BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig1943
         (656 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T49181|T49181 cyclophylin-like protein - Arabidopsis thalian...   174   4e-54   Arabidopsis thaliana [mouse-ear cress]
gb:AY568527_1615465 Arabidopsis thaliana multidomain cyclophilin...   174   4e-54   
gb:AY217752_1590149 Triticum aestivum cyclophilin-like protein (...   158   5e-47   
gb:AK003402_1151842 Mus musculus 18-day embryo whole body cDNA, ...   154   9e-46   
sp|Q9CR16|PPID_MOUSE|PPID_MOUSE 40 kDa peptidyl-prolyl cis-trans isomerase ...   154   9e-46   Mus musculus [mouse]
gb:BC076386_2106753 Rattus norvegicus peptidylprolyl isomerase D...   154   1e-45   
gb:BC071388_2556129 Danio rerio zgc:86711, mRNA (cDNA clone MGC:...   157   3e-45   
pir|A46579|A46579 estrogen receptor-binding cyclophilin - bovine...   153   1e-44   Bos taurus [bovine]
sp|P26882|PPID_BOVIN|PPID_BOVIN 40 kDa peptidyl-prolyl cis-trans isomerase ...   153   1e-44   Bos taurus [bovine]
gb:CR542081_1994307 Homo sapiens full open reading frame cDNA cl...   152   2e-44   
pir|A45981|A45981 peptidylprolyl isomerase (EC 5.2.1.8) CyP-40 -...   152   2e-44   Homo sapiens [man]
sp|Q08752|PPID_HUMAN|PPID_HUMAN 40 kDa peptidyl-prolyl cis-trans isomerase ...   152   2e-44   Homo sapiens [man]
gb:BC082380_2562617 Xenopus laevis MGC81732 protein, mRNA (cDNA ...   152   2e-43   
gb:TGU04634_1400203 Toxoplasma gondii Rh 20 kDa cyclophilin prec...   145   3e-43   
pir|B53522|B53522 20k cyclophilin - Toxoplasma gondii (fragment)      145   3e-43   Toxoplasma gondii
gb:AP004741_1844182 Oryza sativa (japonica cultivar-group) genom...   153   5e-43   
pir|T50768|T50768 peptidylprolyl isomerase (EC 5.2.1.8) [similar...   146   5e-43   Digitalis lanata [Grecian foxglove]
pir|S48018|S48018 peptidylprolyl isomerase (EC 5.2.1.8) Cyp1 - r...   148   2e-42   Oryza sativa [red rice]
gb:BC061335_2553111 Xenopus tropicalis hypothetical protein MGC7...   147   2e-42   
gb:RCO245940_1703385 Ricinus communis mRNA for cyclophilin (cyp1...   144   3e-42   
gb:AY705800_1179907 Pinus halepensis clone 17r cyclophilin mRNA,...   143   3e-42   
pir|T50769|T50769 peptidylprolyl isomerase (EC 5.2.1.8) CYP18 [s...   145   4e-42   Digitalis lanata [Grecian foxglove]
gb:CR382133_1666890 Debaryomyces hansenii chromosome A of strain...   145   6e-42   
pir|T07950|T07950 peptidylprolyl isomerase (EC 5.2.1.8) 1 - Chla...   141   6e-42   Chlamydomonas reinhardtii
sp|Q39613|CYPH_CATRO|CYPH_CATRO Peptidyl-prolyl cis-trans isomerase (EC 5.2...   142   1e-41   Catharanthus roseus [chatas]
gb:PAB271126_1698633 Picea abies mRNA for putative cyclosporin A...   140   2e-41   
gb:AB020612_1514551 Vigna radiata mRNA for CYP1, complete cds.        144   3e-41   
sp|P73789|PPI2_SYNY3|PPI2_SYNY3 Peptidyl-prolyl cis-trans isomerase slr1251...   152   4e-41   Synechocystis sp.
gb:ATU40400_1556976 Arabidopsis thaliana cytosolic cyclophilin (...   148   5e-41   
pir|T50767|T50767 peptidylprolyl isomerase (EC 5.2.1.8) ATCYP4 [...   148   5e-41   Arabidopsis thaliana [mouse-ear cress]
pir|T47724|T47724 peptidylprolyl isomerase (EC 5.2.1.8) ROC2 - A...   148   5e-41   Arabidopsis thaliana [mouse-ear cress]
gb:AY229877_1591321 Populus tremuloides cyclophilin mRNA, comple...   140   5e-41   
gb:AF456323_1801173 Glycine max cyclophilin (Cyp) mRNA, complete...   142   6e-41   
gb:AY456122_1607156 Triticum aestivum cyclophilin A (CYP18-2) ge...   142   6e-41   
pir|S54833|S54833 peptidylprolyl isomerase (EC 5.2.1.8) Cyp - ki...   141   6e-41   Phaseolus vulgaris [French bean]
gb:AY775573_1628283 Codonopsis lanceolata cyclophilin 1 (CyP1) m...   148   8e-41   
sp|Q9P3X9|PPID_NEUCR|PPID_NEUCR 41 kDa peptidyl-prolyl cis-trans isomerase ...   148   1e-40   
gb:AY773481_1628186 Amanita muscaria 40 kDa cyclophilin (Cyp40) ...   150   1e-40   
gb:AF262982_1781650 Triticum aestivum cyclophilin A-1 (CyP1) mRN...   142   1e-40   
gb:BC067931_2554916 Xenopus tropicalis hypothetical protein MGC6...   149   1e-40   
sp|P21568|CYPH_LYCES|CYPH_LYCES Peptidyl-prolyl cis-trans isomerase (EC 5.2...   139   1e-40   Solanum lycopersicum
gb:AY392408_1604713 Thellungiella halophila cyclophilin mRNA, co...   140   2e-40   
gb:BVE311666_1643105 Betula verrucosa mRNA for peptidylprolyl is...   138   2e-40   
sp|Q13427|PPIG_HUMAN|PPIG_HUMAN Peptidyl-prolyl cis-trans isomerase G (EC 5...   145   3e-40   Homo sapiens [man]
gb:BC085963_2564558 Xenopus laevis hypothetical LOC495525, mRNA ...   145   3e-40   
gb:BC085723_2109296 Rattus norvegicus cDNA clone MGC:93333 IMAGE...   145   3e-40   
sp|O55035|PPIG_RAT|PPIG_RAT Peptidyl-prolyl cis-trans isomerase G (EC 5.2...   145   3e-40   Rattus norvegicus [brown rat]
gb:BC073875_1989152 Homo sapiens peptidyl-prolyl isomerase G (cy...   145   3e-40   
gb:AP004159_1838390 Oryza sativa (japonica cultivar-group) genom...   145   3e-40   
gb:BC001555_1967676 Homo sapiens peptidyl-prolyl isomerase G (cy...   145   3e-40   
gb:BC063711_1986345 Homo sapiens peptidyl-prolyl isomerase G (cy...   145   3e-40   
gb:BC048905_2099865 Mus musculus peptidyl-prolyl isomerase G (cy...   145   3e-40   
gb:AY652862_1620183 Populus balsamifera subsp. trichocarpa pepti...   143   3e-40   
pir|A39252|CSTO peptidylprolyl isomerase (EC 5.2.1.8) - tomato        139   3e-40   
pir|T50771|T50771 peptidylprolyl isomerase (EC 5.2.1.8) [similar...   138   3e-40   Solanum tuberosum [potatoes]
pir|S48017|S48017 peptidylprolyl isomerase (EC 5.2.1.8) Cyp2 - r...   143   4e-40   Oryza sativa [red rice]
sp|P52015|CYP7_CAEEL|CYP7_CAEEL Peptidyl-prolyl cis-trans isomerase 7 (EC 5...   141   4e-40   Caenorhabditis elegans [roundworm]
gb:AY429574_1605886 Populus alba x Populus tremula clone INRA 71...   138   4e-40   
gb:CEU27559_1368480 Caenorhabditis elegans cyclophilin (cyp-7) m...   141   7e-40   
pir|S50141|S50141 peptidylprolyl isomerase (EC 5.2.1.8) - Arabid...   138   7e-40   Arabidopsis thaliana [mouse-ear cress]
sp|O49886|CYPH_LUPLU|CYPH_LUPLU Peptidyl-prolyl cis-trans isomerase (EC 5.2...   137   9e-40   Lupinus luteus
gb:AY150052_1584922 Kandelia candel cyclophilin (Cyp1) mRNA, com...   134   9e-40   
gb:OVU70827_1391510 Onchocerca volvulus cyclophilin (Ovcyp-1) mR...   142   1e-39   
gb:OVU47812_1391506 Onchocerca volvulus cyclophilin Ovcyp-2 mRNA...   141   1e-39   
pir|T50770|T50770 peptidylprolyl isomerase (EC 5.2.1.8) vcCyP [s...   140   1e-39   Vicia faba [broad bean]
gb:AF424658_1798993 Phytophthora infestans clone MY-08-C-01 pept...   139   1e-39   
gb:DIU47813_1377748 Dirofilaria immitis cyclophilin Dicyp-2 mRNA...   136   1e-39   
gb:BC071449_2556189 Danio rerio peptidyl-prolyl isomerase G (cyc...   143   2e-39   
gb:BC072740_2556670 Xenopus laevis hypothetical protein LOC44358...   147   2e-39   
gb:RICCYP2R_1703598 Oryza sativa cyclophilin 2 (Cyp2) mRNA, comp...   141   2e-39   
sp|P34790|CYP1_ARATH|CYP1_ARATH Peptidyl-prolyl cis-trans isomerase (EC 5.2...   139   2e-39   Arabidopsis thaliana [mouse-ear cress]
sp|P21569|CYPH_MAIZE|CYPH_MAIZE Peptidyl-prolyl cis-trans isomerase (EC 5.2...   138   2e-39   Zea mays [maize]
pir|D84533|D84533 hypothetical protein At2g15790 [imported] - Ar...   148   3e-39   Arabidopsis thaliana [mouse-ear cress]
gb:AC006438_1534276 Arabidopsis thaliana chromosome 2 clone F19G...   148   3e-39   
pir|T50772|T50772 peptidylprolyl isomerase (EC 5.2.1.8) CYP2 [si...   140   4e-39   Arabidopsis thaliana [mouse-ear cress]
pir|E84597|E84597 cyclophilin (CYP2) [imported] - Arabidopsis th...   140   4e-39   Arabidopsis thaliana [mouse-ear cress]
gb:TCR010066_1399749 Trypanosoma cruzi cyp gene.                      134   5e-39   
gb:BT001578_1356351 Drosophila melanogaster RE23622 full insert ...   142   9e-39   
gb:AE014297_1141825 Drosophila melanogaster chromosome 3R, compl...   142   9e-39   
gb:AY134669_1302795 Drosophila melanogaster peptidylprolyl cis-t...   142   9e-39   
gb:BC044189_2548577 Danio rerio peptidyl-prolyl isomerase G (cyc...   140   1e-38   
gb:CR382129_1661993 Yarrowia lipolytica chromosome C of strain C...   139   3e-38   
gb:BMU47811_1355691 Brugia malayi cyclophilin Bmcyp-2 mRNA, comp...   130   4e-38   
gb:AF053068_1236807 Dictyostelium discoideum cyclophilin B (CypB...   145   5e-38   
sp|Q27450|CYP1_BRUMA|CYP1_BRUMA Peptidylprolyl isomerase 1 (EC 5.2.1.8) (Pe...   139   6e-38   Brugia malayi [agent of lymphatic filariasis]
pir|T02489|T02489 peptidylprolyl isomerase (EC 5.2.1.8) F23F1.12...   142   6e-38   Arabidopsis thaliana [mouse-ear cress]
pir|T50837|T50837 peptidylprolyl isomerase (EC 5.2.1.8) CYP5 [si...   142   8e-38   Arabidopsis thaliana [mouse-ear cress]
sp|P52009|CYP1_CAEEL|CYP1_CAEEL Peptidyl-prolyl cis-trans isomerase 1 (EC 5...   134   8e-38   Caenorhabditis elegans [roundworm]
gb:DIU70884_1377758 Dirofilaria immitis cyclophilin 1 mRNA, part...   139   8e-38   
gb:AY088764_1573777 Arabidopsis thaliana clone 94608 mRNA, compl...   140   1e-37   
pir|S71219|S71219 peptidylprolyl isomerase (EC 5.2.1.8) ROC3 - A...   137   1e-37   Arabidopsis thaliana [mouse-ear cress]
sp|P52011|CYP3_CAEEL|CYP3_CAEEL Peptidyl-prolyl cis-trans isomerase 3 (EC 5...   140   1e-37   Caenorhabditis elegans [roundworm]
pir|B39252|CSRP peptidylprolyl isomerase (EC 5.2.1.8) - rape          136   2e-37   
gb:AY678298_1622003 Lycopersicon esculentum clone 56B23 chromoso...   138   2e-37   
gb:AY085875_1570939 Arabidopsis thaliana clone 19211 mRNA, compl...   140   2e-37   
gb:AY389742_1178349 Hyacinthus orientalis cyclophilin mRNA, comp...   126   2e-37   
gb:BOVCYC40B_1435373 Cow cyclophilin-40 mRNA, partial cds.            153   3e-37   
gb:AY290733_1595602 Triticum aestivum cyclophilin mRNA, partial ...   137   3e-37   
gb:AY543004_1334460 Bigelowiella natans cyclophilin mRNA, comple...   140   3e-37   
gb:SCU92087_1710610 Solanum commersonii stress responsive cyclop...   128   3e-37   
gb:AF242312_1780142 Euphorbia esula cyclophilin mRNA, partial cds.    139   3e-37   
gb:LMFL2581_1387885 Leishmania major Friedlin chromosome 23 cosm...   127   4e-37   
sp|P24525|CYPH_BRANA|CYPH_BRANA Peptidyl-prolyl cis-trans isomerase (EC 5.2...   136   4e-37   Brassica napus [oilseed rape]
sp|P35627|CYP2_ARATH|CYP2_ARATH Peptidyl-prolyl cis-trans isomerase (EC 5.2...   139   4e-37   Arabidopsis thaliana [mouse-ear cress]
gb:AF279458_2061297 Mus musculus Ran-binding protein 2 gene, com...   123   8e-37   
gb:BC030915_2096917 Mus musculus RAN binding protein 2, mRNA (cD...   123   8e-37   
gb:AP003621_1831597 Oryza sativa (japonica cultivar-group) genom...   134   2e-36   
gb:AP003621_1831598 Oryza sativa (japonica cultivar-group) genom...   134   2e-36   
pir|T50838|T50838 peptidylprolyl isomerase (EC 5.2.1.8) ROC7 [si...   137   2e-36   Arabidopsis thaliana [mouse-ear cress]
gb:BNACYP_1633431 Brassica napus cyclophilin (CyP) mRNA, 3' end.      136   2e-36   
gb:AP003621_1831596 Oryza sativa (japonica cultivar-group) genom...   132   2e-36   
gb:AY362759_1322644 Chlamys farreri cyclophilin A mRNA, complete...   126   2e-36   
gb:AF291180_1783697 Capsicum annuum cyclophilin CACYP1 mRNA, com...   128   2e-36   
gb:PFMAL3P7_1394593 Plasmodium falciparum MAL3P7, complete seque...   132   3e-36   
gb:AF017993_1232987 Entamoeba histolytica cyclophilin (CYP1) mRN...   129   3e-36   
sp|P54985|CYPH_BLAGE|CYPH_BLAGE Peptidyl-prolyl cis-trans isomerase (EC 5.2...   124   4e-36   Blattella germanica
pir|S58884|S58884 Ran-binding protein 2 - human>gb:HUMRANBP2_203...   119   5e-36   Homo sapiens [man]
sp|P49792|RBP2_HUMAN|RBP2_HUMAN Ran-binding protein 2 (RanBP2) (Nuclear por...   119   5e-36   Homo sapiens [man]
gb:AY170823_1937714 Homo sapiens transformation-related protein ...   119   5e-36   
gb:AY170822_1937713 Homo sapiens transformation-related protein ...   119   5e-36   
gb:BC005982_1969983 Homo sapiens peptidylprolyl isomerase A (cyc...   124   9e-36   
pir|S25443|CSBY peptidylprolyl isomerase (EC 5.2.1.8), cytosolic...   130   9e-36   
sp|P14832|CYPH_YEAST|CYPH_YEAST Peptidyl-prolyl cis-trans isomerase (EC 5.2...   130   9e-36   Saccharomyces cerevisiae [brewer's yeast]
gb:PME132763_1700771 Pseudotsuga menziesii mRNA for cyclophilin.      117   1e-35   
gb:AF139893_1414924 Oryctolagus cuniculus cyclophilin 18 mRNA, c...   123   1e-35   
gb:CR456707_1992914 Homo sapiens full open reading frame cDNA cl...   123   2e-35   
pir|A94496|CSHUA peptidylprolyl isomerase (EC 5.2.1.8) A - human...   123   2e-35   
sp|P05092|PPIA_HUMAN|PPIA_HUMAN Peptidyl-prolyl cis-trans isomerase A (EC 5...   123   2e-35   Homo sapiens [man]
pir|S07597|CSHYAC peptidylprolyl isomerase (EC 5.2.1.8) A - Chin...   122   2e-35   
sp|P14851|PPIA_CRILO|PPIA_CRILO Peptidyl-prolyl cis-trans isomerase A (EC 5...   122   2e-35   Cricetulus longicaudatus [lesser long-tailed hamster]
gb:AY684994_1958784 Aotus trivirgatus TRIM5/cyclophilin A V4 fus...   122   2e-35   
gb:AY646198_1958001 Aotus trivirgatus TRIM5/cyclophilin A fusion...   122   2e-35   
gb:AY684992_1958782 Aotus trivirgatus TRIM5/cyclophilin A V2 fus...   122   2e-35   
gb:BX294148_769820 Pirellula sp. strain 1 complete genome; segme...   135   2e-35   
gb:AY646199_1958002 Aotus trivirgatus TRIM5/cyclophilin A fusion...   122   2e-35   
gb:AY266299_1428139 Sus scrofa peptidyl-prolyl cis-trans isomera...   122   2e-35   
gb:AY029366_1424135 Felis catus cyclophilin A (cypA) mRNA, compl...   122   2e-35   
pir|A29819|CSRTA peptidylprolyl isomerase (EC 5.2.1.8) A - rat>g...   122   2e-35   
sp|P10111|PPIA_RAT|PPIA_RAT Peptidyl-prolyl cis-trans isomerase A (EC 5.2...   122   2e-35   Rattus norvegicus [brown rat]
sp|P04374|PPIA_BOVIN|PPIA_BOVIN Peptidyl-prolyl cis-trans isomerase A (EC 5...   122   2e-35   Bos taurus [bovine]
gb:AY247029_1427948 Bos taurus peptidylprolyl isomerase A mRNA, ...   122   2e-35   
gb:AB099010_1410333 Bos taurus mRNA for similar to peptidylproly...   122   2e-35   
pir|B47328|B47328 natural killer cell tumor-recognition protein ...   137   3e-35   Mus sp. [mice]
gb:MUSCYCLORA_2125622 Mus musculus cyclophilin-related protein m...   137   3e-35   
sp|P30414|NKCR_HUMAN|NKCR_HUMAN NK-tumor recognition protein (Natural-kille...   137   3e-35   Homo sapiens [man]
sp|P30415|NKCR_MOUSE|NKCR_MOUSE NK-tumor recognition protein (Natural-kille...   137   3e-35   Mus musculus [mouse]
pir|A47328|A47328 natural killer cell tumor-recognition protein ...   137   3e-35   Homo sapiens [man]
gb:AK035582_1164158 Mus musculus adult male urinary bladder cDNA...   137   3e-35   
gb:MMNKTR2_2116730 Mus musculus natural killer tumor recognition...   137   3e-35   
gb:AY594335_1431715 Bos taurus cyclophilin F mRNA, complete cds.      122   3e-35   
gb:AF542516_1810034 Beauveria bassiana cyclophilin A mRNA, compl...   124   3e-35   
gb:AY646200_1958003 Aotus trivirgatus cyclophilin A mRNA, comple...   122   3e-35   
gb:AF222790_1252586 Theileria parva cyclophilin 1 mRNA, complete...   126   3e-35   
gb:AF222791_1252587 Theileria parva cyclophilin 1 gene, partial ...   126   3e-35   
gb:AJ719394_2501581 Gallus gallus mRNA for hypothetical protein,...   122   6e-35   
pir|F84808|F84808 probable peptidyl-prolyl cis-trans isomerase [...   115   6e-35   Arabidopsis thaliana [mouse-ear cress]
gb:AY349021_1321768 Trypanosoma cruzi 21 kDa cyclophilin mRNA, c...   122   6e-35   
gb:AF025804_1234141 Drosophila subobscura cyclophilin 1 (Cyp1) m...   123   6e-35   
gb:BC081399_2562278 Danio rerio peptidylprolyl isomerase F (cycl...   123   8e-35   
gb:AF121347_1242874 Dictyostelium discoideum cyclophilin D (cypD...   133   8e-35   
sp|P52010|CYP2_CAEEL|CYP2_CAEEL Peptidyl-prolyl cis-trans isomerase 2 (EC 5...   129   8e-35   Caenorhabditis elegans [roundworm]
gb:CR859672_1183778 Pongo pygmaeus mRNA; cDNA DKFZp459I0834 (fro...   123   8e-35   
gb:AY346337_1321667 Branchiostoma belcheri tsingtaunese cyclophi...   125   8e-35   
gb:AX887972_1483425 Sequence 3835 from Patent EP1033401.              120   1e-34   
sp|P29117|PPIF_RAT|PPIF_RAT Peptidyl-prolyl cis-trans isomerase, mitochon...   119   2e-34   Rattus norvegicus [brown rat]
gb:BC007104_1970526 Homo sapiens peptidylprolyl isomerase A (cyc...   119   2e-34   
gb:AB125939_1528236 Malassezia pachydermatis CYP mRNA for cyclop...   133   2e-34   
gb:AF078071_1766252 Griffithsia japonica cyclophilin (cypA) mRNA...   126   2e-34   
sp|P91791|CYPH_HEMPU|CYPH_HEMPU Peptidyl-prolyl cis-trans isomerase (EC 5.2...   125   2e-34   Hemicentrotus pulcherrimus
gb:AY091023_1574254 Arabidopsis thaliana unknown protein (At4g32...   117   2e-34   
gb:AE016820_1749778 Ashbya gossypii (= Eremothecium gossypii) AT...   125   2e-34   
pir|S10327|CSMSA peptidylprolyl isomerase (EC 5.2.1.8) A - mouse...   122   2e-34   
sp|P17742|PPIA_MOUSE|PPIA_MOUSE Peptidyl-prolyl cis-trans isomerase A (EC 5...   122   2e-34   Mus musculus [mouse]
sp|P34887|CYPH_ALLCE|CYPH_ALLCE Peptidyl-prolyl cis-trans isomerase (EC 5.2...   140   2e-34   Allium cepa
sp|Q99KR7|PPIF_MOUSE|PPIF_MOUSE Peptidyl-prolyl cis-trans isomerase, mitoch...   119   3e-34   Mus musculus [mouse]
gb:BX842633_1644033 Neurospora crassa DNA linkage group I cosmid...   116   3e-34   
sp|P18253|CYPH_SCHPO|CYPH_SCHPO Peptidyl-prolyl cis-trans isomerase (EC 5.2...   129   3e-34   Schizosaccharomyces pombe
gb:CR382126_1658575 Kluyveromyces lactis strain NRRL Y-1140 chro...   119   4e-34   
sp|Q9D868|PPIH_MOUSE|PPIH_MOUSE Peptidyl-prolyl cis-trans isomerase H (EC 5...   118   4e-34   Mus musculus [mouse]
gb:BT019342_2151301 Synthetic construct Homo sapiens peptidyl pr...   118   4e-34   
gb:CR541899_1994126 Homo sapiens full open reading frame cDNA cl...   118   4e-34   
sp|O43447|PPIH_HUMAN|PPIH_HUMAN Peptidyl-prolyl cis-trans isomerase H (EC 5...   118   4e-34   Homo sapiens [man]
gb:BC071448_2556188 Danio rerio zgc:86780, mRNA (cDNA clone MGC:...   118   5e-34   
gb:BC045448_2549285 Danio rerio zgc:55766, mRNA (cDNA clone MGC:...   118   5e-34   
gb:AY394969_2531712 Danio rerio clone RK058A3D03 peptidyl prolyl...   118   5e-34   
gb:CR380951_1649984 Candida glabrata strain CBS138 chromosome E ...   127   5e-34   
gb:AF025803_1234140 Drosophila pseudoobscura cyclophilin 1 (Cyp1...   120   5e-34   
gb:AE017150_1029647 Trypanosoma brucei chromosome 2, complete se...   121   6e-34   
gb:AE017150_1029659 Trypanosoma brucei chromosome 2, complete se...   121   6e-34   
gb:AY551095_1334919 Crassostrea gigas cyclophilin mRNA, complete...   118   6e-34   
sp|P25007|CYPH_DROME|CYPH_DROME Peptidyl-prolyl cis-trans isomerase (EC 5.2...   121   8e-34   Drosophila melanogaster
sp|P30405|PPIF_HUMAN|PPIF_HUMAN Peptidyl-prolyl cis-trans isomerase, mitoch...   119   8e-34   Homo sapiens [man]
gb:BC049009_2550082 Danio rerio peptidylprolyl isomerase A (cycl...   117   8e-34   
gb:BC059458_2552435 Danio rerio peptidylprolyl isomerase A (cycl...   117   8e-34   
gb:EMU292367_1384651 Echinococcus multilocularis mRNA for putati...   115   8e-34   
pir|B38388|B38388 peptidylprolyl isomerase (EC 5.2.1.8) (cycloph...   121   8e-34   Drosophila melanogaster
gb:AY391452_2531588 Danio rerio 2-peptidylprolyl isomerase A (PP...   117   8e-34   
gb:AE017351_1759269 Cryptococcus neoformans var. neoformans JEC2...   120   1e-33   
pir|T49204|T49204 peptidylprolyl isomerase (EC 5.2.1.8) F27K19.1...   130   1e-33   Arabidopsis thaliana [mouse-ear cress]
sp|O00845|CYPH_PARPR|CYPH_PARPR Peptidyl-prolyl cis-trans isomerase (EC 5.2...   127   1e-33   Paramecium primaurelia
sp|P22011|CYPH_CANAL|CYPH_CANAL Peptidyl-prolyl cis-trans isomerase (EC 5.2...   127   1e-33   Candida albicans
gb:AK010649_1155910 Mus musculus ES cells cDNA, RIKEN full-lengt...   122   1e-33   
gb:BC059741_2552686 Xenopus tropicalis hypothetical protein MGC7...   118   1e-33   
gb:BC059470_2552447 Danio rerio peptidylprolyl isomerase A, like...   117   1e-33   
gb:AY391451_2531587 Danio rerio peptidylprolyl isomerase A (PPIA...   117   1e-33   
gb:CR382129_1661735 Yarrowia lipolytica chromosome C of strain C...   124   1e-33   
gb:AY232025_1177318 Drosophila yakuba clone yak-ad_Cyp1 mRNA seq...   121   1e-33   
gb:AF336984_1787623 Vaucheria litorea cyclophilin mRNA, partial ...   144   1e-33   
sp|P48820|RBP2_BOVIN|RBP2_BOVIN Ran-binding protein 2 (RanBP2) (Nuclear por...   115   1e-33   Bos taurus [bovine]
gb:BOVRSC_1435820 Bos taurus (clone C14) retina-specific cycloph...   115   1e-33   
gb:AC137507_1743426 Oryza sativa chromosome 3 BAC OSJNBb0033J23 ...   115   1e-33   
gb:MFU011956_1686054 Malassezia sympodialis mRNA for allergen Ma...   129   1e-33   
gb:AL133481_1918609 Human DNA sequence from clone RP11-342M3 on ...   118   1e-33   
gb:SMU30265_1397849 Schistosoma mansoni cyclophylin-like protein...   119   2e-33   
gb:BC062863_2553452 Danio rerio peptidylprolyl isomerase A (cycl...   117   2e-33   
gb:BC064250_2553803 Xenopus tropicalis hypothetical protein MGC7...   116   2e-33   
gb:AF252388_1893057 Macaca mulatta cyclophilin mRNA, partial cds.     119   3e-33   
gb:CR380956_1652375 Candida glabrata strain CBS138 chromosome J ...   120   4e-33   
gb:AP003018_1824194 Oryza sativa (japonica cultivar-group) genom...   125   4e-33   
gb:CR382137_1670320 Debaryomyces hansenii chromosome E of strain...   124   4e-33   
gb:SMU50388_1397865 Schistosoma mansoni cyclophilin A mRNA, comp...   116   9e-33   
gb:AK012491_1156989 Mus musculus 11 days embryo whole body cDNA,...   122   9e-33   
gb:CR382124_1657059 Kluyveromyces lactis strain NRRL Y-1140 chro...   120   9e-33   
gb:AP006067_1860854 Oryza sativa (japonica cultivar-group) genom...   127   1e-32   
gb:AP006618_560249 Nocardia farcinica IFM 10152 DNA, complete ge...   120   1e-32   
gb:CR382122_1654998 Kluyveromyces lactis strain NRRL Y-1140 chro...   122   1e-32   
pir|JT0686|JT0686 peptidylprolyl isomerase (EC 5.2.1.8) a, cytos...   134   2e-32   Fusarium sporotrichioides
gb:AE017346_1757189 Cryptococcus neoformans var. neoformans JEC2...   124   2e-32   
gb:AY086899_1571939 Arabidopsis thaliana clone 29220 mRNA, compl...   124   2e-32   
sp|P34791|CYP4_ARATH|CYP4_ARATH Peptidyl-prolyl cis-trans isomerase, chloro...   124   2e-32   Arabidopsis thaliana [mouse-ear cress]
gb:AC084818_1733850 Oryza sativa (japonica cultivar-group) chrom...   130   2e-32   
gb:AF293848_1783878 Pyricularia grisea cyclophilin (CYP1) gene, ...   124   3e-32   
gb:BC068613_2555121 Xenopus laevis hypothetical protein LOC39863...   113   3e-32   
gb:BC054186_2550840 Xenopus laevis hypothetical protein LOC39863...   113   3e-32   
gb:CR382129_1661726 Yarrowia lipolytica chromosome C of strain C...   125   3e-32   
gb:AB062457_1522124 Magnaporthe grisea CYP1 mRNA for cyclophilin...   124   3e-32   
gb:AY646834_2541524 Xenopus laevis cyclophilin A (CypA) mRNA, co...   113   3e-32   
gb:AE016817_1747471 Ashbya gossypii (= Eremothecium gossypii) AT...   122   3e-32   
sp|P53691|CYP6_YEAST|CYP6_YEAST Peptidyl-prolyl cis-trans isomerase CPR6 (E...   117   3e-32   Saccharomyces cerevisiae [brewer's yeast]
gb:AF243140_1416671 Canis familiaris cyclophilin A mRNA, partial...   122   3e-32   
gb:AY557959_1614186 Saccharomyces cerevisiae clone FLH004814.01X...   117   4e-32   
sp|Q9V3G3|PPIE_DROME|PPIE_DROME Peptidyl-prolyl cis-trans isomerase E (EC 5...   114   4e-32   Drosophila melanogaster
gb:SCMCLCLPHN_1397186 Schistosoma japonicum (blood fluke) cyclop...   117   4e-32   
sp|Q06118|PPIA_STRCH|PPIA_STRCH Peptidyl-prolyl cis-trans isomerase A (EC 5...   120   4e-32   Streptomyces anulatus
gb:AY217753_1590150 Triticum aestivum cyclophilin-like protein (...   130   6e-32   
gb:SCO939131_181176 Streptomyces coelicolor A3(2) complete genom...   119   6e-32   
gb:BC041536_2547984 Xenopus laevis CYcloPhilin (18.4 kD) (cyp-7)...   116   6e-32   
gb:AF325026_1786480 Arabidopsis thaliana AT3g62030 (AT3g62030/F2...   123   7e-32   
sp|P52018|CYPB_CAEEL|CYPB_CAEEL Peptidyl-prolyl cis-trans isomerase 11 (EC ...   111   7e-32   Caenorhabditis elegans [roundworm]
pir|S51497|S51497 peptidylprolyl isomerase (EC 5.2.1.8) A - cycl...   129   7e-32   Tolypocladium inflatum
gb:AY231990_1177283 Drosophila yakuba clone yak-ad_CG7768 mRNA s...   117   1e-31   
gb:AB019518_1514317 Trichophyton mentagrophytes mRNA for cycloph...   117   1e-31   
pir|T05766|T05766 peptidylprolyl isomerase (EC 5.2.1.8) M4E13.20...   124   1e-31   Arabidopsis thaliana [mouse-ear cress]
gb:BT016150_1358595 Drosophila melanogaster AT16671 full insert ...   117   1e-31   
gb:CEU34354_1368504 Caenorhabditis elegans cyclophilin isoform 2...   122   1e-31   
sp|P52016|CYP8_CAEEL|CYP8_CAEEL Peptidyl-prolyl cis-trans isomerase 8 (EC 5...   123   2e-31   Caenorhabditis elegans [roundworm]
gb:U40938_1403481 Caenorhabditis elegans cosmid D1009, complete ...   123   2e-31   
gb:AY217751_1590148 Triticum aestivum cyclophilin-like protein (...   128   2e-31   
gb:AE014296_1136235 Drosophila melanogaster chromosome 3L, compl...   117   2e-31   
gb:AE016959_1021004 Oryza sativa (japonica cultivar-group) chrom...   116   2e-31   
gb:LRU238310_1389050 Lumbricus rubellus mRNA for cyclophilin A.       115   2e-31   
gb:AX024013_1456798 Sequence 2 from Patent WO0018934.>gb:AY00586...   123   3e-31   
gb:AE017350_1759182 Cryptococcus neoformans var. neoformans JEC2...   113   4e-31   
gb:TCU68268_1399925 Trypanosoma congolense cyclophilin A (cypA) ...   110   4e-31   
sp|P14088|CYPH_ECHGR|CYPH_ECHGR Peptidyl-prolyl cis-trans isomerase (EC 5.2...   123   4e-31   Echinococcus granulosus
pir|A45000|A45000 peptidylprolyl isomerase (EC 5.2.1.8) [similar...   123   4e-31   Echinococcus granulosus
sp|Q11004|CYP5_SCHPO|CYP5_SCHPO 40 kDa peptidyl-prolyl cis-trans isomerase ...   127   6e-31   Schizosaccharomyces pombe
gb:ATT19L5_1554843 Arabidopsis thaliana DNA chromosome 5, BAC cl...   127   6e-31   
pir|S71849|S71849 peptidylprolyl isomerase (EC 5.2.1.8) A precur...   125   8e-31   
gb:AE013599_1130261 Drosophila melanogaster chromosome 2R, compl...   111   8e-31   
gb:TNCYCABPR_1725339 T.niveum gene for cyclophilin A-binding pro...   125   8e-31   
gb:POS417659_1701052 Pleurotus ostreatus partial mRNA for putati...   118   8e-31   
gb:AY442290_2532577 Bitis gabonica venom gland cyclophilin mRNA,...   122   8e-31   
gb:HS118J21_1996988 Human DNA sequence from clone RP1-118J21 on ...   119   1e-30   
gb:AF042385_1878496 Homo sapiens cyclophilin-33A (CYP-33) mRNA, ...   119   1e-30   
gb:CR860299_1184382 Pongo pygmaeus mRNA; cDNA DKFZp459B225 (from...   119   1e-30   
sp|Q9QZH3|PPIE_MOUSE|PPIE_MOUSE Peptidyl-prolyl cis-trans isomerase E (EC 5...   119   1e-30   Mus musculus [mouse]
sp|Q9UNP9|PPIE_HUMAN|PPIE_HUMAN Peptidyl-prolyl cis-trans isomerase E (EC 5...   119   1e-30   Homo sapiens [man]
gb:AF042386_1878497 Homo sapiens cyclophilin-33B (CYP-33) mRNA, ...   119   1e-30   
gb:AY088365_1573385 Arabidopsis thaliana clone 620 mRNA, complet...   127   1e-30   
sp|Q9ASS6|TL20_ARATH|TL20_ARATH Peptidyl-prolyl cis-trans isomerase TLP20, ...   127   1e-30   
gb:AE017342_1754779 Cryptococcus neoformans var. neoformans JEC2...   117   1e-30   
gb:AE017347_1757736 Cryptococcus neoformans var. neoformans JEC2...   118   1e-30   
gb:NC18F11_1688433 Neurospora crassa DNA linkage group V Cosmid ...   121   1e-30   
gb:CR380954_1651241 Candida glabrata strain CBS138 chromosome H ...   119   1e-30   
sp|O00060|CYPH_UROFA|CYPH_UROFA Peptidyl-prolyl cis-trans isomerase (EC 5.2...   115   1e-30   
gb:AJ698392_1283782 Euplotes vannus macronuclear gene for peptid...   122   2e-30   
gb:AF333997_1787435 Filobasidiella neoformans var. neoformans cy...   117   2e-30   
gb:AF180336_1774806 Filobasidiella neoformans var. neoformans cy...   117   2e-30   
gb:AC116986_1207446 Dictyostelium discoideum chromosome 2 map 22...   114   3e-30   
gb:AY008846_1423475 Sus scrofa cyclophilin mRNA, partial cds.         115   4e-30   
gb:AF411956_2492676 Takifugu rubripes lck gene locus, partial se...   120   5e-30   
gb:AY277722_1594492 Botryotinia fuckeliana cyclophilin 1 (BCP1) ...   126   5e-30   
pir|T40819|T40819 peptidylprolyl isomerase (EC 5.2.1.8) SPBP8B7....   126   5e-30   
gb:AY277722_1594493 Botryotinia fuckeliana cyclophilin 1 (BCP1) ...   126   5e-30   
gb:AB098778_1410147 Bos taurus mRNA for similar to peptidylproly...   122   5e-30   
gb:AF333996_1787434 Filobasidiella neoformans var. neoformans cy...   117   6e-30   
gb:AF182825_2058112 Mus musculus cyclophilin-33 (Cyp33) mRNA, pa...   116   8e-30   
gb:HMU36797_1386253 Hirudo medicinalis cyclophilin-A mRNA (hcyp)...   125   9e-30   
gb:AF180337_1774807 Filobasidiella neoformans var. neoformans cy...   115   1e-29   
gb:AY123113_1579981 Griffithsia japonica peptidylprolyl isomeras...   118   1e-29   
gb:LMCYCL_1387675 Leishmania major mRNA for cyclophilin.              109   1e-29   
gb:XLA496795_2582598 Xenopus laevis partial mRNA for peptidylpro...   116   1e-29   
gb:AF107254_1768413 Emericella nidulans cyclophilin B (cypB) gen...   122   2e-29   
sp|P25719|CYPC_YEAST|CYPC_YEAST Peptidyl-prolyl cis-trans isomerase C, mito...   116   2e-29   
gb:AB084917_1871991 Homo sapiens mRNA for Cyclophilin-LC, comple...   110   2e-29   
gb:AY349022_1321769 Trypanosoma cruzi 40 kDa cyclophilin mRNA, c...   123   2e-29   
sp|Q41651|CYPB_VICFA|CYPB_VICFA Peptidyl-prolyl cis-trans isomerase, chloro...   114   3e-29   
gb:TVU68269_1401293 Trypanosoma vivax cyclophilin A (cypA) mRNA,...   106   3e-29   
gb:BC059560_2552537 Danio rerio zgc:73214, mRNA (cDNA clone MGC:...   118   5e-29   
gb:AE014296_1135573 Drosophila melanogaster chromosome 3L, compl...   108   7e-29   
sp|Q01490|CYPB_ORPSP|CYPB_ORPSP Peptidyl-prolyl cis-trans isomerase B precu...   119   7e-29   
gb:CR382131_1664413 Yarrowia lipolytica chromosome E of strain C...   117   9e-29   
gb:AE016818_1748302 Ashbya gossypii (= Eremothecium gossypii) AT...   110   9e-29   
pir|S68357|S52760 peptidylprolyl isomerase (EC 5.2.1.8) precurso...   115   1e-28   
gb:AF191832_1249603 Trypanosoma cruzi cyclophilin A (CYP A) mRNA...   101   1e-28   
pir|T31517|T31517 hypothetical protein Y116A8C.34 - Caenorhabdit...   118   2e-28   
gb:BC078949_2107095 Rattus norvegicus peptidylprolyl isomerase C...   110   3e-28   
gb:BC087299_2565152 Xenopus laevis hypothetical LOC495937, mRNA ...   102   3e-28   
sp|Q09637|CYP9_CAEEL|CYP9_CAEEL Peptidyl-prolyl cis-trans isomerase 9 (EC 5...   117   4e-28   
gb:BC054168_2550823 Xenopus laevis peptidylprolyl isomerase B, m...   114   4e-28   
gb:BC084369_2563750 Xenopus laevis hypothetical LOC495270, mRNA ...   115   6e-28   
sp|P30412|PPIC_MOUSE|PPIC_MOUSE Peptidyl-prolyl cis-trans isomerase C (EC 5...   112   6e-28   
gb:AF384147_1794193 Triticum aestivum cyclophilin mRNA, partial ...   125   6e-28   
gb:DLCYCLPHG_1675944 D.lanata cyclophilin gene.                       125   6e-28   
sp|P10255|CYPH_NEUCR|CYPH_NEUCR Peptidyl-prolyl cis-trans isomerase, mitoch...   120   7e-28   
gb:NCCYCGEN_1690504 Neurospora crassa cyclophilin gene.               120   7e-28   
gb:CBR5807_1359339 Caenorhabditis briggsae pdi-1 gene and partia...   114   8e-28   
sp|Q27774|PPIB_SCHJA|PPIB_SCHJA Peptidyl-prolyl cis-trans isomerase B precu...   110   1e-27   
sp|Q26551|PPIB_SCHMA|PPIB_SCHMA Peptidyl-prolyl cis-trans isomerase B precu...   106   1e-27   
gb:CR382139_1672459 Debaryomyces hansenii chromosome G of strain...   105   1e-27   
gb:TBU68270_1399479 Trypanosoma brucei brucei cyclophilin A (cyp...   100   2e-27   
gb:CR382133_1666713 Debaryomyces hansenii chromosome A of strain...   109   2e-27   
gb:BC061971_2104749 Rattus norvegicus peptidylprolyl isomerase B...   113   2e-27   
sp|P24368|PPIB_RAT|PPIB_RAT Peptidyl-prolyl cis-trans isomerase B precurs...   113   2e-27   
gb:AY040611_1289020 Brugia malayi R2 (SM7) mRNA, complete cds.        115   2e-27   
gb:AE017342_1754785 Cryptococcus neoformans var. neoformans JEC2...   117   2e-27   
pir|S71547|S71547 peptidylprolyl isomerase (EC 5.2.1.8) B, 20.3K...   113   2e-27   
gb:AL162574_1922495 Human DNA sequence from clone RP11-282A11 on...   103   2e-27   
gb:AK176511_1818499 Arabidopsis thaliana mRNA for cyclophilin (A...   123   2e-27   
gb:CR382134_1667277 Debaryomyces hansenii chromosome B of strain...   118   3e-27   
gb:AX461042_1469010 Sequence 32 from Patent WO0222823.                123   3e-27   
gb:AB002814_1192815 Tachypleus tridentatus mRNA for cyclophilin ...   110   4e-27   
pir|A56861|A56861 peptidylprolyl isomerase (EC 5.2.1.8) CyP-S1 p...   113   4e-27   
sp|P45877|PPIC_HUMAN|PPIC_HUMAN Peptidyl-prolyl cis-trans isomerase C (EC 5...   110   4e-27   
sp|P24367|PPIB_CHICK|PPIB_CHICK Peptidyl-prolyl cis-trans isomerase B precu...   114   4e-27   
sp|P24369|PPIB_MOUSE|PPIB_MOUSE Peptidyl-prolyl cis-trans isomerase B precu...   113   4e-27   
gb:AE013599_1133337 Drosophila melanogaster chromosome 2R, compl...   108   5e-27   
gb:CR456829_1993036 Homo sapiens full open reading frame cDNA cl...   113   6e-27   
gb:BC001125_1967315 Homo sapiens peptidylprolyl isomerase B (cyc...   113   6e-27   
gb:BT020966_1436324 Bos taurus peptidylprolyl isomerase B (cyclo...   113   6e-27   
gb:HUMCYCLO_2030406 Human cyclophilin mRNA, 3' end.                   113   6e-27   
sp|P23284|PPIB_HUMAN|PPIB_HUMAN Peptidyl-prolyl cis-trans isomerase B precu...   113   6e-27   
sp|P80311|PPIB_BOVIN|PPIB_BOVIN Peptidyl-prolyl cis-trans isomerase B precu...   113   6e-27   
gb:CNS07EGF_1373822 chromosome VIII of strain GB-M1 of Encephali...   110   8e-27   
gb:AJ609278_1812003 Cicer arietinum partial mRNA for cyclophilin...   121   9e-27   
sp|P52014|CYP6_CAEEL|CYP6_CAEEL Peptidyl-prolyl cis-trans isomerase 6 precu...   105   1e-26   
gb:AY231912_1177205 Drosophila yakuba clone yak-em_Cyp1 mRNA seq...   121   1e-26   
gb:AY251270_1428027 Ovis aries peptidylprolyl isomerase A mRNA, ...   120   2e-26   
gb:CEU31948_1368492 Caenorhabditis elegans cyclophilin isoform 5...   106   2e-26   
sp|P52013|CYP5_CAEEL|CYP5_CAEEL Peptidyl-prolyl cis-trans isomerase 5 precu...   106   2e-26   
pir|T05352|T05352 hypothetical protein F8B4.120 - Arabidopsis th...    90   3e-26   
gb:AL359711_1925698 Human DNA sequence from clone RP11-425D10 on...   102   3e-26   
gb:AY585929_1616336 Paxillus involutus strain ATCC 200175 putati...   111   5e-26   
gb:AF286342_1258977 Trypanosoma cruzi cyclophilin mRNA, complete...    98   1e-25   
pir|T39632|T39632 peptidylprolyl isomerase (EC 5.2.1.8) u-snrnp-...   100   1e-25   
gb:PFMAL8P1_1192283 Plasmodium falciparum 3D7 chromosome 8, *** ...   104   1e-25   
gb:PFU10322_1395007 Plasmodium falciparum HB3 cyclophilin (cyppf...   104   1e-25   
gb:AF177281_1247763 Plasmodium falciparum isolate FCC1/HN cyclop...   104   1e-25   
gb:CR380954_1651124 Candida glabrata strain CBS138 chromosome H ...   104   2e-25   
gb:AY232181_1177474 Drosophila yakuba clone yak-ad_CG2852 mRNA s...   103   3e-25   
gb:AF096318_1767819 Aspergillus niger cyclophilin-like peptidyl ...   112   4e-25   
gb:CR382127_1660164 Yarrowia lipolytica chromosome A of strain C...   109   5e-25   
gb:AL139085_1920228 Human DNA sequence from clone RP11-431O22 on...   100   7e-25   
gb:TGU04633_1400202 Toxoplasma gondii Rh 18 kDa cyclophilin mRNA...   104   1e-24   
pir|A53522|A53522 peptidylprolyl isomerase (EC 5.2.1.8) [similar...   104   1e-24   
gb:AFU6689_1810976 Aspergillus fumigatus mRNA for rAsp f 11 alle...   109   2e-24   
gb:CR382123_1655917 Kluyveromyces lactis strain NRRL Y-1140 chro...   102   3e-24   
gb:AF041412_1235783 Periplaneta americana peptidyl-prolyl cis-tr...   111   9e-24   
gb:AF228021_1416453 Bos taurus cyclophilin I mRNA, partial cds.        84   1e-23   
gb:AY585963_1616370 Paxillus involutus strain Maj putative cyclo...   111   1e-23   
gb:AY585961_1616368 Paxillus involutus strain Pi01SE putative cy...   111   1e-23   
gb:AY585960_1616367 Paxillus involutus strain ATCC 200175 putati...   111   1e-23   
sp|Q26565|CYPH_SCHMA|CYPH_SCHMA Peptidyl-prolyl cis-trans isomerase (EC 5.2...   107   2e-23   
gb:AF158368_1246025 Leishmania donovani cyclophilin (CYP) gene, ...   110   2e-23   
gb:BX571790_2567682 Zebrafish DNA sequence from clone CH211-199M...    99   4e-23   
gb:AB099054_1410377 Bos taurus mRNA for similar to cyclophilin, ...   109   5e-23   
gb:AE017345_1756685 Cryptococcus neoformans var. neoformans JEC2...    97   5e-23   
gb:AE016814_1745774 Ashbya gossypii (= Eremothecium gossypii) AT...    95   6e-23   
gb:AF055990_1764647 Fucus distichus cyclophilin mRNA, partial cds.    106   3e-22   
gb:CNS07EGG_1374163 chromosome X of strain GB-M1 of Encephalitoz...   101   5e-22   
gb:LRCYCLOP_1389041 Lumbricus rubellus mRNA for cyclophilin B.         92   9e-22   
pir|C86151|C86151 F22M8.7 protein - Arabidopsis thaliana>gb:AE00...   102   2e-21   
sp|P35176|CYPD_YEAST|CYPD_YEAST Peptidyl-prolyl cis-trans isomerase D precu...    96   2e-21   
gb:AP000559_1820309 Oryza sativa (japonica cultivar-group) genom...   100   3e-21   
gb:SCCYPRE_1707469 Yeast gene for cyclophilin-related protein.         94   4e-21   
sp|P23285|CYPB_YEAST|CYPB_YEAST Peptidyl-prolyl cis-trans isomerase B precu...    94   4e-21   
gb:AX884231_1479684 Sequence 94 from Patent EP1033401.                 94   4e-21   
gb:AY585941_1616348 Paxillus filamentosus strain Pf01DE putative...   101   1e-20   
gb:CR749571_1181139 Homo sapiens mRNA; cDNA DKFZp686G0426 (from ...    88   2e-20   
gb:BC072680_1989026 Homo sapiens natural killer-tumor recognitio...    88   2e-20   
gb:AY568523_1615461 Arabidopsis thaliana single domain cyclophil...    69   2e-20   
gb:BC007693_1970916 Homo sapiens peptidylprolyl isomerase (cyclo...   100   2e-20   
gb:AF271652_1894089 Homo sapiens cyclophilin-like protein PPIL3b...   100   2e-20   
gb:AJ719632_2501819 Gallus gallus mRNA for hypothetical protein,...   100   3e-20   
gb:AF315802_2062627 Rattus norvegicus CYP10L (Cyp10l) mRNA, comp...   100   3e-20   
gb:CR382129_1661599 Yarrowia lipolytica chromosome C of strain C...    88   3e-20   
gb:AE014188_967834 Plasmodium falciparum 3D7 chromosome 12, comp...   100   4e-20   
gb:BC075537_2558637 Xenopus tropicalis MGC89451 protein, mRNA (c...    99   6e-20   
gb:AF315803_2062628 Mus musculus CYP10L (Cyp10l) mRNA, complete ...    98   1e-19   
gb:AK010207_1155599 Mus musculus adult male tongue cDNA, RIKEN f...    98   1e-19   
pir|C84777|C84777 cyclophilin-like protein [imported] - Arabidop...    98   1e-19   
gb:AK011000_1156122 Mus musculus 13 days embryo liver cDNA, RIKE...    97   2e-19   
gb:AX885194_1480647 Sequence 1057 from Patent EP1033401.               68   2e-19   
gb:AX887971_1483424 Sequence 3834 from Patent EP1033401.               69   3e-19   
gb:PFA929352_1393005 Plasmodium falciparum strain 3D7, chromosom...    96   4e-19   
gb:AL359711_1925700 Human DNA sequence from clone RP11-425D10 on...    78   5e-19   
gb:AF121134_1242863 Schistosoma mansoni cyclophilin mRNA, comple...    84   6e-19   
gb:AF146799_1886138 Homo sapiens cyclophilin mRNA, complete cds.       95   9e-19   
pir|T29283|T29283 peptidylprolyl isomerase (EC 5.2.1.8) C34D4.12...    95   9e-19   
gb:AY325152_1177821 Rattus norvegicus Ab1-210 mRNA, complete cds.      79   1e-18   
gb:CR382136_1668808 Debaryomyces hansenii chromosome D of strain...    95   1e-18   
gb:AX969689_1484998 Sequence 492 from Patent EP1104808.                95   1e-18   
gb:AY085003_1570085 Arabidopsis thaliana clone 124189 mRNA, comp...    94   2e-18   
sp|Q9NI62|CYPE_DICDI|CYPE_DICDI Peptidyl-prolyl cis-trans isomerase cypE (E...    94   2e-18   
gb:AB098989_1410312 Bos taurus mRNA for similar to cyclophilin B...    94   2e-18   
gb:BC071392_2556133 Danio rerio zgc:86715, mRNA (cDNA clone MGC:...    93   3e-18   
gb:AE013599_1132189 Drosophila melanogaster chromosome 2R, compl...    92   5e-18   
gb:AJ865374_1423285 Ovis aries partial mRNA for putative cycloph...    92   8e-18   
pir|S68767|S68767 peptidylprolyl isomerase (EC 5.2.1.8) - rat (f...    87   9e-18   
gb:AF455393_1801133 Aspergillus niger cyclophilin-like peptidyl ...    91   1e-17   
gb:CR382135_1668264 Debaryomyces hansenii chromosome C of strain...    91   2e-17   
gb:BX842641_1644199 Neurospora crassa DNA linkage group I BAC co...    91   2e-17   
gb:AE017342_1754836 Cryptococcus neoformans var. neoformans JEC2...    90   2e-17   
gb:AP003928_1835396 Oryza sativa (japonica cultivar-group) genom...    90   3e-17   
gb:AY456123_1607157 Triticum aestivum cyclophilin A (CYP18-1) ge...    90   3e-17   
gb:AB110199_1526912 Oryza sativa (japonica cultivar-group) mRNA ...    90   3e-17   
gb:AB067654_1522601 Oryza sativa (japonica cultivar-group) OsCyp...    90   3e-17   
gb:TAU55771_1398413 Theileria annulata cyclophilin homolog Ta cy...    90   3e-17   
gb:AE017343_1755386 Cryptococcus neoformans var. neoformans JEC2...    90   4e-17   
gb:AY062516_1565172 Arabidopsis thaliana peptidylprolyl isomeras...    89   5e-17   
gb:AB013390_1512074 Arabidopsis thaliana genomic DNA, chromosome...    89   5e-17   
gb:AY231875_1177168 Drosophila yakuba clone yak-em_CG2852 mRNA s...    89   5e-17   
gb:AE013599_1133805 Drosophila melanogaster chromosome 2R, compl...    89   5e-17   
gb:AE013599_1133338 Drosophila melanogaster chromosome 2R, compl...    89   5e-17   
pir|D84342|D84342 peptidyl-prolyl isomerase [imported] - Halobac...    89   5e-17   
pir|T43805|T43805 peptidylprolyl isomerase (EC 5.2.1.8) cyp [sim...    89   5e-17   
gb:AE017350_1758959 Cryptococcus neoformans var. neoformans JEC2...    89   7e-17   
gb:PFA929354_1393186 Plasmodium falciparum strain 3D7, chromosom...    89   7e-17   
gb:BC080913_2561827 Xenopus tropicalis MGC79544 protein, mRNA (c...    89   9e-17   
gb:BC071410_2556150 Danio rerio zgc:56616, mRNA (cDNA clone MGC:...    89   9e-17   
gb:AJ720461_2502648 Gallus gallus mRNA for hypothetical protein,...    88   1e-16   
gb:HUMORF006_2035278 Homo sapiens KIAA0073 mRNA, partial cds.          88   1e-16   
gb:BC015385_1975072 Homo sapiens KIAA0073 protein, mRNA (cDNA cl...    88   1e-16   
gb:CR926008_1185525 Pongo pygmaeus mRNA; cDNA DKFZp459P2020 (fro...    88   1e-16   
gb:AK028532_1161039 Mus musculus 0 day neonate skin cDNA, RIKEN ...    88   1e-16   
gb:BX908798_830689 Parachlamydia-related symbiont UWE25, complet...    88   1e-16   
gb:CR382123_1655848 Kluyveromyces lactis strain NRRL Y-1140 chro...    88   1e-16   
gb:AK081792_1173384 Mus musculus 16 days embryo head cDNA, RIKEN...    88   1e-16   
gb:AK012472_1156977 Mus musculus 11 days embryo whole body cDNA,...    88   1e-16   
gb:AK009460_1155154 Mus musculus adult male tongue cDNA, RIKEN f...    88   1e-16   
gb:BX571661_778920 Wolinella succinogenes, complete genome; segm...    88   1e-16   
pir|T18577|T18577 peptidylprolyl isomerase (EC 5.2.1.8) cyp-10 [...    88   1e-16   
sp|Q9D787|PPL2_MOUSE|PPL2_MOUSE Peptidyl-prolyl cis-trans isomerase like 2 ...    88   1e-16   
sp|P87051|PPI1_SCHPO|PPI1_SCHPO Peptidyl-prolyl cis-trans isomerase ppi1 (E...    88   1e-16   
sp|P52017|CYPA_CAEEL|CYPA_CAEEL Peptidyl-prolyl cis-trans isomerase 10 (EC ...    88   1e-16   
gb:AE017345_1756677 Cryptococcus neoformans var. neoformans JEC2...    83   2e-16   
gb:BC085890_2109449 Rattus norvegicus cDNA clone MGC:94681 IMAGE...    87   2e-16   
gb:AY062653_1565309 Arabidopsis thaliana putative protein (At3g4...    87   2e-16   
gb:AE014296_1134026 Drosophila melanogaster chromosome 3L, compl...    87   2e-16   
pir|T41399|T41399 probable cyclophilin-related peptidyl prolyl c...    87   2e-16   
pir|T48940|T48940 hypothetical protein F14L2.150 - Arabidopsis t...    87   2e-16   
gb:BX294145_769060 Pirellula sp. strain 1 complete genome; segme...    86   2e-16   
gb:BC044993_2548952 Xenopus laevis similar to peptidylprolyl iso...    86   3e-16   
gb:CR382129_1661945 Yarrowia lipolytica chromosome C of strain C...    87   3e-16   
gb:CR628336_112062 Legionella pneumophila str. Paris complete ge...    87   3e-16   
gb:CR382131_1663457 Yarrowia lipolytica chromosome E of strain C...    86   4e-16   
gb:AE017354_460317 Legionella pneumophila subsp. pneumophila str...    86   4e-16   
gb:HSU37221_2023857 Human cyclophilin-like protein mRNA, partial...    86   6e-16   
gb:HSU37220_2023856 Human cyclophilin-like protein mRNA, partial...    86   6e-16   
gb:BC028385_1979247 Homo sapiens peptidylprolyl isomerase (cyclo...    86   6e-16   
gb:BC000022_1966358 Homo sapiens peptidylprolyl isomerase (cyclo...    86   6e-16   
sp|Q13356|PPL2_HUMAN|PPL2_HUMAN Peptidyl-prolyl cis-trans isomerase like 2 ...    86   6e-16   
gb:CR382133_1666812 Debaryomyces hansenii chromosome A of strain...    70   6e-16   
gb:AY349020_1321767 Trypanosoma cruzi 35 kDa cyclophilin mRNA, c...    74   6e-16   
gb:AY004869_2073401 Mesocricetus auratus cyclophilin mRNA, parti...    80   6e-16   
gb:CR628337_115140 Legionella pneumophila str. Lens complete gen...    86   7e-16   
pir|H98045|H98045 hypothetical protein spr1393 [imported] - Stre...    86   7e-16   
pir|A95179|A95179 hypothetical protein SP1538 [imported] - Strep...    86   7e-16   
sp|P28517|CYPR_CALVI|CYPR_CALVI Peptidyl-prolyl cis-trans isomerase, rhodop...    81   7e-16   
gb:AE014296_1135904 Drosophila melanogaster chromosome 3L, compl...    85   9e-16   
gb:SCU48868_1710442 Saccharomyces cerevisiae cyclophilin (CPR7) ...    66   1e-15   
sp|P47103|CYP7_YEAST|CYP7_YEAST Peptidyl-prolyl cis-trans isomerase CYP7 (E...    66   1e-15   
gb:AE014186_938133 Plasmodium falciparum 3D7 chromosome 11 compl...    85   1e-15   
gb:AE014894_312907 Streptococcus mutans UA159 section 42 of 185 ...    85   1e-15   
sp|O66105|PPIB_TREPA|PPIB_TREPA Probable peptidyl-prolyl cis-trans isomeras...    85   1e-15   
gb:HS144F13_1997149 Human DNA sequence from clone RP1-144F13 on ...    69   1e-15   
gb:BT011449_1357931 Drosophila melanogaster RE40650 full insert ...    84   2e-15   
gb:AE013599_1131091 Drosophila melanogaster chromosome 2R, compl...    84   2e-15   
pir|E86736|E86736 peptidyl-prolyl cis-trans isomerase [imported]...    84   2e-15   


