 156



>gb:AY094592S1_1575785 Amaranthus powellii acetolactate synthase
           gene, partial cds.
          Length = 252

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 40/128 (31%), Positives = 65/128 (50%)
 Frame = +2

Query: 437 IRFIAFHNEQXXXXXXXXXXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGS 616
           IR +   +EQ            TGR G+ +  SGPG  + ++GL++A +++ PLV I+G 
Sbjct: 34  IRNVLPRHEQGGVFAAEGYARATGRVGVCIATSGPGATNLVSGLADALLDSVPLVAITGQ 93

Query: 617 CDQKDFGRGDFQELDQIEAVKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLP 796
             ++  G   FQE   +E  +  +K +    D+  +P  V E    A +GRPG   +D+P
Sbjct: 94  VPRRMIGTDAFQETPIVEVTRSITKHNYLVLDVEDIPRIVKEAFFLANSGRPGPVLIDIP 153

Query: 797 SDVLHQTV 820
            D+  Q V
Sbjct: 154 KDIQQQLV 161



>gb:AQU514935_1542023 Amaranthus quitensis partial als gene for
           acetolactate synthase, domains C, A and D.
          Length = 242

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 40/128 (31%), Positives = 65/128 (50%)
 Frame = +2

Query: 437 IRFIAFHNEQXXXXXXXXXXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGS 616
           IR +   +EQ            TGR G+ +  SGPG  + ++GL++A +++ PLV I+G 
Sbjct: 29  IRNVLPRHEQGGVFAAEGYARATGRVGVCIATSGPGATNLVSGLADALLDSVPLVAITGQ 88

Query: 617 CDQKDFGRGDFQELDQIEAVKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLP 796
             ++  G   FQE   +E  +  +K +    D+  +P  V E    A +GRPG   +D+P
Sbjct: 89  VPRRMIGTDAFQETPIVEVTRSITKHNYLVLDVEDIPRIVKEAFFLANSGRPGPVLIDIP 148

Query: 797 SDVLHQTV 820
            D+  Q V
Sbjct: 149 KDIQQQLV 156



>gb:CP000024_876755 Streptococcus thermophilus CNRZ1066, complete
           genome.
          Length = 560

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 43/162 (26%), Positives = 75/162 (46%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           LV  SL    V+ +FG+ G  +  + +     G   I   +EQ           +TG+PG
Sbjct: 14  LVVDSLINHDVEYVFGIPGAKIDRVFDTLEDKGPELIVARHEQNAAFMAQGVGRITGKPG 73

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           ++L  SGPG  +   GL  A     P++ I G   + D  +   Q ++ +  ++P +K++
Sbjct: 74  VVLVTSGPGVSNLATGLVTATDEGDPVLAIGGQVKRADLLKRAHQSMNNVAMLEPITKYA 133

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVS 823
           A+  D + +   V      A +G+PG  ++ +P DV    VS
Sbjct: 134 AEVHDANTLSETVANAYRHAKSGKPGASFISIPQDVTDAPVS 175



>gb:CP000023_874837 Streptococcus thermophilus LMG 18311, complete
           genome.
          Length = 560

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 43/162 (26%), Positives = 75/162 (46%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           LV  SL    V+ +FG+ G  +  + +     G   I   +EQ           +TG+PG
Sbjct: 14  LVVDSLINHDVEYVFGIPGAKIDRVFDTLEDKGPELIVARHEQNAAFMAQGVGRITGKPG 73

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           ++L  SGPG  +   GL  A     P++ I G   + D  +   Q ++ +  ++P +K++
Sbjct: 74  VVLVTSGPGVSNLATGLVTATDEGDPVLAIGGQVKRADLLKRAHQSMNNVAMLEPITKYA 133

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVS 823
           A+  D + +   V      A +G+PG  ++ +P DV    VS
Sbjct: 134 AEVHDANTLSETVANAYRHAKSGKPGASFISIPQDVTDAPVS 175



>gb:CP000001_851396 Bacillus cereus ZK, complete genome.
          Length = 565

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 44/157 (28%), Positives = 70/157 (44%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           LV   L + GV  +FG+ G  + S+ +     G   I   +EQ           LTG+PG
Sbjct: 22  LVVDCLIKQGVTHVFGIPGAKIDSVFDVLQERGPELIVCRHEQNAAFMAAAIGRLTGKPG 81

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + L  SGPG  +   GL  A   + P+V ++G+  + D  +   Q +D     +P +K+S
Sbjct: 82  VCLVTSGPGTSNLATGLVTANAESDPVVALAGAVPRTDRLKRTHQSMDNAALFEPITKYS 141

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVL 808
            +      VP  +      A +  PG   + LP DV+
Sbjct: 142 VEVEHPDNVPEALSNAFRSATSTNPGATLVSLPQDVM 178



