BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig1870
         (672 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AX078761_1460706 Sequence 2 from Patent WO0105951.>gb:AB02563...    50   4e-05   
gb:AE017180_399057 Geobacter sulfurreducens PCA, complete genome.      35   1.5     
gb:CR382130_1663428 Yarrowia lipolytica chromosome D of strain C...    33   3.4     
pir|A33626|A33626 fibrinogen alpha chain - sea lamprey (fragment)      33   4.5     Petromyzon marinus [marine lamprey]
sp|Q02629|N100_YEAST|N100_YEAST Nucleoporin NUP100/NSP100 (Nuclear pore pro...    33   4.5     Saccharomyces cerevisiae [brewer's yeast]
sp|P02674|FIB1_PETMA|FIB1_PETMA Fibrinogen alpha-1 chain precursor [Contain...    33   4.5     Petromyzon marinus [marine lamprey]
gb:CR382135_1667874 Debaryomyces hansenii chromosome C of strain...    33   5.9     
gb:BX248340_759188 Mycobacterium bovis subsp. bovis AF2122/97 co...    33   5.9     
gb:AE000516_21897 Mycobacterium tuberculosis CDC1551, complete g...    33   5.9     
pir|D70931|D70931 hypothetical glycine-rich protein Rv1803c - My...    33   5.9     Mycobacterium tuberculosis


>gb:AX078761_1460706 Sequence 2 from Patent
           WO0105951.>gb:AB025633_1516593 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1
           clone:MQM1.>gb:BT002944_1636531 Arabidopsis thaliana
           clone RAFL14-93-K05 (R20243) unknown protein (At5g23570)
           mRNA, complete cds.>gb:BT004380_1637452 Arabidopsis
           thaliana clone U20243 unknown protein (At5g23570) mRNA,
           complete cds.>gb:AF239719_1779893 Arabidopsis thaliana
           SGS3 gene, complete cds.
          Length = 625

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 39/136 (28%), Positives = 52/136 (38%), Gaps = 17/136 (12%)
 Frame = +1

Query: 172 STKGGKQASGSSTYPSVPDMTVHSAQGDG--WEVYGKKSKNKAGTSGGRQYVPQNSAAVS 345
           + +GG +         +    + S+Q DG  WEV  KK+KNK G + G+ +V QNS   +
Sbjct: 13  NVQGGYRPEVEQLVQGLAGTRLASSQDDGGEWEVISKKNKNKPGNTSGKTWVSQNS---N 69

Query: 346 TGNAWGS---------SGH----KAWNNXXXXXXXXXXXXXXXXXXXXXDN--ARFPPAI 480
              AWG          SG         N                     DN     PP  
Sbjct: 70  PPRAWGGQQQGRGSNVSGRGNNVSGRGNGNGRGIQANISGRGRALSRKYDNNFVAPPPVS 129

Query: 481 PPPLQHGWNWSSRVAS 528
            PPL+ GWNW +R  S
Sbjct: 130 RPPLEGGWNWQARGGS 145



>gb:AE017180_399057 Geobacter sulfurreducens PCA, complete genome.
          Length = 2192

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 27/97 (27%), Positives = 42/97 (43%), Gaps = 15/97 (15%)
 Frame = +1

Query: 145  LLCNCLMMSSTK---GGKQASGSSTYPSVPDMTV--HSAQGDGWEVYGKK---------- 279
            +L NC   ++     GG   +G+ + P++ + T   ++A   G  +Y             
Sbjct: 1331 VLTNCTFSNNLSYGYGGGMVNGALSNPTLTNCTFSGNAANISGGGMYNTHGNPSVKNCTF 1390

Query: 280  SKNKAGTSGGRQYVPQNSAAVSTGNAWGSSGHKAWNN 390
            S N AGTSGG  Y   NS  V     WG+S  +  +N
Sbjct: 1391 SGNSAGTSGGGMYNANNSPVVRNSIFWGNSNGEISDN 1427



>gb:CR382130_1663428 Yarrowia lipolytica chromosome D of strain CLIB99
            of Yarrowia lipolytica.
          Length = 1287

 Score = 33.5 bits (75), Expect = 3.4
 Identities = 23/67 (34%), Positives = 33/67 (49%)
 Frame = +2

Query: 311  DSMFPKTLLLFPLAMHGEVQVIKPGIMVGQEGVLSAVQILEDLQVEVEIMQGFLPQFHLL 490
            D++F  T +  P      V+++K G    ++GVLS   I E  Q  VEI     P F +L
Sbjct: 873  DAIFSLTWIARPA-----VKIVKAGNTEAKDGVLSRAPICEGDQDSVEIALEGSPPFTVL 927

Query: 491  YNMDGIG 511
            Y + G G
Sbjct: 928  YRVTGPG 934



>pir|A33626|A33626 fibrinogen alpha chain - sea lamprey (fragment)
          Length = 966

 Score = 33.1 bits (74), Expect = 4.5
 Identities = 20/70 (28%), Positives = 28/70 (40%), Gaps = 3/70 (4%)
 Frame = +1

Query: 172 STKGGKQASGSSTYPSVPDMTVHSAQGDGWEVYGKKSKNKAGTSGGRQYV---PQNSAAV 342
           S KGG   +G  T P+       SAQG  W   G+   N     GG        + +   
Sbjct: 574 SAKGGSWGTGGRTEPNTG-----SAQGGSWGTGGRTEPNTGSAQGGSWGTGGRTEPNTGS 628