>pir|T49181|T49181 cyclophylin-like protein - Arabidopsis
           thaliana>gb:ATMAA21_1553700 Arabidopsis thaliana DNA
           chromosome 3, P1 clone MAA21 (ESSA
           project).>gb:BT000915_1635170 Arabidopsis thaliana clone
           C105215 putative cyclophylin protein (At3g63400) mRNA,
           complete cds.
          Length = 570

 Score =  174 bits (440), Expect(2) = 4e-54
 Identities = 79/95 (83%), Positives = 85/95 (89%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGE G+G STGKPLH+KG  FHR+IKGFMAQGGDFS GNGTGGESIYGGKF+DENF
Sbjct: 40  RALCTGEAGVGKSTGKPLHFKGSSFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENF 99

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +LDH   G+LSMAN GPNTNGSQFFI FKRQPHLD
Sbjct: 100 RLDHDGAGVLSMANCGPNTNGSQFFILFKRQPHLD 134



 Score = 60.5 bits (145), Expect(2) = 4e-54
 Identities = 29/36 (80%), Positives = 31/36 (86%)
 Frame = +1

Query: 259 KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           KKKNP VF DVS  G PVQRIV+ELFADVVP+TAEN
Sbjct: 3   KKKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAEN 38



>gb:AY568527_1615465 Arabidopsis thaliana multidomain cyclophilin
           type peptidyl-prolyl cis-trans isomerase (CYP63) mRNA,
           complete cds.
          Length = 566

 Score =  174 bits (440), Expect(2) = 4e-54
 Identities = 79/95 (83%), Positives = 85/95 (89%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGE G+G STGKPLH+KG  FHR+IKGFMAQGGDFS GNGTGGESIYGGKF+DENF
Sbjct: 40  RALCTGEAGVGKSTGKPLHFKGSSFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENF 99

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +LDH   G+LSMAN GPNTNGSQFFI FKRQPHLD
Sbjct: 100 RLDHDGAGVLSMANCGPNTNGSQFFILFKRQPHLD 134



 Score = 60.5 bits (145), Expect(2) = 4e-54
 Identities = 29/36 (80%), Positives = 31/36 (86%)
 Frame = +1

Query: 259 KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           KKKNP VF DVS  G PVQRIV+ELFADVVP+TAEN
Sbjct: 3   KKKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAEN 38



>gb:AY217752_1590149 Triticum aestivum cyclophilin-like protein
           (CYP70) mRNA, complete cds.
          Length = 636

 Score =  158 bits (400), Expect(2) = 5e-47
 Identities = 74/95 (77%), Positives = 81/95 (85%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G+ST KPL++KG   HRII GFMAQ GDFS G+G GGESIYGGKF DENF
Sbjct: 43  RALCTGEKGLGESTKKPLYFKGTHIHRIIPGFMAQAGDFSGGDGRGGESIYGGKFPDENF 102

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           KL H +PG+LSMANSG NTNGSQFFITFK  PHLD
Sbjct: 103 KLKHDQPGILSMANSGENTNGSQFFITFKAVPHLD 137



 Score = 52.0 bits (123), Expect(2) = 5e-47
 Identities = 23/39 (58%), Positives = 28/39 (71%)
 Frame = +1

Query: 250 KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           K  K  NP VF ++S DG P +RI  +LFADVVP+TAEN
Sbjct: 3   KFKKNLNPQVFLEISIDGRPAERITFQLFADVVPKTAEN 41



>gb:AK003402_1151842 Mus musculus 18-day embryo whole body cDNA,
           RIKEN full-length enriched library, clone:1110004B08
           product:40 KDA PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (EC
           5.2.1.8) (PPIASE) (ROTAMASE) (CYCLOPHILIN-40) (CYP-40)
           (CYCLOPHILIN-RELATED PROTEIN) homolog [Homo sapiens],
           full insert sequence.>gb:AK013919_1157695 Mus musculus
           13 days embryo head cDNA, RIKEN full-length enriched
           library, clone:3100002J09 product:40 KDA PEPTIDYL-PROLYL
           CIS-TRANS ISOMERASE (EC 5.2.1.8) (PPIASE) (ROTAMASE)
           (CYCLOPHILIN-40) (CYP-40) (CYCLOPHILIN-RELATED PROTEIN)
           homolog [Homo sapiens], full insert
           sequence.>gb:AK051597_1169734 Mus musculus 12 days
           embryo spinal ganglion cDNA, RIKEN full-length enriched
           library, clone:D130059D15 product:40 KDA PEPTIDYL-PROLYL
           CIS-TRANS ISOMERASE (EC 5.2.1.8) (PPIASE) (ROTAMASE)
           (CYCLOPHILIN-40) (CYP-40) (CYCLOPHILIN-RELATED PROTEIN)
           homolog [Homo sapiens], full insert
           sequence.>gb:BC011499_2091461 Mus musculus
           peptidylprolyl isomerase D (cyclophilin D), mRNA (cDNA
           clone MGC:6702 IMAGE:3584183), complete
           cds.>gb:BC019778_2093104 Mus musculus peptidylprolyl
           isomerase D (cyclophilin D), mRNA (cDNA clone MGC:25799
           IMAGE:4035785), complete cds.
          Length = 370

 Score =  154 bits (389), Expect(2) = 9e-46
 Identities = 73/95 (76%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G +TGKPLH+KGC FHRIIK FM QGGDFS  NGTGGESIYG KF DENF
Sbjct: 49  RALCTGEKGTGSTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENF 108

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H   GLLSMAN+GPNTNGSQFFIT    PHLD
Sbjct: 109 HYKHDREGLLSMANAGPNTNGSQFFITTVPTPHLD 143



 Score = 52.0 bits (123), Expect(2) = 9e-46
 Identities = 25/39 (64%), Positives = 28/39 (71%)
 Frame = +1

Query: 250 KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           K    KNP VFFDV   G  V RIV+ELFAD+VP+TAEN
Sbjct: 9   KPSNSKNPRVFFDVDIGGERVGRIVLELFADIVPKTAEN 47



>sp|Q9CR16|PPID_MOUSE 40 kDa peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin-40) (CYP-40).
          Length = 369

 Score =  154 bits (389), Expect(2) = 9e-46
 Identities = 73/95 (76%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G +TGKPLH+KGC FHRIIK FM QGGDFS  NGTGGESIYG KF DENF
Sbjct: 48  RALCTGEKGTGSTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENF 107

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H   GLLSMAN+GPNTNGSQFFIT    PHLD
Sbjct: 108 HYKHDREGLLSMANAGPNTNGSQFFITTVPTPHLD 142



 Score = 52.0 bits (123), Expect(2) = 9e-46
 Identities = 25/39 (64%), Positives = 28/39 (71%)
 Frame = +1

Query: 250 KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           K    KNP VFFDV   G  V RIV+ELFAD+VP+TAEN
Sbjct: 8   KPSNSKNPRVFFDVDIGGERVGRIVLELFADIVPKTAEN 46



>gb:BC076386_2106753 Rattus norvegicus peptidylprolyl isomerase D,
           mRNA (cDNA clone MGC:93768 IMAGE:7108860), complete cds.
          Length = 370

 Score =  154 bits (388), Expect(2) = 1e-45
 Identities = 73/95 (76%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G +TGKPLH+KGC FHRIIK FM QGGDFS  NGTGGESIYG KF DENF
Sbjct: 49  RALCTGEKGTGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENF 108

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H   GLLSMAN+GPNTNGSQFFIT    PHLD
Sbjct: 109 HYKHDREGLLSMANAGPNTNGSQFFITTVPTPHLD 143



 Score = 52.0 bits (123), Expect(2) = 1e-45
 Identities = 25/39 (64%), Positives = 28/39 (71%)
 Frame = +1

Query: 250 KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           K    KNP VFFDV   G  V RIV+ELFAD+VP+TAEN
Sbjct: 9   KPSNSKNPRVFFDVDIGGERVGRIVLELFADIVPKTAEN 47



>gb:BC071388_2556129 Danio rerio zgc:86711, mRNA (cDNA clone
           MGC:86711 IMAGE:6896868), complete cds.
          Length = 371

 Score =  157 bits (398), Expect(2) = 3e-45
 Identities = 74/95 (77%), Positives = 77/95 (81%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G STGKPLH+KGC FHRIIK FM QGGDFS  NGTGGESIYG KF DENF
Sbjct: 49  RALCTGEKGVGKSTGKPLHFKGCPFHRIIKSFMIQGGDFSNQNGTGGESIYGDKFEDENF 108

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H   GLLSMAN+GPNTNGSQFFIT    PHLD
Sbjct: 109 HYKHDREGLLSMANAGPNTNGSQFFITTVPTPHLD 143



 Score = 47.0 bits (110), Expect(2) = 3e-45
 Identities = 24/41 (58%), Positives = 27/41 (65%)
 Frame = +1

Query: 244 EWKVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           E K    +NP VFFDV      V R+V ELFADVVP+TAEN
Sbjct: 7   EAKPGNAENPRVFFDVEIGAERVGRVVFELFADVVPKTAEN 47



>pir|A46579|A46579 estrogen receptor-binding cyclophilin -
           bovine>gb:BOVCLPL_1435326 Bovine mRNA for cyclophilin,
           complete cds.
          Length = 370

 Score =  153 bits (386), Expect(2) = 1e-44
 Identities = 73/95 (76%), Positives = 77/95 (81%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKGIG +TGKPLH+KGC FHRIIK FM QGGDFS  NGTGGESIYG KF DENF
Sbjct: 49  RALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENF 108

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H + GLLSMAN+G NTNGSQFFIT    PHLD
Sbjct: 109 HYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLD 143



 Score = 49.7 bits (117), Expect(2) = 1e-44
 Identities = 24/39 (61%), Positives = 27/39 (69%)
 Frame = +1

Query: 250 KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           K     NP VFFDV   G  V RIV+ELFAD+VP+TAEN
Sbjct: 9   KPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAEN 47



>sp|P26882|PPID_BOVIN 40 kDa peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin-40) (CYP-40)
           (Cyclophilin-related protein) (Estrogen receptor binding
           cyclophilin).
          Length = 369

 Score =  153 bits (386), Expect(2) = 1e-44
 Identities = 73/95 (76%), Positives = 77/95 (81%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKGIG +TGKPLH+KGC FHRIIK FM QGGDFS  NGTGGESIYG KF DENF
Sbjct: 48  RALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENF 107

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H + GLLSMAN+G NTNGSQFFIT    PHLD
Sbjct: 108 HYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLD 142



 Score = 49.7 bits (117), Expect(2) = 1e-44
 Identities = 24/39 (61%), Positives = 27/39 (69%)
 Frame = +1

Query: 250 KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           K     NP VFFDV   G  V RIV+ELFAD+VP+TAEN
Sbjct: 8   KPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAEN 46



>gb:CR542081_1994307 Homo sapiens full open reading frame cDNA clone
           RZPDo834G1236D for gene PPID, peptidylprolyl isomerase D
           (cyclophilin D); complete cds, incl. stopcodon.
          Length = 370

 Score =  152 bits (384), Expect(2) = 2e-44
 Identities = 73/95 (76%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKGIG +TGKPLH+KGC FHRIIK FM QGGDFS  NGTGGESIYG KF DENF
Sbjct: 49  RALCTGEKGIGHTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENF 108

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H   GLLSMAN+G NTNGSQFFIT    PHLD
Sbjct: 109 HYKHDREGLLSMANAGRNTNGSQFFITTVPTPHLD 143



 Score = 49.7 bits (117), Expect(2) = 2e-44
 Identities = 24/39 (61%), Positives = 27/39 (69%)
 Frame = +1

Query: 250 KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           K     NP VFFDV   G  V RIV+ELFAD+VP+TAEN
Sbjct: 9   KPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAEN 47



>pir|A45981|A45981 peptidylprolyl isomerase (EC 5.2.1.8) CyP-40 -
           human>gb:AY714221_1960067 Homo sapiens peptidylprolyl
           isomerase D (cyclophilin D) (PPID) gene, complete
           cds.>gb:BC030707_1979929 Homo sapiens peptidylprolyl
           isomerase D (cyclophilin D), mRNA (cDNA clone MGC:33096
           IMAGE:4819748), complete cds.>gb:D63861_1994837 Homo
           sapiens DNA for cyclophilin 40, complete
           cds.>gb:HUMCYC40A_2030399 Human cyclophilin-40 mRNA,
           complete cds.
          Length = 370

 Score =  152 bits (384), Expect(2) = 2e-44
 Identities = 73/95 (76%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKGIG +TGKPLH+KGC FHRIIK FM QGGDFS  NGTGGESIYG KF DENF
Sbjct: 49  RALCTGEKGIGHTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENF 108

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H   GLLSMAN+G NTNGSQFFIT    PHLD
Sbjct: 109 HYKHDREGLLSMANAGRNTNGSQFFITTVPTPHLD 143



 Score = 49.7 bits (117), Expect(2) = 2e-44
 Identities = 24/39 (61%), Positives = 27/39 (69%)
 Frame = +1

Query: 250 KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           K     NP VFFDV   G  V RIV+ELFAD+VP+TAEN
Sbjct: 9   KPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAEN 47



>sp|Q08752|PPID_HUMAN 40 kDa peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin-40) (CYP-40)
           (Cyclophilin-related protein).
          Length = 369

 Score =  152 bits (384), Expect(2) = 2e-44
 Identities = 73/95 (76%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKGIG +TGKPLH+KGC FHRIIK FM QGGDFS  NGTGGESIYG KF DENF
Sbjct: 48  RALCTGEKGIGHTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENF 107

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H   GLLSMAN+G NTNGSQFFIT    PHLD
Sbjct: 108 HYKHDREGLLSMANAGRNTNGSQFFITTVPTPHLD 142



 Score = 49.7 bits (117), Expect(2) = 2e-44
 Identities = 24/39 (61%), Positives = 27/39 (69%)
 Frame = +1

Query: 250 KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           K     NP VFFDV   G  V RIV+ELFAD+VP+TAEN
Sbjct: 8   KPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAEN 46



>gb:BC082380_2562617 Xenopus laevis MGC81732 protein, mRNA (cDNA
           clone MGC:81732 IMAGE:6865456), complete cds.
          Length = 370

 Score =  152 bits (384), Expect(2) = 2e-43
 Identities = 73/95 (76%), Positives = 77/95 (81%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKGIG STGKPLH+KGC FHRIIK FM Q GDFS  +GTGGESIYG KF DENF
Sbjct: 49  RALCTGEKGIGQSTGKPLHFKGCPFHRIIKKFMIQCGDFSNQDGTGGESIYGEKFEDENF 108

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H + GLLSMAN+GPNTNGSQFFIT    PHLD
Sbjct: 109 HYKHDKEGLLSMANAGPNTNGSQFFITTVPTPHLD 143



 Score = 46.2 bits (108), Expect(2) = 2e-43
 Identities = 23/39 (58%), Positives = 25/39 (64%)
 Frame = +1

Query: 250 KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           K     NP VF D    G  V RIV+ELFADVVP+TAEN
Sbjct: 9   KPSNPSNPKVFLDAEIGGERVGRIVLELFADVVPKTAEN 47



>gb:TGU04634_1400203 Toxoplasma gondii Rh 20 kDa cyclophilin
           precursor mRNA, partial cds.
          Length = 347

 Score =  145 bits (366), Expect(2) = 3e-43
 Identities = 73/95 (76%), Positives = 77/95 (81%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G S GKPL+YKGC FHRII  FM QGGDF++ NGTGGESIYG KFADENF
Sbjct: 212 RALCTGEKGTGRS-GKPLYYKGCPFHRIIPQFMCQGGDFTRMNGTGGESIYGEKFADENF 270

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              HSEP LLSMAN+GPNTNGSQFFIT    P LD
Sbjct: 271 SYKHSEPFLLSMANAGPNTNGSQFFITTVPCPWLD 305



 Score = 52.4 bits (124), Expect(2) = 3e-43
 Identities = 26/56 (46%), Positives = 33/56 (58%)
 Frame = +1

Query: 199 RVHSDRVPVTPVGLFEWKVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           R+    +P     L+  ++    NP VFFD+S D  P  RI  ELFADVVP+TAEN
Sbjct: 155 RLRPGSLPCVAFCLYSSRLSTMPNPRVFFDISIDKKPAGRIEFELFADVVPKTAEN 210



>pir|B53522|B53522 20k cyclophilin - Toxoplasma gondii (fragment)
          Length = 347

 Score =  145 bits (366), Expect(2) = 3e-43
 Identities = 73/95 (76%), Positives = 77/95 (81%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G S GKPL+YKGC FHRII  FM QGGDF++ NGTGGESIYG KFADENF
Sbjct: 212 RALCTGEKGTGRS-GKPLYYKGCPFHRIIPQFMCQGGDFTRMNGTGGESIYGEKFADENF 270

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              HSEP LLSMAN+GPNTNGSQFFIT    P LD
Sbjct: 271 SYKHSEPFLLSMANAGPNTNGSQFFITTVPCPWLD 305



 Score = 52.4 bits (124), Expect(2) = 3e-43
 Identities = 26/56 (46%), Positives = 33/56 (58%)
 Frame = +1

Query: 199 RVHSDRVPVTPVGLFEWKVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           R+    +P     L+  ++    NP VFFD+S D  P  RI  ELFADVVP+TAEN
Sbjct: 155 RLRPGSLPCVAFCLYSSRLSTMPNPRVFFDISIDKKPAGRIEFELFADVVPKTAEN 210



>gb:AP004741_1844182 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBb0024N18.
          Length = 396

 Score =  153 bits (387), Expect(2) = 5e-43
 Identities = 72/95 (75%), Positives = 77/95 (81%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G  TGK LHYKG  FHR+IKGFM QGGD + G+GTGGESIYG KF DENF
Sbjct: 59  RALCTGEKGVGAVTGKHLHYKGSCFHRVIKGFMVQGGDITAGDGTGGESIYGLKFEDENF 118

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H   G+LSMANSGPNTNGSQFFIT  R PHLD
Sbjct: 119 VLKHERKGMLSMANSGPNTNGSQFFITTTRTPHLD 153



 Score = 43.5 bits (101), Expect(2) = 5e-43
 Identities = 22/34 (64%), Positives = 24/34 (70%)
 Frame = +1

Query: 265 KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           KNP  F DVS  G    RIV+EL+A VVPRTAEN
Sbjct: 24  KNPRCFMDVSIGGEIEGRIVIELYASVVPRTAEN 57



>pir|T50768|T50768 peptidylprolyl isomerase (EC 5.2.1.8)
           [similarity] - Digitalis lanata>gb:DLCYCLO_1675943
           D.lanata mRNA for cyclophilin.
          Length = 172

 Score =  146 bits (369), Expect(2) = 5e-43
 Identities = 69/95 (72%), Positives = 77/95 (81%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G  TGKPLHYKG  FHR+I GFM QGGDF+ GNGTGGESIYG KFADENF
Sbjct: 37  RALCTGEKGVG-KTGKPLHYKGSAFHRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PG+LSMAN+GP TNGSQFFI  ++   LD
Sbjct: 96  VKKHTGPGILSMANAGPGTNGSQFFICTEKTSWLD 130



 Score = 50.4 bits (119), Expect(2) = 5e-43
 Identities = 23/33 (69%), Positives = 27/33 (81%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++  G P  RIVMEL+ADVVP+TAEN
Sbjct: 3   NPKVFFDMTIGGQPCGRIVMELYADVVPKTAEN 35



>pir|S48018|S48018 peptidylprolyl isomerase (EC 5.2.1.8) Cyp1 -
           rice>gb:RICCYP1R_1703596 Oryza sativa cyclophilin 1
           (Cyp1) mRNA, complete cds.>gb:AP006162_1861130 Oryza
           sativa (japonica cultivar-group) genomic DNA, chromosome
           9, BAC clone:B1331F11.
          Length = 179

 Score =  148 bits (373), Expect(2) = 2e-42
 Identities = 71/95 (74%), Positives = 78/95 (82%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R LCTGEKG+G S GKPLHYKG  FHRII  FM QGGDF++GNGTGGESIYG +FADENF
Sbjct: 39  RCLCTGEKGLGAS-GKPLHYKGSAFHRIIPNFMCQGGDFTRGNGTGGESIYGDRFADENF 97

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           KL H+ PG+LSMAN+GPNTNGSQFFI   R   LD
Sbjct: 98  KLRHTGPGVLSMANAGPNTNGSQFFICTTRTTWLD 132



 Score = 47.4 bits (111), Expect(2) = 2e-42
 Identities = 22/37 (59%), Positives = 25/37 (67%)
 Frame = +1