>gb:BX569693_776648 Synechococcus sp. WH8102 complete genome;
           segment 5/7.
          Length = 617

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 52/181 (28%), Positives = 84/181 (46%), Gaps = 4/181 (2%)
 Frame = +2

Query: 275 SESSVVVHFRDNLMADVDTNMLVAMSLARAGVDRMFGVVG---IPVTSLANRAVALG-IR 442
           S S+VV     N    +     +  +L R GVD +FG  G   +P+    + A + G ++
Sbjct: 5   SASTVVGGLDANAPQTISGAAALMDALRRHGVDTIFGYPGGAILPIYDALHIAESEGWVK 64

Query: 443 FIAFHNEQXXXXXXXXXXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCD 622
            I   +EQ            TG+ G+    SGPG  + + G++ A +++ P+V+I+G   
Sbjct: 65  HILVRHEQAGTHAADAYARATGKVGVCFGTSGPGATNLVTGIATAQMDSVPMVVITGQVP 124

Query: 623 QKDFGRGDFQELDQIEAVKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSD 802
           +   G   FQE D      P  K S    D + + + V +    AA+GRPG   +D+P D
Sbjct: 125 RPAIGTDAFQETDIFGITLPIVKHSWVVRDPADLGSIVAQAFLIAASGRPGPVLIDIPKD 184

Query: 803 V 805
           V
Sbjct: 185 V 185



>gb:AY619685_637078 Uncultured gamma proteobacterium eBACHOT4E07
           clone eBACHOT4E07, complete sequence.
          Length = 578

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 44/158 (27%), Positives = 72/158 (45%), Gaps = 1/158 (0%)
 Frame = +2

Query: 332 NMLVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTG 508
           N ++  SL   GV+ +FG  G     + +       +  I   +EQ            TG
Sbjct: 6   NDILIKSLIEEGVEYIFGYPGGAALHIYDSIFKQKEMEHILVRHEQGATHAADGYARATG 65

Query: 509 RPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFS 688
           +PG++L  SGPG  + + G++ A +++ P+++ISG   +   G   FQE D I   +P  
Sbjct: 66  KPGVVLVTSGPGATNAITGIATAYMDSIPMIVISGQVAKHLIGTDAFQETDMIGISRPIV 125

Query: 689 KFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSD 802
           K S        +   V +    A +GRPG   +D+P D
Sbjct: 126 KHSFTVDSAENISEIVKQAFHIATSGRPGPVVIDVPKD 163



>gb:AE017355_462091 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 565

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 44/157 (28%), Positives = 70/157 (44%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           LV   L + GV  +FG+ G  + S+ +     G   I   +EQ           LTG+PG
Sbjct: 22  LVVDCLIKQGVTHVFGIPGAKIDSVFDVLQERGPELIVCRHEQNAAFMAAAIGRLTGKPG 81

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + L  SGPG  +   GL  A   + P+V ++G+  + D  +   Q +D     +P +K+S
Sbjct: 82  VCLVTSGPGTSNLATGLVTANAESDPVVALAGAVPRTDRLKRTHQSMDNAALFEPITKYS 141

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVL 808
            +      VP  +      A +  PG   + LP DV+
Sbjct: 142 VEVEHPDNVPEALSNAFRSATSTNPGATLVSLPQDVM 178



>gb:AE017267_422186 Bacillus cereus ATCC 10987, section 4 of 18 of
           the complete genome.>gb:AE017194_1060605 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 565

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 44/157 (28%), Positives = 70/157 (44%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           LV   L + GV  +FG+ G  + S+ +     G   I   +EQ           LTG+PG
Sbjct: 22  LVVDCLIKQGVTHVFGIPGAKIDSVFDVLQERGPELIVCRHEQNAAFMAAAIGRLTGKPG 81

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + L  SGPG  +   GL  A   + P+V ++G+  + D  +   Q +D     +P +K+S
Sbjct: 82  VCLVTSGPGTSNLATGLVTANAESDPVVALAGAVPRTDRLKRTHQSMDNAALFEPITKYS 141

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVL 808
            +      VP  +      A +  PG   + LP DV+
Sbjct: 142 VEVEHPDNVPEALSNAFRSATSTNPGATLVSLPQDVM 178



>gb:AE017027_381107 Bacillus anthracis str. Ames section 4 of 18 of
           the complete genome.>gb:AE017225_406226 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_450956 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE016879_1010812 Bacillus
           anthracis str. Ames complete genome.
          Length = 562

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 44/157 (28%), Positives = 70/157 (44%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           LV   L + GV  +FG+ G  + S+ +     G   I   +EQ           LTG+PG
Sbjct: 19  LVVDCLIKQGVTHVFGIPGAKIDSVFDVLQERGPELIVCRHEQNAAFMAAAIGRLTGKPG 78