Query: 256 MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           M  KNP VFFD+        R+VMELFAD VP+TAEN
Sbjct: 1   MASKNPKVFFDILIGKARAGRVVMELFADTVPKTAEN 37



>gb:BC061335_2553111 Xenopus tropicalis hypothetical protein
           MGC75854, mRNA (cDNA clone MGC:75854 IMAGE:5382751),
           complete cds.
          Length = 370

 Score =  147 bits (371), Expect(2) = 2e-42
 Identities = 72/95 (75%), Positives = 75/95 (78%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKGIG STGKPLH+KGC FHRIIK FM Q GDFS  NGTGGESIYG KF DENF
Sbjct: 49  RALSTGEKGIGQSTGKPLHFKGCPFHRIIKKFMIQCGDFSNQNGTGGESIYGEKFEDENF 108

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H + GLLSMAN+GPNTNGSQFFIT     HLD
Sbjct: 109 HYKHDKEGLLSMANAGPNTNGSQFFITTVPTAHLD 143



 Score = 47.8 bits (112), Expect(2) = 2e-42
 Identities = 24/39 (61%), Positives = 26/39 (66%)
 Frame = +1

Query: 250 KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           K     NP VF DV   G  V RIV+ELFADVVP+TAEN
Sbjct: 9   KPSNPSNPKVFLDVEIGGERVGRIVLELFADVVPKTAEN 47



>gb:RCO245940_1703385 Ricinus communis mRNA for cyclophilin (cyp1
           gene).
          Length = 173

 Score =  144 bits (362), Expect(2) = 3e-42
 Identities = 69/95 (72%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPLHYKG  FHR+I GFM QGGDF+ GNGTGGESIYG KFADENF
Sbjct: 38  RALCTGEKGVGRS-GKPLHYKGSSFHRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENF 96

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PG+LSMAN+GP TNGSQFFI   +   LD
Sbjct: 97  IKKHTGPGILSMANAGPGTNGSQFFICTAKTEWLD 131



 Score = 50.4 bits (119), Expect(2) = 3e-42
 Identities = 23/33 (69%), Positives = 25/33 (75%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++  G P  RIVMELFAD  PRTAEN
Sbjct: 4   NPKVFFDMTVGGAPAGRIVMELFADTTPRTAEN 36



>gb:AY705800_1179907 Pinus halepensis clone 17r cyclophilin mRNA,
           complete cds.
          Length = 172

 Score =  143 bits (361), Expect(2) = 3e-42
 Identities = 69/95 (72%), Positives = 77/95 (81%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G S GKPLH+KG  FHR+I GFM QGGDF++GNGTGGESIYG KFADENF
Sbjct: 37  RALCTGEKGTGRS-GKPLHFKGSSFHRVIPGFMCQGGDFTRGNGTGGESIYGEKFADENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 96  VKKHTGPGILSMANAGPNTNGSQFFICTAQTSWLD 130



 Score = 50.8 bits (120), Expect(2) = 3e-42
 Identities = 23/33 (69%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD+   G P  RIVMEL+ADVVP+TAEN
Sbjct: 3   NPKVFFDMQVGGAPAGRIVMELYADVVPKTAEN 35



>pir|T50769|T50769 peptidylprolyl isomerase (EC 5.2.1.8) CYP18
           [similarity] - Digitalis lanata>gb:DLCYP18_1675945
           D.lanata CYP18 gene.
          Length = 172

 Score =  145 bits (367), Expect(2) = 4e-42
 Identities = 69/95 (72%), Positives = 77/95 (81%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPLHYKG  FHR+I GFM QGGDF+ GNGTGGESIYG KFADENF
Sbjct: 37  RALCTGEKGVGKS-GKPLHYKGSAFHRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PG+LSMAN+GP TNGSQFFI  ++   LD
Sbjct: 96  VKKHTGPGILSMANAGPGTNGSQFFICTEKTAWLD 130



 Score = 48.1 bits (113), Expect(2) = 4e-42
 Identities = 22/32 (68%), Positives = 26/32 (81%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFD+S  G P  RIVMEL+ADVVP+TA+N
Sbjct: 4   PKVFFDMSIGGQPCGRIVMELYADVVPKTADN 35



>gb:CR382133_1666890 Debaryomyces hansenii chromosome A of strain
           CBS767 of Debaryomyces hansenii.
          Length = 370

 Score =  145 bits (366), Expect(2) = 6e-42
 Identities = 69/95 (72%), Positives = 77/95 (81%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG  +S+GK LHYKG IFHRIIK FM QGGDF+ G+G GGESIYG KF DENF
Sbjct: 41  RALCTGEKGASESSGKQLHYKGSIFHRIIKDFMCQGGDFTHGSGIGGESIYGEKFEDENF 100

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +L H +P LLSMAN+G NTNGSQFFIT    PHL+
Sbjct: 101 QLTHDKPFLLSMANAGANTNGSQFFITTVPTPHLN 135



 Score = 48.1 bits (113), Expect(2) = 6e-42
 Identities = 22/36 (61%), Positives = 26/36 (72%)
 Frame = +1

Query: 259 KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           K   P VFFD+S DG P  R+V EL+ DVVP+TAEN
Sbjct: 4   KLNRPKVFFDISADGKPKGRVVFELYNDVVPKTAEN 39



>pir|T07950|T07950 peptidylprolyl isomerase (EC 5.2.1.8) 1 -
           Chlamydomonas reinhardtii>gb:AF052206_1764330
           Chlamydomonas reinhardtii cyclophilin 1 (cyp1) mRNA,
           complete cds.
          Length = 172

 Score =  141 bits (355), Expect(2) = 6e-42
 Identities = 67/95 (70%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPLH+KG  FHR+I  FM QGGDF++GNGTGGESIYG KF DENF
Sbjct: 37  RALCTGEKGVGRS-GKPLHFKGSTFHRVIPNFMCQGGDFTRGNGTGGESIYGEKFPDENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           K  H+ PG+LSMAN+GPNTNGSQFF+       LD
Sbjct: 96  KHRHTGPGVLSMANAGPNTNGSQFFLCTVETAWLD 130



 Score = 52.4 bits (124), Expect(2) = 6e-42
 Identities = 23/33 (69%), Positives = 28/33 (84%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP+VFFD++ DG PV RI MEL+AD VP+TAEN
Sbjct: 3   NPIVFFDITADGAPVGRIEMELYADDVPKTAEN 35



>sp|Q39613|CYPH_CATRO Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein).>pir|T10056|T10056 peptidylprolyl
           isomerase (EC 5.2.1.8) (cyclophilin 1), cytosolic -
           Madagascar periwinkle>gb:CRPCKR1_1673512 C.roseus PCKR1
           mRNA for cyclophilin.
          Length = 172

 Score =  142 bits (357), Expect(2) = 1e-41
 Identities = 69/95 (72%), Positives = 75/95 (78%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G S GKPLHYK   FHR+I GFM QGGDF+ GNGTGGESIYG KFADENF
Sbjct: 37  RALCTGEKGTGRS-GKPLHYKDSSFHRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 96  IKKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 130



 Score = 50.8 bits (120), Expect(2) = 1e-41
 Identities = 24/33 (72%), Positives = 25/33 (75%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD+S  G P  RIVMELFAD  PRTAEN
Sbjct: 3   NPRVFFDMSVGGQPAGRIVMELFADTTPRTAEN 35



>gb:PAB271126_1698633 Picea abies mRNA for putative cyclosporin
           A-binding protein, (pPA0005 gene).
          Length = 172

 Score =  140 bits (354), Expect(2) = 2e-41
 Identities = 67/95 (70%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGE+G G S GKPLH+K   FHR+I GFM QGGDF++GNGTGGESIYG KFADENF
Sbjct: 37  RALCTGERGTGRS-GKPLHFKSSTFHRVIPGFMCQGGDFTRGNGTGGESIYGEKFADENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 96  ARKHTGPGILSMANAGPNTNGSQFFICTAQTSWLD 130



 Score = 50.8 bits (120), Expect(2) = 2e-41
 Identities = 23/33 (69%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD+   G P  RIVMEL+ADVVP+TAEN
Sbjct: 3   NPKVFFDMQVGGAPAGRIVMELYADVVPKTAEN 35



>gb:AB020612_1514551 Vigna radiata mRNA for CYP1, complete cds.
          Length = 172

 Score =  144 bits (363), Expect(2) = 3e-41
 Identities = 69/95 (72%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPLHYKG IFHR+I  FM QGGDF+ GNGTGGESIYG KFADENF
Sbjct: 37  RALCTGEKGVGRS-GKPLHYKGSIFHRVIPNFMCQGGDFTAGNGTGGESIYGAKFADENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PG+LSMAN+GP TNGSQFFI   +   LD
Sbjct: 96  VKKHTGPGILSMANAGPGTNGSQFFICTTKTEWLD 130



 Score = 47.0 bits (110), Expect(2) = 3e-41
 Identities = 21/33 (63%), Positives = 24/33 (72%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++  G P  +IV ELFAD  PRTAEN
Sbjct: 3   NPKVFFDMTIGGQPAGKIVFELFADTTPRTAEN 35



>sp|P73789|PPI2_SYNY3 Peptidyl-prolyl cis-trans isomerase slr1251
           (EC 5.2.1.8) (PPIase) (Rotamase).>pir|S74880|S74880
           peptidylprolyl isomerase (EC 5.2.1.8) - Synechocystis
           sp.  (strain PCC 6803)>gb:BA000022_688620 Synechocystis
           sp. PCC 6803 DNA, complete genome.
          Length = 171

 Score =  152 bits (385), Expect(2) = 4e-41
 Identities = 72/95 (75%), Positives = 81/95 (85%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G + GKPLH+KG  FHR+I  FMAQGGDF++GNGTGGESIYG KFADENF
Sbjct: 36  RALCTGEKGVGKA-GKPLHFKGSHFHRVITDFMAQGGDFTRGNGTGGESIYGEKFADENF 94

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +L H  PGLLSMAN+GPNTNGSQFF+TF   P LD
Sbjct: 95  QLKHDRPGLLSMANAGPNTNGSQFFLTFVPCPWLD 129



 Score = 38.1 bits (87), Expect(2) = 4e-41
 Identities = 17/30 (56%), Positives = 21/30 (70%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           VFFD++       RIVMELF +V P+TAEN
Sbjct: 5   VFFDITIGSDTAGRIVMELFDEVTPKTAEN 34



>gb:ATU40400_1556976 Arabidopsis thaliana cytosolic cyclophilin
           (ROC2) gene, complete cds.
          Length = 176

 Score =  148 bits (373), Expect(2) = 5e-41
 Identities = 71/95 (74%), Positives = 78/95 (82%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGE GIG + GK LHYKG  FHRII GFM QGGDF++GNGTGGESIYG KF DENF
Sbjct: 37  RALCTGENGIGKA-GKALHYKGSAFHRIIPGFMCQGGDFTRGNGTGGESIYGSKFEDENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           KL H+ PG+LSMANSGPNTNGSQFFI  ++   LD
Sbjct: 96  KLKHTGPGILSMANSGPNTNGSQFFICTEKTSWLD 130



 Score = 42.4 bits (98), Expect(2) = 5e-41
 Identities = 20/33 (60%), Positives = 22/33 (66%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD+        R+VMELFADV PRTA N
Sbjct: 3   NPKVFFDILIGKMKAGRVVMELFADVTPRTANN 35



>pir|T50767|T50767 peptidylprolyl isomerase (EC 5.2.1.8) ATCYP4
           [similarity] - Arabidopsis thaliana>gb:ATU31370_1556898
           Arabidopsis thaliana cyclophilin (ATCYP4) gene, complete
           cds.
          Length = 176

 Score =  148 bits (373), Expect(2) = 5e-41
 Identities = 71/95 (74%), Positives = 78/95 (82%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGE GIG + GK LHYKG  FHRII GFM QGGDF++GNGTGGESIYG KF DENF
Sbjct: 37  RALCTGENGIGKA-GKALHYKGSAFHRIIPGFMCQGGDFTRGNGTGGESIYGSKFEDENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           KL H+ PG+LSMANSGPNTNGSQFFI  ++   LD
Sbjct: 96  KLKHTGPGILSMANSGPNTNGSQFFICTEKTSWLD 130



 Score = 42.4 bits (98), Expect(2) = 5e-41
 Identities = 20/33 (60%), Positives = 22/33 (66%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD+        R+VMELFADV PRTA N
Sbjct: 3   NPKVFFDILIGKMKAGRVVMELFADVTPRTANN 35



>pir|T47724|T47724 peptidylprolyl isomerase (EC 5.2.1.8) ROC2 -
           Arabidopsis thaliana>gb:ATF18O21_1549197 Arabidopsis
           thaliana DNA chromosome 3, BAC clone
           F18O21.>gb:AY072128_1567022 Arabidopsis thaliana
           putative peptidylprolyl isomerase (At3g56070) mRNA,
           complete cds.>gb:AY096697_1576233 Arabidopsis thaliana
           putative peptidylprolyl isomerase (At3g56070) mRNA,
           complete cds.
          Length = 176

 Score =  148 bits (373), Expect(2) = 5e-41
 Identities = 71/95 (74%), Positives = 78/95 (82%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGE GIG + GK LHYKG  FHRII GFM QGGDF++GNGTGGESIYG KF DENF
Sbjct: 37  RALCTGENGIGKA-GKALHYKGSAFHRIIPGFMCQGGDFTRGNGTGGESIYGSKFEDENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           KL H+ PG+LSMANSGPNTNGSQFFI  ++   LD
Sbjct: 96  KLKHTGPGILSMANSGPNTNGSQFFICTEKTSWLD 130



 Score = 42.4 bits (98), Expect(2) = 5e-41
 Identities = 20/33 (60%), Positives = 22/33 (66%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD+        R+VMELFADV PRTA N
Sbjct: 3   NPKVFFDILIGKMKAGRVVMELFADVTPRTANN 35



>gb:AY229877_1591321 Populus tremuloides cyclophilin mRNA, complete
           cds.
          Length = 172

 Score =  140 bits (354), Expect(2) = 5e-41
 Identities = 69/95 (72%), Positives = 75/95 (78%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG   S GKPLHYKG  FHR+I GFM QGGDF++GNGTGGESIYG KFADENF
Sbjct: 37  RALCTGEKGKVRS-GKPLHYKGSTFHRVIPGFMCQGGDFTEGNGTGGESIYGAKFADENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PG+LSMANSGP TNGSQFFI   +   LD
Sbjct: 96  VKKHTGPGILSMANSGPGTNGSQFFICTDKTEWLD 130



 Score = 49.7 bits (117), Expect(2) = 5e-41
 Identities = 22/33 (66%), Positives = 25/33 (75%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP V+FD++  G P  RIVMELFAD  PRTAEN
Sbjct: 3   NPKVYFDMTIGGAPAGRIVMELFADTTPRTAEN 35



>gb:AF456323_1801173 Glycine max cyclophilin (Cyp) mRNA, complete
           cds.
          Length = 172

 Score =  142 bits (359), Expect(2) = 6e-41
 Identities = 68/95 (71%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPLHYKG  FHR+I  FM QGGDF+ GNGTGGESIYG KFADENF
Sbjct: 37  RALCTGEKGVGRS-GKPLHYKGSSFHRVIPSFMCQGGDFTAGNGTGGESIYGAKFADENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PG+LSMAN+GP TNGSQFFI  ++   LD
Sbjct: 96  VKKHTGPGILSMANAGPGTNGSQFFICTEKTEWLD 130



 Score = 47.4 bits (111), Expect(2) = 6e-41
 Identities = 22/33 (66%), Positives = 25/33 (75%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++  G    RIVMEL+ADV PRTAEN
Sbjct: 3   NPKVFFDMTIGGQSAGRIVMELYADVTPRTAEN 35



>gb:AY456122_1607156 Triticum aestivum cyclophilin A (CYP18-2) gene,
           complete cds.>gb:AF262983_1781651 Triticum aestivum
           cyclophilin A-2 (CyP2) mRNA, complete cds.
          Length = 171

 Score =  142 bits (359), Expect(2) = 6e-41
 Identities = 67/86 (77%), Positives = 74/86 (86%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPLHYKG  FHR+I  FM QGGDF+KGNGTGGESIYG KFADE F
Sbjct: 37  RALCTGEKGVGKS-GKPLHYKGSSFHRVIPDFMCQGGDFTKGNGTGGESIYGEKFADEKF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFI 628
              H++PG+LSMAN+GPNTNGSQFFI
Sbjct: 96  VHKHTKPGILSMANAGPNTNGSQFFI 121



 Score = 47.4 bits (111), Expect(2) = 6e-41
 Identities = 21/33 (63%), Positives = 24/33 (72%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++  G P  RIVMEL+ D VPRT EN
Sbjct: 3   NPRVFFDMTVGGAPAGRIVMELYKDAVPRTVEN 35



>pir|S54833|S54833 peptidylprolyl isomerase (EC 5.2.1.8) Cyp -
           kidney bean>gb:PVCYCGNA_1702927 P.vulgaris gene for
           cyclophilin.
          Length = 172

 Score =  141 bits (356), Expect(2) = 6e-41
 Identities = 67/95 (70%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKP+H+KG IFHR+I  FM QGGDF+ GNGTGGESIYG KFADENF
Sbjct: 37  RALCTGEKGVGRS-GKPVHFKGSIFHRVIPNFMCQGGDFTAGNGTGGESIYGAKFADENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PG+LSMAN+GP TNGSQFFI   +   LD
Sbjct: 96  VKKHTGPGILSMANAGPGTNGSQFFICTTKTEWLD 130



 Score = 48.5 bits (114), Expect(2) = 6e-41
 Identities = 22/33 (66%), Positives = 25/33 (75%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++  G P  RIV EL+ADV PRTAEN
Sbjct: 3   NPKVFFDMTIGGQPAGRIVFELYADVTPRTAEN 35



>gb:AY775573_1628283 Codonopsis lanceolata cyclophilin 1 (CyP1)
           mRNA, complete cds.
          Length = 174

 Score =  148 bits (374), Expect(2) = 8e-41
 Identities = 73/95 (76%), Positives = 79/95 (83%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKGIG S GKPLHYKG IFHRII  FM QGGDF++ NGTGGESIYG KFADENF
Sbjct: 37  RALCTGEKGIGLS-GKPLHYKGSIFHRIIPNFMCQGGDFTRFNGTGGESIYGAKFADENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           K  H+ PG+LSMANSGPNTNGSQFFI  ++   LD
Sbjct: 96  KNKHTGPGILSMANSGPNTNGSQFFICTEKTSWLD 130



 Score = 41.2 bits (95), Expect(2) = 8e-41
 Identities = 20/33 (60%), Positives = 22/33 (66%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD+        RIVMELFAD  P+TAEN
Sbjct: 3   NPKVFFDIVIGKMKAGRIVMELFADSTPKTAEN 35



>sp|Q9P3X9|PPID_NEUCR 41 kDa peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin-41)
           (CYP-41).>gb:NCR292563_1690629 Neurospora crassa mRNA
           for cyclophilin41.
          Length = 375

 Score =  148 bits (374), Expect(2) = 1e-40
 Identities = 70/95 (73%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G   GKPLHYKG  FHR+IK FM QGGDF+ GNGTGGESIYG KF DENF
Sbjct: 45  RALCTGEKGVG-KLGKPLHYKGSTFHRVIKQFMIQGGDFTAGNGTGGESIYGAKFEDENF 103

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +L H  P LLSMAN+GP TNGSQFF+T    PHLD
Sbjct: 104 QLKHDRPFLLSMANAGPGTNGSQFFVTTVPTPHLD 138



 Score = 40.8 bits (94), Expect(2) = 1e-40
 Identities = 18/37 (48%), Positives = 25/37 (67%)
 Frame = +1

Query: 256 MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +K+    VFFD++  G    RIV EL+ D+VP+TAEN
Sbjct: 7   VKQARSRVFFDITIGGKAAGRIVFELYNDIVPKTAEN 43



>gb:AY773481_1628186 Amanita muscaria 40 kDa cyclophilin (Cyp40)
           mRNA, complete cds.
          Length = 371

 Score =  150 bits (379), Expect(2) = 1e-40
 Identities = 72/95 (75%), Positives = 77/95 (81%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPL YKG  FHR+IKGFM QGGDF+ GNGTGGESIYG KF DE F
Sbjct: 38  RALCTGEKGLGQS-GKPLWYKGSAFHRVIKGFMCQGGDFTAGNGTGGESIYGEKFEDEGF 96

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            + HS P LLSMAN+GPNTNGSQFFIT    PHLD
Sbjct: 97  PVHHSRPFLLSMANAGPNTNGSQFFITVSATPHLD 131



 Score = 38.9 bits (89), Expect(2) = 1e-40
 Identities = 15/32 (46%), Positives = 23/32 (71%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P+VFFD++  G    R+   L++D+VP+TAEN
Sbjct: 5   PIVFFDIAIGGQLAGRVAFRLYSDLVPKTAEN 36



>gb:AF262982_1781650 Triticum aestivum cyclophilin A-1 (CyP1) mRNA,
           complete cds.>gb:AF262984_1781652 Triticum aestivum
           cyclophilin A-3 (CyP3) mRNA, complete cds.
          Length = 171

 Score =  142 bits (357), Expect(2) = 1e-40
 Identities = 66/86 (76%), Positives = 74/86 (86%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPLHYKG  FHR+I  FM QGGDF++GNGTGGESIYG KFADE F
Sbjct: 37  RALCTGEKGVGKS-GKPLHYKGSAFHRVIPDFMCQGGDFTRGNGTGGESIYGEKFADEKF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFI 628
              H++PG+LSMAN+GPNTNGSQFFI
Sbjct: 96  VHKHTKPGILSMANAGPNTNGSQFFI 121



 Score = 47.4 bits (111), Expect(2) = 1e-40
 Identities = 21/33 (63%), Positives = 24/33 (72%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++  G P  RIVMEL+ D VPRT EN
Sbjct: 3   NPRVFFDMTVGGAPAGRIVMELYKDAVPRTVEN 35



>gb:BC067931_2554916 Xenopus tropicalis hypothetical protein
           MGC69461, mRNA (cDNA clone MGC:69461 IMAGE:5336022),
           complete cds.
          Length = 736

 Score =  149 bits (376), Expect(2) = 1e-40
 Identities = 68/95 (71%), Positives = 78/95 (82%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R+LCTGE+GIG ST KPLHYK C+FHR++K FM QGGDFS+GNG GGESIYGG F DENF
Sbjct: 41  RSLCTGERGIGKSTQKPLHYKNCMFHRVVKDFMIQGGDFSEGNGRGGESIYGGFFEDENF 100

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            + H++  LLSMAN G +TNGSQFFIT K  PHLD
Sbjct: 101 SIQHNKEFLLSMANRGKDTNGSQFFITTKPTPHLD 135



 Score = 39.7 bits (91), Expect(2) = 1e-40
 Identities = 16/37 (43%), Positives = 24/37 (64%)
 Frame = +1

Query: 256 MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +K +    FFD++ +  P  R+V ELF+DV P+T EN
Sbjct: 3   VKVQRTRCFFDIAINNAPAGRVVFELFSDVCPKTCEN 39



>sp|P21568|CYPH_LYCES Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein).>gb:TOMCYP_1725644 Lycopersicon
           esculentum cyclophilin (CyP) mRNA, complete cds.
          Length = 171

 Score =  139 bits (351), Expect(2) = 1e-40
 Identities = 65/86 (75%), Positives = 71/86 (82%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G   GKPLHYKG  FHR+I GFM QGGDF+ GNGTGGESIYG KF DENF
Sbjct: 37  RALCTGEKGVG-KMGKPLHYKGSTFHRVIPGFMCQGGDFTAGNGTGGESIYGAKFNDENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFI 628
              H+ PG+LSMAN+GP TNGSQFFI
Sbjct: 96  VKKHTGPGILSMANAGPGTNGSQFFI 121



 Score = 49.3 bits (116), Expect(2) = 1e-40
 Identities = 21/33 (63%), Positives = 25/33 (75%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++  G P  R+VMELFAD  P+TAEN
Sbjct: 3   NPKVFFDLTIGGAPAGRVVMELFADTTPKTAEN 35



>gb:AY392408_1604713 Thellungiella halophila cyclophilin mRNA,
           complete cds.
          Length = 173

 Score =  140 bits (354), Expect(2) = 2e-40
 Identities = 68/95 (71%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPLHYKG  FHR+I  FM QGGDF+KGNGTGGESIYG KF DENF
Sbjct: 38  RALCTGEKGMGKS-GKPLHYKGSAFHRVIPKFMCQGGDFTKGNGTGGESIYGMKFKDENF 96

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PG+LSMAN+G NTNGSQFFI  ++   LD
Sbjct: 97  TKKHTGPGILSMANAGANTNGSQFFICTEKTSWLD 131



 Score = 47.4 bits (111), Expect(2) = 2e-40
 Identities = 21/33 (63%), Positives = 24/33 (72%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++  G P  RIVMEL+AD  P TAEN
Sbjct: 4   NPKVFFDMTVGGSPAGRIVMELYADTTPETAEN 36



>gb:BVE311666_1643105 Betula verrucosa mRNA for peptidylprolyl
           isomerase (cyclophilin), ppiase gene (CyP).
          Length = 173

 Score =  138 bits (348), Expect(2) = 2e-40
 Identities = 68/95 (71%), Positives = 74/95 (77%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G S GKPLHYK   FHR+I GFM QGGDF+ GNGTGGESIYG KFADENF
Sbjct: 38  RALCTGEKGNGRS-GKPLHYKKSSFHRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENF 96

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PG+LSMAN+GP TNGSQFFI   +   LD
Sbjct: 97  IKKHTGPGILSMANAGPGTNGSQFFICTAKTEWLD 131



 Score = 49.7 bits (117), Expect(2) = 2e-40
 Identities = 23/33 (69%), Positives = 25/33 (75%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD+   G PV RIVMEL+AD  PRTAEN
Sbjct: 4   NPKVFFDMEVGGQPVGRIVMELYADTTPRTAEN 36



>sp|Q13427|PPIG_HUMAN Peptidyl-prolyl cis-trans isomerase G (EC
           5.2.1.8) (Peptidyl-prolyl isomerase G) (PPIase G)
           (Rotamase G) (Cyclophilin G) (Clk associating
           RS-cyclophilin) (CARS-cyclophilin) (CARS-Cyp) (SRcyp)
           (CASP10).>pir|JC5314|JC5314 CDC28/cdc2-like kinase
           associating arginine-serine cyclophilin -
           human>gb:HSSRCYP_2020513 H.sapiens mRNA for SRcyp
           protein.>gb:HSU40763_2024127 Human Clk-associated RS
           cyclophilin CARS-Cyp mRNA, complete cds.
          Length = 754

 Score =  145 bits (367), Expect(2) = 3e-40
 Identities = 67/95 (70%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R LCTGEKG G ST KPLHYK C+FHR++K FM QGGDFS+GNG GGESIYGG F DE+F
Sbjct: 41  RCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESF 100

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            + H++  LLSMAN G +TNGSQFFIT K  PHLD
Sbjct: 101 AVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLD 135



 Score = 42.0 bits (97), Expect(2) = 3e-40
 Identities = 17/37 (45%), Positives = 25/37 (67%)
 Frame = +1

Query: 256 MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +K + P  FFD++ +  P  R+V ELF+DV P+T EN
Sbjct: 3   IKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCEN 39



>gb:BC085963_2564558 Xenopus laevis hypothetical LOC495525, mRNA
           (cDNA clone MGC:97908 IMAGE:7196980), complete cds.
          Length = 752

 Score =  145 bits (367), Expect(2) = 3e-40
 Identities = 67/95 (70%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R LCTGEKG G ST KPLHYK C+FHR++K FM QGGDFS+GNG GGESIYGG F DE+F
Sbjct: 41  RCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESF 100

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            + H++  LLSMAN G +TNGSQFFIT K  PHLD
Sbjct: 101 AVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLD 135



 Score = 42.0 bits (97), Expect(2) = 3e-40
 Identities = 17/37 (45%), Positives = 25/37 (67%)
 Frame = +1

Query: 256 MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +K + P  FFD++ +  P  R+V ELF+DV P+T EN
Sbjct: 3   IKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCEN 39



>gb:BC085723_2109296 Rattus norvegicus cDNA clone MGC:93333
           IMAGE:7123868, complete cds.
          Length = 752

 Score =  145 bits (367), Expect(2) = 3e-40
 Identities = 67/95 (70%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R LCTGEKG G ST KPLHYK C+FHR++K FM QGGDFS+GNG GGESIYGG F DE+F
Sbjct: 41  RCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESF 100

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            + H++  LLSMAN G +TNGSQFFIT K  PHLD
Sbjct: 101 AVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLD 135



 Score = 42.0 bits (97), Expect(2) = 3e-40
 Identities = 17/37 (45%), Positives = 25/37 (67%)
 Frame = +1

Query: 256 MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +K + P  FFD++ +  P  R+V ELF+DV P+T EN
Sbjct: 3   IKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCEN 39



>sp|O55035|PPIG_RAT Peptidyl-prolyl cis-trans isomerase G (EC
           5.2.1.8) (Peptidyl-prolyl isomerase G) (PPIase G)
           (Rotamase G) (Cyclophilin G) (Matrin cyclophilin)
           (Matrin-cyp).>gb:AF043642_2052182 Rattus norvegicus
           matrin cyclophilin (matrin-cyp) mRNA, complete cds.
          Length = 752

 Score =  145 bits (367), Expect(2) = 3e-40
 Identities = 67/95 (70%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R LCTGEKG G ST KPLHYK C+FHR++K FM QGGDFS+GNG GGESIYGG F DE+F
Sbjct: 41  RCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESF 100

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            + H++  LLSMAN G +TNGSQFFIT K  PHLD
Sbjct: 101 AVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLD 135



 Score = 42.0 bits (97), Expect(2) = 3e-40
 Identities = 17/37 (45%), Positives = 25/37 (67%)
 Frame = +1

Query: 256 MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +K + P  FFD++ +  P  R+V ELF+DV P+T EN
Sbjct: 3   IKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCEN 39



>gb:BC073875_1989152 Homo sapiens peptidyl-prolyl isomerase G
           (cyclophilin G), mRNA (cDNA clone IMAGE:3918701),
           partial cds.
          Length = 402

 Score =  145 bits (367), Expect(2) = 3e-40
 Identities = 67/95 (70%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R LCTGEKG G ST KPLHYK C+FHR++K FM QGGDFS+GNG GGESIYGG F DE+F
Sbjct: 41  RCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESF 100

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            + H++  LLSMAN G +TNGSQFFIT K  PHLD
Sbjct: 101 AVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLD 135



 Score = 42.0 bits (97), Expect(2) = 3e-40
 Identities = 17/37 (45%), Positives = 25/37 (67%)
 Frame = +1

Query: 256 MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +K + P  FFD++ +  P  R+V ELF+DV P+T EN
Sbjct: 3   IKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCEN 39



>gb:AP004159_1838390 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1175_B01.>gb:AP005002_1847068 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0486G03.
          Length = 403

 Score =  145 bits (367), Expect(2) = 3e-40
 Identities = 67/95 (70%), Positives = 75/95 (78%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+  +TG PLHYKG   HRI+KGFM QGGD + G+GTGGESIYG  F DENF
Sbjct: 66  RALCTGEKGVSAATGVPLHYKGSCIHRIVKGFMVQGGDITAGDGTGGESIYGLNFEDENF 125

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H   G+LSMAN+GP+TNGSQFFIT  R PHLD
Sbjct: 126 VLKHERKGMLSMANAGPDTNGSQFFITTTRTPHLD 160



 Score = 42.0 bits (97), Expect(2) = 3e-40
 Identities = 21/41 (51%), Positives = 27/41 (65%)
 Frame = +1

Query: 244 EWKVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           E +V+  +NP  + DVS  G    RIV+EL+A V PRTAEN
Sbjct: 24  EAEVVVVRNPRCYLDVSIGGDMEGRIVVELYASVAPRTAEN 64



>gb:BC001555_1967676 Homo sapiens peptidyl-prolyl isomerase G
           (cyclophilin G), mRNA (cDNA clone IMAGE:3461499),
           complete cds.
          Length = 357

 Score =  145 bits (367), Expect(2) = 3e-40
 Identities = 67/95 (70%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R LCTGEKG G ST KPLHYK C+FHR++K FM QGGDFS+GNG GGESIYGG F DE+F
Sbjct: 41  RCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESF 100

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            + H++  LLSMAN G +TNGSQFFIT K  PHLD
Sbjct: 101 AVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLD 135



 Score = 42.0 bits (97), Expect(2) = 3e-40
 Identities = 17/37 (45%), Positives = 25/37 (67%)
 Frame = +1

Query: 256 MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +K + P  FFD++ +  P  R+V ELF+DV P+T EN
Sbjct: 3   IKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCEN 39



>gb:BC063711_1986345 Homo sapiens peptidyl-prolyl isomerase G
           (cyclophilin G), mRNA (cDNA clone IMAGE:5123534),
           partial cds.
          Length = 247

 Score =  145 bits (367), Expect(2) = 3e-40
 Identities = 67/95 (70%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R LCTGEKG G ST KPLHYK C+FHR++K FM QGGDFS+GNG GGESIYGG F DE+F
Sbjct: 41  RCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESF 100

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            + H++  LLSMAN G +TNGSQFFIT K  PHLD
Sbjct: 101 AVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLD 135



 Score = 42.0 bits (97), Expect(2) = 3e-40
 Identities = 17/37 (45%), Positives = 25/37 (67%)
 Frame = +1

Query: 256 MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +K + P  FFD++ +  P  R+V ELF+DV P+T EN
Sbjct: 3   IKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCEN 39



>gb:BC048905_2099865 Mus musculus peptidyl-prolyl isomerase G
           (cyclophilin G), mRNA (cDNA clone IMAGE:3489827),
           partial cds.
          Length = 189

 Score =  145 bits (367), Expect(2) = 3e-40
 Identities = 67/95 (70%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R LCTGEKG G ST KPLHYK C+FHR++K FM QGGDFS+GNG GGESIYGG F DE+F
Sbjct: 41  RCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESF 100

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            + H++  LLSMAN G +TNGSQFFIT K  PHLD
Sbjct: 101 AVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLD 135



 Score = 42.0 bits (97), Expect(2) = 3e-40
 Identities = 17/37 (45%), Positives = 25/37 (67%)
 Frame = +1

Query: 256 MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +K + P  FFD++ +  P  R+V ELF+DV P+T EN
Sbjct: 3   IKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCEN 39



>gb:AY652862_1620183 Populus balsamifera subsp. trichocarpa
           peptidyl-prolyl cis-trans isomerase (CYC063) gene,
           complete cds.
          Length = 172

 Score =  143 bits (360), Expect(2) = 3e-40
 Identities = 70/95 (73%), Positives = 75/95 (78%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G S GKPLHYKG  FHR+I GFM QGGDF+ GNGTGGESIYG KFADENF
Sbjct: 37  RALCTGEKGKGRS-GKPLHYKGSTFHRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PG+LSMANSGP TNGSQFFI   +   LD
Sbjct: 96  IKKHTGPGILSMANSGPGTNGSQFFICTDKTEWLD 130



 Score = 44.7 bits (104), Expect(2) = 3e-40
 Identities = 20/33 (60%), Positives = 24/33 (72%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP V+ D++  G P  RIV+ELFAD  PRTAEN
Sbjct: 3   NPKVYLDMTIGGVPAGRIVIELFADTTPRTAEN 35



>pir|A39252|CSTO peptidylprolyl isomerase (EC 5.2.1.8) - tomato
          Length = 171

 Score =  139 bits (351), Expect(2) = 3e-40
 Identities = 65/86 (75%), Positives = 71/86 (82%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G   GKPLHYKG  FHR+I GFM QGGDF+ GNGTGGESIYG KF DENF
Sbjct: 37  RALCTGEKGVG-KMGKPLHYKGSTFHRVIPGFMCQGGDFTAGNGTGGESIYGAKFNDENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFI 628
              H+ PG+LSMAN+GP TNGSQFFI
Sbjct: 96  VKKHTGPGILSMANAGPGTNGSQFFI 121



 Score = 48.1 bits (113), Expect(2) = 3e-40
 Identities = 20/33 (60%), Positives = 25/33 (75%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++  G P  R+VMEL+AD  P+TAEN
Sbjct: 3   NPKVFFDLTIGGAPAGRVVMELYADTTPKTAEN 35



>pir|T50771|T50771 peptidylprolyl isomerase (EC 5.2.1.8)
           [similarity] - potato>gb:AF126551_1770416 Solanum
           tuberosum subsp. tuberosum cyclophilin mRNA, complete
           cds.
          Length = 171

 Score =  138 bits (348), Expect(2) = 3e-40
 Identities = 66/95 (69%), Positives = 73/95 (76%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G   GKPLHYKG  FHR+I GFM QGGDF+ GNGTGGESIYG KF DENF
Sbjct: 37  RALCTGEKGVG-KMGKPLHYKGSTFHRVIPGFMCQGGDFTAGNGTGGESIYGAKFKDENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+  G+LSMAN+GP TNGSQFFI   +   LD
Sbjct: 96  VKKHTGTGILSMANAGPGTNGSQFFICTAKTEWLD 130



 Score = 49.3 bits (116), Expect(2) = 3e-40
 Identities = 21/33 (63%), Positives = 25/33 (75%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++  G P  R+VMELFAD  P+TAEN
Sbjct: 3   NPRVFFDLTIGGAPAGRVVMELFADTTPKTAEN 35



>pir|S48017|S48017 peptidylprolyl isomerase (EC 5.2.1.8) Cyp2 -
           rice>gb:RICCYP2G_1703597 Oryza sativa cyclophilin 2
           (Cyp2) gene, complete cds.>gb:AP004078_1837353 Oryza
           sativa (japonica cultivar-group) genomic DNA, chromosome
           2, BAC clone:OJ1020_C02.>gb:AP005851_1859098 Oryza
           sativa (japonica cultivar-group) genomic DNA, chromosome
           2, BAC clone:OSJNBb0088N06.
          Length = 172

 Score =  143 bits (361), Expect(2) = 4e-40
 Identities = 67/86 (77%), Positives = 73/86 (84%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPLHYKG  FHR+I  FM QGGDF++GNGTGGESIYG KFADE F
Sbjct: 37  RALCTGEKGVGKS-GKPLHYKGSTFHRVIPEFMCQGGDFTRGNGTGGESIYGEKFADEVF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFI 628
           K  H  PG+LSMAN+GPNTNGSQFFI
Sbjct: 96  KFKHDSPGILSMANAGPNTNGSQFFI 121



 Score = 43.9 bits (102), Expect(2) = 4e-40
 Identities = 21/33 (63%), Positives = 24/33 (72%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           N  VFFD++  G P  RIVMEL+A  VPRTAEN
Sbjct: 3   NTRVFFDMTVGGAPAGRIVMELYAKDVPRTAEN 35



>sp|P52015|CYP7_CAEEL Peptidyl-prolyl cis-trans isomerase 7 (EC
           5.2.1.8) (PPIase) (Rotamase)
           (Cyclophilin-7).>pir|T27371|T27371 peptidylprolyl
           isomerase (EC 5.2.1.8) Y75B12B.2 [similarity] -
           Caenorhabditis elegans>gb:CEY75B12B_1371077
           Caenorhabditis elegans YAC Y75B12B, complete sequence.
          Length = 171

 Score =  141 bits (355), Expect(2) = 4e-40
 Identities = 68/95 (71%), Positives = 77/95 (81%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPLH+KG  FHRII  FM QGGDF++GNGTGGESIYG KF DENF
Sbjct: 37  RALCTGEKGVGKS-GKPLHFKGSKFHRIIPEFMIQGGDFTRGNGTGGESIYGEKFPDENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           K  H+ PG+LSMAN+GPNTNGSQFF+   +   LD
Sbjct: 96  KEKHTGPGVLSMANAGPNTNGSQFFLCTVKTAWLD 130



 Score = 46.2 bits (108), Expect(2) = 4e-40
 Identities = 20/32 (62%), Positives = 25/32 (78%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFD++  G P  RIVMEL+ D+VP+TAEN
Sbjct: 4   PRVFFDITIAGKPTGRIVMELYNDIVPKTAEN 35



>gb:AY429574_1605886 Populus alba x Populus tremula clone INRA
           7171-B4 putative cyclophilin mRNA, partial
           cds.>gb:AY429575_1605887 Populus alba x Populus tremula
           putative cyclophilin mRNA, partial cds.
          Length = 151

 Score =  138 bits (347), Expect(2) = 4e-40
 Identities = 66/95 (69%), Positives = 74/95 (77%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G   GKPLH+KG  FHR+I  FM QGGDF+ GNGTGGESIYG KFADENF
Sbjct: 34  RALCTGEKGVG-RLGKPLHFKGSSFHRVIPNFMCQGGDFTAGNGTGGESIYGAKFADENF 92

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PG+LSMAN+GP TNGSQFFI   +   LD
Sbjct: 93  VRKHTGPGVLSMANAGPGTNGSQFFICTVKTEWLD 127



 Score = 49.3 bits (116), Expect(2) = 4e-40
 Identities = 24/32 (75%), Positives = 26/32 (81%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P  FFD++  G PV RIVMELFADVVPRTAEN
Sbjct: 1   PNPFFDMTVGGQPVGRIVMELFADVVPRTAEN 32



>gb:CEU27559_1368480 Caenorhabditis elegans cyclophilin (cyp-7)
           mRNA, complete cds.
          Length = 171

 Score =  141 bits (355), Expect(2) = 7e-40
 Identities = 68/95 (71%), Positives = 77/95 (81%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPLH+KG  FHRII  FM QGGDF++GNGTGGESIYG KF DENF
Sbjct: 37  RALCTGEKGVGKS-GKPLHFKGSKFHRIIPEFMIQGGDFTRGNGTGGESIYGEKFPDENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           K  H+ PG+LSMAN+GPNTNGSQFF+   +   LD
Sbjct: 96  KEKHTGPGVLSMANAGPNTNGSQFFLCTVKTAWLD 130



 Score = 45.4 bits (106), Expect(2) = 7e-40
 Identities = 20/32 (62%), Positives = 25/32 (78%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFD++  G P  RIVMEL+ D+VP+TAEN
Sbjct: 4   PRVFFDITTAGKPTGRIVMELYNDIVPKTAEN 35



>pir|S50141|S50141 peptidylprolyl isomerase (EC 5.2.1.8) -
           Arabidopsis thaliana>gb:ATCHRIV82_1547448 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           82.>gb:ATF11I11_1548281 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F11I11 (ESSA
           project).>gb:ATU07276_1556712 Arabidopsis thaliana
           peptidyl-prolyl cis-trans isomerase mRNA, complete
           cds.>gb:ATU32186_1556907 Arabidopsis thaliana
           cyclophilin (ATCYP1) gene, complete
           cds.>gb:AY054468_1563123 Arabidopsis thaliana
           peptidylprolyl isomerase (cyclophilin) (At4g34870;
           T11I11.110) mRNA, complete cds.>gb:AY087606_1572636
           Arabidopsis thaliana clone 37 mRNA, complete
           sequence.>gb:BT006560_1639447 Arabidopsis thaliana
           At4g34870 gene, complete cds.
          Length = 172

 Score =  138 bits (347), Expect(2) = 7e-40
 Identities = 67/95 (70%), Positives = 74/95 (77%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G   GKPLH+KG IFHR+I GFM QGGDF+  NGTGGESIYG KF DENF
Sbjct: 37  RALCTGEKGMG-KLGKPLHFKGSIFHRVIPGFMCQGGDFTAKNGTGGESIYGAKFKDENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+  G+LSMANSGPNTNGSQFFI   +   LD
Sbjct: 96  IKKHTGAGILSMANSGPNTNGSQFFICTDKTSWLD 130



 Score = 48.5 bits (114), Expect(2) = 7e-40
 Identities = 22/33 (66%), Positives = 24/33 (72%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD+S  G P+ RI MELFAD  P TAEN
Sbjct: 3   NPRVFFDMSLSGTPIGRIEMELFADTTPNTAEN 35



>sp|O49886|CYPH_LUPLU Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein).>gb:LLCYCLOPH_1685072 Lupinus luteus
           mRNA for cyclophilin.>gb:AF178458_1774712 Lupinus luteus
           cytosolic cyclophilin gene, complete cds.
          Length = 172

 Score =  137 bits (344), Expect(2) = 9e-40
 Identities = 66/95 (69%), Positives = 74/95 (77%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPLHYKG  FHR+I  FM QGGDF+ GNGTG ESIYG KFADENF
Sbjct: 37  RALCTGEKGVGRS-GKPLHYKGSTFHRVIPNFMCQGGDFTAGNGTGAESIYGAKFADENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PG+LSMAN+G  TNGSQFFI  ++   LD
Sbjct: 96  IKRHTGPGILSMANAGAGTNGSQFFICTEKTEWLD 130



 Score = 49.3 bits (116), Expect(2) = 9e-40
 Identities = 22/33 (66%), Positives = 25/33 (75%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++  G P  RIVMEL+AD  PRTAEN
Sbjct: 3   NPKVFFDMAIAGNPAGRIVMELYADTTPRTAEN 35



>gb:AY150052_1584922 Kandelia candel cyclophilin (Cyp1) mRNA,
           complete cds.
          Length = 172

 Score =  134 bits (337), Expect(2) = 9e-40
 Identities = 66/95 (69%), Positives = 72/95 (75%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G S GKPLHYKG  FH +I  FM QGGDF+ GN TGGESIYG KFADENF
Sbjct: 37  RALCTGEKGKGRS-GKPLHYKGSTFHLVIPNFMCQGGDFTAGNETGGESIYGSKFADENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PG+LSMAN+GP TNGSQFFI   +   LD
Sbjct: 96  VKKHTGPGILSMANAGPGTNGSQFFICTAKTEWLD 130



 Score = 52.0 bits (123), Expect(2) = 9e-40
 Identities = 24/33 (72%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP V+FD+S  G P  RIVMELFADVVPRT EN
Sbjct: 3   NPRVYFDMSVGGSPAGRIVMELFADVVPRTTEN 35



>gb:OVU70827_1391510 Onchocerca volvulus cyclophilin (Ovcyp-1) mRNA,
           partial cds.
          Length = 213

 Score =  142 bits (359), Expect(2) = 1e-39
 Identities = 66/93 (70%), Positives = 73/93 (78%)
 Frame = +2

Query: 377 LCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKL 556
           LCTG  GIG  +GKPLHYKG  FHR+IK FM QGGDF+KG+GTGGESIYGG F DE F +
Sbjct: 42  LCTGMAGIGKISGKPLHYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVM 101

Query: 557 DHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            H EP L+SMAN GPNTNGSQFFIT    PHL+
Sbjct: 102 KHDEPFLVSMANKGPNTNGSQFFITTTPAPHLN 134



 Score = 42.7 bits (99), Expect(2) = 1e-39
 Identities = 20/36 (55%), Positives = 23/36 (63%)
 Frame = +1

Query: 259 KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           KK    VFFDV+ DG    RIVMEL+ D+ PRT  N
Sbjct: 3   KKDRRRVFFDVTIDGNLAGRIVMELYNDIAPRTCNN 38



>gb:OVU47812_1391506 Onchocerca volvulus cyclophilin Ovcyp-2 mRNA,
           complete cds.
          Length = 171

 Score =  141 bits (356), Expect(2) = 1e-39
 Identities = 67/95 (70%), Positives = 77/95 (81%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPLHYKG  FHR+I  FM QGGDF++GNGTGGESIYG KF DENF
Sbjct: 37  RALCTGEKGVGKS-GKPLHYKGSKFHRVIPNFMCQGGDFTRGNGTGGESIYGEKFEDENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           K  H+ PG+LSMAN+GP+TNGSQFF+   +   LD
Sbjct: 96  KEKHTGPGVLSMANAGPDTNGSQFFLCTVKTDWLD 130



 Score = 43.9 bits (102), Expect(2) = 1e-39
 Identities = 20/32 (62%), Positives = 24/32 (75%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFD++  G    RIVMELF D+VP+TAEN
Sbjct: 4   PRVFFDITIGGQQSGRIVMELFNDIVPKTAEN 35



>pir|T50770|T50770 peptidylprolyl isomerase (EC 5.2.1.8) vcCyP
           [similarity] - fava bean>gb:AB012947_1511974 Vicia faba
           vcCyP mRNA, complete cds.
          Length = 171

 Score =  140 bits (352), Expect(2) = 1e-39
 Identities = 67/95 (70%), Positives = 75/95 (78%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPLH+KG  FHR+I  FM QGGDF+ GNGTGGESIYG KFADENF
Sbjct: 37  RALCTGEKGVGRS-GKPLHFKGSSFHRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PG+LSMAN+GP TNGSQFFI   +   LD
Sbjct: 96  IKKHTGPGILSMANAGPGTNGSQFFICTAKTDWLD 130



 Score = 45.4 bits (106), Expect(2) = 1e-39
 Identities = 21/33 (63%), Positives = 24/33 (72%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++  G    RI+ ELFADV PRTAEN
Sbjct: 3   NPKVFFDMTVGGQNAGRIIFELFADVTPRTAEN 35



>gb:AF424658_1798993 Phytophthora infestans clone MY-08-C-01
           peptidylprolyl isomerase mRNA, complete cds.
          Length = 171

 Score =  139 bits (349), Expect(2) = 1e-39
 Identities = 67/95 (70%), Positives = 74/95 (77%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPLH+KG  FHR+I  FM QGGDF++GNGTGGESIYG KF DENF
Sbjct: 37  RALCTGEKGVGRS-GKPLHFKGSSFHRVIPNFMCQGGDFTRGNGTGGESIYGEKFPDENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H   G+LSMAN+GPNTNGSQFFI       LD
Sbjct: 96  LLKHKGEGILSMANAGPNTNGSQFFICTVETSWLD 130



 Score = 46.6 bits (109), Expect(2) = 1e-39
 Identities = 21/33 (63%), Positives = 24/33 (72%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++  G P  RI  ELFAD VP+TAEN
Sbjct: 3   NPQVFFDMTVGGAPAGRITFELFADKVPKTAEN 35



>gb:DIU47813_1377748 Dirofilaria immitis cyclophilin Dicyp-2 mRNA,
           complete cds.
          Length = 171

 Score =  136 bits (343), Expect(2) = 1e-39
 Identities = 65/95 (68%), Positives = 75/95 (78%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R LCTGE+G+G S GK LHYKG  FHR+I  FM QGGDF++GNGTGGESIYG KF DENF
Sbjct: 37  RCLCTGERGVGRS-GKKLHYKGSKFHRVIPNFMLQGGDFTRGNGTGGESIYGEKFPDENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +  H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 96  QEKHTGPGVLSMANAGPNTNGSQFFICTAKTEWLD 130



 Score = 48.9 bits (115), Expect(2) = 1e-39
 Identities = 21/32 (65%), Positives = 26/32 (81%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P V+FD++ DG    RIVMELFAD+VP+TAEN
Sbjct: 4   PKVYFDITIDGSNAGRIVMELFADIVPKTAEN 35



>gb:BC071449_2556189 Danio rerio peptidyl-prolyl isomerase G
           (cyclophilin G), mRNA (cDNA clone IMAGE:6900240),
           partial cds.
          Length = 392

 Score =  143 bits (361), Expect(2) = 2e-39
 Identities = 67/95 (70%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R LCTGEKG+G +T KPLHYKG  FHRI+K FM QGGDFS+GNG GGESIYGG F DE+F
Sbjct: 41  RCLCTGEKGVGKTTQKPLHYKGTPFHRIVKDFMIQGGDFSEGNGRGGESIYGGFFEDESF 100

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            + H++  LLSMAN G +TNGSQFFIT K  PHLD
Sbjct: 101 SMKHTKEFLLSMANRGKDTNGSQFFITTKPTPHLD 135



 Score = 41.6 bits (96), Expect(2) = 2e-39
 Identities = 17/37 (45%), Positives = 24/37 (64%)
 Frame = +1

Query: 256 MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +K + P  FFD+     P  R+V+ELF+DV P+T EN
Sbjct: 3   VKAQRPRCFFDIGISNVPAGRVVIELFSDVCPKTCEN 39



>gb:BC072740_2556670 Xenopus laevis hypothetical protein LOC443580,
           mRNA (cDNA clone IMAGE:5047615), partial cds.
          Length = 226

 Score =  147 bits (370), Expect(2) = 2e-39
 Identities = 67/95 (70%), Positives = 77/95 (81%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R+LCTGE+GIG ST KPLHYK C+FHR++K FM QGGDFS+GNG GGESIYGG F DENF
Sbjct: 41  RSLCTGERGIGKSTQKPLHYKNCLFHRVVKDFMIQGGDFSEGNGRGGESIYGGFFEDENF 100

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            + H++  LLSMAN G +TNGSQFFI  K  PHLD
Sbjct: 101 SVQHNKEFLLSMANRGKDTNGSQFFIITKPTPHLD 135



 Score = 38.1 bits (87), Expect(2) = 2e-39
 Identities = 16/37 (43%), Positives = 24/37 (64%)
 Frame = +1

Query: 256 MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +K +    FFD++ +  P  R+V ELF+DV P+T EN
Sbjct: 3   VKVQRTRCFFDIAVNNVPAGRVVFELFSDVCPKTCEN 39



>gb:RICCYP2R_1703598 Oryza sativa cyclophilin 2 (Cyp2) mRNA,
           complete cds.
          Length = 172

 Score =  141 bits (355), Expect(2) = 2e-39
 Identities = 66/86 (76%), Positives = 72/86 (83%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPLHYKG  FHR+I  FM QGGDF++GNGTGGESIYG KFADE F
Sbjct: 37  RALCTGEKGVGKS-GKPLHYKGSTFHRVIPEFMCQGGDFTRGNGTGGESIYGEKFADEVF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFI 628
           K  H  PG+LS AN+GPNTNGSQFFI
Sbjct: 96  KFKHDSPGILSTANAGPNTNGSQFFI 121



 Score = 43.9 bits (102), Expect(2) = 2e-39
 Identities = 21/33 (63%), Positives = 24/33 (72%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           N  VFFD++  G P  RIVMEL+A  VPRTAEN
Sbjct: 3   NTRVFFDMTVGGAPAGRIVMELYAKDVPRTAEN 35



>sp|P34790|CYP1_ARATH Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein).>pir|T06073|T06073 peptidylprolyl
           isomerase (EC 5.2.1.8) ROC1 - Arabidopsis
           thaliana>gb:ATCHRIV89_1547826 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           89.>gb:ATHROC1ARA_1553357 Arabidopsis thaliana cytosolic
           cyclophilin (ROC1) mRNA, complete
           cds.>gb:ATT9A14_1556551 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T9A14 (ESSA
           project).>gb:AY088103_1573127 Arabidopsis thaliana clone
           41363 mRNA, complete sequence.>gb:AY093227_1575181
           Arabidopsis thaliana peptidylprolyl isomerase ROC1
           (At4g38740) mRNA, complete cds.>gb:BT003397_1636820
           Arabidopsis thaliana peptidylprolyl isomerase ROC1
           (At4g38740) mRNA, complete cds.
          Length = 172

 Score =  139 bits (350), Expect(2) = 2e-39
 Identities = 66/95 (69%), Positives = 75/95 (78%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G  TGKPLH+KG  FHR+I  FM QGGDF+ GNGTGGESIYG KF DENF
Sbjct: 37  RALCTGEKGVG-GTGKPLHFKGSKFHRVIPNFMCQGGDFTAGNGTGGESIYGSKFEDENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +  H+ PG+LSMAN+G NTNGSQFFI   +   LD
Sbjct: 96  ERKHTGPGILSMANAGANTNGSQFFICTVKTDWLD 130



 Score = 45.8 bits (107), Expect(2) = 2e-39
 Identities = 20/32 (62%), Positives = 24/32 (75%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P V+FD++ DG P  RIVMEL+ D  PRTAEN
Sbjct: 4   PKVYFDMTIDGQPAGRIVMELYTDKTPRTAEN 35



>sp|P21569|CYPH_MAIZE Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein).>pir|C39252|CSZM peptidylprolyl
           isomerase (EC 5.2.1.8) - maize>gb:MZECYP_1687897 Zea
           mays cyclophilin (CyP) mRNA, complete
           cds.>gb:ZMCYCL_1731815 Z.mays gene for cyclophilin.
          Length = 172

 Score =  138 bits (347), Expect(2) = 2e-39
 Identities = 67/95 (70%), Positives = 73/95 (76%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPLHYKG  FHR+I  FM QGGDF++GNGTGGESIYG KF DE F
Sbjct: 37  RALCTGEKGVGKS-GKPLHYKGSTFHRVIPEFMCQGGDFTRGNGTGGESIYGEKFPDEKF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
                 PG+LSMAN+GPNTNGSQFFI     P LD
Sbjct: 96  VRKQPAPGVLSMANAGPNTNGSQFFICTVATPWLD 130



 Score = 47.0 bits (110), Expect(2) = 2e-39
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++  G P  RIVMEL+A+ VP+TAEN
Sbjct: 3   NPRVFFDMTVGGAPAGRIVMELYANEVPKTAEN 35



>pir|D84533|D84533 hypothetical protein At2g15790 [imported] -
           Arabidopsis thaliana
          Length = 404

 Score =  148 bits (373), Expect(2) = 3e-39
 Identities = 70/95 (73%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R LCTGEKG+G +TG PLHYKG  FHR+IKGFM QGGD S  +GTGGESIYG KF DENF
Sbjct: 37  RLLCTGEKGLGPNTGVPLHYKGNRFHRVIKGFMIQGGDISANDGTGGESIYGLKFDDENF 96

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +L H   G+LSMANSGPNTNGSQFFIT  R  HLD
Sbjct: 97  ELKHERKGMLSMANSGPNTNGSQFFITTTRTSHLD 131



 Score = 36.2 bits (82), Expect(2) = 3e-39
 Identities = 17/29 (58%), Positives = 21/29 (72%)
 Frame = +1

Query: 280 FFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           F D+S  G    RIV+EL+ DVVP+TAEN
Sbjct: 7   FMDISIGGELEGRIVIELYDDVVPKTAEN 35



>gb:AC006438_1534276 Arabidopsis thaliana chromosome 2 clone F19G14
           map mi398, complete sequence.>gb:AY026065_1559016
           Arabidopsis thaliana cyclophilin-40 mRNA, complete cds.
          Length = 361

 Score =  148 bits (373), Expect(2) = 3e-39
 Identities = 70/95 (73%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R LCTGEKG+G +TG PLHYKG  FHR+IKGFM QGGD S  +GTGGESIYG KF DENF
Sbjct: 37  RLLCTGEKGLGPNTGVPLHYKGNRFHRVIKGFMIQGGDISANDGTGGESIYGLKFDDENF 96

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +L H   G+LSMANSGPNTNGSQFFIT  R  HLD
Sbjct: 97  ELKHERKGMLSMANSGPNTNGSQFFITTTRTSHLD 131



 Score = 36.2 bits (82), Expect(2) = 3e-39
 Identities = 17/29 (58%), Positives = 21/29 (72%)
 Frame = +1

Query: 280 FFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           F D+S  G    RIV+EL+ DVVP+TAEN
Sbjct: 7   FMDISIGGELEGRIVIELYDDVVPKTAEN 35



>pir|T50772|T50772 peptidylprolyl isomerase (EC 5.2.1.8) CYP2
           [similarity] - Arabidopsis thaliana>gb:AF020434_1761639
           Arabidopsis thaliana cyclophilin (CYP2) gene, complete
           cds.
          Length = 174

 Score =  140 bits (354), Expect(2) = 4e-39
 Identities = 67/95 (70%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPLH+KG  FHR+I  FM QGGDF+KGNGTGGESIYG KF DENF
Sbjct: 38  RALCTGEKGVGRS-GKPLHFKGSSFHRVIPNFMCQGGDFTKGNGTGGESIYGAKFEDENF 96

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +  H+ PG+LSMAN+G NTNGSQFFI   +   LD
Sbjct: 97  ERKHTGPGILSMANAGANTNGSQFFICTVKTDWLD 131



 Score = 43.1 bits (100), Expect(2) = 4e-39
 Identities = 18/33 (54%), Positives = 24/33 (72%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +P VFFD++  G P  +IVMEL+ D  P+TAEN
Sbjct: 4   HPKVFFDMTIGGAPAGKIVMELYTDKTPKTAEN 36



>pir|E84597|E84597 cyclophilin (CYP2) [imported] - Arabidopsis
           thaliana>gb:AC006264_1533909 Arabidopsis thaliana
           chromosome 2 clone F26H11 map mi148, complete
           sequence.>gb:AY087454_1572485 Arabidopsis thaliana clone
           35643 mRNA, complete sequence.
          Length = 174

 Score =  140 bits (354), Expect(2) = 4e-39
 Identities = 67/95 (70%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPLH+KG  FHR+I  FM QGGDF+KGNGTGGESIYG KF DENF
Sbjct: 38  RALCTGEKGVGRS-GKPLHFKGSSFHRVIPNFMCQGGDFTKGNGTGGESIYGAKFEDENF 96

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +  H+ PG+LSMAN+G NTNGSQFFI   +   LD
Sbjct: 97  ERKHTGPGILSMANAGANTNGSQFFICTVKTDWLD 131



 Score = 43.1 bits (100), Expect(2) = 4e-39
 Identities = 18/33 (54%), Positives = 24/33 (72%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +P VFFD++  G P  +IVMEL+ D  P+TAEN
Sbjct: 4   HPKVFFDMTIGGAPAGKIVMELYTDKTPKTAEN 36



>gb:TCR010066_1399749 Trypanosoma cruzi cyp gene.
          Length = 258

 Score =  134 bits (337), Expect(2) = 5e-39
 Identities = 67/98 (68%), Positives = 74/98 (75%), Gaps = 3/98 (3%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G S GKPLHYKGC+FHR+I GFM QGGD ++GNGTGGESIYG  F DE+F
Sbjct: 57  RALCTGEKGRGKS-GKPLHYKGCVFHRVIPGFMIQGGDITRGNGTGGESIYGMNFRDESF 115

Query: 551 K---LDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
                 H+  G LSMAN+GPNTNGSQFFI     P LD
Sbjct: 116 SGKAGKHTGVGCLSMANAGPNTNGSQFFICTANTPWLD 153



 Score = 49.3 bits (116), Expect(2) = 5e-39
 Identities = 22/34 (64%), Positives = 26/34 (76%)
 Frame = +1

Query: 265 KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +NP VFFD+S D  P  RI MEL+AD VP+TAEN
Sbjct: 22  RNPKVFFDISIDNKPSGRIKMELYADTVPKTAEN 55



>gb:BT001578_1356351 Drosophila melanogaster RE23622 full insert
           cDNA.
          Length = 1002

 Score =  142 bits (359), Expect(2) = 9e-39
 Identities = 68/95 (71%), Positives = 73/95 (76%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G  TGK L YKG IFHR++K FM Q GDFS GNGTGGESIYGG F DE+F
Sbjct: 78  RALCTGEKGFGLITGKKLQYKGVIFHRVVKDFMVQAGDFSAGNGTGGESIYGGTFEDESF 137

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +  H  P LLSMAN G NTNGSQFFIT +  PHLD
Sbjct: 138 EKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLD 172



 Score = 40.0 bits (92), Expect(2) = 9e-39
 Identities = 19/32 (59%), Positives = 22/32 (68%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P  FFD+S  G  + RIV ELF DV P+TAEN
Sbjct: 45  PRCFFDISLGGLGMGRIVFELFNDVAPKTAEN 76



>gb:AE014297_1141825 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003765_1223818 Drosophila melanogaster
           chromosome 3R, section 103 of 118 of the complete
           sequence.
          Length = 970

 Score =  142 bits (359), Expect(2) = 9e-39
 Identities = 68/95 (71%), Positives = 73/95 (76%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G  TGK L YKG IFHR++K FM Q GDFS GNGTGGESIYGG F DE+F
Sbjct: 46  RALCTGEKGFGLITGKKLQYKGVIFHRVVKDFMVQAGDFSAGNGTGGESIYGGTFEDESF 105

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +  H  P LLSMAN G NTNGSQFFIT +  PHLD
Sbjct: 106 EKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLD 140



 Score = 40.0 bits (92), Expect(2) = 9e-39
 Identities = 19/32 (59%), Positives = 22/32 (68%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P  FFD+S  G  + RIV ELF DV P+TAEN
Sbjct: 13  PRCFFDISLGGLGMGRIVFELFNDVAPKTAEN 44



>gb:AY134669_1302795 Drosophila melanogaster peptidylprolyl
           cis-trans isomerase mRNA, complete cds.
          Length = 968

 Score =  142 bits (359), Expect(2) = 9e-39
 Identities = 68/95 (71%), Positives = 73/95 (76%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G  TGK L YKG IFHR++K FM Q GDFS GNGTGGESIYGG F DE+F
Sbjct: 46  RALCTGEKGFGLITGKKLQYKGVIFHRVVKDFMVQAGDFSAGNGTGGESIYGGTFEDESF 105

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +  H  P LLSMAN G NTNGSQFFIT +  PHLD
Sbjct: 106 EKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLD 140



 Score = 40.0 bits (92), Expect(2) = 9e-39
 Identities = 19/32 (59%), Positives = 22/32 (68%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P  FFD+S  G  + RIV ELF DV P+TAEN
Sbjct: 13  PRCFFDISLGGLGMGRIVFELFNDVAPKTAEN 44



>gb:BC044189_2548577 Danio rerio peptidyl-prolyl isomerase G
           (cyclophilin G), mRNA (cDNA clone MGC:55535
           IMAGE:2642143), complete cds.
          Length = 687

 Score =  140 bits (354), Expect(2) = 1e-38
 Identities = 66/95 (69%), Positives = 75/95 (78%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R LCTGEKG+G +T KPLHYKG  FHRI+K FM QGGDFS+GNG GGESIYGG F D +F
Sbjct: 41  RCLCTGEKGVGKTTQKPLHYKGTPFHRIVKDFMIQGGDFSEGNGRGGESIYGGFFEDGSF 100

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            + H++  LLSMAN G +TNGSQFFIT K  PHLD
Sbjct: 101 SMKHTKEFLLSMANRGKDTNGSQFFITTKPTPHLD 135



 Score = 41.6 bits (96), Expect(2) = 1e-38
 Identities = 17/37 (45%), Positives = 24/37 (64%)
 Frame = +1

Query: 256 MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +K + P  FFD+     P  R+V+ELF+DV P+T EN
Sbjct: 3   VKAQRPRCFFDIGISNVPAGRVVIELFSDVCPKTCEN 39



>gb:CR382129_1661993 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 367

 Score =  139 bits (349), Expect(2) = 3e-38
 Identities = 67/95 (70%), Positives = 72/95 (75%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG     G PLH+KG  FHR+IK FM QGGDF+ GNGTGGESIYG KF DE F
Sbjct: 37  RALCTGEKG-NTQAGIPLHFKGSSFHRVIKDFMVQGGDFTAGNGTGGESIYGEKFPDEAF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H +P LLSMAN+GPNTNGSQFFIT    PHLD
Sbjct: 96  PYPHDQPFLLSMANAGPNTNGSQFFITTTETPHLD 130



 Score = 42.4 bits (98), Expect(2) = 3e-38
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFF+V+  G  + +I  ELFAD VP+TAEN
Sbjct: 3   NPRVFFEVAIGGKTIGKIYFELFADKVPKTAEN 35



>gb:BMU47811_1355691 Brugia malayi cyclophilin Bmcyp-2 mRNA,
           complete cds.
          Length = 171

 Score =  130 bits (328), Expect(2) = 4e-38
 Identities = 63/95 (66%), Positives = 74/95 (77%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R LCTGE+G+G S GK LHYKG  FHR+I  FM QGGDF++GNGTGG+SIYG KF DENF
Sbjct: 37  RCLCTGERGMGRS-GKKLHYKGSKFHRVIPNFMLQGGDFTRGNGTGGQSIYGEKFPDENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +  H+  G+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 96  QEKHTGLGVLSMANAGPNTNGSQFFICTAKTEWLD 130



 Score = 50.1 bits (118), Expect(2) = 4e-38
 Identities = 22/32 (68%), Positives = 26/32 (81%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFD++ DG    RIVMELFAD+VP+TAEN
Sbjct: 4   PKVFFDITIDGSNAGRIVMELFADIVPKTAEN 35



>gb:AF053068_1236807 Dictyostelium discoideum cyclophilin B (CypB)
           gene, complete cds.>gb:AF123597_1242910 Dictyostelium
           discoideum cyclophilin B (cypB) mRNA, complete cds.
          Length = 197

 Score =  145 bits (365), Expect(2) = 5e-38
 Identities = 69/87 (79%), Positives = 76/87 (87%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPLHYK   FHRII  FM QGGDF++G+GTGGESIYG KF DENF
Sbjct: 63  RALCTGEKGLGTS-GKPLHYKDSKFHRIIPNFMIQGGDFTRGDGTGGESIYGKKFNDENF 121

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFIT 631
           K+ HS+PGLLSMAN+GPNTNGSQFFIT
Sbjct: 122 KIKHSKPGLLSMANAGPNTNGSQFFIT 148



 Score = 35.4 bits (80), Expect(2) = 5e-38
 Identities = 15/30 (50%), Positives = 18/30 (60%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           VFFD+  D  P  RIV  L+   VP+T EN
Sbjct: 32  VFFDIEIDNKPAGRIVFGLYGKTVPKTVEN 61



>sp|Q27450|CYP1_BRUMA Peptidylprolyl isomerase 1 (EC 5.2.1.8)
           (Peptidylprolyl cis-trans isomerase 1) (PPIase 1)
           (Cyclophilin) (BmCYP-1).>gb:BMCLP_1355446 Brugia malayi
           (clone Bmcyp-1) peptidylprolyl isomerase mRNA, complete
           cds.
          Length = 843

 Score =  139 bits (351), Expect(2) = 6e-38
 Identities = 64/93 (68%), Positives = 72/93 (77%)
 Frame = +2

Query: 377 LCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKL 556
           LCTG  G G  +GKPLHYKG  FHR+IK FM QGGDF+KG+GTGGESIYGG F DE F +
Sbjct: 42  LCTGMAGTGKISGKPLHYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVM 101

Query: 557 DHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            H EP ++SMAN GPNTNGSQFFIT    PHL+
Sbjct: 102 KHDEPFVVSMANKGPNTNGSQFFITTTPAPHLN 134



 Score = 40.4 bits (93), Expect(2) = 6e-38
 Identities = 19/36 (52%), Positives = 22/36 (61%)
 Frame = +1

Query: 259 KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           KK    VF DV+ DG    RIVMEL+ D+ PRT  N
Sbjct: 3   KKDRRRVFLDVTIDGNLAGRIVMELYNDIAPRTCNN 38



>pir|T02489|T02489 peptidylprolyl isomerase (EC 5.2.1.8) F23F1.12 -
           Arabidopsis thaliana>gb:AC004680_1532014 Arabidopsis
           thaliana chromosome 2 clone F23F1 map m283, complete
           sequence.>gb:AY054593_1563247 Arabidopsis thaliana
           cyclophilin (At2g29960; F23F1.12) mRNA, complete
           cds.>gb:BT000068_1634346 Arabidopsis thaliana
           cyclophilin (At2g29960) mRNA, complete cds.
          Length = 201

 Score =  142 bits (359), Expect(2) = 6e-38
 Identities = 71/95 (74%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPLHYKG  FHRII  FM QGGDF+ GNG GGESIYG KFADENF
Sbjct: 65  RALCTGEKGVGKS-GKPLHYKGSKFHRIIPSFMIQGGDFTHGNGMGGESIYGQKFADENF 123

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           KL H+ PG+LSMANSG +TNGSQFFIT      LD
Sbjct: 124 KLKHTGPGVLSMANSGEDTNGSQFFITTVTTSWLD 158



 Score = 37.4 bits (85), Expect(2) = 6e-38
 Identities = 17/37 (45%), Positives = 23/37 (62%)
 Frame = +1

Query: 256 MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +K+    V+FDV  DG    R+V+ LF   VP+TAEN
Sbjct: 27  LKEVTHKVYFDVEIDGKSAGRVVIGLFGKAVPKTAEN 63



>pir|T50837|T50837 peptidylprolyl isomerase (EC 5.2.1.8) CYP5
           [similarity] - Arabidopsis thaliana>gb:AF020433_1761638
           Arabidopsis thaliana cyclophilin (CYP5) gene, complete
           cds.
          Length = 201

 Score =  142 bits (359), Expect(2) = 8e-38
 Identities = 71/95 (74%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPLHYKG  FHRII  FM QGGDF+ GNG GGESIYG KFADENF
Sbjct: 65  RALCTGEKGVGKS-GKPLHYKGSKFHRIIPSFMIQGGDFTHGNGMGGESIYGQKFADENF 123

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           KL H+ PG+LSMANSG +TNGSQFFIT      LD
Sbjct: 124 KLKHTGPGVLSMANSGEDTNGSQFFITTVTTSWLD 158



 Score = 37.0 bits (84), Expect(2) = 8e-38
 Identities = 17/37 (45%), Positives = 23/37 (62%)
 Frame = +1

Query: 256 MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +K+    V+FDV  DG    R+V+ LF   VP+TAEN
Sbjct: 27  LKEITHKVYFDVEIDGKSAGRVVIGLFGKAVPKTAEN 63



>sp|P52009|CYP1_CAEEL Peptidyl-prolyl cis-trans isomerase 1 (EC
           5.2.1.8) (PPIase) (Rotamase)
           (Cyclophilin-1).>pir|T27034|T27034 peptidylprolyl
           isomerase (EC 5.2.1.8) Y49A3A.5 [similarity] -
           Caenorhabditis elegans>gb:CEU30943_1368486
           Caenorhabditis elegans cyclophilin-1 (cyp-1) mRNA,
           complete cds.>gb:CEY49A3A_1370318 Caenorhabditis elegans
           YAC Y49A3A, complete sequence.
          Length = 192

 Score =  134 bits (338), Expect(2) = 8e-38
 Identities = 66/95 (69%), Positives = 73/95 (76%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G+  G  LH+KG  FHRII  FM QGGDF++ NGTGGESIYG KF DENF
Sbjct: 55  RALCTGEKGVGEQ-GVALHFKGSKFHRIIPEFMIQGGDFTRHNGTGGESIYGNKFKDENF 113

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG LSMAN+GPNTNGSQFFI     P LD
Sbjct: 114 DLKHTGPGCLSMANAGPNTNGSQFFICTVDTPWLD 148



 Score = 45.1 bits (105), Expect(2) = 8e-38
 Identities = 21/34 (61%), Positives = 24/34 (70%)
 Frame = +1

Query: 265 KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           + P VFFDVS    P  R+ MELF DVVP+TAEN
Sbjct: 20  QRPKVFFDVSIGEEPAGRVTMELFNDVVPKTAEN 53



>gb:DIU70884_1377758 Dirofilaria immitis cyclophilin 1 mRNA, partial
           cds.
          Length = 188

 Score =  139 bits (350), Expect(2) = 8e-38
 Identities = 65/93 (69%), Positives = 71/93 (76%)
 Frame = +2

Query: 377 LCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKL 556
           LCTG  GIG  +GKPLHYKG  FHR IK FM QGGDF+KG+GTGGESIYGG F DE F +
Sbjct: 42  LCTGMAGIGKLSGKPLHYKGSTFHRCIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVM 101

Query: 557 DHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            H EP L+SMAN GPNTNG QFFIT    PHL+
Sbjct: 102 KHDEPFLVSMANKGPNTNGPQFFITTTPAPHLN 134



 Score = 40.4 bits (93), Expect(2) = 8e-38
 Identities = 19/36 (52%), Positives = 22/36 (61%)
 Frame = +1

Query: 259 KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           KK    VF DV+ DG    RIVMEL+ D+ PRT  N
Sbjct: 3   KKDRRRVFLDVTIDGSLAGRIVMELYNDIAPRTCNN 38



>gb:AY088764_1573777 Arabidopsis thaliana clone 94608 mRNA, complete
           sequence.>gb:AY568519_1615457 Arabidopsis thaliana
           single domain cyclophilin type peptidyl-prolyl cis-trans
           isomerase (CYP21-2) mRNA, complete cds.
          Length = 228

 Score =  140 bits (352), Expect(2) = 1e-37
 Identities = 67/95 (70%), Positives = 78/95 (82%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R+LCTGEKG+G+  GKPL++KG  FHRII GFM QGGDF++G+G GGESIYG KFADENF
Sbjct: 92  RSLCTGEKGVGNM-GKPLYFKGSSFHRIIPGFMIQGGDFTRGDGRGGESIYGDKFADENF 150

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           KL H+ PG LSMANSGP++NGSQFFIT      LD
Sbjct: 151 KLKHTGPGFLSMANSGPDSNGSQFFITTVTTSWLD 185



 Score = 39.3 bits (90), Expect(2) = 1e-37
 Identities = 15/30 (50%), Positives = 23/30 (76%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           V+FD+  +G P  RI++ LF ++VP+TAEN
Sbjct: 61  VYFDIQINGSPAGRILIGLFGNIVPKTAEN 90



>pir|S71219|S71219 peptidylprolyl isomerase (EC 5.2.1.8) ROC3 -
           Arabidopsis thaliana>gb:AC005825_1533061 Arabidopsis
           thaliana chromosome 2 clone T24I21 map mi398, complete
           sequence.>gb:ATU40399_1556975 Arabidopsis thaliana
           cytosolic cyclophilin (ROC3) mRNA, complete
           cds.>gb:AY048215_1561677 Arabidopsis thaliana
           At2g16600/T24I21.1 mRNA, complete
           cds.>gb:AY086330_1571380 Arabidopsis thaliana clone
           23995 mRNA, complete sequence.>gb:AY091694_1574705
           Arabidopsis thaliana At2g16600/T24I21.1 mRNA, complete
           cds.
          Length = 173

 Score =  137 bits (344), Expect(2) = 1e-37
 Identities = 66/95 (69%), Positives = 74/95 (77%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGE+GIG   GKPLHYKG  FHR+I  FM QGGDF+ GNGTGGESIYG KF DENF
Sbjct: 38  RALCTGERGIGKQ-GKPLHYKGSSFHRVIPKFMCQGGDFTAGNGTGGESIYGSKFKDENF 96

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PG+LSMAN+G NTNGSQFFI  ++   LD
Sbjct: 97  IKKHTGPGILSMANAGANTNGSQFFICTEKTSWLD 131



 Score = 42.4 bits (98), Expect(2) = 1e-37
 Identities = 19/33 (57%), Positives = 23/33 (69%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP V+FD++  G    RIVMEL+AD  P TAEN
Sbjct: 4   NPKVYFDMTVGGKSAGRIVMELYADTTPETAEN 36



>sp|P52011|CYP3_CAEEL Peptidyl-prolyl cis-trans isomerase 3 (EC
           5.2.1.8) (PPIase) (Rotamase)
           (Cyclophilin-3).>pir|T27373|T27373 peptidylprolyl
           isomerase (EC 5.2.1.8) Y75B12B.5 [similarity] -
           Caenorhabditis elegans>gb:CEU31077_1368487
           Caenorhabditis elegans cyclophilin isoform 3 (cyp-3)
           mRNA, complete cds.>gb:CEY75B12B_1371079 Caenorhabditis
           elegans YAC Y75B12B, complete sequence.
          Length = 173

 Score =  140 bits (353), Expect(2) = 1e-37
 Identities = 68/95 (71%), Positives = 76/95 (80%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGE GIG S GKPLH+KG  FHRII  FM QGGDF++GNGTGGESIYG KF DENF
Sbjct: 37  RALCTGENGIGKS-GKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESIYGEKFPDENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           K  H+ PG+LSMAN+GPNTNGSQFF+   +   LD
Sbjct: 96  KEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLD 130



 Score = 38.5 bits (88), Expect(2) = 1e-37
 Identities = 18/30 (60%), Positives = 22/30 (73%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           VFFD++  G    RIVMEL+ DVVP+TA N
Sbjct: 6   VFFDITIGGKASGRIVMELYDDVVPKTAGN 35



>pir|B39252|CSRP peptidylprolyl isomerase (EC 5.2.1.8) - rape
          Length = 171

 Score =  136 bits (342), Expect(2) = 2e-37
 Identities = 66/95 (69%), Positives = 74/95 (77%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGE+GIG S GKPLHYKG  FHR+I  FM QGGDF+ GNGTGGESIYG KF DENF
Sbjct: 37  RALCTGERGIGKS-GKPLHYKGSAFHRVIPKFMCQGGDFTAGNGTGGESIYGMKFKDENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PG+LSM N+G NTNGSQFFI  ++   LD
Sbjct: 96  VKKHTGPGILSMRNAGSNTNGSQFFICTEKTSWLD 130



 Score = 42.4 bits (98), Expect(2) = 2e-37
 Identities = 20/33 (60%), Positives = 23/33 (69%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++       RIVMEL+AD VP TAEN
Sbjct: 3   NPKVFFDMTVGDKAAGRIVMELYADTVPETAEN 35



>gb:AY678298_1622003 Lycopersicon esculentum clone 56B23 chromosome
           6, genomic sequence.
          Length = 225