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + L  SGPG  +   GL  A   + P+V ++G+  + D  +   Q +D     +P +K+S
Sbjct: 79  VCLVTSGPGTSNLATGLVTANAESDPVVALAGAVPRTDRLKRTHQSMDNAALFEPITKYS 138

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVL 808
            +      VP  +      A +  PG   + LP DV+
Sbjct: 139 VEVEHPDNVPEALSNAFRSATSTNPGATLVSLPQDVM 175



>gb:AE017000_375826 Bacillus cereus ATCC 14579 section 3 of 18 of
           the complete genome.>gb:AE016877_1016076 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 562

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 44/157 (28%), Positives = 70/157 (44%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           LV   L + GV  +FG+ G  + S+ +     G   I   +EQ           LTG+PG
Sbjct: 19  LVVDCLIKQGVTHVFGIPGAKIDSVFDVLQERGPELIVCRHEQNAAFMAAAIGRLTGKPG 78

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + L  SGPG  +   GL  A   + P+V ++G+  + D  +   Q +D     +P +K+S
Sbjct: 79  VCLVTSGPGTSNLATGLVTANAESDPVVALAGAVPRTDRLKRTHQSMDNAALFEPITKYS 138

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVL 808
            +      VP  +      A +  PG   + LP DV+
Sbjct: 139 VEVEHPDNVPEALSNAFRSATSTNPGATLVSLPQDVM 175



>gb:AE014291_308815 Brucella suis 1330 chromosome I, complete
           sequence.
          Length = 584

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 45/157 (28%), Positives = 74/157 (47%), Gaps = 1/157 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG-IRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  +L   GV+ +FG  G  V  + +       I+ +   +EQ            TG+ 
Sbjct: 6   MVIQALIDQGVESIFGYPGGAVLPIYDELFQQDQIQHVLVRHEQGAGHAAEGYARSTGKV 65

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G++L  SGPG  + +  L +A +++ PLV ISG       G   FQE D I   +P +K 
Sbjct: 66  GVMLVTSGPGATNAVTPLQDALMDSIPLVCISGQVPTTLIGSDAFQECDTIGITRPCTKH 125

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           +    D++ +   + E    A+ GRPG   +D+P D+
Sbjct: 126 NWLVKDVNDLSRVLHEAFHVASTGRPGPVVVDIPKDI 162



>gb:AE009923_257448 Pyrobaculum aerophilum strain IM2 section 178 of
           201 of the complete genome.>gb:AE009441_900074
           Pyrobaculum aerophilum strain IM2 complete genome.
          Length = 556

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 41/141 (29%), Positives = 69/141 (48%)
 Frame = +2

Query: 383 GVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGILLTVSGPGCVHGLA 562
           G+ G  +  L +      I  I F +EQ           ++GRP ++   SGPG  + + 
Sbjct: 2   GIPGGQIMPLFDALYGQDIETILFRHEQGAIHAAEGYARVSGRPAVVAVTSGPGATNLVT 61

Query: 563 GLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKATDISKVPACVFE 742
           G+++A +++ P+V I+G      FGR  FQE D +  V P +KF+ +    S+  +    
Sbjct: 62  GITDAYMDSTPVVAITGQVVTSVFGRDGFQETDILGVVTPVTKFTYQVKKPSEATSAFKT 121

Query: 743 VLDWAAAGRPGGCYLDLPSDV 805
             + +  GRPG   +DLP D+
Sbjct: 122 AYEISIIGRPGPTLIDLPRDI 142



>gb:AE008692_240877 Zymomonas mobilis subsp. mobilis ZM4, complete
           genome.
          Length = 595

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 47/157 (29%), Positives = 73/157 (46%), Gaps = 1/157 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVA-LGIRFIAFHNEQXXXXXXXXXXXLTGRP 514
           +V  +L   GVD +FG  G  V  + +      GIR I    E             TG+P
Sbjct: 10  IVLETLKDMGVDLIFGYPGGAVLPIYDALYQDEGIRHILARQEGGAVHAAEGYARSTGKP 69

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           G+++  SGPG  + + G+++A +++ PLV+ SG       G   FQE D I   +  +K 
Sbjct: 70  GVVIVTSGPGATNAVTGIADAMLDSIPLVVFSGQVATNLIGTDAFQEADTIGITRHCTKH 129

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           +    D   +   + E    A +GRPG   +DLP +V
Sbjct: 130 NYLVRDPKDLAQTIVEAFHLATSGRPGPVVIDLPKNV 166



>pir|H83392|H83392 probable decarboxylase PA2035 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004629_56271
           Pseudomonas aeruginosa PAO1, section 190 of 529 of the
           complete genome.>gb:AE004091_970371 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 552

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 43/167 (25%), Positives = 76/167 (45%), Gaps = 1/167 (0%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVAL-GIRFIAFHNEQXXXXXXXXXXXLTGRP 514
           ++  +L R  VD ++ + G     + +      GIR +   +E            LTGRP
Sbjct: 13  ILVEALRRNAVDTVYCIPGESYLPVLDALYDTDGIRTVVTRHEGAASNMADAYGKLTGRP 72

Query: 515 GILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKF 694
           GI     GPG  H   G+  A  ++ P+++  G  +    GR  FQE+D ++     +K+
Sbjct: 73  GICFVTRGPGATHAANGVHTAQQDSTPMILFVGQVESAFKGREAFQEVDYVQMFSGLAKW 132

Query: 695 SAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSESEA 835
           + +   I ++P  V      A +GRPG   + LP ++L  +   ++A
Sbjct: 133 AVEIDRIERIPEIVGRAFSVATSGRPGPVVVALPEEILFGSAQVADA 179



>pir|H86777|H86777 hypothetical protein ilvB [imported] -
           Lactococcus lactis subsp. lactis (strain
           IL1403)>gb:AE006354_218126 Lactococcus lactis subsp.
           lactis IL1403 section 116 of 218 of the complete
           genome.>gb:AE005176_1095199 Lactococcus lactis subsp.
           lactis IL1403, complete genome.
          Length = 540

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 38/131 (29%), Positives = 67/131 (51%)
 Frame = +2

Query: 434 GIRFIAFHNEQXXXXXXXXXXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISG 613
           GI+ I   +EQ            +G+ G+++  SGPG  + + G+++A +++ PL++ +G
Sbjct: 13  GIQHILARHEQGATHEAEGYAKSSGKVGVVVVTSGPGATNAVTGIADAYLDSVPLLVFTG 72

Query: 614 SCDQKDFGRGDFQELDQIEAVKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDL 793
                  G+  FQE D +    P +K++ +  + + +P  V E    A  GRPG   +DL
Sbjct: 73  QVGPLSIGKDAFQEADTVGITAPITKYNYQIRETADIPRIVTEAYYLARTGRPGPVEIDL 132

Query: 794 PSDVLHQTVSE 826
           P DV    V+E
Sbjct: 133 PKDVSTLEVTE 143



>sp|O53250|ILVB_MYCTU Acetolactate synthase (EC 2.2.1.6)
           (Acetohydroxy-acid synthase) (ALS).>pir|F70855|F70855
           probable ilvB protein - Mycobacterium tuberculosis
           (strain H37RV)>gb:BX248344_760385 Mycobacterium bovis
           subsp. bovis AF2122/97 complete genome; segment
           11/14.>gb:BX842581_821098 Mycobacterium tuberculosis
           H37Rv complete genome; segment 10/13.
          Length = 618

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 47/157 (29%), Positives = 75/157 (47%), Gaps = 1/157 (0%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAV-ALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           V  SL   GVD +FG+ G  V  + +    +  +R +   +EQ           +TGR G
Sbjct: 44  VIRSLEELGVDVIFGIPGGAVLPVYDPLFDSKKLRHVLVRHEQGAGHAASGYAHVTGRVG 103

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFS 697
           + +  SGPG  + +  L++A +++ P+V I+G   +   G   FQE D      P +K +
Sbjct: 104 VCMATSGPGATNLVTPLADAQMDSIPVVAITGQVGRGLIGTDAFQEADISGITMPITKHN 163

Query: 698 AKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVL 808
                   +P  + E    AA+GRPG   +D+P DVL
Sbjct: 164 FLVRSGDDIPRVLAEAFHIAASGRPGAVLVDIPKDVL 200



>gb:AF308649_1784819 Solanum ptychanthum biotype imidazolinone
           herbicide resistant acetolactate synthase gene, partial
           cds.>gb:AF308650_1784820 Solanum ptychanthum biotype
           imidazolinone herbicide resistant acetolactate synthase
           gene, partial cds.
          Length = 567

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 39/128 (30%), Positives = 65/128 (50%)
 Frame = +2

Query: 437 IRFIAFHNEQXXXXXXXXXXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGS 616
           IR +   +EQ            TG PG+ +  SGPG  + ++GL++A +++ P+V I+G 
Sbjct: 41  IRNVLPRHEQGGVFAAEGYARATGFPGVCIATSGPGATNLVSGLADALLDSIPIVAITGQ 100

Query: 617 CDQKDFGRGDFQELDQIEAVKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLP 796
             ++  G   FQE   +E  +  +K +    D+  +P  V E    A +GRPG   +D+P
Sbjct: 101 VPRRMIGTDAFQETPIVEVTRSITKHNYLVMDVEDIPRIVREAFFLAKSGRPGPVLIDVP 160

Query: 797 SDVLHQTV 820
            D+  Q V
Sbjct: 161 KDIQQQLV 168



>gb:AF308648_1784818 Solanum ptychanthum biotype imidazolinone
           herbicide sensitive acetolactate synthase gene, partial
           cds.
          Length = 567

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 39/128 (30%), Positives = 65/128 (50%)
 Frame = +2