 Score =  138 bits (348), Expect(2) = 2e-37
 Identities = 67/95 (70%), Positives = 75/95 (78%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G + GKPLHYKG  FHRII  FM QGGDF++G+G GGESIYG  F DENF
Sbjct: 89  RALCTGEKGTGKA-GKPLHYKGSSFHRIIPSFMIQGGDFTRGDGRGGESIYGESFPDENF 147

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+EPG+LSMAN+GP+TNGSQFFIT      LD
Sbjct: 148 DLKHTEPGILSMANAGPDTNGSQFFITTVTTSWLD 182



 Score = 39.7 bits (91), Expect(2) = 2e-37
 Identities = 18/30 (60%), Positives = 21/30 (70%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           V+FDV  +G P  RIVM LF   VP+TAEN
Sbjct: 58  VYFDVEINGKPTGRIVMGLFGKTVPKTAEN 87



>gb:AY085875_1570939 Arabidopsis thaliana clone 19211 mRNA, complete
           sequence.
          Length = 201

 Score =  140 bits (354), Expect(2) = 2e-37
 Identities = 70/95 (73%), Positives = 75/95 (78%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPLHYKG  FHRII  FM QGGDF+ GNG GGESIYG KFADENF
Sbjct: 65  RALCTGEKGVGKS-GKPLHYKGSKFHRIIPSFMIQGGDFTHGNGMGGESIYGQKFADENF 123

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           KL H+ PG+LSMANSG + NGSQFFIT      LD
Sbjct: 124 KLKHTGPGVLSMANSGEDXNGSQFFITTVTTSWLD 158



 Score = 37.4 bits (85), Expect(2) = 2e-37
 Identities = 17/37 (45%), Positives = 23/37 (62%)
 Frame = +1

Query: 256 MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +K+    V+FDV  DG    R+V+ LF   VP+TAEN
Sbjct: 27  LKEVTHKVYFDVEIDGKSAGRVVIGLFGKAVPKTAEN 63



>gb:AY389742_1178349 Hyacinthus orientalis cyclophilin mRNA,
           complete cds.
          Length = 173

 Score =  126 bits (317), Expect(2) = 2e-37
 Identities = 63/95 (66%), Positives = 71/95 (74%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEK  G S GKPLHY+G     +I GFM QGGDF+ GNGTGGESIYG KF D+NF
Sbjct: 47  RALCTGEKEPGRS-GKPLHYRGPPSTGVIPGFMCQGGDFTAGNGTGGESIYGSKFEDQNF 105

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +  H+ PG+LSMAN+GPNTNGSQFFI       LD
Sbjct: 106 ERKHTGPGILSMANAGPNTNGSQFFICTDETDWLD 140



 Score = 51.6 bits (122), Expect(2) = 2e-37
 Identities = 24/33 (72%), Positives = 25/33 (75%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD+S  G P  RIVMELFADV P TAEN
Sbjct: 13  NPKVFFDMSIGGAPAGRIVMELFADVTPNTAEN 45



>gb:BOVCYC40B_1435373 Cow cyclophilin-40 mRNA, partial cds.
          Length = 309

 Score =  153 bits (386), Expect(2) = 3e-37
 Identities = 73/95 (76%), Positives = 77/95 (81%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKGIG +TGKPLH+KGC FHRIIK FM QGGDFS  NGTGGESIYG KF DENF
Sbjct: 13  RALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENF 72

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H + GLLSMAN+G NTNGSQFFIT    PHLD
Sbjct: 73  HYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLD 107



 Score = 24.6 bits (52), Expect(2) = 3e-37
 Identities = 9/11 (81%), Positives = 11/11 (100%)
 Frame = +1

Query: 334 FADVVPRTAEN 366
           FAD+VP+TAEN
Sbjct: 1   FADIVPKTAEN 11



>gb:AY290733_1595602 Triticum aestivum cyclophilin mRNA, partial
           sequence.>gb:AF542973_1810235 Triticum aestivum
           cyclophilin mRNA, partial cds.
          Length = 233

 Score =  137 bits (344), Expect(2) = 3e-37
 Identities = 68/95 (71%), Positives = 75/95 (78%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G+S GKPLHYKG  FHRII  FM QGGDF+ G+G GGESIYG KF DENF
Sbjct: 96  RALCTGEKGMGNS-GKPLHYKGSSFHRIIPSFMIQGGDFTLGDGRGGESIYGTKFGDENF 154

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           KL H+ PG LSMAN+G +TNGSQFFIT      LD
Sbjct: 155 KLKHTGPGYLSMANAGRDTNGSQFFITTVTTSWLD 189



 Score = 40.8 bits (94), Expect(2) = 3e-37
 Identities = 17/30 (56%), Positives = 21/30 (70%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           V+FD+  DG P  R+VM LF   VP+TAEN
Sbjct: 65  VYFDIEIDGKPAGRVVMGLFGKAVPKTAEN 94



>gb:AY543004_1334460 Bigelowiella natans cyclophilin mRNA, complete
           cds.
          Length = 201

 Score =  140 bits (353), Expect(2) = 3e-37
 Identities = 70/95 (73%), Positives = 75/95 (78%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G S GKPLHYKG  FHRII  FM QGGDF++GNG GGESIYG KF DENF
Sbjct: 61  RALCTGEKGTGKS-GKPLHYKGSSFHRIIPQFMIQGGDFTQGNGRGGESIYGEKFEDENF 119

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           KL H+ P  LSMAN+GPNTNGSQFFIT  +   LD
Sbjct: 120 KLRHTSPYQLSMANAGPNTNGSQFFITTVKTSWLD 154



 Score = 37.4 bits (85), Expect(2) = 3e-37
 Identities = 19/39 (48%), Positives = 22/39 (56%)
 Frame = +1

Query: 250 KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           K + K    VFFDV   G    RIVM L+   VP+TAEN
Sbjct: 21  KKLPKVTSKVFFDVEIGGEKAGRIVMGLYGKTVPKTAEN 59



>gb:SCU92087_1710610 Solanum commersonii stress responsive
           cyclophilin (SCCYP1) mRNA, complete cds.
          Length = 172

 Score =  128 bits (322), Expect(2) = 3e-37
 Identities = 64/96 (66%), Positives = 71/96 (73%), Gaps = 1/96 (1%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGE-SIYGGKFADEN 547
           RALCTGEKG+G   GKPLHYKG  FHR+I GFM QGGDF+ GNGTG E SIYG KF DEN
Sbjct: 37  RALCTGEKGVG-KMGKPLHYKGSTFHRVIPGFMCQGGDFTAGNGTGEEKSIYGAKFKDEN 95

Query: 548 FKLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           F   H+  G+LSMAN+GP TNGSQF I   +   LD
Sbjct: 96  FVKKHTGAGILSMANAGPGTNGSQFLICSAKTEWLD 131



 Score = 49.3 bits (116), Expect(2) = 3e-37
 Identities = 21/33 (63%), Positives = 25/33 (75%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++  G P  R+VMELFAD  P+TAEN
Sbjct: 3   NPRVFFDLTIGGAPAGRVVMELFADTTPKTAEN 35



>gb:AF242312_1780142 Euphorbia esula cyclophilin mRNA, partial cds.
          Length = 160

 Score =  139 bits (351), Expect(2) = 3e-37
 Identities = 67/95 (70%), Positives = 75/95 (78%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S  KPLH+KG  FHR+I GFM QGGDF+ GNGTGGESIYG KFADENF
Sbjct: 25  RALCTGEKGVGRSR-KPLHFKGSSFHRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENF 83

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PG+LSMAN+GP TNGSQFFI   +   LD
Sbjct: 84  IKKHTGPGILSMANAGPGTNGSQFFICTAKTEWLD 118



 Score = 38.1 bits (87), Expect(2) = 3e-37
 Identities = 17/22 (77%), Positives = 18/22 (81%)
 Frame = +1

Query: 301 GGPVQRIVMELFADVVPRTAEN 366
           G PV RIVMEL+AD  PRTAEN
Sbjct: 2   GAPVGRIVMELYADTTPRTAEN 23



>gb:LMFL2581_1387885 Leishmania major Friedlin chromosome 23 cosmid
           L2581, complete cds.
          Length = 295

 Score =  127 bits (318), Expect(2) = 4e-37
 Identities = 65/98 (66%), Positives = 72/98 (73%), Gaps = 3/98 (3%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G S GKPLHYK  +FHR+I  FM QGGDF++GNGTGGESIYG  F DE+F
Sbjct: 57  RALCTGEKGKGRS-GKPLHYKSSVFHRVIPNFMIQGGDFTRGNGTGGESIYGTTFRDESF 115

Query: 551 KLD---HSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
                 H+  G LSMAN+GPNTNGSQFFI     P LD
Sbjct: 116 SGKAGRHTGLGCLSMANAGPNTNGSQFFICTAATPWLD 153



 Score = 50.4 bits (119), Expect(2) = 4e-37
 Identities = 24/38 (63%), Positives = 27/38 (71%)
 Frame = +1

Query: 253 VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           V K  NP VFFD+S D     RIVMEL+AD VP+TAEN
Sbjct: 18  VEKTTNPKVFFDISIDNKAAGRIVMELYADTVPKTAEN 55



>sp|P24525|CYPH_BRANA Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein).
          Length = 171

 Score =  136 bits (342), Expect(2) = 4e-37
 Identities = 66/95 (69%), Positives = 74/95 (77%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGE+GIG S GKPLHYKG  FHR+I  FM QGGDF+ GNGTGGESIYG KF DENF
Sbjct: 37  RALCTGERGIGKS-GKPLHYKGSAFHRVIPKFMCQGGDFTAGNGTGGESIYGMKFKDENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PG+LSM N+G NTNGSQFFI  ++   LD
Sbjct: 96  VKKHTGPGILSMRNAGSNTNGSQFFICTEKTSWLD 130



 Score = 41.2 bits (95), Expect(2) = 4e-37
 Identities = 19/33 (57%), Positives = 23/33 (69%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP V+FD++       RIVMEL+AD VP TAEN
Sbjct: 3   NPKVYFDMTVGDKAAGRIVMELYADTVPETAEN 35



>sp|P35627|CYP2_ARATH Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein).>pir|S22496|S22496 peptidylprolyl
           isomerase (EC 5.2.1.8) - Arabidopsis
           thaliana>gb:ATCYCP_1548038 A.thaliana mRNA for
           cyclophilin-like protein.
          Length = 169

 Score =  139 bits (351), Expect(2) = 4e-37
 Identities = 68/95 (71%), Positives = 75/95 (78%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKGIG S GK + Y+G +FHR+I  FM QGGDF+ GNG GGESIYG KFADENF
Sbjct: 34  RALCTGEKGIGPS-GKKMTYEGSVFHRVIPKFMLQGGDFTLGNGRGGESIYGAKFADENF 92

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PGLLSMAN+GP TNGSQFFIT    PHLD
Sbjct: 93  IHKHTTPGLLSMANAGPGTNGSQFFITTVATPHLD 127



 Score = 37.7 bits (86), Expect(2) = 4e-37
 Identities = 18/29 (62%), Positives = 22/29 (75%)
 Frame = +1

Query: 280 FFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           FFD++  G P  RI+MELF D VP+TAEN
Sbjct: 5   FFDMTIGGQPAGRIIMELFPD-VPKTAEN 32



>gb:AF279458_2061297 Mus musculus Ran-binding protein 2 gene, complete
            cds.
          Length = 3053

 Score =  123 bits (308), Expect(2) = 8e-37
 Identities = 60/95 (63%), Positives = 68/95 (71%)
 Frame = +2

Query: 371  RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
            RALCTGEKG G        +K  IFHR++  F+ QGGD +K NGTGG+SIYG KF DENF
Sbjct: 2926 RALCTGEKGFG--------FKNSIFHRVVPDFICQGGDITKYNGTGGQSIYGDKFDDENF 2977

Query: 551  KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
             L H+ PGLLSMAN G NTN SQFFIT K+  HLD
Sbjct: 2978 DLKHTGPGLLSMANYGQNTNSSQFFITLKKAEHLD 3012



 Score = 53.1 bits (126), Expect(2) = 8e-37
 Identities = 23/39 (58%), Positives = 32/39 (82%)
 Frame = +1

Query: 250  KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
            ++ K  NP+VFFDV  DG P+ RI+MELF+++VP+TAEN
Sbjct: 2886 ELSKDTNPVVFFDVCADGEPLGRIIMELFSNIVPQTAEN 2924



>gb:BC030915_2096917 Mus musculus RAN binding protein 2, mRNA (cDNA
           clone IMAGE:4507618), complete cds.
          Length = 252

 Score =  123 bits (308), Expect(2) = 8e-37
 Identities = 60/95 (63%), Positives = 68/95 (71%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        +K  IFHR++  F+ QGGD +K NGTGG+SIYG KF DENF
Sbjct: 125 RALCTGEKGFG--------FKNSIFHRVVPDFICQGGDITKYNGTGGQSIYGDKFDDENF 176

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PGLLSMAN G NTN SQFFIT K+  HLD
Sbjct: 177 DLKHTGPGLLSMANYGQNTNSSQFFITLKKAEHLD 211



 Score = 53.1 bits (126), Expect(2) = 8e-37
 Identities = 23/39 (58%), Positives = 32/39 (82%)
 Frame = +1

Query: 250 KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           ++ K  NP+VFFDV  DG P+ RI+MELF+++VP+TAEN
Sbjct: 85  ELSKDTNPVVFFDVCADGEPLGRIIMELFSNIVPQTAEN 123



>gb:AP003621_1831597 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0621D05.>gb:AP003634_1831849 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0655A07.
          Length = 225

 Score =  134 bits (336), Expect(2) = 2e-36
 Identities = 67/95 (70%), Positives = 74/95 (77%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G S GK LH+KG  FHRII  FM QGGDF+ G+G GGESIYG KFADENF
Sbjct: 89  RALCTGEKGTGKS-GKALHFKGSAFHRIIPSFMIQGGDFTLGDGRGGESIYGTKFADENF 147

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           K+ H+ PGLLSMAN+G +TNGSQFFIT      LD
Sbjct: 148 KIKHTGPGLLSMANAGRDTNGSQFFITTVTTSWLD 182



 Score = 41.2 bits (95), Expect(2) = 2e-36
 Identities = 18/30 (60%), Positives = 21/30 (70%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           V+FDV  DG P  R+VM LF   VP+TAEN
Sbjct: 58  VYFDVEIDGKPAGRVVMGLFGKTVPKTAEN 87



>gb:AP003621_1831598 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0621D05.>gb:AP003634_1831850 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0655A07.
          Length = 220

 Score =  134 bits (336), Expect(2) = 2e-36
 Identities = 67/95 (70%), Positives = 74/95 (77%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G S GK LH+KG  FHRII  FM QGGDF+ G+G GGESIYG KFADENF
Sbjct: 84  RALCTGEKGTGKS-GKALHFKGSAFHRIIPSFMIQGGDFTLGDGRGGESIYGTKFADENF 142

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           K+ H+ PGLLSMAN+G +TNGSQFFIT      LD
Sbjct: 143 KIKHTGPGLLSMANAGRDTNGSQFFITTVTTSWLD 177



 Score = 41.2 bits (95), Expect(2) = 2e-36
 Identities = 18/30 (60%), Positives = 21/30 (70%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           V+FDV  DG P  R+VM LF   VP+TAEN
Sbjct: 53  VYFDVEIDGKPAGRVVMGLFGKTVPKTAEN 82



>pir|T50838|T50838 peptidylprolyl isomerase (EC 5.2.1.8) ROC7
           [similarity] - Arabidopsis thaliana>gb:AB020755_1514716
           Arabidopsis thaliana genomic DNA, chromosome 5, P1
           clone:MZN1.>gb:AY048227_1561689 Arabidopsis thaliana
           AT5g58710/mzn1_160 mRNA, complete
           cds.>gb:AY086471_1571519 Arabidopsis thaliana clone
           25325 mRNA, complete sequence.>gb:AY094017_1575523
           Arabidopsis thaliana AT5g58710/mzn1_160 mRNA, complete
           cds.>gb:AF192490_1775518 Arabidopsis thaliana
           cyclophilin (ROC7) mRNA, complete cds.
          Length = 204

 Score =  137 bits (346), Expect(2) = 2e-36
 Identities = 69/95 (72%), Positives = 74/95 (77%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKGIG + GK LHYKG  FHRII  FM QGGDF+ GNG GGESIYG KFADENF
Sbjct: 68  RALCTGEKGIGKN-GKALHYKGSSFHRIIPSFMLQGGDFTHGNGMGGESIYGEKFADENF 126

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           KL H+ PG LSMAN+G +TNGSQFFIT      LD
Sbjct: 127 KLKHTGPGFLSMANAGQDTNGSQFFITTVTTSWLD 161



 Score = 37.4 bits (85), Expect(2) = 2e-36
 Identities = 18/37 (48%), Positives = 22/37 (59%)
 Frame = +1

Query: 256 MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +K+    V+FDV  DG    RIVM LF   VP+T EN
Sbjct: 30  LKEITHKVYFDVEIDGKAAGRIVMGLFGKTVPKTVEN 66



>gb:BNACYP_1633431 Brassica napus cyclophilin (CyP) mRNA, 3' end.
          Length = 168

 Score =  136 bits (342), Expect(2) = 2e-36
 Identities = 66/95 (69%), Positives = 74/95 (77%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGE+GIG S GKPLHYKG  FHR+I  FM QGGDF+ GNGTGGESIYG KF DENF
Sbjct: 34  RALCTGERGIGKS-GKPLHYKGSAFHRVIPKFMCQGGDFTAGNGTGGESIYGMKFKDENF 92

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PG+LSM N+G NTNGSQFFI  ++   LD
Sbjct: 93  VKKHTGPGILSMRNAGSNTNGSQFFICTEKTSWLD 127



 Score = 38.9 bits (89), Expect(2) = 2e-36
 Identities = 18/32 (56%), Positives = 22/32 (68%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P V+FD++       RIVMEL+AD VP TAEN
Sbjct: 1   PKVYFDMTVGDKAAGRIVMELYADTVPETAEN 32



>gb:AP003621_1831596 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0621D05.>gb:AP003634_1831848 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0655A07.
          Length = 208

 Score =  132 bits (333), Expect(2) = 2e-36
 Identities = 66/95 (69%), Positives = 73/95 (76%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RA+CTGEKG+G S GKPL YKG  FHRII GFM QGGD   GNGTG +SIYGG F DENF
Sbjct: 73  RAICTGEKGLGKS-GKPLSYKGTPFHRIIPGFMIQGGDTVSGNGTGCDSIYGGMFPDENF 131

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           K++HS PGLLSMAN   +TNGSQFFIT  +   LD
Sbjct: 132 KINHSAPGLLSMANYAKDTNGSQFFITTVKLTRLD 166



 Score = 42.0 bits (97), Expect(2) = 2e-36
 Identities = 19/37 (51%), Positives = 25/37 (67%)
 Frame = +1

Query: 256 MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           + K    VFFD++ +G P  RIVM LF + VP+TAEN
Sbjct: 35  LTKVTTKVFFDITINGKPAGRIVMGLFGNTVPKTAEN 71



>gb:AY362759_1322644 Chlamys farreri cyclophilin A mRNA, complete
           cds.
          Length = 164

 Score =  126 bits (316), Expect(2) = 2e-36
 Identities = 62/95 (65%), Positives = 70/95 (73%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        YKG  FHR+I  FM QGGDF++ NGTGG+SIYG KFADENF
Sbjct: 37  RALCTGEKGFG--------YKGSPFHRVIPSFMCQGGDFTRQNGTGGKSIYGEKFADENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFF+   R   LD
Sbjct: 89  TLKHTGPGVLSMANAGPNTNGSQFFLCTARTEWLD 123



 Score = 48.5 bits (114), Expect(2) = 2e-36
 Identities = 23/33 (69%), Positives = 27/33 (81%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFDV+ +G PV RI+MEL  DVVP+TAEN
Sbjct: 3   NPRVFFDVTANGKPVGRIMMELRGDVVPKTAEN 35



>gb:AF291180_1783697 Capsicum annuum cyclophilin CACYP1 mRNA,
           complete cds.
          Length = 155

 Score =  128 bits (322), Expect(2) = 2e-36
 Identities = 62/86 (72%), Positives = 70/86 (81%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G   GKPLHYKG  FHR++ GFM QGGDF+ GNGTGGESIYG KFADE+F
Sbjct: 37  RALCTGEKGVG-RMGKPLHYKGSTFHRVMPGFMCQGGDFTAGNGTGGESIYGAKFADESF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFI 628
           +  H+ PG+LSMA   P TNGSQFFI
Sbjct: 96  RGKHTGPGVLSMA-IAPGTNGSQFFI 120



 Score = 46.2 bits (108), Expect(2) = 2e-36
 Identities = 20/33 (60%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++  G P  R+VME+FA+ VP+TAEN
Sbjct: 3   NPKVFFDLTIGGQPAGRVVMEMFANDVPKTAEN 35



>gb:PFMAL3P7_1394593 Plasmodium falciparum MAL3P7, complete
           sequence.>gb:PFU33869_1395067 Plasmodium falciparum
           cyclophilin mRNA, complete cds.
          Length = 171

 Score =  132 bits (331), Expect(2) = 3e-36
 Identities = 67/95 (70%), Positives = 72/95 (75%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEK IG S GK LHYK  IFHRII  FM QGGD + GNG+GGESIYG  F DENF
Sbjct: 38  RALCTGEK-IG-SRGKNLHYKNSIFHRIIPQFMCQGGDITNGNGSGGESIYGRSFTDENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            + H +PGLLSMAN+GPNTN SQFFIT    P LD
Sbjct: 96  NMKHDQPGLLSMANAGPNTNSSQFFITLVPCPWLD 130



 Score = 42.4 bits (98), Expect(2) = 3e-36
 Identities = 18/34 (52%), Positives = 22/34 (64%)
 Frame = +1

Query: 265 KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           K   VFFD+S D     RI+ ELF+D+ PRT EN
Sbjct: 3   KRSKVFFDISIDNSNAGRIIFELFSDITPRTCEN 36



>gb:AF017993_1232987 Entamoeba histolytica cyclophilin (CYP1) mRNA,
           complete cds.>gb:AF498649_1277185 Entamoeba histolytica
           small heat shock protein (HSP16) and cyclophilin (CYP1)
           genes, complete cds; and serine/threonine protein
           kinase-like protein (STPK1) gene, partial cds.
          Length = 167

 Score =  129 bits (325), Expect(2) = 3e-36
 Identities = 64/95 (67%), Positives = 73/95 (76%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R LCTGEKG G      L YKGC FHR+IK FM QGGDF++ NGTGG+SIYG KFADE F
Sbjct: 37  RCLCTGEKGNG------LTYKGCGFHRVIKDFMIQGGDFTRHNGTGGKSIYGTKFADEAF 90

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            + H++PG+LSMAN+GPNTNGSQFFIT    P LD
Sbjct: 91  TVKHTKPGMLSMANAGPNTNGSQFFITTVPCPWLD 125



 Score = 44.7 bits (104), Expect(2) = 3e-36
 Identities = 20/32 (62%), Positives = 24/32 (75%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFD++  G    RIVMELF D+VP+TAEN
Sbjct: 4   PKVFFDITIGGEKAGRIVMELFNDIVPKTAEN 35



>sp|P54985|CYPH_BLAGE Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein).>pir|S63995|S63995 peptidylprolyl
           isomerase (EC 5.2.1.8) - German
           cockroach>gb:BGPEPPROI_1355291 B.germanica mRNA for
           peptidyl-propyl cis-trans-isomerase.
          Length = 164

 Score =  124 bits (310), Expect(2) = 4e-36
 Identities = 61/95 (64%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        YKG  FHR+I  FM QGGDF+  NGTGG+SIYG KF DENF
Sbjct: 37  RALCTGEKGFG--------YKGSRFHRVIPNFMCQGGDFTNHNGTGGKSIYGTKFEDENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +L H+ PG+L MAN+GPNTNGSQFFIT  +   LD
Sbjct: 89  QLKHTGPGILWMANAGPNTNGSQFFITTAKTSWLD 123



 Score = 50.1 bits (118), Expect(2) = 4e-36
 Identities = 24/33 (72%), Positives = 28/33 (84%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +P VFFD+S DG PV RIVMEL +DVVP+TAEN
Sbjct: 3   HPRVFFDMSADGQPVGRIVMELRSDVVPKTAEN 35



>pir|S58884|S58884 Ran-binding protein 2 - human>gb:HUMRANBP2_2036133
            Human mRNA for RanBP2 (Ran-binding protein 2), complete
            cds.
          Length = 3224

 Score =  119 bits (298), Expect(2) = 5e-36
 Identities = 58/95 (61%), Positives = 67/95 (70%)
 Frame = +2

Query: 371  RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
            RALCTGEKG G        +K  IFHR+I  F+ QGGD +K +GTGG+SIYG KF DENF
Sbjct: 3097 RALCTGEKGFG--------FKNSIFHRVIPDFVCQGGDITKHDGTGGQSIYGDKFEDENF 3148

Query: 551  KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
             + H+ PGLLSMAN G NTN SQF IT K+  HLD
Sbjct: 3149 DVKHTGPGLLSMANQGQNTNNSQFVITLKKAEHLD 3183



 Score = 54.3 bits (129), Expect(2) = 5e-36
 Identities = 24/39 (61%), Positives = 32/39 (82%)
 Frame = +1

Query: 250  KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
            ++ K+ NP+VFFDV  DG P+ RI MELF+++VPRTAEN
Sbjct: 3057 ELSKETNPVVFFDVCADGEPLGRITMELFSNIVPRTAEN 3095



>sp|P49792|RBP2_HUMAN Ran-binding protein 2 (RanBP2) (Nuclear pore
            complex protein Nup358) (Nucleoporin Nup358) (358 kDa
            nucleoporin) (P270).>gb:HUMNUP358G_2035219 Homo sapiens
            nucleoporin (NUP358) gene, complete cds.
          Length = 3224

 Score =  119 bits (298), Expect(2) = 5e-36
 Identities = 58/95 (61%), Positives = 67/95 (70%)
 Frame = +2

Query: 371  RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
            RALCTGEKG G        +K  IFHR+I  F+ QGGD +K +GTGG+SIYG KF DENF
Sbjct: 3097 RALCTGEKGFG--------FKNSIFHRVIPDFVCQGGDITKHDGTGGQSIYGDKFEDENF 3148

Query: 551  KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
             + H+ PGLLSMAN G NTN SQF IT K+  HLD
Sbjct: 3149 DVKHTGPGLLSMANQGQNTNNSQFVITLKKAEHLD 3183



 Score = 54.3 bits (129), Expect(2) = 5e-36
 Identities = 24/39 (61%), Positives = 32/39 (82%)
 Frame = +1

Query: 250  KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
            ++ K+ NP+VFFDV  DG P+ RI MELF+++VPRTAEN
Sbjct: 3057 ELSKETNPVVFFDVCADGEPLGRITMELFSNIVPRTAEN 3095



>gb:AY170823_1937714 Homo sapiens transformation-related protein 2
           mRNA, complete cds.
          Length = 439

 Score =  119 bits (298), Expect(2) = 5e-36
 Identities = 58/95 (61%), Positives = 67/95 (70%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        +K  IFHR+I  F+ QGGD +K +GTGG+SIYG KF DENF
Sbjct: 312 RALCTGEKGFG--------FKNSIFHRVIPDFVCQGGDITKHDGTGGQSIYGDKFEDENF 363

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            + H+ PGLLSMAN G NTN SQF IT K+  HLD
Sbjct: 364 DVKHTGPGLLSMANQGQNTNNSQFVITLKKAEHLD 398



 Score = 54.3 bits (129), Expect(2) = 5e-36
 Identities = 24/39 (61%), Positives = 32/39 (82%)
 Frame = +1

Query: 250 KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           ++ K+ NP+VFFDV  DG P+ RI MELF+++VPRTAEN
Sbjct: 272 ELSKETNPVVFFDVCADGEPLGRITMELFSNIVPRTAEN 310



>gb:AY170822_1937713 Homo sapiens transformation-related protein 1
           mRNA, complete cds.
          Length = 439

 Score =  119 bits (298), Expect(2) = 5e-36
 Identities = 58/95 (61%), Positives = 67/95 (70%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        +K  IFHR+I  F+ QGGD +K +GTGG+SIYG KF DENF
Sbjct: 312 RALCTGEKGFG--------FKNSIFHRVIPDFVCQGGDITKHDGTGGQSIYGDKFEDENF 363

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            + H+ PGLLSMAN G NTN SQF IT K+  HLD
Sbjct: 364 DVKHTGPGLLSMANQGQNTNNSQFVITLKKAEHLD 398



 Score = 54.3 bits (129), Expect(2) = 5e-36
 Identities = 24/39 (61%), Positives = 32/39 (82%)
 Frame = +1

Query: 250 KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           ++ K+ NP+VFFDV  DG P+ RI MELF+++VPRTAEN
Sbjct: 272 ELSKETNPVVFFDVCADGEPLGRITMELFSNIVPRTAEN 310



>gb:BC005982_1969983 Homo sapiens peptidylprolyl isomerase A
           (cyclophilin A), transcript variant 1, mRNA (cDNA clone
           MGC:14681 IMAGE:4109260), complete cds.
          Length = 165

 Score =  124 bits (310), Expect(2) = 9e-36
 Identities = 62/95 (65%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG+SIYG KF DENF
Sbjct: 37  RALSTGEKGFG--------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 89  TLKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 123



 Score = 48.9 bits (115), Expect(2) = 9e-36
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++ DG P+ R+  ELFAD VP+TAEN
Sbjct: 3   NPTVFFDIAVDGEPLGRVSFELFADKVPKTAEN 35



>pir|S25443|CSBY peptidylprolyl isomerase (EC 5.2.1.8), cytosolic -
           yeast  (Saccharomyces cerevisiae)>gb:AY557665_1613892
           Saccharomyces cerevisiae clone FLH001736.01X YDR155C
           gene, complete cds.>gb:SC8358_1705631 S.cerevisiae
           chromosome IV cosmid 8358.>gb:SCCYCL_1707465 Yeast mRNA
           for cyclophilin.>gb:YSCCPHA_1728632 S.cerevisiae
           cyclophilin (CPH) gene, complete cds.
          Length = 162

 Score =  130 bits (326), Expect(2) = 9e-36
 Identities = 65/95 (68%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        Y G  FHR+I  FM QGGDF+ GNGTGG+SIYGGKF DENF
Sbjct: 35  RALCTGEKGFG--------YAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENF 86

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           K  H  PGLLSMAN+GPNTNGSQFFIT    P LD
Sbjct: 87  KKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLD 121



 Score = 42.7 bits (99), Expect(2) = 9e-36
 Identities = 17/30 (56%), Positives = 24/30 (80%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           V+FDV  DG P+ R+V +L+ D+VP+TAEN
Sbjct: 4   VYFDVEADGQPIGRVVFKLYNDIVPKTAEN 33



>sp|P14832|CYPH_YEAST Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein) (CPH) (PPI-II).
          Length = 161

 Score =  130 bits (326), Expect(2) = 9e-36
 Identities = 65/95 (68%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        Y G  FHR+I  FM QGGDF+ GNGTGG+SIYGGKF DENF
Sbjct: 34  RALCTGEKGFG--------YAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENF 85

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           K  H  PGLLSMAN+GPNTNGSQFFIT    P LD
Sbjct: 86  KKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLD 120



 Score = 42.7 bits (99), Expect(2) = 9e-36
 Identities = 17/30 (56%), Positives = 24/30 (80%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           V+FDV  DG P+ R+V +L+ D+VP+TAEN
Sbjct: 3   VYFDVEADGQPIGRVVFKLYNDIVPKTAEN 32



>gb:PME132763_1700771 Pseudotsuga menziesii mRNA for cyclophilin.
          Length = 189

 Score =  117 bits (292), Expect(2) = 1e-35
 Identities = 59/95 (62%), Positives = 66/95 (69%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R  CTGE       G P+ YKGC FHR+IK FM Q GDF KG+G+G  SIYG KF DENF
Sbjct: 55  RQFCTGEYR---KAGIPIGYKGCHFHRVIKDFMIQAGDFVKGDGSGCISIYGSKFEDENF 111

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PGLLSMANSGPNTNGSQFF+T  +   LD
Sbjct: 112 IAKHTGPGLLSMANSGPNTNGSQFFLTCAKCDWLD 146



 Score = 55.5 bits (132), Expect(2) = 1e-35
 Identities = 28/46 (60%), Positives = 33/46 (71%), Gaps = 2/46 (4%)
 Frame = +1

Query: 235 GLFEW--KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           G+ EW  K+   KNP+VFFDV+    P  RI MELFAD+VPRTAEN
Sbjct: 8   GVVEWHQKLPNPKNPVVFFDVTIGTIPAGRIKMELFADIVPRTAEN 53



>gb:AF139893_1414924 Oryctolagus cuniculus cyclophilin 18 mRNA,
           complete cds.
          Length = 164

 Score =  123 bits (309), Expect(2) = 1e-35
 Identities = 62/95 (65%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG+SIYG KF DENF
Sbjct: 37  RALSTGEKGFG--------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 89  LLKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 123



 Score = 48.9 bits (115), Expect(2) = 1e-35
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++ DG P+ R+  ELFAD VP+TAEN
Sbjct: 3   NPTVFFDIAVDGEPLGRVSFELFADKVPKTAEN 35



>gb:CR456707_1992914 Homo sapiens full open reading frame cDNA clone
           RZPDo834F113D for gene PPIA, peptidylprolyl isomerase A
           (cyclophilin A); complete cds, incl. stopcodon.
          Length = 165

 Score =  123 bits (308), Expect(2) = 2e-35
 Identities = 62/95 (65%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG+SIYG KF DENF
Sbjct: 37  RALSTGEKGFG--------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 89  ILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 123



 Score = 48.9 bits (115), Expect(2) = 2e-35
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++ DG P+ R+  ELFAD VP+TAEN
Sbjct: 3   NPTVFFDIAVDGEPLGRVSFELFADKVPKTAEN 35



>pir|A94496|CSHUA peptidylprolyl isomerase (EC 5.2.1.8) A -
           human>gb:AX134743_1461837 Sequence 26 from Patent
           WO0132876.>gb:AF023859_1877161 Papio hamadryas
           cyclophilin A mRNA, complete cds.>gb:AF023860_1877162
           Cercopithecus aethiops cyclophilin A mRNA, complete
           cds.>gb:AF023861_1877163 Macaca mulatta cyclophilin A
           mRNA, complete cds.>gb:AY739283_1961585 Homo sapiens
           peptidylprolyl isomerase A (cyclophilin A) (PPIA) gene,
           complete cds.>gb:BC000689_1966945 Homo sapiens
           peptidylprolyl isomerase A (cyclophilin A), transcript
           variant 1, mRNA (cDNA clone MGC:2351 IMAGE:3349335),
           complete cds.>gb:BC003026_1968622 Homo sapiens
           peptidylprolyl isomerase A (cyclophilin A), transcript
           variant 1, mRNA (cDNA clone MGC:4203 IMAGE:2823490),
           complete cds.>gb:BC005320_1969769 Homo sapiens
           peptidylprolyl isomerase A (cyclophilin A), transcript
           variant 1, mRNA (cDNA clone MGC:12404 IMAGE:3935025),
           complete cds.>gb:BC013915_1974257 Homo sapiens
           peptidylprolyl isomerase A (cyclophilin A), transcript
           variant 1, mRNA (cDNA clone MGC:22814 IMAGE:3684721),
           complete cds.>gb:BC073992_1989209 Homo sapiens
           peptidylprolyl isomerase A (cyclophilin A), transcript
           variant 1, mRNA (cDNA clone MGC:87929 IMAGE:6161389),
           complete cds.>gb:HSCPH70_2011629 Human cyclophilin gene
           for cyclophilin (EC 5.2.1.8).>gb:HSCYCR_2011754 Human
           mRNA for T-cell cyclophilin.
          Length = 165

 Score =  123 bits (308), Expect(2) = 2e-35
 Identities = 62/95 (65%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG+SIYG KF DENF
Sbjct: 37  RALSTGEKGFG--------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 89  ILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 123



 Score = 48.9 bits (115), Expect(2) = 2e-35
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++ DG P+ R+  ELFAD VP+TAEN
Sbjct: 3   NPTVFFDIAVDGEPLGRVSFELFADKVPKTAEN 35



>sp|P05092|PPIA_HUMAN Peptidyl-prolyl cis-trans isomerase A (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A)
           (Cyclosporin A-binding protein).
          Length = 164

 Score =  123 bits (308), Expect(2) = 2e-35
 Identities = 62/95 (65%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG+SIYG KF DENF
Sbjct: 36  RALSTGEKGFG--------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENF 87

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 88  ILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 122



 Score = 48.9 bits (115), Expect(2) = 2e-35
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++ DG P+ R+  ELFAD VP+TAEN
Sbjct: 2   NPTVFFDIAVDGEPLGRVSFELFADKVPKTAEN 34



>pir|S07597|CSHYAC peptidylprolyl isomerase (EC 5.2.1.8) A - Chinese
           hamster>gb:CLCYC_2111778 Chinese hamster mRNA for
           cyclophilin.
          Length = 164

 Score =  122 bits (306), Expect(2) = 2e-35
 Identities = 62/95 (65%), Positives = 68/95 (71%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG SIYG KF DENF
Sbjct: 37  RALSTGEKGFG--------YKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 89  ILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 123



 Score = 49.7 bits (117), Expect(2) = 2e-35
 Identities = 22/33 (66%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD+S DG P+ R+  ELFAD VP+TAEN
Sbjct: 3   NPTVFFDISADGEPLGRVSFELFADKVPKTAEN 35



>sp|P14851|PPIA_CRILO Peptidyl-prolyl cis-trans isomerase A (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A)
           (Cyclosporin A-binding protein).
          Length = 163

 Score =  122 bits (306), Expect(2) = 2e-35
 Identities = 62/95 (65%), Positives = 68/95 (71%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG SIYG KF DENF
Sbjct: 36  RALSTGEKGFG--------YKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENF 87

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 88  ILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 122



 Score = 49.7 bits (117), Expect(2) = 2e-35
 Identities = 22/33 (66%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD+S DG P+ R+  ELFAD VP+TAEN
Sbjct: 2   NPTVFFDISADGEPLGRVSFELFADKVPKTAEN 34



>gb:AY684994_1958784 Aotus trivirgatus TRIM5/cyclophilin A V4 fusion
           protein mRNA, complete cds.
          Length = 474

 Score =  122 bits (307), Expect(2) = 2e-35
 Identities = 62/95 (65%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG+SIYG KF DENF
Sbjct: 347 RALSTGEKGFG--------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFDDENF 398

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 399 ILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 433



 Score = 48.9 bits (115), Expect(2) = 2e-35
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++ DG P+ R+  ELFAD VP+TAEN
Sbjct: 313 NPTVFFDIAVDGEPLGRVSFELFADKVPKTAEN 345



>gb:AY646198_1958001 Aotus trivirgatus TRIM5/cyclophilin A fusion
           protein mRNA, complete cds.
          Length = 474

 Score =  122 bits (307), Expect(2) = 2e-35
 Identities = 62/95 (65%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG+SIYG KF DENF
Sbjct: 347 RALSTGEKGFG--------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFDDENF 398

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 399 ILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 433



 Score = 48.9 bits (115), Expect(2) = 2e-35
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++ DG P+ R+  ELFAD VP+TAEN
Sbjct: 313 NPTVFFDIAVDGEPLGRVSFELFADKVPKTAEN 345



>gb:AY684992_1958782 Aotus trivirgatus TRIM5/cyclophilin A V2 fusion
           protein mRNA, complete cds.
          Length = 473

 Score =  122 bits (307), Expect(2) = 2e-35
 Identities = 62/95 (65%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG+SIYG KF DENF
Sbjct: 347 RALSTGEKGFG--------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFDDENF 398

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 399 ILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 433



 Score = 48.9 bits (115), Expect(2) = 2e-35
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++ DG P+ R+  ELFAD VP+TAEN
Sbjct: 313 NPTVFFDIAVDGEPLGRVSFELFADKVPKTAEN 345



>gb:BX294148_769820 Pirellula sp. strain 1 complete genome; segment
           16/24.
          Length = 207

 Score =  135 bits (341), Expect(2) = 2e-35
 Identities = 68/95 (71%), Positives = 73/95 (76%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G   G PL ++G  FHR+I GFM QGGDF+ GNGTGGESIYG KFADENF
Sbjct: 71  RALSTGEKGEG-KLGVPLDFEGSAFHRVIPGFMLQGGDFTAGNGTGGESIYGMKFADENF 129

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           K  H+ PGLLSMANSG NTNGSQFFIT    P LD
Sbjct: 130 KFQHTTPGLLSMANSGRNTNGSQFFITVAPTPWLD 164



 Score = 35.8 bits (81), Expect(2) = 2e-35
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           V+FDVS    P  RIV+ LF   VP+TAEN
Sbjct: 40  VYFDVSIGSEPAGRIVLGLFGKDVPKTAEN 69



>gb:AY646199_1958002 Aotus trivirgatus TRIM5/cyclophilin A fusion
           protein gene, partial cds.
          Length = 200

 Score =  122 bits (307), Expect(2) = 2e-35
 Identities = 62/95 (65%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG+SIYG KF DENF
Sbjct: 73  RALSTGEKGFG--------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFDDENF 124

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 125 ILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 159



 Score = 48.9 bits (115), Expect(2) = 2e-35
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++ DG P+ R+  ELFAD VP+TAEN
Sbjct: 39  NPTVFFDIAVDGEPLGRVSFELFADKVPKTAEN 71



>gb:AY266299_1428139 Sus scrofa peptidyl-prolyl cis-trans isomerase
           A mRNA, complete cds.
          Length = 164

 Score =  122 bits (307), Expect(2) = 2e-35
 Identities = 62/95 (65%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG+SIYG KF DENF
Sbjct: 37  RALSTGEKGFG--------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFDDENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 89  ILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 123



 Score = 48.9 bits (115), Expect(2) = 2e-35
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++ DG P+ R+  ELFAD VP+TAEN
Sbjct: 3   NPTVFFDIAVDGEPLGRVSFELFADKVPKTAEN 35



>gb:AY029366_1424135 Felis catus cyclophilin A (cypA) mRNA, complete
           cds.
          Length = 164

 Score =  122 bits (307), Expect(2) = 2e-35
 Identities = 62/95 (65%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG+SIYG KF DENF
Sbjct: 37  RALSTGEKGFG--------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFDDENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 89  ILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 123



 Score = 48.9 bits (115), Expect(2) = 2e-35
 Identities = 20/33 (60%), Positives = 27/33 (81%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP+VFFD++ DG P+ R+  +LFAD VP+TAEN
Sbjct: 3   NPIVFFDIAVDGEPLGRVSFDLFADKVPKTAEN 35



>pir|A29819|CSRTA peptidylprolyl isomerase (EC 5.2.1.8) A -
           rat>gb:BC059141_2103658 Rattus norvegicus peptidylprolyl
           isomerase A, mRNA (cDNA clone MGC:72881 IMAGE:6919594),
           complete cds.>gb:RATCYCA_2131946 Rat cyclophilin mRNA,
           complete cds.>gb:RATP31_2133275 Rat housekeeping protein
           P31 mRNA, complete cds.
          Length = 164

 Score =  122 bits (307), Expect(2) = 2e-35
 Identities = 62/95 (65%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG+SIYG KF DENF
Sbjct: 37  RALSTGEKGFG--------YKGSSFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 89  ILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 123



 Score = 48.9 bits (115), Expect(2) = 2e-35
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++ DG P+ R+  ELFAD VP+TAEN
Sbjct: 3   NPTVFFDITADGEPLGRVCFELFADKVPKTAEN 35



>sp|P10111|PPIA_RAT Peptidyl-prolyl cis-trans isomerase A (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A)
           (Cyclosporin A-binding protein) (P31).
          Length = 163

 Score =  122 bits (307), Expect(2) = 2e-35
 Identities = 62/95 (65%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG+SIYG KF DENF
Sbjct: 36  RALSTGEKGFG--------YKGSSFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENF 87

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 88  ILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 122



 Score = 48.9 bits (115), Expect(2) = 2e-35
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++ DG P+ R+  ELFAD VP+TAEN
Sbjct: 2   NPTVFFDITADGEPLGRVCFELFADKVPKTAEN 34



>sp|P04374|PPIA_BOVIN Peptidyl-prolyl cis-trans isomerase A (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A)
           (Cyclosporin A-binding protein).>pir|A01852|CSBOAB
           peptidylprolyl isomerase (EC 5.2.1.8) A -
           bovine>pir|S02172|CSPGA peptidylprolyl isomerase (EC
           5.2.1.8) A - pig
          Length = 163

 Score =  122 bits (307), Expect(2) = 2e-35
 Identities = 62/95 (65%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG+SIYG KF DENF
Sbjct: 36  RALSTGEKGFG--------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFDDENF 87

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 88  ILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 122



 Score = 48.9 bits (115), Expect(2) = 2e-35
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++ DG P+ R+  ELFAD VP+TAEN
Sbjct: 2   NPTVFFDIAVDGEPLGRVSFELFADKVPKTAEN 34



>gb:AY247029_1427948 Bos taurus peptidylprolyl isomerase A mRNA,
           complete cds.
          Length = 159

 Score =  122 bits (307), Expect(2) = 2e-35
 Identities = 62/95 (65%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG+SIYG KF DENF
Sbjct: 37  RALSTGEKGFG--------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFDDENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 89  ILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 123



 Score = 48.9 bits (115), Expect(2) = 2e-35
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++ DG P+ R+  ELFAD VP+TAEN
Sbjct: 3   NPTVFFDIAVDGEPLGRVSFELFADKVPKTAEN 35



>gb:AB099010_1410333 Bos taurus mRNA for similar to peptidylprolyl
           isomerase A (cyclophilin A), partial cds, clone:
           ORCS12086.
          Length = 155

 Score =  122 bits (307), Expect(2) = 2e-35
 Identities = 62/95 (65%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG+SIYG KF DENF
Sbjct: 37  RALSTGEKGFG--------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFDDENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 89  ILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 123



 Score = 48.9 bits (115), Expect(2) = 2e-35
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++ DG P+ R+  ELFAD VP+TAEN
Sbjct: 3   NPTVFFDIAVDGEPLGRVSFELFADKVPKTAEN 35



>pir|B47328|B47328 natural killer cell tumor-recognition protein -
           mouse
          Length = 1507

 Score =  137 bits (345), Expect(2) = 3e-35
 Identities = 65/93 (69%), Positives = 72/93 (77%)
 Frame = +2

Query: 377 LCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKL 556
           LC+GEKG+G +TGK L YKG  FHR++K FM QGGDFS+GNG GGESIYGG F DENF L
Sbjct: 96  LCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFIL 155

Query: 557 DHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            H    LLSMAN G +TNGSQFFIT K  PHLD
Sbjct: 156 KHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 188



 Score = 33.9 bits (76), Expect(2) = 3e-35
 Identities = 13/32 (40%), Positives = 21/32 (65%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P   FD+  +  PV RI+ +LF+D+ P+T +N
Sbjct: 61  PQCHFDIEINREPVGRIMFQLFSDICPKTCKN 92



>gb:MUSCYCLORA_2125622 Mus musculus cyclophilin-related protein
           mRNA, complete cds.
          Length = 1482

 Score =  137 bits (345), Expect(2) = 3e-35
 Identities = 65/93 (69%), Positives = 72/93 (77%)
 Frame = +2

Query: 377 LCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKL 556
           LC+GEKG+G +TGK L YKG  FHR++K FM QGGDFS+GNG GGESIYGG F DENF L
Sbjct: 71  LCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFIL 130

Query: 557 DHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            H    LLSMAN G +TNGSQFFIT K  PHLD
Sbjct: 131 KHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 163



 Score = 33.9 bits (76), Expect(2) = 3e-35
 Identities = 13/32 (40%), Positives = 21/32 (65%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P   FD+  +  PV RI+ +LF+D+ P+T +N
Sbjct: 36  PQCHFDIEINREPVGRIMFQLFSDICPKTCKN 67



>sp|P30414|NKCR_HUMAN NK-tumor recognition protein (Natural-killer
           cells cyclophilin-related protein) (NK-TR
           protein).>gb:AF184110_1888539 Homo sapiens
           cyclophilin-related protein (NKTR) gene, complete
           cds.>gb:HUMCYCLORA_2030407 Homo sapiens
           cyclophilin-related protein mRNA, complete cds.
          Length = 1462

 Score =  137 bits (345), Expect(2) = 3e-35
 Identities = 65/93 (69%), Positives = 72/93 (77%)
 Frame = +2

Query: 377 LCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKL 556
           LC+GEKG+G +TGK L YKG  FHR++K FM QGGDFS+GNG GGESIYGG F DENF L
Sbjct: 42  LCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFIL 101

Query: 557 DHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            H    LLSMAN G +TNGSQFFIT K  PHLD
Sbjct: 102 KHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 134



 Score = 33.9 bits (76), Expect(2) = 3e-35
 Identities = 13/32 (40%), Positives = 21/32 (65%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P   FD+  +  PV RI+ +LF+D+ P+T +N
Sbjct: 7   PQCHFDIEINREPVGRIMFQLFSDICPKTCKN 38



>sp|P30415|NKCR_MOUSE NK-tumor recognition protein (Natural-killer
           cells cyclophilin-related protein) (NK-TR protein).
          Length = 1453

 Score =  137 bits (345), Expect(2) = 3e-35
 Identities = 65/93 (69%), Positives = 72/93 (77%)
 Frame = +2

Query: 377 LCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKL 556
           LC+GEKG+G +TGK L YKG  FHR++K FM QGGDFS+GNG GGESIYGG F DENF L
Sbjct: 42  LCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFIL 101

Query: 557 DHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            H    LLSMAN G +TNGSQFFIT K  PHLD
Sbjct: 102 KHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 134



 Score = 33.9 bits (76), Expect(2) = 3e-35
 Identities = 13/32 (40%), Positives = 21/32 (65%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P   FD+  +  PV RI+ +LF+D+ P+T +N
Sbjct: 7   PQCHFDIEINREPVGRIMFQLFSDICPKTCKN 38



>pir|A47328|A47328 natural killer cell tumor-recognition protein -
           human
          Length = 1403

 Score =  137 bits (345), Expect(2) = 3e-35
 Identities = 65/93 (69%), Positives = 72/93 (77%)
 Frame = +2

Query: 377 LCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKL 556
           LC+GEKG+G +TGK L YKG  FHR++K FM QGGDFS+GNG GGESIYGG F DENF L
Sbjct: 96  LCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFIL 155

Query: 557 DHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            H    LLSMAN G +TNGSQFFIT K  PHLD
Sbjct: 156 KHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 188



 Score = 33.9 bits (76), Expect(2) = 3e-35
 Identities = 13/32 (40%), Positives = 21/32 (65%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P   FD+  +  PV RI+ +LF+D+ P+T +N
Sbjct: 61  PQCHFDIEINREPVGRIMFQLFSDICPKTCKN 92



>gb:AK035582_1164158 Mus musculus adult male urinary bladder cDNA,
           RIKEN full-length enriched library, clone:9530071C22
           product:natural killer tumor recognition sequence, full
           insert sequence.
          Length = 966

 Score =  137 bits (345), Expect(2) = 3e-35
 Identities = 65/93 (69%), Positives = 72/93 (77%)
 Frame = +2

Query: 377 LCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKL 556
           LC+GEKG+G +TGK L YKG  FHR++K FM QGGDFS+GNG GGESIYGG F DENF L
Sbjct: 42  LCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFIL 101

Query: 557 DHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            H    LLSMAN G +TNGSQFFIT K  PHLD
Sbjct: 102 KHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 134



 Score = 33.9 bits (76), Expect(2) = 3e-35
 Identities = 13/32 (40%), Positives = 21/32 (65%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P   FD+  +  PV RI+ +LF+D+ P+T +N
Sbjct: 7   PQCHFDIEINREPVGRIMFQLFSDICPKTCKN 38



>gb:MMNKTR2_2116730 Mus musculus natural killer tumor recognition
           protein (Nktr) gene, exons 6, 7 and 8, and partial cds.
          Length = 258

 Score =  137 bits (345), Expect(2) = 3e-35
 Identities = 65/93 (69%), Positives = 72/93 (77%)
 Frame = +2

Query: 377 LCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKL 556
           LC+GEKG+G +TGK L YKG  FHR++K FM QGGDFS+GNG GGESIYGG F DENF L
Sbjct: 42  LCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFIL 101

Query: 557 DHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            H    LLSMAN G +TNGSQFFIT K  PHLD
Sbjct: 102 KHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 134



 Score = 33.9 bits (76), Expect(2) = 3e-35
 Identities = 13/32 (40%), Positives = 21/32 (65%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P   FD+  +  PV RI+ +LF+D+ P+T +N
Sbjct: 7   PQCHFDIEINREPVGRIMFQLFSDICPKTCKN 38



>gb:AY594335_1431715 Bos taurus cyclophilin F mRNA, complete cds.
          Length = 209

 Score =  122 bits (306), Expect(2) = 3e-35
 Identities = 60/95 (63%), Positives = 67/95 (70%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        YKG  FHR+I  FM Q GDF+  NGTGG+SIYG +F DENF
Sbjct: 80  RALCTGEKGFG--------YKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENF 131

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           KL H  PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 132 KLKHEGPGVLSMANAGPNTNGSQFFICTIKTDWLD 166



 Score = 48.9 bits (115), Expect(2) = 3e-35
 Identities = 22/33 (66%), Positives = 27/33 (81%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NPLV+ DV  DG P+ R+V+EL ADVVP+TAEN
Sbjct: 46  NPLVYLDVGADGQPLGRVVLELKADVVPKTAEN 78



>gb:AF542516_1810034 Beauveria bassiana cyclophilin A mRNA, complete
           cds.
          Length = 164

 Score =  124 bits (312), Expect(2) = 3e-35
 Identities = 59/86 (68%), Positives = 68/86 (79%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        +KG  FHR+I GFM QGGDF+  NGTGG+SIYG KFADENF
Sbjct: 37  RALCTGEKGYG--------FKGSSFHRVIPGFMCQGGDFTNHNGTGGKSIYGEKFADENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFI 628
           +L H+ PG+LSMAN+GPNTNGSQFF+
Sbjct: 89  QLKHTGPGILSMANAGPNTNGSQFFL 114



 Score = 46.6 bits (109), Expect(2) = 3e-35
 Identities = 22/33 (66%), Positives = 27/33 (81%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFF+VS +G P+ +IVMEL  DVVP+TAEN
Sbjct: 3   NPKVFFEVSANGEPLGKIVMELRKDVVPKTAEN 35



>gb:AY646200_1958003 Aotus trivirgatus cyclophilin A mRNA, complete
           cds.
          Length = 164

 Score =  122 bits (306), Expect(2) = 3e-35
 Identities = 62/95 (65%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG+SIYG KF DENF
Sbjct: 37  RALSTGEKGFG--------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFDDENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 89  ILKHTGPGILSMANAGPNTNGSQFFICTVKTEWLD 123



 Score = 48.9 bits (115), Expect(2) = 3e-35
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++ DG P+ R+  ELFAD VP+TAEN
Sbjct: 3   NPTVFFDIAVDGEPLGRVSFELFADKVPKTAEN 35



>gb:AF222790_1252586 Theileria parva cyclophilin 1 mRNA, complete
           cds.
          Length = 227

 Score =  126 bits (317), Expect(2) = 3e-35
 Identities = 60/87 (68%), Positives = 66/87 (75%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEK    + G PLHYKG  FHR+I  F  QGGDF+  NGTGG+SIYG KF DENF
Sbjct: 95  RALCTGEKS---TPGNPLHYKGSTFHRVIPHFTCQGGDFTNHNGTGGKSIYGAKFEDENF 151

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFIT 631
            L H  P LLSMAN+GPNTNGSQFF+T
Sbjct: 152 TLKHDRPFLLSMANAGPNTNGSQFFVT 178



 Score = 44.3 bits (103), Expect(2) = 3e-35
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +1

Query: 265 KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           K P V+FD++  G    R+V ELF+DVVP+TAEN
Sbjct: 60  KRPRVYFDLTVGGAKAGRVVFELFSDVVPKTAEN 93



>gb:AF222791_1252587 Theileria parva cyclophilin 1 gene, partial
           cds.
          Length = 188

 Score =  126 bits (317), Expect(2) = 3e-35
 Identities = 60/87 (68%), Positives = 66/87 (75%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEK    + G PLHYKG  FHR+I  F  QGGDF+  NGTGG+SIYG KF DENF
Sbjct: 63  RALCTGEKS---TPGNPLHYKGSTFHRVIPHFTCQGGDFTNHNGTGGKSIYGAKFEDENF 119

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFIT 631
            L H  P LLSMAN+GPNTNGSQFF+T
Sbjct: 120 TLKHDRPFLLSMANAGPNTNGSQFFVT 146



 Score = 44.3 bits (103), Expect(2) = 3e-35
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +1

Query: 265 KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           K P V+FD++  G    R+V ELF+DVVP+TAEN
Sbjct: 28  KRPRVYFDLTVGGAKAGRVVFELFSDVVPKTAEN 61



>gb:AJ719394_2501581 Gallus gallus mRNA for hypothetical protein,
           clone 1o7.
          Length = 204

 Score =  122 bits (307), Expect(2) = 6e-35
 Identities = 60/95 (63%), Positives = 67/95 (70%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        YKG  FHR+I  FM QGGDF+  NGTGG+SIYG +F DENF
Sbjct: 76  RALCTGEKGFG--------YKGSTFHRVIPSFMCQGGDFTNHNGTGGKSIYGSRFPDENF 127

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H  PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 128 LLKHEGPGVLSMANAGPNTNGSQFFICTAKTDWLD 162



 Score = 47.4 bits (111), Expect(2) = 6e-35
 Identities = 21/34 (61%), Positives = 27/34 (79%)
 Frame = +1

Query: 265 KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +NPLV+ DV  D  P+ R+V+EL ADVVP+TAEN
Sbjct: 41  RNPLVYLDVGADNQPLGRVVLELKADVVPKTAEN 74



>pir|F84808|F84808 probable peptidyl-prolyl cis-trans isomerase
           [imported] - Arabidopsis thaliana>gb:AC005499_1532763
           Arabidopsis thaliana chromosome 2 clone T6A23 map ve018,
           complete sequence.>gb:AY568522_1615460 Arabidopsis
           thaliana single domain cyclophilin type peptidyl-prolyl
           cis-trans isomerase (CYP22-1) mRNA, complete
           cds.>gb:BT002031_1635634 Arabidopsis thaliana putative
           peptidyl-prolyl cis-trans isomerase (At2g38730) mRNA,
           complete cds.>gb:BT006565_1639452 Arabidopsis thaliana
           At2g38730 gene, complete cds.
          Length = 199

 Score =  115 bits (287), Expect(2) = 6e-35
 Identities = 59/95 (62%), Positives = 64/95 (67%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R  CTGE       GKPL YK C FHR+IK FM Q GDF K +G+G  SIYG KF DENF
Sbjct: 65  RQFCTGELR---KAGKPLGYKECQFHRVIKDFMVQSGDFLKNDGSGCMSIYGHKFEDENF 121

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PGLLSMANSGPNTNG QFFIT  +   LD
Sbjct: 122 TAKHTGPGLLSMANSGPNTNGCQFFITCAKCDWLD 156



 Score = 55.1 bits (131), Expect(2) = 6e-35
 Identities = 29/51 (56%), Positives = 33/51 (64%), Gaps = 2/51 (3%)
 Frame = +1

Query: 220 PVTPVGLFEWKVM--KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P +  G  EW V     KNP+VFFDVS  G P  RI MELFAD+ P+TAEN
Sbjct: 13  PSSGGGNVEWHVRPPNPKNPVVFFDVSIGGIPAGRIKMELFADIAPKTAEN 63



>gb:AY349021_1321768 Trypanosoma cruzi 21 kDa cyclophilin mRNA,
           complete cds.
          Length = 196

 Score =  122 bits (305), Expect(2) = 6e-35
 Identities = 65/98 (66%), Positives = 70/98 (71%), Gaps = 3/98 (3%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GK L YKG  FHR+I  FM QGGDF+ GNGTGGESIYG KF DE+F
Sbjct: 56  RALCTGEKGVGRS-GKALCYKGSKFHRVIPQFMCQGGDFTNGNGTGGESIYGMKFPDESF 114

Query: 551 ---KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
                 H  PG LSMAN+GPNTNGSQFFI       LD
Sbjct: 115 AGRAGKHFGPGTLSMANAGPNTNGSQFFICTAATEWLD 152



 Score = 48.1 bits (113), Expect(2) = 6e-35
 Identities = 21/34 (61%), Positives = 25/34 (73%)
 Frame = +1

Query: 265 KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           KNPLVFF++S    P  R+ MELF D VP+TAEN
Sbjct: 21  KNPLVFFEISIGAQPAGRVEMELFKDAVPKTAEN 54



>gb:AF025804_1234141 Drosophila subobscura cyclophilin 1 (Cyp1)
           mRNA, partial cds.
          Length = 157

 Score =  123 bits (308), Expect(2) = 6e-35
 Identities = 61/95 (64%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        YKG IFHR+I  FM QGGDF+  NGTGG+SIYG KFADENF
Sbjct: 38  RALCTGEKGFG--------YKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFADENF 89

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +L H+  G+LSMAN+G NTNGSQFFI   +   LD
Sbjct: 90  QLKHTGTGILSMANAGANTNGSQFFICTVKTAWLD 124



 Score = 47.0 bits (110), Expect(2) = 6e-35
 Identities = 21/32 (65%), Positives = 27/32 (84%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFD++ DG P+ RI+MEL +DVVP+TAEN
Sbjct: 5   PRVFFDMTADGEPLGRIIMELRSDVVPKTAEN 36



>gb:BC081399_2562278 Danio rerio peptidylprolyl isomerase F
           (cyclophilin F), mRNA (cDNA clone MGC:101753
           IMAGE:7229434), complete cds.
          Length = 189

 Score =  123 bits (308), Expect(2) = 8e-35
 Identities = 62/95 (65%), Positives = 68/95 (71%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGE G G        YKG +FHRII  FM QGGDF+  NGTGG+SIYG KF DENF
Sbjct: 61  RALCTGEHGFG--------YKGSVFHRIIPEFMCQGGDFTNHNGTGGKSIYGKKFNDENF 112

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           KL H+  G+LSMANSGPNTNGSQFFI   +   LD
Sbjct: 113 KLKHTGAGILSMANSGPNTNGSQFFICTAKTEWLD 147



 Score = 46.6 bits (109), Expect(2) = 8e-35
 Identities = 20/34 (58%), Positives = 27/34 (79%)
 Frame = +1

Query: 265 KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           KNP+VF D++ DG  + RI++ELFADVVP+T  N
Sbjct: 26  KNPVVFMDIAADGEFIGRIIIELFADVVPKTVAN 59



>gb:AF121347_1242874 Dictyostelium discoideum cyclophilin D (cypD)
           mRNA, nuclear gene encoding mitochondrial protein,
           complete cds.
          Length = 174

 Score =  133 bits (334), Expect(2) = 8e-35
 Identities = 67/95 (70%), Positives = 73/95 (76%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKGIG S GKPLHYKG  FHR+IK FM QGGDF+ G G GGESIYG  F DENF
Sbjct: 40  RALCTGEKGIGKS-GKPLHYKGSSFHRVIKNFMVQGGDFTHGTGIGGESIYGRTFNDENF 98

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            + H + G LSMAN+G NTNGSQFFIT    PHL+
Sbjct: 99  LVKH-KIGCLSMANAGKNTNGSQFFITTAETPHLN 132



 Score = 36.6 bits (83), Expect(2) = 8e-35
 Identities = 15/30 (50%), Positives = 21/30 (70%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           VFF +     P+ R+V EL+ D+VP+TAEN
Sbjct: 9   VFFQIKQGNTPLGRVVFELYNDIVPKTAEN 38



>sp|P52010|CYP2_CAEEL Peptidyl-prolyl cis-trans isomerase 2 (EC
           5.2.1.8) (PPIase) (Rotamase)
           (Cyclophilin-2).>pir|T27882|T27882 peptidylprolyl
           isomerase (EC 5.2.1.8) ZK520.5 [similarity] -
           Caenorhabditis elegans>gb:CEZK520_1371640 Caenorhabditis
           elegans cosmid ZK520, complete sequence.
          Length = 172

 Score =  129 bits (324), Expect(2) = 8e-35
 Identities = 65/95 (68%), Positives = 73/95 (76%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G S GK LH+KG  FHRII  FM QGGDF++GNGTGGESI+G KF DENF
Sbjct: 37  RALCTGEKGKGKS-GKKLHFKGSKFHRIIPEFMIQGGDFTEGNGTGGESIHGEKFDDENF 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           K  H+ PG+LSMAN G NTNGSQFF+   +   LD
Sbjct: 96  KEKHTGPGVLSMANCGANTNGSQFFLCTVKTTWLD 130



 Score = 40.4 bits (93), Expect(2) = 8e-35
 Identities = 18/30 (60%), Positives = 23/30 (76%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           VFFD++  G    RIVMEL+ D+VP+TAEN
Sbjct: 6   VFFDITIGGKKGGRIVMELYNDIVPKTAEN 35



>gb:CR859672_1183778 Pongo pygmaeus mRNA; cDNA DKFZp459I0834 (from
           clone DKFZp459I0834).
          Length = 165

 Score =  123 bits (308), Expect(2) = 8e-35
 Identities = 62/95 (65%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG+SIYG KF DENF
Sbjct: 37  RALSTGEKGFG--------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 89  ILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 123



 Score = 46.6 bits (109), Expect(2) = 8e-35
 Identities = 20/33 (60%), Positives = 25/33 (75%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VF D++ DG P+ R+  ELFAD VP+TAEN
Sbjct: 3   NPTVFLDIAVDGEPLGRVSFELFADKVPKTAEN 35



>gb:AY346337_1321667 Branchiostoma belcheri tsingtaunese cyclophilin
           A mRNA, complete cds.
          Length = 164

 Score =  125 bits (313), Expect(2) = 8e-35
 Identities = 60/95 (63%), Positives = 71/95 (74%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEK +G        YKG  FHR+I GFM QGGDF +G+GTGG+SIYG KFADENF
Sbjct: 37  RALCTGEKSMG--------YKGSTFHRVIPGFMCQGGDFIRGDGTGGKSIYGNKFADENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +L H+  G+LSMAN+GPNTNGSQFF+   +   LD
Sbjct: 89  QLKHTGKGILSMANAGPNTNGSQFFLCTAKTDWLD 123



 Score = 44.7 bits (104), Expect(2) = 8e-35
 Identities = 20/32 (62%), Positives = 25/32 (78%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFD++  G P+ R+VMEL ADV P+TAEN
Sbjct: 4   PRVFFDITAGGQPLGRVVMELRADVAPKTAEN 35



>gb:AX887972_1483425 Sequence 3835 from Patent EP1033401.
          Length = 165

 Score =  120 bits (301), Expect(2) = 1e-34
 Identities = 61/95 (64%), Positives = 68/95 (71%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG+SIYG KF DENF
Sbjct: 37  RALSTGEKGFG--------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ P +LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 89  ILKHTGPXILSMANAGPNTNGSQFFICTAKTEWLD 123



 Score = 48.9 bits (115), Expect(2) = 1e-34
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++ DG P+ R+  ELFAD VP+TAEN
Sbjct: 3   NPTVFFDIAVDGEPLGRVSFELFADKVPKTAEN 35



>sp|P29117|PPIF_RAT Peptidyl-prolyl cis-trans isomerase,
           mitochondrial precursor (EC 5.2.1.8) (PPIase) (Rotamase)
           (Cyclophilin F).>gb:BC086977_2109885 Rattus norvegicus
           peptidylprolyl isomerase F (cyclophilin F), mRNA (cDNA
           clone MGC:93084 IMAGE:7193156), complete
           cds.>gb:RNU68544_2137642 Rattus norvegicus cyclophilin D
           mRNA, nuclear gene encoding mitochondrial protein,
           complete cds.
          Length = 206

 Score =  119 bits (298), Expect(2) = 2e-34
 Identities = 59/95 (62%), Positives = 66/95 (69%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        YKG  FHR+I  FM Q GDF+  NGTGG+SIYG +F DENF
Sbjct: 78  RALCTGEKGFG--------YKGSTFHRVIPAFMCQAGDFTNHNGTGGKSIYGSRFPDENF 129

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H  PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 130 TLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLD 164



 Score = 49.3 bits (116), Expect(2) = 2e-34
 Identities = 22/34 (64%), Positives = 28/34 (82%)
 Frame = +1

Query: 265 KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +NPLV+ DV  DG P+ R+V+EL ADVVP+TAEN
Sbjct: 43  QNPLVYLDVGADGQPLGRVVLELKADVVPKTAEN 76



>gb:BC007104_1970526 Homo sapiens peptidylprolyl isomerase A
           (cyclophilin A), transcript variant 1, mRNA (cDNA clone
           MGC:14747 IMAGE:4281376), complete cds.
          Length = 165

 Score =  119 bits (299), Expect(2) = 2e-34
 Identities = 61/95 (64%), Positives = 68/95 (71%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG+SIYG KF DENF
Sbjct: 37  RALSTGEKGFG--------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GP TNGSQFFI   +   LD
Sbjct: 89  ILKHTGPGILSMANAGPITNGSQFFICTAKTEWLD 123



 Score = 48.9 bits (115), Expect(2) = 2e-34
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++ DG P+ R+  ELFAD VP+TAEN
Sbjct: 3   NPTVFFDIAVDGEPLGRVSFELFADKVPKTAEN 35



>gb:AB125939_1528236 Malassezia pachydermatis CYP mRNA for
           cyclophilin, complete cds.
          Length = 162

 Score =  133 bits (334), Expect(2) = 2e-34
 Identities = 66/95 (69%), Positives = 72/95 (75%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        Y G  FHR+I  FM QGGDF+ GNGTGG+SIYG KFADENF
Sbjct: 35  RALCTGEKGFG--------YAGSHFHRVIPNFMLQGGDFTAGNGTGGKSIYGAKFADENF 86

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +L HS+PGLLSMAN+GPNTNGSQFFIT    P LD
Sbjct: 87  QLKHSKPGLLSMANAGPNTNGSQFFITTVVAPWLD 121



 Score = 35.4 bits (80), Expect(2) = 2e-34
 Identities = 15/30 (50%), Positives = 21/30 (70%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           VFFD++ +G P+  I  +LF DVVP+T  N
Sbjct: 4   VFFDITKNGSPLDPIKFKLFDDVVPKTTAN 33



>gb:AF078071_1766252 Griffithsia japonica cyclophilin (cypA) mRNA,
           complete cds.
          Length = 162

 Score =  126 bits (317), Expect(2) = 2e-34
 Identities = 61/95 (64%), Positives = 71/95 (74%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        +KG +FHR+I GFM QGGDF++G+GTGG+SIYG KF DENF
Sbjct: 35  RALCTGEKGFG--------FKGSVFHRVIPGFMLQGGDFTRGDGTGGKSIYGEKFEDENF 86

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG LSMAN+GPNTNGSQFFI  +    LD
Sbjct: 87  TLKHTGPGTLSMANAGPNTNGSQFFICTETTSWLD 121



 Score = 42.0 bits (97), Expect(2) = 2e-34
 Identities = 21/29 (72%), Positives = 22/29 (75%)
 Frame = +1

Query: 280 FFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           FFDVS  G P  RIVMEL  DVVP+TAEN
Sbjct: 5   FFDVSIAGKPSGRIVMELRPDVVPKTAEN 33



>sp|P91791|CYPH_HEMPU Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein).>gb:S82440_1396994 cyclophilin
           [Hemicentrotus pulcherrimus, early pluteus larva, mRNA,
           1755 nt].
          Length = 164

 Score =  125 bits (315), Expect(2) = 2e-34
 Identities = 60/86 (69%), Positives = 68/86 (79%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        YKG  FHR+I GFM QGGDF++ NGTGG+SIYG KFADENF
Sbjct: 37  RALCTGEKGFG--------YKGSTFHRVIPGFMCQGGDFTRHNGTGGKSIYGEKFADENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFI 628
            L H++PG+LSMAN+G NTNGSQFFI
Sbjct: 89  TLKHTQPGILSMANAGVNTNGSQFFI 114



 Score = 42.7 bits (99), Expect(2) = 2e-34
 Identities = 21/32 (65%), Positives = 25/32 (78%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFD+  +G  + RIVMEL ADVVP+TAEN
Sbjct: 4   PQVFFDLQANGENLGRIVMELRADVVPKTAEN 35



>gb:AY091023_1574254 Arabidopsis thaliana unknown protein
           (At4g32420) mRNA, complete cds.>gb:AY568529_1615467
           Arabidopsis thaliana multidomain cyclophilin type
           peptidyl-prolyl cis-trans isomerase (CYP95) mRNA,
           complete cds.
          Length = 837

 Score =  117 bits (293), Expect(2) = 2e-34
 Identities = 59/95 (62%), Positives = 66/95 (69%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKGIG  + KPLHYKG  FHRI+KG  AQ GDF   NGT GESIY GKF DE+ 
Sbjct: 40  RALCTGEKGIGPRSRKPLHYKGSFFHRIMKGSSAQAGDFVNRNGTAGESIYAGKFPDESP 99

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           KL H E GLLSM+ +  +  GS F ITF+    LD
Sbjct: 100 KLRHEETGLLSMSIADRDKFGSHFHITFRPNQQLD 134



 Score = 50.8 bits (120), Expect(2) = 2e-34
 Identities = 22/36 (61%), Positives = 27/36 (75%)
 Frame = +1

Query: 259 KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           KKKNP VF DVS DG P + +V ELF +V P+T+EN
Sbjct: 3   KKKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSEN 38



>gb:AE016820_1749778 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VII, complete sequence.
          Length = 162

 Score =  125 bits (314), Expect(2) = 2e-34
 Identities = 62/95 (65%), Positives = 68/95 (71%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        Y GC FHR+I  FM QGGDF+ G G GG+SIYGGKF DENF
Sbjct: 35  RALCTGEKGFG--------YAGCPFHRVIPDFMLQGGDFTHGTGVGGKSIYGGKFPDENF 86

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H +PGLLSMAN+GPNTNGSQFFIT    P L+
Sbjct: 87  VKKHEKPGLLSMANAGPNTNGSQFFITTVPCPWLN 121



 Score = 42.7 bits (99), Expect(2) = 2e-34
 Identities = 19/30 (63%), Positives = 23/30 (76%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           VFFDV  DG P+ RIV +L+ DV P+TAEN
Sbjct: 4   VFFDVEADGQPLGRIVFQLYNDVTPKTAEN 33



>pir|S10327|CSMSA peptidylprolyl isomerase (EC 5.2.1.8) A -
           mouse>gb:AK002236_1151065 Mus musculus adult male kidney
           cDNA, RIKEN full-length enriched library,
           clone:0610006E04 product:peptidylprolyl isomerase A,
           full insert sequence.>gb:AK007981_1154312 Mus musculus
           10 day old male pancreas cDNA, RIKEN full-length
           enriched library, clone:1810074A10
           product:peptidylprolyl isomerase A, full insert
           sequence.>gb:AK012531_1157011 Mus musculus 11 days
           embryo whole body cDNA, RIKEN full-length enriched
           library, clone:2700078G16 product:peptidylprolyl
           isomerase A, full insert sequence.>gb:AK012663_1157089
           Mus musculus 10, 11 days embryo whole body cDNA, RIKEN
           full-length enriched library, clone:2810003N04
           product:peptidylprolyl isomerase A, full insert
           sequence.>gb:AK028210_1160860 Mus musculus 11 days
           embryo whole body cDNA, RIKEN full-length enriched
           library, clone:2700098C05 product:peptidylprolyl
           isomerase A, full insert sequence.>gb:AF022115_1877060
           Homo sapiens cyclophilin mRNA, complete
           cds.>gb:AL607152_2071522 Mouse DNA sequence from clone
           RP23-198N14 on chromosome 11, complete
           sequence.>gb:BC083076_2108492 Mus musculus
           peptidylprolyl isomerase A, mRNA (cDNA clone MGC:103198
           IMAGE:6442005), complete cds.>gb:BC087928_2110257 Mus
           musculus peptidylprolyl isomerase A, mRNA (cDNA clone
           MGC:107289 IMAGE:6533710), complete
           cds.>gb:MMCYCM_2114673 Mouse mRNA for cyclophilin (EC
           5.2.1.8).>gb:BC082162_2562518 Xenopus laevis
           hypothetical LOC494607, mRNA (cDNA clone MGC:98498
           IMAGE:7198636), complete cds.
          Length = 164

 Score =  122 bits (306), Expect(2) = 2e-34
 Identities = 62/95 (65%), Positives = 68/95 (71%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG SIYG KF DENF
Sbjct: 37  RALSTGEKGFG--------YKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 89  ILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 123



 Score = 45.8 bits (107), Expect(2) = 2e-34
 Identities = 20/33 (60%), Positives = 25/33 (75%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++ D  P+ R+  ELFAD VP+TAEN
Sbjct: 3   NPTVFFDITADDEPLGRVSFELFADKVPKTAEN 35



>sp|P17742|PPIA_MOUSE Peptidyl-prolyl cis-trans isomerase A (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A)
           (Cyclosporin A-binding protein) (SP18).
          Length = 163

 Score =  122 bits (306), Expect(2) = 2e-34
 Identities = 62/95 (65%), Positives = 68/95 (71%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG SIYG KF DENF
Sbjct: 36  RALSTGEKGFG--------YKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENF 87

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 88  ILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 122



 Score = 45.8 bits (107), Expect(2) = 2e-34
 Identities = 20/33 (60%), Positives = 25/33 (75%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++ D  P+ R+  ELFAD VP+TAEN
Sbjct: 2   NPTVFFDITADDEPLGRVSFELFADKVPKTAEN 34



>sp|P34887|CYPH_ALLCE Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein).>gb:ALCCYCLOPH_1818940 Allium cepa
           cyclophilin mRNA, complete cds.
          Length = 150

 Score =  140 bits (352), Expect(2) = 2e-34
 Identities = 67/95 (70%), Positives = 75/95 (78%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+GD   KPLHYKG  FHR+I GFM QGGDF+ GNGTGGESIYG KF DENF
Sbjct: 16  RALCTGEKGMGDR--KPLHYKGSSFHRVIPGFMCQGGDFTAGNGTGGESIYGAKFKDENF 73

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PG+LSMAN+GP TNGSQFFI  ++   LD
Sbjct: 74  IKKHTGPGVLSMANAGPGTNGSQFFICTEKTAWLD 108



 Score = 28.1 bits (61), Expect(2) = 2e-34
 Identities = 12/14 (85%), Positives = 13/14 (92%)
 Frame = +1

Query: 325 MELFADVVPRTAEN 366
           MELF DVVP+TAEN
Sbjct: 1   MELFQDVVPQTAEN 14



>sp|Q99KR7|PPIF_MOUSE Peptidyl-prolyl cis-trans isomerase,
           mitochondrial precursor (EC 5.2.1.8) (PPIase) (Rotamase)
           (Cyclophilin F).>gb:BC004041_2089555 Mus musculus
           peptidylprolyl isomerase F (cyclophilin F), mRNA (cDNA
           clone MGC:7667 IMAGE:3496285), complete cds.
          Length = 206

 Score =  119 bits (297), Expect(2) = 3e-34
 Identities = 59/95 (62%), Positives = 65/95 (68%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        YKG  FHR+I  FM Q GDF+  NGTGG SIYG +F DENF
Sbjct: 78  RALCTGEKGFG--------YKGSTFHRVIPAFMCQAGDFTNHNGTGGRSIYGSRFPDENF 129

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H  PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 130 TLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLD 164



 Score = 48.9 bits (115), Expect(2) = 3e-34
 Identities = 22/33 (66%), Positives = 27/33 (81%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NPLV+ DV  DG P+ R+V+EL ADVVP+TAEN
Sbjct: 44  NPLVYLDVGADGQPLGRVVLELKADVVPKTAEN 76



>gb:BX842633_1644033 Neurospora crassa DNA linkage group I cosmid
           contig 53H1.
          Length = 182

 Score =  116 bits (291), Expect(2) = 3e-34
 Identities = 61/96 (63%), Positives = 66/96 (68%), Gaps = 1/96 (1%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGK-FADEN 547
           R  CTGE    ++ G+P  YKG  FHRII  FM QGGDF  G+GTG   IYG K FADEN
Sbjct: 45  RQFCTGESK--NNLGRPQGYKGSKFHRIIPNFMCQGGDFLNGDGTGSTCIYGTKSFADEN 102

Query: 548 FKLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           F L H  PGLLSMAN+GPNTNGSQFFIT    P LD
Sbjct: 103 FLLKHDTPGLLSMANAGPNTNGSQFFITTVPTPFLD 138



 Score = 51.2 bits (121), Expect(2) = 3e-34
 Identities = 23/33 (69%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NPLVFFD++  G P+ RI  ELF DVVPRTAEN
Sbjct: 11  NPLVFFDITLGGEPLGRITFELFKDVVPRTAEN 43