Query: 437 IRFIAFHNEQXXXXXXXXXXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGS 616
           IR +   +EQ            TG PG+ +  SGPG  + ++GL++A +++ P+V I+G 
Sbjct: 41  IRNVLPRHEQGGVFAAEGYARATGFPGVCIATSGPGATNLVSGLADALLDSIPIVAITGQ 100

Query: 617 CDQKDFGRGDFQELDQIEAVKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLP 796
             ++  G   FQE   +E  +  +K +    D+  +P  V E    A +GRPG   +D+P
Sbjct: 101 VPRRMIGTDAFQETPIVEVTRSITKHNYLVMDVEDIPRIVREAFFLAKSGRPGPVLIDVP 160

Query: 797 SDVLHQTV 820
            D+  Q V
Sbjct: 161 KDIQQQLV 168



>gb:EFI491151_1676384 Endomyces fibuliger ilv2 gene for acetolactate
           synthase.
          Length = 724

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 43/152 (28%), Positives = 74/152 (48%), Gaps = 1/152 (0%)
 Frame = +2

Query: 353 LARAGVDRMFGVVGIPVTSLANRAV-ALGIRFIAFHNEQXXXXXXXXXXXLTGRPGILLT 529
           + R  VD +FG  G  +  + +    +    F+   +EQ            TG+PG++L 
Sbjct: 134 MLRHKVDTVFGYPGGAILPVYDAIYESKNFNFVLPRHEQGAGHMAEGYARATGKPGVVLV 193

Query: 530 VSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAKAT 709
            SGPG  + +  +++A ++  PLV+ +G       G   FQE D I   +  +K++    
Sbjct: 194 TSGPGATNVITPMADALMDGVPLVVFTGQVPTSAIGTDAFQEADVIGISRSCTKWNVMVK 253

Query: 710 DISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
            +S++P  + E  + A +GRPG   +DLP DV
Sbjct: 254 SVSELPRRINEAFEIATSGRPGPVLVDLPKDV 285



>gb:CR380957_1652662 Candida glabrata strain CBS138 chromosome K
           complete sequence.
          Length = 677

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 51/211 (24%), Positives = 93/211 (44%), Gaps = 13/211 (6%)
 Frame = +2

Query: 269 SGSESSVVVHFRDNLMADVDTNMLVAMSLARAGVDRMFGVVG---IPVTSLANRAVALGI 439
           S    +V     DN    +    +    +AR  VD +FG  G   +PV    + +     
Sbjct: 64  SSKLKNVATQKMDNSFVGLTGGQIFNEMMARNNVDTVFGYPGGAILPVYDAIHNSDKF-- 121

Query: 440 RFIAFHNEQXXXXXXXXXXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSC 619
           +F+   +EQ            +G+PG++L  SGPG  + +  +++A  +  P+V+ +G  
Sbjct: 122 KFVLPKHEQGAGHMAEGYARASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQV 181

Query: 620 DQKDFGRGDFQELDQIEAVKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPS 799
                G   FQE D +   +  +K++    +++++P  + E    A +GRPG   +DLP 
Sbjct: 182 PTTAIGTDAFQEADIVGISRSCTKWNVMVKNVAELPLRINEAFQIATSGRPGPVLVDLPK 241

Query: 800 DV----------LHQTVSESEAERLIAEAQD 862
           DV          +  T+  +  ++L A  QD
Sbjct: 242 DVTAAILRTPIPVKSTLPSTALQQLTAGVQD 272



>gb:AY541451_1612670 Helianthus annuus haplotype 1 acetohydroxyacid
           synthase 1 (AHAS1) gene, complete cds.
          Length = 655

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 45/160 (28%), Positives = 78/160 (48%), Gaps = 3/160 (1%)
 Frame = +2

Query: 350 SLARAGVDRMFGVVG---IPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           +L R GV  +F   G   + +     R+    IR +   +EQ            +G PG+
Sbjct: 91  ALEREGVTDVFAYPGGASMEIHQALTRSST--IRNVLPRHEQGGVFAAEGYARASGLPGV 148

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
            +  SGPG  + ++GL++A +++ P+V I+G   ++  G   FQE   +E  +  +K + 
Sbjct: 149 CIATSGPGATNLVSGLADALLDSVPMVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNY 208

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTV 820
              D+  +P  V E    A++GRPG   +D+P D+  Q V
Sbjct: 209 LVLDVEDIPRIVREAFYLASSGRPGPVLIDVPKDIQQQLV 248



>gb:AX768081_1474716 Sequence 3 from Patent WO03044200.
          Length = 568

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 38/128 (29%), Positives = 66/128 (51%)
 Frame = +2

Query: 437 IRFIAFHNEQXXXXXXXXXXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGS 616
           IR +   +EQ            +G PG+ +  SGPG  + ++GL++A +++ P+V I+G 
Sbjct: 34  IRNVLPRHEQGGVFAAEGYARASGLPGVCIATSGPGATNLVSGLADALLDSVPIVAITGQ 93

Query: 617 CDQKDFGRGDFQELDQIEAVKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLP 796
             ++  G   FQE   +E  +  +K +    D+  +P  V E    A++GRPG   +D+P
Sbjct: 94  VSRRMIGTDAFQETPIVEVTRSITKHNYLVLDVEDIPRIVREAFYLASSGRPGPVLIDVP 153

Query: 797 SDVLHQTV 820
            D+  Q V
Sbjct: 154 KDIQQQLV 161



>gb:BX936398_834779 Yersinia pseudotuberculosis IP32953 genome,
           complete sequence.
          Length = 548

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 41/155 (26%), Positives = 72/155 (46%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           V  +L   GVD +FG  G  +  + +     G+  +   +EQ            TG+ G+
Sbjct: 7   VVQALRAQGVDTVFGYPGGAIMPVYDALYDGGVEHLLCRHEQGAAIAAIGYARATGKVGV 66

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
            +  SGPG  + + GL++A +++ P++ I+G       G   FQE+D +      +K S 
Sbjct: 67  CIATSGPGATNLITGLADALLDSVPVIAITGQVGSALIGTDAFQEIDVLGLSLACTKHSF 126

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
               +  +P  + E    A +GRPG   +D+P D+
Sbjct: 127 LVESLDALPEIMAEAFAIATSGRPGPVLIDIPKDI 161



>gb:AY785370_646010 Streptomyces cinnamonensis unknown gene, partial
           cds; and putative leader peptide and acetohydroxy acid
           synthase large subunit (ilvB) genes, complete cds.
          Length = 615

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 48/181 (26%), Positives = 80/181 (44%), Gaps = 1/181 (0%)
 Frame = +2

Query: 269 SGSESSVVVHFRDNLMADVDTNMLVAMSLARAGVDRMFGVVGIPVTSLANRAV-ALGIRF 445
           SG +S+ V H        V     +  SL   G D +FG+ G  +    +  + +  +R 
Sbjct: 18  SGQQSAPVEH--------VTGAQSLIRSLEEVGADTVFGIPGGAILPAYDPMMDSTRVRH 69

Query: 446 IAFHNEQXXXXXXXXXXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQ 625
           +   +EQ            TG+ G+ +  SGPG  + +  +++A +++ PLV I+G    
Sbjct: 70  VLVRHEQGAGHAATGYAQATGKVGVCMATSGPGATNLVTPIADAHMDSVPLVAITGQVAS 129

Query: 626 KDFGRGDFQELDQIEAVKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           K  G   FQE D +    P +K +   T    +P  + E    A+ GRPG   +D+  D 
Sbjct: 130 KAIGTDAFQEADIVGITMPITKHNFLVTKAEDIPRTIAEAFHIASTGRPGPVLVDIAKDA 189

Query: 806 L 808
           L
Sbjct: 190 L 190



>gb:TACID3_196459 Thermoplasma acidophilum complete genome; segment
           3/5.
          Length = 553

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 43/162 (26%), Positives = 79/162 (48%), Gaps = 6/162 (3%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPG 517
           ++A  L R GV+ +F + G  + SL        I+ +A  +EQ            + +PG
Sbjct: 13  IIAEYLERNGVEYVFTLTGHTILSLYEAIRKTKIKLVAVRHEQIAAHAADGYFRASHKPG 72

Query: 518 ILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVK------ 679
           +++T  GPG ++   G++ AA+++ PL++ISG       G G  QE++Q+  +       
Sbjct: 73  VVITHIGPGLLNATTGVATAALDSSPLIVISGDAPSVYEGAGPHQEINQVTDLSQYLVYV 132

Query: 680 PFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
           PF+K + +   +  +   +      A  GRPG   +D+P D+
Sbjct: 133 PFAKRAWRINHVENIERIMDRAFSIALDGRPGVSLVDVPMDI 174



>pir|AC0475|AC0475 acetolactate synthase (EC 4.1.3.18) isozyme II
           large chain [imported] [imported] - Yersinia pestis
           (strain CO92)>gb:AE013633_298669 Yersinia pestis KIM
           section 33 of 415 of the complete
           genome.>gb:AE017139_388894 Yersinia pestis biovar
           Medievalis str. 91001 section 13 of 16 of the complete
           genome.>gb:AJ414159_525656 Yersinia pestis strain CO92
           complete genome; segment 19/20.>gb:AE009952_928852
           Yersinia pestis KIM complete genome.>gb:AE017042_1145460
           Yersinia pestis biovar Medievalis str. 91001 complete
           genome.
          Length = 548

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 41/155 (26%), Positives = 72/155 (46%)
 Frame = +2