>sp|P18253|CYPH_SCHPO Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein) (CPH).>pir|S11212|CSZPA
           peptidylprolyl isomerase (EC 5.2.1.8) A - fission yeast 
           (Schizosaccharomyces pombe)>gb:SPBC28F2_1719706 S.pombe
           chromosome II cosmid c28F2.>gb:SPPPCTI_1721997
           Schizosaccharomyces pombe gene for cyclophilin
           (peptidyl-prolyl cis-trans
           isomerase).>gb:YSP972HA_1731014 Fission yeast DNA for
           ISP4, peptidyl-prolyl cis-trans isomerase, atf1,
           chromosome II cosmid 1228 sequence.
          Length = 162

 Score =  129 bits (324), Expect(2) = 3e-34
 Identities = 64/95 (67%), Positives = 71/95 (74%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        Y G  FHR+I  FM QGGDF++GNGTGG+SIYG KF DENF
Sbjct: 35  RALCTGEKGYG--------YAGSTFHRVIPQFMLQGGDFTRGNGTGGKSIYGEKFPDENF 86

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H++PGLLSMAN+GPNTNGSQFFIT    P LD
Sbjct: 87  ALKHNKPGLLSMANAGPNTNGSQFFITTVVTPWLD 121



 Score = 38.5 bits (88), Expect(2) = 3e-34
 Identities = 18/29 (62%), Positives = 22/29 (75%)
 Frame = +1

Query: 280 FFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           FFDV  +G P+ RIV +LF DVVP+TA N
Sbjct: 5   FFDVIANGQPLGRIVFKLFDDVVPKTAAN 33



>gb:CR382126_1658575 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 372

 Score =  119 bits (299), Expect(2) = 4e-34
 Identities = 61/94 (64%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = +2

Query: 377 LCTGEKGIGDSTGK-PLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFK 553
           LC G  G   S    PL YKG IFHR+IK FM Q GDF+  NGTGGESIYG KF DENF 
Sbjct: 41  LCEGNSGFAKSKPDIPLSYKGSIFHRVIKSFMCQFGDFTNFNGTGGESIYGEKFEDENFT 100

Query: 554 LDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           L H +P LLSMAN+G NTNGSQ FIT    PHLD
Sbjct: 101 LKHDKPFLLSMANAGANTNGSQCFITCVPTPHLD 134



 Score = 47.8 bits (112), Expect(2) = 4e-34
 Identities = 21/37 (56%), Positives = 26/37 (70%)
 Frame = +1

Query: 256 MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           M +  P  FFD+S  G P  RIV EL++DVVP+TAEN
Sbjct: 1   MSETRPKTFFDISIGGKPAGRIVFELYSDVVPKTAEN 37



>sp|Q9D868|PPIH_MOUSE Peptidyl-prolyl cis-trans isomerase H (EC
           5.2.1.8) (PPIase H) (Rotamase H).>gb:AK008394_1154557
           Mus musculus adult male small intestine cDNA, RIKEN
           full-length enriched library, clone:2010111B15
           product:U-SNRNP-ASSOCIATED CYCLOPHILIN (EC 5.2.1.8)
           homolog [Homo sapiens], full insert sequence.
          Length = 188

 Score =  118 bits (296), Expect(2) = 4e-34
 Identities = 61/95 (64%), Positives = 66/95 (69%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R  CTGE       G P+ YKG  FHR+IK FM QGGDF  G+GTG  SIY G FADENF
Sbjct: 44  RQFCTGEFR---KDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENF 100

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           KL HS PGLLSMANSGP+TNG QFFIT  +   LD
Sbjct: 101 KLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLD 135



 Score = 48.9 bits (115), Expect(2) = 4e-34
 Identities = 23/33 (69%), Positives = 27/33 (81%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP+VFFDVS  G  V R+ +ELFADVVP+TAEN
Sbjct: 10  NPVVFFDVSIGGQEVGRMKIELFADVVPKTAEN 42



>gb:BT019342_2151301 Synthetic construct Homo sapiens peptidyl
           prolyl isomerase H (cyclophilin H) mRNA, partial cds.
          Length = 178

 Score =  118 bits (296), Expect(2) = 4e-34
 Identities = 61/95 (64%), Positives = 66/95 (69%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R  CTGE       G P+ YKG  FHR+IK FM QGGDF  G+GTG  SIY G FADENF
Sbjct: 44  RQFCTGEFR---KDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENF 100

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           KL HS PGLLSMANSGP+TNG QFFIT  +   LD
Sbjct: 101 KLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLD 135



 Score = 48.9 bits (115), Expect(2) = 4e-34
 Identities = 23/33 (69%), Positives = 27/33 (81%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP+VFFDVS  G  V R+ +ELFADVVP+TAEN
Sbjct: 10  NPVVFFDVSIGGQEVGRMKIELFADVVPKTAEN 42



>gb:CR541899_1994126 Homo sapiens full open reading frame cDNA clone
           RZPDo834B1133D for gene PPIH, peptidyl prolyl isomerase
           H (cyclophilin H); complete cds, incl. stopcodon.
          Length = 177

 Score =  118 bits (296), Expect(2) = 4e-34
 Identities = 61/95 (64%), Positives = 66/95 (69%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R  CTGE       G P+ YKG  FHR+IK FM QGGDF  G+GTG  SIY G FADENF
Sbjct: 44  RQFCTGEFR---KDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENF 100

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           KL HS PGLLSMANSGP+TNG QFFIT  +   LD
Sbjct: 101 KLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLD 135



 Score = 48.9 bits (115), Expect(2) = 4e-34
 Identities = 23/33 (69%), Positives = 27/33 (81%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP+VFFDVS  G  V R+ +ELFADVVP+TAEN
Sbjct: 10  NPVVFFDVSIGGQEVGRMKIELFADVVPKTAEN 42



>sp|O43447|PPIH_HUMAN Peptidyl-prolyl cis-trans isomerase H (EC
           5.2.1.8) (PPIase H) (Rotamase H) (U-snRNP-associated
           cyclophilin SnuCyp-20) (USA-CYP) (Small nuclear
           ribonucleoprotein particle-specific cyclophilin H)
           (CypH).>gb:AK003179_1151702 Mus musculus 18-day embryo
           whole body cDNA, RIKEN full-length enriched library,
           clone:1100001J08 product:U-SNRNP-ASSOCIATED CYCLOPHILIN
           (EC 5.2.1.8) homolog [Homo sapiens], full insert
           sequence.>gb:AK005202_1152884 Mus musculus adult male
           cerebellum cDNA, RIKEN full-length enriched library,
           clone:1500011D08 product:U-SNRNP-ASSOCIATED CYCLOPHILIN
           (EC 5.2.1.8) homolog [Homo sapiens], full insert
           sequence.>gb:AK014665_1158082 Mus musculus 0 day neonate
           head cDNA, RIKEN full-length enriched library,
           clone:4833408F11 product:U-SNRNP-ASSOCIATED CYCLOPHILIN
           (EC 5.2.1.8) homolog [Homo sapiens], full insert
           sequence.>gb:AF016371_1876690 Homo sapiens
           U-snRNP-associated cyclophilin (USA-CyP) mRNA, complete
           cds.>gb:AF036331_1878026 Homo sapiens cyclophilin
           (CYP-20) mRNA, complete cds.>gb:BC003412_1968822 Homo
           sapiens peptidyl prolyl isomerase H (cyclophilin H),
           mRNA (cDNA clone MGC:5016 IMAGE:3451034), complete
           cds.>gb:BT019343_1991029 Homo sapiens peptidyl prolyl
           isomerase H (cyclophilin H) mRNA, complete
           cds.>gb:CR541920_1994147 Homo sapiens full open reading
           frame cDNA clone RZPDo834G0833D for gene PPIH, peptidyl
           prolyl isomerase H (cyclophilin H); complete cds,
           without stopcodon.>gb:BC050116_2100360 Mus musculus
           peptidyl prolyl isomerase H, mRNA (cDNA clone MGC:60913
           IMAGE:6432881), complete cds.
          Length = 177

 Score =  118 bits (296), Expect(2) = 4e-34
 Identities = 61/95 (64%), Positives = 66/95 (69%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R  CTGE       G P+ YKG  FHR+IK FM QGGDF  G+GTG  SIY G FADENF
Sbjct: 44  RQFCTGEFR---KDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENF 100

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           KL HS PGLLSMANSGP+TNG QFFIT  +   LD
Sbjct: 101 KLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLD 135



 Score = 48.9 bits (115), Expect(2) = 4e-34
 Identities = 23/33 (69%), Positives = 27/33 (81%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP+VFFDVS  G  V R+ +ELFADVVP+TAEN
Sbjct: 10  NPVVFFDVSIGGQEVGRMKIELFADVVPKTAEN 42



>gb:BC071448_2556188 Danio rerio zgc:86780, mRNA (cDNA clone
           MGC:86780 IMAGE:6900230), complete cds.
          Length = 215

 Score =  118 bits (295), Expect(2) = 5e-34
 Identities = 60/95 (63%), Positives = 66/95 (69%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R  CTGE       G P+ YKGC FHR+IK FM QGGDF  G+GTG  SIY G FADENF
Sbjct: 44  RQFCTGEF---KKDGVPVGYKGCTFHRVIKDFMIQGGDFVNGDGTGICSIYRGPFADENF 100

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           ++ HS PGLLSMANSGP TNG QFFIT  +   LD
Sbjct: 101 RMKHSGPGLLSMANSGPGTNGCQFFITCTKCDWLD 135



 Score = 48.9 bits (115), Expect(2) = 5e-34
 Identities = 22/33 (66%), Positives = 27/33 (81%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP+VFFDVS  G  V R+ +ELFAD+VP+TAEN
Sbjct: 10  NPIVFFDVSIGGQEVGRMKIELFADIVPKTAEN 42



>gb:BC045448_2549285 Danio rerio zgc:55766, mRNA (cDNA clone
           MGC:55766 IMAGE:3816820), complete cds.
          Length = 181

 Score =  118 bits (295), Expect(2) = 5e-34
 Identities = 60/95 (63%), Positives = 66/95 (69%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R  CTGE       G P+ YKGC FHR+IK FM QGGDF  G+GTG  SIY G FADENF
Sbjct: 44  RQFCTGEF---KKDGVPVGYKGCTFHRVIKDFMIQGGDFVNGDGTGICSIYRGPFADENF 100

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           ++ HS PGLLSMANSGP TNG QFFIT  +   LD
Sbjct: 101 RMKHSGPGLLSMANSGPGTNGCQFFITCTKCDWLD 135



 Score = 48.9 bits (115), Expect(2) = 5e-34
 Identities = 22/33 (66%), Positives = 27/33 (81%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP+VFFDVS  G  V R+ +ELFAD+VP+TAEN
Sbjct: 10  NPIVFFDVSIGGQEVGRMKIELFADIVPKTAEN 42



>gb:AY394969_2531712 Danio rerio clone RK058A3D03 peptidyl prolyl
           isomerase H mRNA, complete cds.
          Length = 177

 Score =  118 bits (295), Expect(2) = 5e-34
 Identities = 60/95 (63%), Positives = 66/95 (69%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R  CTGE       G P+ YKGC FHR+IK FM QGGDF  G+GTG  SIY G FADENF
Sbjct: 44  RQFCTGEF---KKDGVPVGYKGCTFHRVIKDFMIQGGDFVNGDGTGICSIYRGPFADENF 100

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           ++ HS PGLLSMANSGP TNG QFFIT  +   LD
Sbjct: 101 RMKHSGPGLLSMANSGPGTNGCQFFITCTKCDWLD 135



 Score = 48.9 bits (115), Expect(2) = 5e-34
 Identities = 22/33 (66%), Positives = 27/33 (81%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP+VFFDVS  G  V R+ +ELFAD+VP+TAEN
Sbjct: 10  NPIVFFDVSIGGQEVGRMKIELFADIVPKTAEN 42



>gb:CR380951_1649984 Candida glabrata strain CBS138 chromosome E
           complete sequence.
          Length = 162

 Score =  127 bits (318), Expect(2) = 5e-34
 Identities = 64/95 (67%), Positives = 68/95 (71%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        Y G  FHR+I  FM QGGDF+ GNGTGG+SIYGGKF DENF
Sbjct: 35  RALCTGEKGFG--------YAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENF 86

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H  PGLLSMAN+GPNTNGSQFFIT    P LD
Sbjct: 87  VKRHERPGLLSMANAGPNTNGSQFFITTVPCPWLD 121



 Score = 40.0 bits (92), Expect(2) = 5e-34
 Identities = 16/30 (53%), Positives = 23/30 (76%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           V+FD+  DG P+ R+V +L+ DVVP+TA N
Sbjct: 4   VYFDIEADGQPLGRVVFQLYDDVVPKTAAN 33



>gb:AF025803_1234140 Drosophila pseudoobscura cyclophilin 1 (Cyp1)
           mRNA, partial cds.
          Length = 157

 Score =  120 bits (300), Expect(2) = 5e-34
 Identities = 60/95 (63%), Positives = 67/95 (70%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        YKG IFHR+I  FM QGGDF+  NGTGG+SIYG KF DENF
Sbjct: 38  RALCTGEKGFG--------YKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENF 89

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+  G+LSMAN+G NTNGSQFFI   +   LD
Sbjct: 90  LLKHTGTGILSMANAGANTNGSQFFICTVKTAWLD 124



 Score = 47.0 bits (110), Expect(2) = 5e-34
 Identities = 21/32 (65%), Positives = 27/32 (84%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFD++ DG P+ RI+MEL +DVVP+TAEN
Sbjct: 5   PRVFFDMTADGEPLGRIIMELRSDVVPKTAEN 36



>gb:AE017150_1029647 Trypanosoma brucei chromosome 2, complete
           sequence.>gb:AE017168_1229847 Trypanosoma brucei
           chromosome 2, section 2 of 4 of the complete sequence.
          Length = 274

 Score =  121 bits (304), Expect(2) = 6e-34
 Identities = 65/98 (66%), Positives = 70/98 (71%), Gaps = 3/98 (3%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GK L YKG  FHR+I  FM QGGDF+ GNGTGGESIYG KF DE+F
Sbjct: 134 RALCTGEKGLGRS-GKALSYKGSKFHRVIPQFMCQGGDFTSGNGTGGESIYGLKFPDESF 192

Query: 551 ---KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
                 H  PG LSMAN+G NTNGSQFFI     P LD
Sbjct: 193 AGRAGKHFGPGTLSMANAGRNTNGSQFFICTAATPWLD 230



 Score = 45.1 bits (105), Expect(2) = 6e-34
 Identities = 20/33 (60%), Positives = 24/33 (72%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NPLV+FD+S       R+ MELF DVVP+TAEN
Sbjct: 100 NPLVYFDISIGSQKAGRVEMELFKDVVPKTAEN 132



>gb:AE017150_1029659 Trypanosoma brucei chromosome 2, complete
           sequence.>gb:AE017168_1229859 Trypanosoma brucei
           chromosome 2, section 2 of 4 of the complete sequence.
          Length = 196

 Score =  121 bits (304), Expect(2) = 6e-34
 Identities = 65/98 (66%), Positives = 70/98 (71%), Gaps = 3/98 (3%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GK L YKG  FHR+I  FM QGGDF+ GNGTGGESIYG KF DE+F
Sbjct: 56  RALCTGEKGLGRS-GKALSYKGSKFHRVIPQFMCQGGDFTSGNGTGGESIYGLKFPDESF 114

Query: 551 ---KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
                 H  PG LSMAN+G NTNGSQFFI     P LD
Sbjct: 115 AGRAGKHFGPGTLSMANAGRNTNGSQFFICTAATPWLD 152



 Score = 45.1 bits (105), Expect(2) = 6e-34
 Identities = 20/33 (60%), Positives = 24/33 (72%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NPLV+FD+S       R+ MELF DVVP+TAEN
Sbjct: 22  NPLVYFDISIGSQKAGRVEMELFKDVVPKTAEN 54



>gb:AY551095_1334919 Crassostrea gigas cyclophilin mRNA, complete
           cds.
          Length = 164

 Score =  118 bits (296), Expect(2) = 6e-34
 Identities = 60/95 (63%), Positives = 67/95 (70%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        YKG  FHR+I  FM QGGDF+  NGTGG+SIYG KF DENF
Sbjct: 37  RALCTGEKGFG--------YKGSGFHRVIPQFMCQGGDFTNHNGTGGKSIYGNKFPDENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +L    PG LSMAN+GPNTNGSQFFI  ++   LD
Sbjct: 89  QLKPLGPGTLSMANAGPNTNGSQFFICTEKTSWLD 123



 Score = 48.1 bits (113), Expect(2) = 6e-34
 Identities = 23/32 (71%), Positives = 25/32 (78%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFD+S  G P  RIVMEL ADVVP+TAEN
Sbjct: 4   PQVFFDISIGGQPAGRIVMELEADVVPKTAEN 35



>sp|P25007|CYPH_DROME Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein).>gb:AE014298_1125953 Drosophila
           melanogaster chromosome X, complete
           sequence.>gb:AE003501_1212962 Drosophila melanogaster
           chromosome X, section 53 of 74 of the complete sequence.
          Length = 227

 Score =  121 bits (303), Expect(2) = 8e-34
 Identities = 60/95 (63%), Positives = 68/95 (71%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        YKG IFHR+I  FM QGGDF+  NGTGG+SIYG KF DENF
Sbjct: 100 RALCTGEKGFG--------YKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENF 151

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +L H+  G+LSMAN+G NTNGSQFFI   +   LD
Sbjct: 152 ELKHTGSGILSMANAGANTNGSQFFICTVKTAWLD 186



 Score = 45.1 bits (105), Expect(2) = 8e-34
 Identities = 21/32 (65%), Positives = 26/32 (81%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFD++ D  P+ RIVMEL +DVVP+TAEN
Sbjct: 67  PRVFFDMTADNEPLGRIVMELRSDVVPKTAEN 98



>sp|P30405|PPIF_HUMAN Peptidyl-prolyl cis-trans isomerase,
           mitochondrial precursor (EC 5.2.1.8) (PPIase) (Rotamase)
           (Cyclophilin F).>pir|A41581|A41581 peptidylprolyl
           isomerase (EC 5.2.1.8) 3 precursor -
           human>gb:AX134756_1461838 Sequence 39 from Patent
           WO0132876.>gb:AL133481_1918610 Human DNA sequence from
           clone RP11-342M3 on chromosome 10 Contains the 3' end of
           the PPIF gene for peptidylprolyl isomerase F
           (cyclophilin F), gene FLJ90798, the EIF5AP1 pseudogene
           for eukaryotic translation initiation factor 5A
           pseudogene 1, a novel gene, a novel pseudogene and a CpG
           island, complete sequence.>gb:AL391665_1926991 Human DNA
           sequence from clone RP11-519K18 on chromosome 10
           Contains the 3' end of the RAI17 gene for retinoic acid
           induced 17, the 5' end of the PPIF gene for
           peptidylprolyl isomerase F (cyclophilin F) and two CpG
           islands, complete sequence.>gb:BC005020_1969529 Homo
           sapiens peptidylprolyl isomerase F (cyclophilin F), mRNA
           (cDNA clone MGC:11022 IMAGE:3659599), complete
           cds.>gb:HUMCYP_2030428 H.sapiens cyclophilin isoform
           (hCyP3) mRNA, complete cds.
          Length = 207

 Score =  119 bits (298), Expect(2) = 8e-34
 Identities = 59/95 (62%), Positives = 66/95 (69%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        YKG  FHR+I  FM Q GDF+  NGTGG+SIYG +F DENF
Sbjct: 79  RALCTGEKGFG--------YKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENF 130

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H  PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 131 TLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLD 165



 Score = 47.0 bits (110), Expect(2) = 8e-34
 Identities = 21/33 (63%), Positives = 27/33 (81%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NPLV+ DV  +G P+ R+V+EL ADVVP+TAEN
Sbjct: 45  NPLVYLDVDANGKPLGRVVLELKADVVPKTAEN 77



>gb:BC049009_2550082 Danio rerio peptidylprolyl isomerase A
           (cyclophilin A), mRNA (cDNA clone IMAGE:5604178),
           partial cds.
          Length = 190

 Score =  117 bits (294), Expect(2) = 8e-34
 Identities = 57/86 (66%), Positives = 63/86 (73%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R LCTG+ G G        YKG  FHR+I GFM QGGDF+  NGTGG+SIYG KFADENF
Sbjct: 63  RQLCTGQPGYG--------YKGSSFHRVIPGFMCQGGDFTNHNGTGGKSIYGNKFADENF 114

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFI 628
            L H+  G LSMAN+GPNTNGSQFFI
Sbjct: 115 NLKHTGAGCLSMANAGPNTNGSQFFI 140



 Score = 48.5 bits (114), Expect(2) = 8e-34
 Identities = 23/32 (71%), Positives = 26/32 (81%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFD++  G PV R+VMEL ADVVPRTAEN
Sbjct: 30  PKVFFDLTAGGNPVGRVVMELRADVVPRTAEN 61



>gb:BC059458_2552435 Danio rerio peptidylprolyl isomerase A
           (cyclophilin A), mRNA (cDNA clone IMAGE:4199657),
           partial cds.
          Length = 183

 Score =  117 bits (294), Expect(2) = 8e-34
 Identities = 57/86 (66%), Positives = 63/86 (73%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R LCTG+ G G        YKG  FHR+I GFM QGGDF+  NGTGG+SIYG KFADENF
Sbjct: 56  RQLCTGQPGYG--------YKGSSFHRVIPGFMCQGGDFTNHNGTGGKSIYGNKFADENF 107

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFI 628
            L H+  G LSMAN+GPNTNGSQFFI
Sbjct: 108 NLKHTGAGCLSMANAGPNTNGSQFFI 133



 Score = 48.5 bits (114), Expect(2) = 8e-34
 Identities = 23/32 (71%), Positives = 26/32 (81%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFD++  G PV R+VMEL ADVVPRTAEN
Sbjct: 23  PKVFFDLTAGGNPVGRVVMELRADVVPRTAEN 54



>gb:EMU292367_1384651 Echinococcus multilocularis mRNA for putative
           U-snRNP-associated cyclophilin (rnpc gene).
          Length = 185

 Score =  115 bits (287), Expect(2) = 8e-34
 Identities = 59/88 (67%), Positives = 64/88 (72%), Gaps = 1/88 (1%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGG-KFADEN 547
           R LCTGE       G P  YKGC FHRIIK FM QGGDF  G+GTG  SIYGG KF+DEN
Sbjct: 51  RQLCTGEYR---KDGVPTGYKGCTFHRIIKDFMVQGGDFVNGDGTGSCSIYGGSKFSDEN 107

Query: 548 FKLDHSEPGLLSMANSGPNTNGSQFFIT 631
           F + HS PG+LSMANSG +TNG QFFIT
Sbjct: 108 FIMKHSSPGMLSMANSGKDTNGCQFFIT 135



 Score = 51.2 bits (121), Expect(2) = 8e-34
 Identities = 23/46 (50%), Positives = 31/46 (67%)
 Frame = +1

Query: 229 PVGLFEWKVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P  +   ++   KNP+VFFD+S  G  + RI +ELFADV P+TAEN
Sbjct: 4   PAPMVSERMNNPKNPVVFFDISIGGQDIGRIQLELFADVTPKTAEN 49



>pir|B38388|B38388 peptidylprolyl isomerase (EC 5.2.1.8)
           (cyclophilin) cyp-1 - fruit fly (Drosophila
           melanogaster)>gb:BT009946_1357312 Drosophila
           melanogaster SD01793 full insert
           cDNA.>gb:DROCYP1_1381847 Drosophila melanogaster CYP-1
           protein mRNA, complete cds.
          Length = 165

 Score =  121 bits (303), Expect(2) = 8e-34
 Identities = 60/95 (63%), Positives = 68/95 (71%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        YKG IFHR+I  FM QGGDF+  NGTGG+SIYG KF DENF
Sbjct: 38  RALCTGEKGFG--------YKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENF 89

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +L H+  G+LSMAN+G NTNGSQFFI   +   LD
Sbjct: 90  ELKHTGSGILSMANAGANTNGSQFFICTVKTAWLD 124



 Score = 45.1 bits (105), Expect(2) = 8e-34
 Identities = 21/32 (65%), Positives = 26/32 (81%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFD++ D  P+ RIVMEL +DVVP+TAEN
Sbjct: 5   PRVFFDMTADNEPLGRIVMELRSDVVPKTAEN 36



>gb:AY391452_2531588 Danio rerio 2-peptidylprolyl isomerase A
           (PPIA-2) mRNA, complete cds.
          Length = 164

 Score =  117 bits (294), Expect(2) = 8e-34
 Identities = 57/86 (66%), Positives = 63/86 (73%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R LCTG+ G G        YKG  FHR+I GFM QGGDF+  NGTGG+SIYG KFADENF
Sbjct: 37  RQLCTGQPGYG--------YKGSSFHRVIPGFMCQGGDFTNHNGTGGKSIYGNKFADENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFI 628
            L H+  G LSMAN+GPNTNGSQFFI
Sbjct: 89  NLKHTGAGCLSMANAGPNTNGSQFFI 114



 Score = 48.5 bits (114), Expect(2) = 8e-34
 Identities = 23/32 (71%), Positives = 26/32 (81%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFD++  G PV R+VMEL ADVVPRTAEN
Sbjct: 4   PKVFFDLTAGGNPVGRVVMELRADVVPRTAEN 35



>gb:AE017351_1759269 Cryptococcus neoformans var. neoformans JEC21
           chromosome 11, complete sequence.
          Length = 526

 Score =  120 bits (301), Expect(2) = 1e-33
 Identities = 60/97 (61%), Positives = 66/97 (68%), Gaps = 3/97 (3%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKGI   +  PLHYK  I HR+I+GFM QGGDF+K  G GGESIYG  F DE  
Sbjct: 38  RALCTGEKGISPISSLPLHYKNSIVHRVIEGFMIQGGDFTKKTGAGGESIYGAPFEDERL 97

Query: 551 KLDHSE---PGLLSMANSGPNTNGSQFFITFKRQPHL 652
             +  E    GLL MAN GPNTNGSQ+FIT    PHL
Sbjct: 98  NGEGCEVDTKGLLVMANRGPNTNGSQYFITLAAAPHL 134



 Score = 45.4 bits (106), Expect(2) = 1e-33
 Identities = 20/33 (60%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD +  G P+ R+V EL+A+VVP+TAEN
Sbjct: 4   NPRVFFDFAVAGQPLGRVVFELYANVVPKTAEN 36



>pir|T49204|T49204 peptidylprolyl isomerase (EC 5.2.1.8) F27K19.100
           [similarity] - Arabidopsis thaliana>gb:ATF27K19_1550237
           Arabidopsis thaliana DNA chromosome 3, BAC clone F27K19.
          Length = 234

 Score =  130 bits (328), Expect(2) = 1e-33
 Identities = 63/90 (70%), Positives = 73/90 (81%)
 Frame = +2

Query: 386 GEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHS 565
           GEKG+G+  GKPL++KG  FHRII GFM QGGDF++G+G GGESIYG KFADENFKL H+
Sbjct: 103 GEKGVGNM-GKPLYFKGSSFHRIIPGFMIQGGDFTRGDGRGGESIYGDKFADENFKLKHT 161

Query: 566 EPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            PG LSMANSGP++NGSQFFIT      LD
Sbjct: 162 GPGFLSMANSGPDSNGSQFFITTVTTSWLD 191



 Score = 35.0 bits (79), Expect(2) = 1e-33
 Identities = 13/28 (46%), Positives = 21/28 (75%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTA 360
           V+FD+  +G P  RI++ LF ++VP+TA
Sbjct: 61  VYFDIQINGSPAGRILIGLFGNIVPKTA 88



>sp|O00845|CYPH_PARPR Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein).>gb:PPINMP_1395604 Paramecium
           primaurelia genes encoding cAMP-dependent protein
           kinase, peptidylprolyl isomerase and NMP kinase.
          Length = 162

 Score =  127 bits (320), Expect(2) = 1e-33
 Identities = 63/95 (66%), Positives = 71/95 (74%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R L TG +G G        YKG +FHR+I  FMAQGGDF+  NGTGG+SIYG KFADENF
Sbjct: 35  RELATGSRGFG--------YKGSVFHRVITDFMAQGGDFTNFNGTGGKSIYGEKFADENF 86

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           KL H++P LLSMAN+GPNTNGSQFFITF   P LD
Sbjct: 87  KLKHTKPALLSMANAGPNTNGSQFFITFVPCPWLD 121



 Score = 38.1 bits (87), Expect(2) = 1e-33
 Identities = 17/30 (56%), Positives = 22/30 (73%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           VFFDV F G   ++IV +L+ DVVP+TA N
Sbjct: 4   VFFDVQFGGDAPKKIVFKLYDDVVPKTAAN 33



>sp|P22011|CYPH_CANAL Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein) (CPH).>pir|JQ0888|CSCK peptidylprolyl
           isomerase (EC 5.2.1.8) - yeast (Candida
           albicans)>gb:YSACYP1_1728102 C.albicans peptidyl-propyl
           cis-trans isomerase (CYP1) gene, complete cds.
          Length = 162

 Score =  127 bits (319), Expect(2) = 1e-33
 Identities = 65/95 (68%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        YKG IFHR+I  FM QGGDF+  NGTGG+SIYG KFADENF
Sbjct: 35  RALCTGEKGFG--------YKGSIFHRVIPQFMLQGGDFTNFNGTGGKSIYGTKFADENF 86

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H  PGLLSMAN+GPNTNGSQFFIT    P LD
Sbjct: 87  VKRHDRPGLLSMANAGPNTNGSQFFITTVPCPWLD 121



 Score = 38.5 bits (88), Expect(2) = 1e-33
 Identities = 17/30 (56%), Positives = 23/30 (76%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           V+FDVS DG  + +I  +L+ DVVP+TAEN
Sbjct: 4   VYFDVSADGQKLGKITFKLYDDVVPKTAEN 33



>gb:AK010649_1155910 Mus musculus ES cells cDNA, RIKEN full-length
           enriched library, clone:2410041G18
           product:peptidylprolyl isomerase A, full insert
           sequence.
          Length = 164

 Score =  122 bits (306), Expect(2) = 1e-33
 Identities = 62/95 (65%), Positives = 68/95 (71%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG SIYG KF DENF
Sbjct: 37  RALSTGEKGFG--------YKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 89  ILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 123



 Score = 43.5 bits (101), Expect(2) = 1e-33
 Identities = 19/33 (57%), Positives = 25/33 (75%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++ +  P+ R+  ELFAD VP+TAEN
Sbjct: 3   NPTVFFDITANEEPLGRVSFELFADKVPKTAEN 35



>gb:BC059741_2552686 Xenopus tropicalis hypothetical protein
           MGC75715, mRNA (cDNA clone MGC:75715 IMAGE:5380778),
           complete cds.
          Length = 164

 Score =  118 bits (295), Expect(2) = 1e-33
 Identities = 60/95 (63%), Positives = 67/95 (70%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCT EKG G        YK   FHRII  FM QGGDF+  NGTGG+SIYG KFADENF
Sbjct: 37  RALCTNEKGFG--------YKNSGFHRIIPEFMCQGGDFTNHNGTGGKSIYGNKFADENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +L H+ PG+LSMAN+G NTNGSQFFI   +   LD
Sbjct: 89  QLRHTGPGILSMANAGANTNGSQFFICTAKTSWLD 123



 Score = 47.8 bits (112), Expect(2) = 1e-33
 Identities = 21/32 (65%), Positives = 27/32 (84%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFD++ DG P+ RI+MEL +DVVP+TAEN
Sbjct: 4   PRVFFDIAVDGCPMGRIIMELRSDVVPKTAEN 35



>gb:BC059470_2552447 Danio rerio peptidylprolyl isomerase A, like,
           mRNA (cDNA clone MGC:73102 IMAGE:4786094), complete
           cds.>gb:BC071370_2556112 Danio rerio peptidylprolyl
           isomerase A, like, mRNA (cDNA clone MGC:86688
           IMAGE:6895545), complete cds.
          Length = 164

 Score =  117 bits (292), Expect(2) = 1e-33
 Identities = 58/86 (67%), Positives = 62/86 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        YKG  FHR+I  FM QGGDF+  NGTGG+SIYG KF DENF
Sbjct: 37  RALCTGEKGFG--------YKGSGFHRVIPQFMCQGGDFTNHNGTGGKSIYGNKFEDENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFI 628
            L H   G LSMAN+GPNTNGSQFFI
Sbjct: 89  TLKHGGKGTLSMANAGPNTNGSQFFI 114



 Score = 48.9 bits (115), Expect(2) = 1e-33
 Identities = 23/33 (69%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++ DG    RIVMEL ADVVP+TAEN
Sbjct: 3   NPKVFFDITIDGKEAGRIVMELRADVVPKTAEN 35



>gb:AY391451_2531587 Danio rerio peptidylprolyl isomerase A (PPIA-1)
           mRNA, complete cds.
          Length = 164

 Score =  117 bits (292), Expect(2) = 1e-33
 Identities = 58/86 (67%), Positives = 62/86 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        YKG  FHR+I  FM QGGDF+  NGTGG+SIYG KF DENF
Sbjct: 37  RALCTGEKGFG--------YKGSGFHRVIPQFMCQGGDFTNHNGTGGKSIYGNKFEDENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFI 628
            L H   G LSMAN+GPNTNGSQFFI
Sbjct: 89  TLKHGGKGTLSMANAGPNTNGSQFFI 114



 Score = 48.9 bits (115), Expect(2) = 1e-33
 Identities = 23/33 (69%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP VFFD++ DG    RIVMEL ADVVP+TAEN
Sbjct: 3   NPKVFFDITIDGKEAGRIVMELRADVVPKTAEN 35



>gb:CR382129_1661735 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 163

 Score =  124 bits (311), Expect(2) = 1e-33
 Identities = 61/95 (64%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGE+G G        Y   IFHR+I  FM QGGDF++ NGTGG+SIYG KF DENF
Sbjct: 36  RALCTGEQGFG--------YANSIFHRVIPQFMLQGGDFTRHNGTGGKSIYGAKFPDENF 87

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +  H+ PGLLSMANSGPNTNGSQFF+T    P LD
Sbjct: 88  EAKHTRPGLLSMANSGPNTNGSQFFVTTVPCPWLD 122



 Score = 41.6 bits (96), Expect(2) = 1e-33
 Identities = 18/30 (60%), Positives = 24/30 (80%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           V+FDVS DG P+ RI  +L+ D+VP+TAEN
Sbjct: 5   VYFDVSADGQPLGRIEFKLYNDIVPKTAEN 34



>gb:AY232025_1177318 Drosophila yakuba clone yak-ad_Cyp1 mRNA
           sequence.
          Length = 152

 Score =  121 bits (303), Expect(2) = 1e-33
 Identities = 60/95 (63%), Positives = 68/95 (71%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        YKG IFHR+I  FM QGGDF+  NGTGG+SIYG KF DENF
Sbjct: 38  RALCTGEKGFG--------YKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENF 89

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +L H+  G+LSMAN+G NTNGSQFFI   +   LD
Sbjct: 90  ELKHTGSGILSMANAGANTNGSQFFICTVKTAWLD 124



 Score = 44.7 bits (104), Expect(2) = 1e-33
 Identities = 20/32 (62%), Positives = 26/32 (81%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFD++ D  P+ RI+MEL +DVVP+TAEN
Sbjct: 5   PRVFFDMTADNEPLGRIIMELRSDVVPKTAEN 36



>gb:AF336984_1787623 Vaucheria litorea cyclophilin mRNA, partial
           cds.
          Length = 145

 Score =  144 bits (363), Expect = 1e-33
 Identities = 69/95 (72%), Positives = 77/95 (81%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG+G S GKPL YKG  FHR+IK FM QGGDF++GNGTGGESIYG KFADENF
Sbjct: 10  RALCTGEKGVGRS-GKPLWYKGSAFHRVIKDFMCQGGDFTRGNGTGGESIYGDKFADENF 68

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GP TNGSQFF+     P LD
Sbjct: 69  SLRHTGPGILSMANAGPGTNGSQFFLCTVPTPWLD 103



>sp|P48820|RBP2_BOVIN Ran-binding protein 2 (RanBP2) (Nuclear pore
            complex protein Nup358) (Nucleoporin Nup358) (358 kDa
            nucleoporin) (P270) (Fragment).>gb:BOVCYC_1435372 Bos
            taurus (clones L6, C15, C12, C8, C9, C17, C19, C12, C18,
            C5, C6, C3, C13, C10, C47) mRNA, 3' end of cds.
          Length = 1085

 Score =  115 bits (289), Expect(2) = 1e-33
 Identities = 57/95 (60%), Positives = 66/95 (69%)
 Frame = +2

Query: 371  RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
            RALCTGEKG G        +K  IFHR+I  F+ QGGD +K +GTGG SIYG KF DENF
Sbjct: 958  RALCTGEKGFG--------FKSSIFHRVIPDFVCQGGDITKHDGTGGRSIYGDKFEDENF 1009

Query: 551  KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
             + H+ PGLLSMAN G +TN SQFFIT K+   LD
Sbjct: 1010 DVKHTGPGLLSMANRGQDTNNSQFFITLKKAERLD 1044



 Score = 49.7 bits (117), Expect(2) = 1e-33
 Identities = 21/36 (58%), Positives = 29/36 (80%)
 Frame = +1

Query: 259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
            K+ NP+VFFD+  D  P+ RI MELF+++VP+TAEN
Sbjct: 921  KETNPVVFFDICADDEPLGRITMELFSNIVPKTAEN 956



>gb:BOVRSC_1435820 Bos taurus (clone C14) retina-specific
           cyclophilin mRNA, complete cds.
          Length = 252

 Score =  115 bits (289), Expect(2) = 1e-33
 Identities = 57/95 (60%), Positives = 66/95 (69%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        +K  IFHR+I  F+ QGGD +K +GTGG SIYG KF DENF
Sbjct: 125 RALCTGEKGFG--------FKSSIFHRVIPDFVCQGGDITKHDGTGGRSIYGDKFEDENF 176

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            + H+ PGLLSMAN G +TN SQFFIT K+   LD
Sbjct: 177 DVKHTGPGLLSMANRGQDTNNSQFFITLKKAERLD 211



 Score = 49.7 bits (117), Expect(2) = 1e-33
 Identities = 21/36 (58%), Positives = 29/36 (80%)
 Frame = +1

Query: 259 KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           K+ NP+VFFD+  D  P+ RI MELF+++VP+TAEN
Sbjct: 88  KETNPVVFFDICADDEPLGRITMELFSNIVPKTAEN 123



>gb:AC137507_1743426 Oryza sativa chromosome 3 BAC OSJNBb0033J23
           genomic sequence, complete sequence.
          Length = 204

 Score =  115 bits (287), Expect(2) = 1e-33
 Identities = 59/95 (62%), Positives = 66/95 (69%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R  CTGE      +G P  YKGC FHR+IK FM QGGD+ KG+GTG  SIYG KF DENF
Sbjct: 70  RQFCTGEHR---KSGLPQGYKGCQFHRVIKDFMIQGGDYMKGDGTGCTSIYGTKFDDENF 126

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H+ PGLLSMANSG N+NGSQFFIT  +   LD
Sbjct: 127 IAKHTGPGLLSMANSGVNSNGSQFFITCAKCEWLD 161



 Score = 50.4 bits (119), Expect(2) = 1e-33
 Identities = 23/34 (67%), Positives = 27/34 (79%)
 Frame = +1

Query: 265 KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           KNP+VFFDV+    P  RI MELFAD+VP+TAEN
Sbjct: 35  KNPVVFFDVTIGSIPAGRIKMELFADIVPKTAEN 68



>gb:MFU011956_1686054 Malassezia sympodialis mRNA for allergen Mal s
           6, strain ATCC no. 42132.
          Length = 162

 Score =  129 bits (323), Expect(2) = 1e-33
 Identities = 62/87 (71%), Positives = 69/87 (79%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        Y G  FHR+I  FM QGGDF+ GNGTGG+SIYG KFADENF
Sbjct: 35  RALCTGEKGFG--------YAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENF 86

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFIT 631
           +L H++PGLLSMAN+GPNTNGSQFFIT
Sbjct: 87  QLKHNKPGLLSMANAGPNTNGSQFFIT 113



 Score = 36.6 bits (83), Expect(2) = 1e-33
 Identities = 16/30 (53%), Positives = 22/30 (73%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           VFFD++ +G P+  I  +LF DVVP+TA N
Sbjct: 4   VFFDITKNGAPLGTIKFKLFDDVVPKTAAN 33



>gb:AL133481_1918609 Human DNA sequence from clone RP11-342M3 on
           chromosome 10 Contains the 3' end of the PPIF gene for
           peptidylprolyl isomerase F (cyclophilin F), gene
           FLJ90798, the EIF5AP1 pseudogene for eukaryotic
           translation initiation factor 5A pseudogene 1, a novel
           gene, a novel pseudogene and a CpG island, complete
           sequence.>gb:AL391665_1926992 Human DNA sequence from
           clone RP11-519K18 on chromosome 10 Contains the 3' end
           of the RAI17 gene for retinoic acid induced 17, the 5'
           end of the PPIF gene for peptidylprolyl isomerase F
           (cyclophilin F) and two CpG islands, complete sequence.
          Length = 164