Query: 341 VAMSLARAGVDRMFGVVGIPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGI 520
           V  +L   GVD +FG  G  +  + +     G+  +   +EQ            TG+ G+
Sbjct: 7   VVQALRAQGVDTVFGYPGGAIMPVYDALYDGGVEHLLCRHEQGAAIAAIGYARATGKVGV 66

Query: 521 LLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSA 700
            +  SGPG  + + GL++A +++ P++ I+G       G   FQE+D +      +K S 
Sbjct: 67  CIATSGPGATNLITGLADALLDSVPVIAITGQVGSALIGTDAFQEIDVLGLSLACTKHSF 126

Query: 701 KATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDV 805
               +  +P  + E    A +GRPG   +D+P D+
Sbjct: 127 LVESLDALPEIMAEAFAIATSGRPGPVLIDIPKDI 161



>pir|S39111|S39111 acetolactate synthase (EC 4.1.3.18) precursor -
           fission yeast (Schizosaccharomyces
           pombe)>gb:YSPILV1A_1731133 Schizosaccharomyces pombe
           acetolactate synthase (ilv1) gene, exon 1.
          Length = 669

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 45/161 (27%), Positives = 75/161 (46%), Gaps = 3/161 (1%)
 Frame = +2

Query: 353 LARAGVDRMFGVVG---IPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGIL 523
           + +  V  +FG  G   +PV     R+      FI   +EQ           +T +PG++
Sbjct: 97  MLKHNVKHVFGYPGGAILPVFDAIYRSPHF--EFILPRHEQAAGHAAQAYSRVTKKPGVV 154

Query: 524 LTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAK 703
           L  SGPG  + +  +++A  +  PLV+ SG       G   FQE D +   +  +K++  
Sbjct: 155 LVTSGPGATNVITPIADALADGTPLVVFSGQVATSAIGSDAFQEADMVGISRSCTKWNVM 214

Query: 704 ATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSE 826
             D++ +P  + E  + A +GRPG   +DLP DV    + E
Sbjct: 215 VKDVADLPRRIDEAFEIATSGRPGPVLVDLPKDVTASVLKE 255



>sp|P36620|ILVB_SCHPO Acetolactate synthase, mitochondrial precursor
           (EC 2.2.1.6) (Acetohydroxy-acid synthase) (ALS)
           (AHAS).>gb:SPBP35G2_1720616 S.pombe chromosome II P1
           p35G2.
          Length = 669

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 45/161 (27%), Positives = 75/161 (46%), Gaps = 3/161 (1%)
 Frame = +2

Query: 353 LARAGVDRMFGVVG---IPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTGRPGIL 523
           + +  V  +FG  G   +PV     R+      FI   +EQ           +T +PG++
Sbjct: 97  MLKHNVKHVFGYPGGAILPVFDAIYRSPHF--EFILPRHEQAAGHAAQAYSRVTKKPGVV 154

Query: 524 LTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSKFSAK 703
           L  SGPG  + +  +++A  +  PLV+ SG       G   FQE D +   +  +K++  
Sbjct: 155 LVTSGPGATNVITPIADALADGTPLVVFSGQVATSAIGSDAFQEADMVGISRSCTKWNVM 214

Query: 704 ATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQTVSE 826
             D++ +P  + E  + A +GRPG   +DLP DV    + E
Sbjct: 215 VKDVADLPRRIDEAFEIATSGRPGPVLVDLPKDVTASVLKE 255



>sp|P09114|ILV2_TOBAC Acetolactate synthase II, chloroplast
           precursor (EC 2.2.1.6) (Acetohydroxy-acid synthase II)
           (ALS II).>pir|S00546|YCNT2 acetolactate synthase (EC
           4.1.3.18) class II precursor - common
           tobacco>gb:NTALSURB_1691462 Tobacco acetolactate
           synthase gene, ALS SuRB (EC 4.1.3.18).
          Length = 664

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 39/128 (30%), Positives = 65/128 (50%)
 Frame = +2

Query: 437 IRFIAFHNEQXXXXXXXXXXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGS 616
           IR +   +EQ            TG PG+ +  SGPG  + ++GL++A +++ P+V I+G 
Sbjct: 130 IRNVLPRHEQGGVFAAEGYARATGFPGVCIATSGPGATNLVSGLADALLDSVPIVAITGQ 189

Query: 617 CDQKDFGRGDFQELDQIEAVKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLP 796
             ++  G   FQE   +E  +  +K +    D+  +P  V E    A +GRPG   +D+P
Sbjct: 190 VPRRMIGTDAFQETPIVEVTRSITKHNYLVMDVEDIPRVVREAFFLARSGRPGPVLIDVP 249

Query: 797 SDVLHQTV 820
            D+  Q V
Sbjct: 250 KDIQQQLV 257



>sp|P09342|ILV1_TOBAC Acetolactate synthase I, chloroplast precursor
           (EC 2.2.1.6) (Acetohydroxy-acid synthase I) (ALS
           I).>pir|S00545|YCNT1 acetolactate synthase (EC 4.1.3.18)
           class I precursor - common tobacco>gb:NTALSURA_1691461
           Tobacco acetolactate synthase gene, ALS SuRA (EC
           4.1.3.18).
          Length = 667

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 39/128 (30%), Positives = 65/128 (50%)
 Frame = +2

Query: 437 IRFIAFHNEQXXXXXXXXXXXLTGRPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGS 616
           IR +   +EQ            TG PG+ +  SGPG  + ++GL++A +++ P+V I+G 
Sbjct: 133 IRNVLPRHEQGGVFAAEGYARATGFPGVCIATSGPGATNLVSGLADALLDSVPIVAITGQ 192

Query: 617 CDQKDFGRGDFQELDQIEAVKPFSKFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLP 796
             ++  G   FQE   +E  +  +K +    D+  +P  V E    A +GRPG   +D+P
Sbjct: 193 VPRRMIGTDAFQETPIVEVTRSITKHNYLVMDVEDIPRVVREAFFLARSGRPGPILIDVP 252

Query: 797 SDVLHQTV 820
            D+  Q V
Sbjct: 253 KDIQQQLV 260



>gb:RRA344990_1703952 Raphanus raphanistrum partial als gene for
           putative acetolactate synthase, specimen voucher
           161825R0.
          Length = 585

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 45/161 (27%), Positives = 80/161 (49%), Gaps = 2/161 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVGIPVTSLANRAVALG--IRFIAFHNEQXXXXXXXXXXXLTGR 511
           ++  +L R GV+ +F   G   +   ++A+     IR +   +EQ            +G+
Sbjct: 17  ILVEALERQGVETVFAYPG-GASMXIHQALTRSSTIRNVLPRHEQGGVFAAEGYARSSGK 75

Query: 512 PGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFSK 691
           PGI +  SGPG  + ++GL++A +++ PLV I+G   ++  G   FQE   +E  +  +K
Sbjct: 76  PGICIATSGPGATNLVSGLADAMLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITK 135

Query: 692 FSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ 814
            +     +  +P  V E    A +GRPG   +D+P D+  Q
Sbjct: 136 HNYLVMXVDDIPRIVQEAFFLATSGRPGPVLVDVPKDIQQQ 176



>gb:RRA344985_1703947 Raphanus raphanistrum partial als gene for
           putative acetolactate synthase, specimen voucher
           161653S2.
          Length = 585

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 45/162 (27%), Positives = 79/162 (48%), Gaps = 3/162 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVG---IPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTG 508
           ++  +L R GV+ +F   G   + +     R+    IR +   +EQ            +G
Sbjct: 17  ILVEALERQGVETVFAYPGGASMEIHQALTRSST--IRNVLPRHEQGGVFAAEGYARSSG 74

Query: 509 RPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFS 688
           +PGI +  SGPG  + ++GL++A +++ PLV I+G   ++  G   FQE   +E  +  +
Sbjct: 75  KPGICIATSGPGATNLVSGLADAMLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSIT 134

Query: 689 KFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ 814
           K +     +  +P  V E    A +GRPG   +D+P D+  Q
Sbjct: 135 KHNYLVMXVDDIPRIVQEAFFLATSGRPGPVLVDVPKDIQQQ 176



>gb:RRA344984_1703946 Raphanus raphanistrum partial als gene for
           putative acetolactate synthase, specimen voucher
           161653S1.
          Length = 585

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 45/162 (27%), Positives = 79/162 (48%), Gaps = 3/162 (1%)
 Frame = +2

Query: 338 LVAMSLARAGVDRMFGVVG---IPVTSLANRAVALGIRFIAFHNEQXXXXXXXXXXXLTG 508
           ++  +L R GV+ +F   G   + +     R+    IR +   +EQ            +G
Sbjct: 17  ILVEALERQGVETVFAYPGGASMEIHQALTRSST--IRNVLPRHEQGGVFAAEGYARSSG 74

Query: 509 RPGILLTVSGPGCVHGLAGLSNAAVNTWPLVMISGSCDQKDFGRGDFQELDQIEAVKPFS 688
           +PGI +  SGPG  + ++GL++A +++ PLV I+G   ++  G   FQE   +E  +  +
Sbjct: 75  KPGICIATSGPGATNLVSGLADAMLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSIT 134

Query: 689 KFSAKATDISKVPACVFEVLDWAAAGRPGGCYLDLPSDVLHQ 814
           K +     +  +P  V E    A +GRPG   +D+P D+  Q
Sbjct: 135 KHNYLVMXVDDIPRIVQEAFFLATSGRPGPVLVDVPKDIQQQ 176


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 930,007,764
Number of Sequences: 1806583
Number of extensions: 20412746
Number of successful extensions: 62296
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 58745
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 62114
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 58632447358
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)