 Score =  118 bits (296), Expect(2) = 1e-33
 Identities = 57/86 (66%), Positives = 63/86 (73%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        YKG  FHR+I  FM Q GDF+  NGTGG+SIYG +F DENF
Sbjct: 42  RALCTGEKGFG--------YKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENF 93

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFI 628
            L H  PG+LSMAN+GPNTNGSQFFI
Sbjct: 94  TLKHVGPGVLSMANAGPNTNGSQFFI 119



 Score = 47.0 bits (110), Expect(2) = 1e-33
 Identities = 21/33 (63%), Positives = 27/33 (81%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NPLV+ DV  +G P+ R+V+EL ADVVP+TAEN
Sbjct: 8   NPLVYLDVDANGKPLGRVVLELKADVVPKTAEN 40



>gb:SMU30265_1397849 Schistosoma mansoni cyclophylin-like protein
           trans-spliced mRNA, complete cds.
          Length = 273

 Score =  119 bits (297), Expect(2) = 2e-33
 Identities = 60/95 (63%), Positives = 67/95 (70%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGE+G G        Y  C FHR+I  FM QGGDF KG+GTGG+SIYG KF DENF
Sbjct: 145 RALCTGERGFG--------YHNCCFHRVIPQFMCQGGDFVKGDGTGGKSIYGRKFDDENF 196

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +L H   G+LSMANSGPNTNGSQFFI   +   LD
Sbjct: 197 QLRHEGFGVLSMANSGPNTNGSQFFICTTKCDWLD 231



 Score = 46.2 bits (108), Expect(2) = 2e-33
 Identities = 22/39 (56%), Positives = 26/39 (66%)
 Frame = +1

Query: 250 KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           K  K+  P VFFD+    G   RIVMEL +D+VPRTAEN
Sbjct: 105 KKQKRNLPRVFFDIRIGNGDAGRIVMELRSDIVPRTAEN 143



>gb:BC062863_2553452 Danio rerio peptidylprolyl isomerase A
           (cyclophilin A), mRNA (cDNA clone IMAGE:7002384),
           partial cds.
          Length = 184

 Score =  117 bits (294), Expect(2) = 2e-33
 Identities = 57/86 (66%), Positives = 63/86 (73%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R LCTG+ G G        YKG  FHR+I GFM QGGDF+  NGTGG+SIYG KFADENF
Sbjct: 57  RQLCTGQPGYG--------YKGSSFHRVIPGFMCQGGDFTNHNGTGGKSIYGNKFADENF 108

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFI 628
            L H+  G LSMAN+GPNTNGSQFFI
Sbjct: 109 NLKHTGAGCLSMANAGPNTNGSQFFI 134



 Score = 47.0 bits (110), Expect(2) = 2e-33
 Identities = 22/32 (68%), Positives = 25/32 (78%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFD++  G PV R+VMEL  DVVPRTAEN
Sbjct: 24  PKVFFDLTAGGSPVGRVVMELRTDVVPRTAEN 55



>gb:BC064250_2553803 Xenopus tropicalis hypothetical protein
           MGC76244, mRNA (cDNA clone MGC:76244 IMAGE:5378978),
           complete cds.
          Length = 177

 Score =  116 bits (290), Expect(2) = 2e-33
 Identities = 60/95 (63%), Positives = 64/95 (67%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R  CTGE       G P+ YKG  FHR+IK FM QGGDF  G+GTG  SIY G FADENF
Sbjct: 44  RQFCTGEFR---KDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENF 100

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           K  HS PGLLSMANSGP TNG QFFIT  +   LD
Sbjct: 101 KQKHSTPGLLSMANSGPGTNGCQFFITCSKCDWLD 135



 Score = 48.5 bits (114), Expect(2) = 2e-33
 Identities = 21/33 (63%), Positives = 27/33 (81%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           NP+VFFD+S  G  V R+ +ELFAD+VP+TAEN
Sbjct: 10  NPIVFFDISIGGQEVGRMKVELFADIVPKTAEN 42



>gb:AF252388_1893057 Macaca mulatta cyclophilin mRNA, partial cds.
          Length = 158

 Score =  119 bits (298), Expect(2) = 3e-33
 Identities = 59/95 (62%), Positives = 66/95 (69%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        YKG  FHR+I  FM Q GDF+  NGTGG+SIYG +F DENF
Sbjct: 42  RALCTGEKGFG--------YKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENF 93

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H  PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 94  TLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLD 128



 Score = 45.1 bits (105), Expect(2) = 3e-33
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           N LV+ DV  DG P+ R+V+EL ADVVP+TAEN
Sbjct: 8   NLLVYLDVGADGQPLGRVVLELKADVVPKTAEN 40



>gb:CR380956_1652375 Candida glabrata strain CBS138 chromosome J
           complete sequence.
          Length = 371

 Score =  120 bits (302), Expect(2) = 4e-33
 Identities = 60/94 (63%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = +2

Query: 377 LCTGEKGIGDSTGK-PLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFK 553
           LC G+ G+  S    PL YKG IFHR+IK FM Q GDF+  +GTGGESIYG KF DENF+
Sbjct: 39  LCEGKSGMAKSKPDVPLSYKGSIFHRVIKDFMIQFGDFTNFDGTGGESIYGEKFEDENFE 98

Query: 554 LDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           + H +P LLSMAN+GPNTNGSQ FIT    PHLD
Sbjct: 99  IKHDKPFLLSMANAGPNTNGSQAFITCVPTPHLD 132



 Score = 43.1 bits (100), Expect(2) = 4e-33
 Identities = 19/32 (59%), Positives = 23/32 (71%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P  +FD+S  G P  RIV EL+ DVVP+TAEN
Sbjct: 4   PKAYFDISIGGTPKGRIVFELYKDVVPKTAEN 35



>gb:AP003018_1824194 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:OSJNBa0004B13.>gb:AP003020_1824247 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0498A12.>gb:AP003631_1831794 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0581F09.
          Length = 231

 Score =  125 bits (313), Expect(2) = 4e-33
 Identities = 62/95 (65%), Positives = 68/95 (71%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTG+KG G        YKGC FHRIIK FM QGGDF   NGTGG SIYG  F DENF
Sbjct: 99  RALCTGDKGYG--------YKGCSFHRIIKDFMIQGGDFQNNNGTGGRSIYGECFDDENF 150

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GP+TNGSQFFI   + P LD
Sbjct: 151 TLKHTGPGVLSMANAGPDTNGSQFFICTVKTPWLD 185



 Score = 38.9 bits (89), Expect(2) = 4e-33
 Identities = 18/39 (46%), Positives = 24/39 (61%)
 Frame = +1

Query: 250 KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           ++  K N   FFDV   G P  RIV+ LF +VVP+T +N
Sbjct: 59  ELQAKVNSKCFFDVEVGGEPAGRIVIGLFGEVVPKTVDN 97



>gb:CR382137_1670320 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 162

 Score =  124 bits (311), Expect(2) = 4e-33
 Identities = 62/95 (65%), Positives = 68/95 (71%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        Y    FHR+I  FM QGGDF++GNGTGG+SIYG KF DENF
Sbjct: 35  RALCTGEKGFG--------YASSTFHRVIPQFMLQGGDFTRGNGTGGKSIYGEKFRDENF 86

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H +PGLLSMAN+GPNTNGSQFFIT    P LD
Sbjct: 87  VKKHEKPGLLSMANAGPNTNGSQFFITTVTCPWLD 121



 Score = 39.7 bits (91), Expect(2) = 4e-33
 Identities = 16/30 (53%), Positives = 23/30 (76%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           V+FD+S DG  + R+  +L+ DVVP+TAEN
Sbjct: 4   VYFDISADGNKLGRVTFKLYDDVVPKTAEN 33



>gb:SMU50388_1397865 Schistosoma mansoni cyclophilin A mRNA,
           complete cds.
          Length = 172

 Score =  116 bits (291), Expect(2) = 9e-33
 Identities = 59/95 (62%), Positives = 66/95 (69%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGE+G G        Y  C FHR+I  FM QGGDF KG+GTGG+SIYG KF DEN 
Sbjct: 44  RALCTGERGFG--------YHNCCFHRVIPQFMCQGGDFVKGDGTGGKSIYGRKFDDENI 95

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +L H   G+LSMANSGPNTNGSQFFI   +   LD
Sbjct: 96  QLRHEGFGVLSMANSGPNTNGSQFFICTTKCDWLD 130



 Score = 46.2 bits (108), Expect(2) = 9e-33
 Identities = 22/39 (56%), Positives = 26/39 (66%)
 Frame = +1

Query: 250 KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           K  K+  P VFFD+    G   RIVMEL +D+VPRTAEN
Sbjct: 4   KKQKRNLPRVFFDIRIGNGDAGRIVMELRSDIVPRTAEN 42



>gb:AK012491_1156989 Mus musculus 11 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2700065P13
           product:peptidylprolyl isomerase A, full insert
           sequence.
          Length = 167

 Score =  122 bits (306), Expect(2) = 9e-33
 Identities = 62/95 (65%), Positives = 68/95 (71%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG SIYG KF DENF
Sbjct: 40  RALSTGEKGFG--------YKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENF 91

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 92  ILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 126



 Score = 40.4 bits (93), Expect(2) = 9e-33
 Identities = 20/36 (55%), Positives = 25/36 (69%), Gaps = 3/36 (8%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVME---LFADVVPRTAEN 366
           NP VFFD++ D  P+ R+  E   LFAD VP+TAEN
Sbjct: 3   NPTVFFDITADDEPLGRVSFEVGWLFADKVPKTAEN 38



>gb:CR382124_1657059 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 162

 Score =  120 bits (300), Expect(2) = 9e-33
 Identities = 60/95 (63%), Positives = 66/95 (69%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        Y G +FHR+I  FM QGGDF+ G G GG+SIYG KF DENF
Sbjct: 35  RALATGEKGFG--------YAGSVFHRVIPDFMLQGGDFTHGTGVGGKSIYGAKFPDENF 86

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
              H +PGLLSMAN+GPNTNGSQFFIT    P LD
Sbjct: 87  VKKHEKPGLLSMANAGPNTNGSQFFITTVPCPWLD 121



 Score = 42.7 bits (99), Expect(2) = 9e-33
 Identities = 19/30 (63%), Positives = 23/30 (76%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           VFFDV  DG P+ RIV +L+ DVVP+T EN
Sbjct: 4   VFFDVEADGQPLGRIVFQLYNDVVPKTTEN 33



>gb:AP006067_1860854 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0569E11.>gb:AP006174_1861365 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, PAC
           clone:P0229B10.
          Length = 215

 Score =  127 bits (319), Expect(2) = 1e-32
 Identities = 61/95 (64%), Positives = 73/95 (76%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGE+GIG   GK LHYKG  FHRII GFM QGGD  +G+G G ESIYGG F DENF
Sbjct: 71  RALCTGEEGIGHK-GKSLHYKGSRFHRIIPGFMIQGGDIVRGDGKGSESIYGGTFPDENF 129

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            + H+ PG+++MANSGP++NGSQF+IT  +   LD
Sbjct: 130 IVKHTHPGVIAMANSGPDSNGSQFYITTIKTSWLD 164



 Score = 34.7 bits (78), Expect(2) = 1e-32
 Identities = 15/30 (50%), Positives = 20/30 (66%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           V+ DV  DG  + RIV+ L+ DVVP+T  N
Sbjct: 40  VYLDVEIDGQHIGRIVIGLYGDVVPKTVAN 69



>gb:AP006618_560249 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 197

 Score =  120 bits (301), Expect(2) = 1e-32
 Identities = 59/95 (62%), Positives = 68/95 (71%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGE+G G        Y+G   HR+I GFMAQGGDF+ G+GTGG SIYG  FADENF
Sbjct: 70  RALATGEQGFG--------YRGSTLHRVIPGFMAQGGDFTHGDGTGGHSIYGPVFADENF 121

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +L H+ PG++SMAN GP TNGSQFFIT    P LD
Sbjct: 122 QLPHAGPGVVSMANRGPGTNGSQFFITLDATPWLD 156



 Score = 41.6 bits (96), Expect(2) = 1e-32
 Identities = 18/32 (56%), Positives = 24/32 (75%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P V+ D++  G P  R+V+EL +DVVPRTAEN
Sbjct: 37  PRVYLDLTIGGAPAGRVVIELRSDVVPRTAEN 68



>gb:CR382122_1654998 Kluyveromyces lactis strain NRRL Y-1140
           chromosome B of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 192

 Score =  122 bits (305), Expect(2) = 1e-32
 Identities = 63/95 (66%), Positives = 68/95 (71%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        YKG  FHRII  FM QGGD    NG GG+SIYG KFADENF
Sbjct: 63  RALCTGEKGFG--------YKGVPFHRIIPNFMLQGGDTDLTNGYGGKSIYGNKFADENF 114

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +  H++PGLLSMAN+GPNTNGSQFFIT    P LD
Sbjct: 115 QEKHTKPGLLSMANAGPNTNGSQFFITTVPCPWLD 149



 Score = 40.0 bits (92), Expect(2) = 1e-32
 Identities = 17/30 (56%), Positives = 22/30 (73%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           VFFD S +G  + RI  EL+ D+VP+TAEN
Sbjct: 32  VFFDTSINGNKMDRIEFELYDDIVPKTAEN 61



>pir|JT0686|JT0686 peptidylprolyl isomerase (EC 5.2.1.8) a,
           cytosolic - fungus  (Fusarium sporotrichioides)
          Length = 179

 Score =  134 bits (338), Expect(2) = 2e-32
 Identities = 64/87 (73%), Positives = 72/87 (82%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           +ALCTGEKG G        YKG  FHRII  FM QGGDF++GNGTGG+SIYG KFADENF
Sbjct: 48  KALCTGEKGFG--------YKGSSFHRIIPDFMLQGGDFTRGNGTGGKSIYGEKFADENF 99

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFIT 631
           KL+HS+PGLLSMAN+GPNTNGSQFF+T
Sbjct: 100 KLEHSKPGLLSMANAGPNTNGSQFFVT 126



 Score = 26.9 bits (58), Expect(2) = 2e-32
 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 13/43 (30%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQ-------------RIVMELFADVVPRTAEN 366
           VFFD++++G   Q             RI   LF + VP+TAEN
Sbjct: 4   VFFDITWEGPVFQNGKPTSTVKEQSGRINFNLFNEQVPKTAEN 46



>gb:AE017346_1757189 Cryptococcus neoformans var. neoformans JEC21
           chromosome 6, complete sequence.
          Length = 375

 Score =  124 bits (310), Expect(2) = 2e-32
 Identities = 61/93 (65%), Positives = 69/93 (74%)
 Frame = +2

Query: 377 LCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKL 556
           LC G+K   +  G  L Y G  FHR IKGFM QGGDF++G+GTGGESIYG KF DENF+L
Sbjct: 39  LCIGDKT--NEAGVKLAYAGSSFHRCIKGFMLQGGDFTRGDGTGGESIYGEKFEDENFEL 96

Query: 557 DHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            H +P LLSMAN+GP TNGSQFFIT    PHLD
Sbjct: 97  KHDKPMLLSMANAGPGTNGSQFFITTVPTPHLD 129



 Score = 37.4 bits (85), Expect(2) = 2e-32
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           N + +FD++    P  R+  ELF DVVP+TA N
Sbjct: 3   NTIAYFDITIANEPAGRLTFELFDDVVPKTANN 35



>gb:AY086899_1571939 Arabidopsis thaliana clone 29220 mRNA, complete
           sequence.
          Length = 260

 Score =  124 bits (312), Expect(2) = 2e-32
 Identities = 63/95 (66%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEK  G        YKG  FHRIIK FM QGGDF++GNGTGG SIYG KF DENF
Sbjct: 128 RALCTGEKKYG--------YKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENF 179

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 180 TLKHTGPGILSMANAGPNTNGSQFFICTVKTSWLD 214



 Score = 36.6 bits (83), Expect(2) = 2e-32
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           V+FDV   G    RIVM LF +VVP+T EN
Sbjct: 97  VYFDVEIGGEVAGRIVMGLFGEVVPKTVEN 126



>sp|P34791|CYP4_ARATH Peptidyl-prolyl cis-trans isomerase,
           chloroplast precursor (EC 5.2.1.8) (PPIase) (Rotamase)
           (Cyclophilin) (Cyclosporin A-binding
           protein).>pir|B53422|B53422 peptidylprolyl isomerase (EC
           5.2.1.8) ROC4 - Arabidopsis thaliana>gb:ATF21F14_1549612
           Arabidopsis thaliana DNA chromosome 3, BAC clone
           F21F14.>gb:ATHROC4ARA_1553358 Arabidopsis thaliana
           nuclear-encoded chloroplast stromal cyclophilin (ROC4)
           mRNA, complete cds.>gb:ATU42724_1556989 Arabidopsis
           thaliana cyclophilin (ROC4) gene, nuclear gene encoding
           chloroplast protein, complete cds.>gb:AY059843_1564687
           Arabidopsis thaliana peptidylprolyl isomerase ROC4
           (At3g62030; F21F14.200) mRNA, complete
           cds.>gb:AY093284_1575238 Arabidopsis thaliana
           peptidylprolyl isomerase ROC4 (At3g62030) mRNA, complete
           cds.
          Length = 260

 Score =  124 bits (312), Expect(2) = 2e-32
 Identities = 63/95 (66%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEK  G        YKG  FHRIIK FM QGGDF++GNGTGG SIYG KF DENF
Sbjct: 128 RALCTGEKKYG--------YKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENF 179

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 180 TLKHTGPGILSMANAGPNTNGSQFFICTVKTSWLD 214



 Score = 36.6 bits (83), Expect(2) = 2e-32
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           V+FDV   G    RIVM LF +VVP+T EN
Sbjct: 97  VYFDVEIGGEVAGRIVMGLFGEVVPKTVEN 126



>gb:AC084818_1733850 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0668H12, complete sequence.
          Length = 250

 Score =  130 bits (327), Expect(2) = 2e-32
 Identities = 64/95 (67%), Positives = 71/95 (74%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        YKG  FHR+IK FM QGGDF KGNGTGG+SIYG  F DENF
Sbjct: 119 RALCTGEKGFG--------YKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF 170

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           KL H+ PG++SMAN+GPNTNGSQFFI   + P LD
Sbjct: 171 KLVHTGPGVVSMANAGPNTNGSQFFICTVKTPWLD 205



 Score = 30.8 bits (68), Expect(2) = 2e-32
 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 3/33 (9%)
 Frame = +1

Query: 277 VFFDVSFD---GGPVQRIVMELFADVVPRTAEN 366
           V+FD+S     G  V R+V+ L+ D VP+TAEN
Sbjct: 85  VYFDISIGNPVGKNVGRVVIGLYGDDVPQTAEN 117



>gb:AF293848_1783878 Pyricularia grisea cyclophilin (CYP1) gene,
           complete cds; nuclear gene encoding mitochondrial and
           cytosolic products.
          Length = 215

 Score =  124 bits (310), Expect(2) = 3e-32
 Identities = 60/95 (63%), Positives = 70/95 (73%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R LC GE G+G        YK   FHRII  FM QGGDF++GNGTGG+S+YG KFADENF
Sbjct: 86  RRLCVGEPGVGG-------YKDSGFHRIIPDFMLQGGDFTRGNGTGGKSVYGEKFADENF 138

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           ++ H+ PGLLSMAN+GPNTNGSQFFIT  +   LD
Sbjct: 139 QIKHTRPGLLSMANAGPNTNGSQFFITTVKTSWLD 173



 Score = 37.4 bits (85), Expect(2) = 3e-32
 Identities = 17/32 (53%), Positives = 25/32 (78%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFD+SF+G   +R+  +L+ DVVP+TA+N
Sbjct: 54  PNVFFDISFNG-VTKRVEFKLYDDVVPKTADN 84



>gb:BC068613_2555121 Xenopus laevis hypothetical protein LOC398630,
           mRNA (cDNA clone IMAGE:3400465), partial cds.
          Length = 192

 Score =  113 bits (282), Expect(2) = 3e-32
 Identities = 57/95 (60%), Positives = 66/95 (69%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCT +KG G        ++   FHRII  FM QGGDF+  NGTGG+SIYG KFADENF
Sbjct: 65  RALCTHDKGFG--------FRNSGFHRIIPEFMCQGGDFTNHNGTGGKSIYGNKFADENF 116

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+G NTNGSQFFI   +   LD
Sbjct: 117 TLKHTGPGILSMANAGANTNGSQFFICTAKTSWLD 151



 Score = 48.1 bits (113), Expect(2) = 3e-32
 Identities = 23/32 (71%), Positives = 27/32 (84%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFDV+ DG P+ RIVMEL +DVVP+TAEN
Sbjct: 32  PRVFFDVAADGCPLGRIVMELRSDVVPKTAEN 63



>gb:BC054186_2550840 Xenopus laevis hypothetical protein LOC398630,
           mRNA (cDNA clone IMAGE:6876259), partial cds.
          Length = 193

 Score =  113 bits (282), Expect(2) = 3e-32
 Identities = 57/95 (60%), Positives = 66/95 (69%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCT +KG G        ++   FHRII  FM QGGDF+  NGTGG+SIYG KFADENF
Sbjct: 66  RALCTHDKGFG--------FRNSGFHRIIPEFMCQGGDFTNHNGTGGKSIYGNKFADENF 117

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+G NTNGSQFFI   +   LD
Sbjct: 118 TLKHTGPGILSMANAGANTNGSQFFICTAKTSWLD 152



 Score = 48.1 bits (113), Expect(2) = 3e-32
 Identities = 23/32 (71%), Positives = 27/32 (84%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFDV+ DG P+ RIVMEL +DVVP+TAEN
Sbjct: 33  PRVFFDVAADGCPLGRIVMELRSDVVPKTAEN 64



>gb:CR382129_1661726 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 176

 Score =  125 bits (314), Expect(2) = 3e-32
 Identities = 62/95 (65%), Positives = 68/95 (71%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        Y G  FHR+I  FM QGGDF+  NGTGG+SIYG KF DENF
Sbjct: 49  RALCTGEKGFG--------YAGSSFHRVIPNFMLQGGDFTNHNGTGGKSIYGQKFPDENF 100

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            + H+ PGLLSMAN+GPNTNGSQFFIT    P LD
Sbjct: 101 NVKHTRPGLLSMANAGPNTNGSQFFITTVDTPWLD 135



 Score = 35.8 bits (81), Expect(2) = 3e-32
 Identities = 15/30 (50%), Positives = 23/30 (76%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           V+F+VS +G P+ +I  +L+ D VP+TAEN
Sbjct: 18  VYFNVSANGNPLGKISFKLYKDQVPKTAEN 47



>gb:AB062457_1522124 Magnaporthe grisea CYP1 mRNA for cyclophilin,
           complete cds.>gb:AB062672_1522144 Magnaporthe grisea
           CYP1 gene for cyclophilin, complete
           cds.>gb:AF293848_1783879 Pyricularia grisea cyclophilin
           (CYP1) gene, complete cds; nuclear gene encoding
           mitochondrial and cytosolic products.
          Length = 165

 Score =  124 bits (310), Expect(2) = 3e-32
 Identities = 60/95 (63%), Positives = 70/95 (73%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R LC GE G+G        YK   FHRII  FM QGGDF++GNGTGG+S+YG KFADENF
Sbjct: 36  RRLCVGEPGVGG-------YKDSGFHRIIPDFMLQGGDFTRGNGTGGKSVYGEKFADENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           ++ H+ PGLLSMAN+GPNTNGSQFFIT  +   LD
Sbjct: 89  QIKHTRPGLLSMANAGPNTNGSQFFITTVKTSWLD 123



 Score = 37.4 bits (85), Expect(2) = 3e-32
 Identities = 17/32 (53%), Positives = 25/32 (78%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFD+SF+G   +R+  +L+ DVVP+TA+N
Sbjct: 4   PNVFFDISFNG-VTKRVEFKLYDDVVPKTADN 34



>gb:AY646834_2541524 Xenopus laevis cyclophilin A (CypA) mRNA,
           complete cds.
          Length = 164

 Score =  113 bits (282), Expect(2) = 3e-32
 Identities = 57/95 (60%), Positives = 66/95 (69%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCT +KG G        ++   FHRII  FM QGGDF+  NGTGG+SIYG KFADENF
Sbjct: 37  RALCTHDKGFG--------FRNSGFHRIIPEFMCQGGDFTNHNGTGGKSIYGNKFADENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+G NTNGSQFFI   +   LD
Sbjct: 89  TLKHTGPGILSMANAGANTNGSQFFICTAKTSWLD 123



 Score = 48.1 bits (113), Expect(2) = 3e-32
 Identities = 23/32 (71%), Positives = 27/32 (84%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFDV+ DG P+ RIVMEL +DVVP+TAEN
Sbjct: 4   PRVFFDVAADGCPLGRIVMELRSDVVPKTAEN 35



>gb:AE016817_1747471 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 369

 Score =  122 bits (305), Expect(2) = 3e-32
 Identities = 60/94 (63%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = +2

Query: 377 LCTGEKG-IGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFK 553
           LC G+ G      G PL Y+G +FHR+IKGFM Q GDF+ G+GTGGESIYG KF DENF 
Sbjct: 40  LCAGDAGECRTKPGVPLCYQGSLFHRVIKGFMCQFGDFTNGDGTGGESIYGEKFEDENFA 99

Query: 554 LDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
             H  P LLSMAN+GPNTNGSQ FIT    PHLD
Sbjct: 100 RKHDRPFLLSMANAGPNTNGSQCFITCAPTPHLD 133



 Score = 38.9 bits (89), Expect(2) = 3e-32
 Identities = 15/29 (51%), Positives = 22/29 (75%)
 Frame = +1

Query: 280 FFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +FD+S  G P  R+V E+++DV P+TAEN
Sbjct: 8   YFDLSIGGKPAGRVVFEVYSDVTPKTAEN 36



>sp|P53691|CYP6_YEAST Peptidyl-prolyl cis-trans isomerase CPR6 (EC
           5.2.1.8) (PPIase) (Rotamase).>pir|S48567|S48567
           cyclophilin-like protein CPR6 - yeast (Saccharomyces
           cerevisiae)>gb:SCU48867_1710441 Saccharomyces cerevisiae
           cyclophilin (CPR6) mRNA, complete
           cds.>gb:YSCH8167_1729052 Saccharomyces cerevisiae
           chromosome XII cosmid 8167.
          Length = 371

 Score =  117 bits (293), Expect(2) = 3e-32
 Identities = 59/94 (62%), Positives = 66/94 (70%), Gaps = 1/94 (1%)
 Frame = +2

Query: 377 LCTGEKGIGDSTGK-PLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFK 553
           LC G  G+  +    PL YKG IFHR+IK FM Q GDF+  NGTGGESIY  KF DENF 
Sbjct: 39  LCEGNAGMAKTKPDVPLSYKGSIFHRVIKDFMCQFGDFTNFNGTGGESIYDEKFEDENFT 98

Query: 554 LDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           + H +P LLSMAN+GPNTNGSQ FIT    PHLD
Sbjct: 99  VKHDKPFLLSMANAGPNTNGSQAFITCVPTPHLD 132



 Score = 43.5 bits (101), Expect(2) = 3e-32
 Identities = 19/32 (59%), Positives = 23/32 (71%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P  FFD+S  G P  RIV EL+ D+VP+TAEN
Sbjct: 4   PKTFFDISIGGKPQGRIVFELYNDIVPKTAEN 35



>gb:AF243140_1416671 Canis familiaris cyclophilin A mRNA, partial
           cds.
          Length = 156

 Score =  122 bits (307), Expect(2) = 3e-32
 Identities = 62/95 (65%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        YKG  FHRII GFM QGGDF++ NGTGG+SIYG KF DENF
Sbjct: 29  RALSTGEKGFG--------YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFDDENF 80

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGSQFFI   +   LD
Sbjct: 81  ILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD 115



 Score = 38.1 bits (87), Expect(2) = 3e-32
 Identities = 16/27 (59%), Positives = 21/27 (77%)
 Frame = +1

Query: 286 DVSFDGGPVQRIVMELFADVVPRTAEN 366
           D++ DG P+ R+  ELFAD VP+TAEN
Sbjct: 1   DIAVDGEPLGRVSFELFADKVPKTAEN 27



>gb:AY557959_1614186 Saccharomyces cerevisiae clone FLH004814.01X
           YLR216C gene, complete cds.
          Length = 371

 Score =  117 bits (293), Expect(2) = 4e-32
 Identities = 59/94 (62%), Positives = 66/94 (70%), Gaps = 1/94 (1%)
 Frame = +2

Query: 377 LCTGEKGIGDSTGK-PLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFK 553
           LC G  G+  +    PL YKG IFHR+IK FM Q GDF+  NGTGGESIY  KF DENF 
Sbjct: 39  LCEGNAGMAKTKPDVPLSYKGSIFHRVIKDFMCQFGDFTNFNGTGGESIYDEKFEDENFT 98

Query: 554 LDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           + H +P LLSMAN+GPNTNGSQ FIT    PHLD
Sbjct: 99  VKHDKPFLLSMANAGPNTNGSQAFITCVPTPHLD 132



 Score = 43.1 bits (100), Expect(2) = 4e-32
 Identities = 19/32 (59%), Positives = 23/32 (71%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P  FFD+S  G P  RIV EL+ D+VP+TAEN
Sbjct: 4   PKTFFDISVGGKPQGRIVFELYNDIVPKTAEN 35



>sp|Q9V3G3|PPIE_DROME Peptidyl-prolyl cis-trans isomerase E (EC
           5.2.1.8) (PPIase E) (Rotamase E) (Cyclophilin E)
           (Cyclophilin 33).>gb:AE013599_1132442 Drosophila
           melanogaster chromosome 2R, complete
           sequence.>gb:AE003803_1225312 Drosophila melanogaster
           chromosome 2R, section 47 of 74 of the complete
           sequence.>gb:AF182826_1248508 Drosophila melanogaster
           cyclophilin-33 (cyp33) mRNA, complete
           cds.>gb:AY061421_1293224 Drosophila melanogaster LD35248
           full length cDNA.
          Length = 300

 Score =  114 bits (285), Expect(2) = 4e-32
 Identities = 58/95 (61%), Positives = 64/95 (67%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R LCT E+G G        YKGC FHR+I  FM QGGDF+  NGTGG+SIYG KF DENF
Sbjct: 172 RQLCTHEQGYG--------YKGCSFHRVIPEFMCQGGDFTNNNGTGGKSIYGKKFNDENF 223

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+  G LSMANSG NTNGSQFFI   +   LD
Sbjct: 224 NLKHNSFGTLSMANSGANTNGSQFFICTTKTDWLD 258



 Score = 46.2 bits (108), Expect(2) = 4e-32
 Identities = 22/36 (61%), Positives = 26/36 (72%)
 Frame = +1

Query: 259 KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +K+NP VFFD+   G    RIVM L ADVVP+TAEN
Sbjct: 135 EKRNPQVFFDIRIGGNDAGRIVMLLRADVVPKTAEN 170



>gb:SCMCLCLPHN_1397186 Schistosoma japonicum (blood fluke)
           cyclophilin mRNA, 3' end.
          Length = 179

 Score =  117 bits (294), Expect(2) = 4e-32
 Identities = 59/95 (62%), Positives = 67/95 (70%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTG++G G        Y  C FHR+I  FM QGGDF KG+GTGG+SIYG KF DENF
Sbjct: 51  RALCTGDRGFG--------YHNCCFHRVIPQFMCQGGDFVKGDGTGGKSIYGRKFDDENF 102

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +L H   G+LSMANSGPNTNGSQFFI   +   LD
Sbjct: 103 QLRHEGFGVLSMANSGPNTNGSQFFICTTKCDWLD 137



 Score = 42.7 bits (99), Expect(2) = 4e-32
 Identities = 21/39 (53%), Positives = 25/39 (64%)
 Frame = +1

Query: 250 KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           K  K+  P VFFD+        RIVMEL +D+VPRTAEN
Sbjct: 11  KKQKRNLPRVFFDIRIGNADRGRIVMELRSDIVPRTAEN 49



>sp|Q06118|PPIA_STRCH Peptidyl-prolyl cis-trans isomerase A (EC
           5.2.1.8) (PPIase A) (Rotamase A) (Cyclophilin ScCypA)
           (Cyclophilin homolog).>pir|S28020|S28020 peptidylprolyl
           isomerase (EC 5.2.1.8) - Streptomyces
           chrysomallus>gb:SCCYCLOA_173123 Streptomyces
           chrysomallus orfA, estA, cypA genes.
          Length = 165

 Score =  120 bits (300), Expect(2) = 4e-32
 Identities = 61/95 (64%), Positives = 68/95 (71%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RAL TGEKG G        Y G  FHR+I  FM QGGDF++G+GTGG+SIYG KFADENF
Sbjct: 36  RALATGEKGFG--------YAGSSFHRVITDFMLQGGDFTRGDGTGGKSIYGEKFADENF 87

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +L H   GLLSMAN+G NTNGSQFFIT    P LD
Sbjct: 88  QLKHDRVGLLSMANAGKNTNGSQFFITTVLTPWLD 122



 Score = 40.4 bits (93), Expect(2) = 4e-32
 Identities = 17/30 (56%), Positives = 21/30 (70%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           V+FD++ D  P  RI   LF DVVP+TAEN
Sbjct: 5   VYFDITIDDAPAGRITFNLFDDVVPKTAEN 34



>gb:AY217753_1590150 Triticum aestivum cyclophilin-like protein
           (CYP20-2) mRNA, complete cds.
          Length = 245

 Score =  130 bits (326), Expect(2) = 6e-32
 Identities = 64/95 (67%), Positives = 71/95 (74%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        YKG  FHR+IK FM QGGDF KGNGTGG+SIYG  F DENF
Sbjct: 114 RALCTGEKGFG--------YKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF 165

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +L H+ PG+LSMAN+GPNTNGSQFFI   + P LD
Sbjct: 166 QLVHTGPGVLSMANAGPNTNGSQFFICTVKTPWLD 200



 Score = 30.0 bits (66), Expect(2) = 6e-32
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 3/42 (7%)
 Frame = +1

Query: 250 KVMKKKNPLVFFDVSFD---GGPVQRIVMELFADVVPRTAEN 366
           ++  K    V+FD+S     G  V RIV+ L+ D VP+T EN
Sbjct: 71  ELQSKVTNKVYFDISIGNPVGKNVGRIVIGLYGDDVPQTVEN 112



>gb:SCO939131_181176 Streptomyces coelicolor A3(2) complete genome;
           segment 28/29.
          Length = 165

 Score =  119 bits (299), Expect(2) = 6e-32
 Identities = 60/93 (64%), Positives = 67/93 (72%)
 Frame = +2

Query: 377 LCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKL 556
           L TGE G G        Y G  FHR+I  FM QGGDF+ GNGTGG+SIYG KFADENF+L
Sbjct: 39  LATGEHGFG--------YAGSPFHRVIPQFMLQGGDFTNGNGTGGKSIYGEKFADENFQL 90

Query: 557 DHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            H+EP LLSMAN+GPNTNGSQFF+T    P LD
Sbjct: 91  KHTEPYLLSMANAGPNTNGSQFFVTTVPTPWLD 123



 Score = 40.4 bits (93), Expect(2) = 6e-32
 Identities = 18/33 (54%), Positives = 21/33 (63%)
 Frame = +1

Query: 268 NPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           N  V+FD+  DG    RIV ELF DV P+TA N
Sbjct: 3   NSKVYFDIDIDGQDAGRIVFELFEDVTPKTARN 35



>gb:BC041536_2547984 Xenopus laevis CYcloPhilin (18.4 kD) (cyp-7),
           mRNA (cDNA clone MGC:53254 IMAGE:5543670), complete cds.
          Length = 164

 Score =  116 bits (291), Expect(2) = 6e-32
 Identities = 60/95 (63%), Positives = 66/95 (69%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCT EKG G        YK   FHRII  FM QGGDF+  NGTGG+SIYG KFADENF
Sbjct: 37  RALCTHEKGYG--------YKNSGFHRIIPSFMCQGGDFTNHNGTGGKSIYGEKFADENF 88

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+G NTNGSQFFI   +   LD
Sbjct: 89  TLKHTGPGILSMANAGSNTNGSQFFICTAKTSWLD 123



 Score = 43.5 bits (101), Expect(2) = 6e-32
 Identities = 20/32 (62%), Positives = 26/32 (81%)
 Frame = +1

Query: 271 PLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           P VFFD++ +  P+ RI+MEL +DVVPRTAEN
Sbjct: 4   PRVFFDIAANECPMGRIIMELRSDVVPRTAEN 35



>gb:AF325026_1786480 Arabidopsis thaliana AT3g62030
           (AT3g62030/F21F14_200) mRNA, complete cds.
          Length = 260

 Score =  123 bits (308), Expect(2) = 7e-32
 Identities = 62/95 (65%), Positives = 69/95 (72%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEK  G        YKG  FHRIIK FM QGGDF++GNGTGG SIYG KF DENF
Sbjct: 128 RALCTGEKKYG--------YKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENF 179

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
            L H+ PG+LSMAN+GPNTNGS+FFI   +   LD
Sbjct: 180 TLKHTGPGILSMANAGPNTNGSKFFICTVKTSWLD 214



 Score = 36.6 bits (83), Expect(2) = 7e-32
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           V+FDV   G    RIVM LF +VVP+T EN
Sbjct: 97  VYFDVEIGGEVAGRIVMGLFGEVVPKTVEN 126



>sp|P52018|CYPB_CAEEL Peptidyl-prolyl cis-trans isomerase 11 (EC
           5.2.1.8) (PPIase) (Rotamase)
           (Cyclophilin-11).>pir|T18578|T18578 peptidylprolyl
           isomerase (EC 5.2.1.8) cyp-11 [similarity] -
           Caenorhabditis elegans>gb:CET01B7_1366944 Caenorhabditis
           elegans cosmid T01B7, complete
           sequence.>gb:CEU34955_1368513 Caenorhabditis elegans
           cyclophilin isoform 11 (cyp-11) mRNA, complete cds.
          Length = 183

 Score =  111 bits (278), Expect(2) = 7e-32
 Identities = 56/95 (58%), Positives = 63/95 (66%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           R  CTGE       G P  YK C FHR+IK FM QGGDF  G+GTG  SIYG KF DENF
Sbjct: 50  RQFCTGEY---KKDGVPNGYKNCTFHRVIKDFMIQGGDFCNGDGTGLMSIYGSKFRDENF 106

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD 655
           +L H  PG+LSMAN+G +TNG QFFIT  +   LD
Sbjct: 107 ELKHIGPGMLSMANAGSDTNGCQFFITCAKTDFLD 141



 Score = 48.1 bits (113), Expect(2) = 7e-32
 Identities = 23/48 (47%), Positives = 31/48 (64%)
 Frame = +1

Query: 223 VTPVGLFEWKVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAEN 366
           +T    F  ++    NP+VF +V+  G P+  IV+ELFADV PRTAEN
Sbjct: 1   MTEYDKFAEQLRHPDNPIVFLEVTAGGAPIGTIVIELFADVTPRTAEN 48



>pir|S51497|S51497 peptidylprolyl isomerase (EC 5.2.1.8) A -
           cyclosporin fungus
          Length = 180

 Score =  129 bits (324), Expect(2) = 7e-32
 Identities = 62/87 (71%), Positives = 69/87 (79%)
 Frame = +2

Query: 371 RALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENF 550
           RALCTGEKG G        Y+G  FHRII  FM QGGDF++GNGTGG+SIYG KFADENF
Sbjct: 49  RALCTGEKGFG--------YEGSSFHRIIPEFMLQGGDFTRGNGTGGKSIYGEKFADENF 100

Query: 551 KLDHSEPGLLSMANSGPNTNGSQFFIT 631
           +L H  PGLLSMAN+GPNTNGSQFF+T
Sbjct: 101 QLKHDRPGLLSMANAGPNTNGSQFFVT 127



 Score = 30.4 bits (67), Expect(2) = 7e-32
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 13/43 (30%)
 Frame = +1

Query: 277 VFFDVSFDGGPVQ-------------RIVMELFADVVPRTAEN 366
           VFFD+ ++G  +Q             RI  +L+ DVVP+TAEN
Sbjct: 5   VFFDIEWEGPVMQGCKPTSTVKEQSGRINFKLYDDVVPKTAEN 47


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 703,347,699
Number of Sequences: 1806583
Number of extensions: 14509583
Number of successful extensions: 36463
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 33896
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 35668
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 35782545470
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)