Query: 343 STGNAWGSSG 372
           + G +WG+ G
Sbjct: 629 AQGGSWGTGG 638



>sp|Q02629|N100_YEAST Nucleoporin NUP100/NSP100 (Nuclear pore
           protein NUP100/NSP100).>pir|B44402|B44402 nuclear pore
           complex protein NUP100 - yeast (Saccharomyces
           cerevisiae)>gb:SCNUP100_1708881 S.cerevisiae gene for
           nuclear pore complex protein NUP100 and
           tRNA-His.>gb:SCXI207K_1710868 S.cerevisiae chromosome XI
           (20.7 kb) DNA for Hsp70 homologue (A881), nucleoside
           diphosphate kinase homologue (A153), nuclear pore
           complex protein NUP100 (B959), tRNA-Trp, tRNA-Val,
           tRNA-His, F385, B766, C256, A169, A180,
           B147.>gb:SCYKL068W_1713041 S.cerevisiae chromosome XI
           reading frame ORF YKL068w.
          Length = 959

 Score = 33.1 bits (74), Expect = 4.5
 Identities = 22/77 (28%), Positives = 36/77 (46%)
 Frame = +1

Query: 136 FGSLLCNCLMMSSTKGGKQASGSSTYPSVPDMTVHSAQGDGWEVYGKKSKNKAGTSGGRQ 315
           FGS   N    SS  GG+  S + T+ +          G+G  ++G  + +++ T+G   
Sbjct: 145 FGSQNNNSAGTSSLFGGQSTSTTGTFGNTGSSFGTGLNGNGSNIFGAGNNSQSNTTGS-L 203

Query: 316 YVPQNSAAVSTGNAWGS 366
           +  Q S+A  T N  GS
Sbjct: 204 FGNQQSSAFGTNNQQGS 220



>sp|P02674|FIB1_PETMA Fibrinogen alpha-1 chain precursor [Contains:
           Fibrinopeptide A] (Fragment).>gb:FSAFIBAA_2572219
           Petromyzon marinus fibrinogen alpha chain mRNA.
          Length = 966

 Score = 33.1 bits (74), Expect = 4.5
 Identities = 20/70 (28%), Positives = 28/70 (40%), Gaps = 3/70 (4%)
 Frame = +1

Query: 172 STKGGKQASGSSTYPSVPDMTVHSAQGDGWEVYGKKSKNKAGTSGGRQYV---PQNSAAV 342
           S KGG   +G  T P+       SAQG  W   G+   N     GG        + +   
Sbjct: 574 SAKGGSWGTGGRTEPNTG-----SAQGGSWGTGGRTEPNTGSAQGGSWGTGGRTEPNTGS 628

Query: 343 STGNAWGSSG 372
           + G +WG+ G
Sbjct: 629 AQGGSWGTGG 638



>gb:CR382135_1667874 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 557

 Score = 32.7 bits (73), Expect = 5.9
 Identities = 24/80 (30%), Positives = 33/80 (41%), Gaps = 11/80 (13%)
 Frame = +1

Query: 169 SSTKGGKQASGSSTYPSVPDMTVHSAQGD----------GWEVYGKKSKNKAGTSGGRQ- 315
           S T  GK A GSS   +  + +   A G           G + YG      +GT+ GR  
Sbjct: 180 SGTTSGKDAYGSSGAGTSGNTSGRDAYGSSGAGTSGTTSGKDAYGSSGAGTSGTTSGRDA 239

Query: 316 YVPQNSAAVSTGNAWGSSGH 375
           +    + A  + N  GSSGH
Sbjct: 240 HGSSGNDAYGSSNTHGSSGH 259



>gb:BX248340_759188 Mycobacterium bovis subsp. bovis AF2122/97
           complete genome; segment 7/14.
          Length = 540

 Score = 32.7 bits (73), Expect = 5.9
 Identities = 19/65 (29%), Positives = 30/65 (46%)
 Frame = +1

Query: 178 KGGKQASGSSTYPSVPDMTVHSAQGDGWEVYGKKSKNKAGTSGGRQYVPQNSAAVSTGNA 357
           +GG  A+G++  P     +  +    GW +YG      AG +GG    P  ++A   G A
Sbjct: 78  QGGAGANGAAGQPGKAGGSGGNGGAGGW-IYGHGGHGGAGGNGGNATAPGGASAGFDGGA 136

Query: 358 WGSSG 372
            G+ G
Sbjct: 137 GGNGG 141



>gb:AE000516_21897 Mycobacterium tuberculosis CDC1551, complete
           genome.
          Length = 650

 Score = 32.7 bits (73), Expect = 5.9
 Identities = 19/65 (29%), Positives = 30/65 (46%)
 Frame = +1

Query: 178 KGGKQASGSSTYPSVPDMTVHSAQGDGWEVYGKKSKNKAGTSGGRQYVPQNSAAVSTGNA 357
           +GG  A+G++  P     +  +    GW +YG      AG +GG    P  ++A   G A
Sbjct: 188 QGGAGANGAAGQPGKAGGSGGNGGAGGW-IYGHGGHGGAGGNGGNATAPGGASAGFDGGA 246

Query: 358 WGSSG 372
            G+ G
Sbjct: 247 GGNGG 251



>pir|D70931|D70931 hypothetical glycine-rich protein Rv1803c -
           Mycobacterium tuberculosis (strain
           H37RV)>gb:BX842577_819875 Mycobacterium tuberculosis
           H37Rv complete genome; segment 6/13.
          Length = 639

 Score = 32.7 bits (73), Expect = 5.9
 Identities = 19/65 (29%), Positives = 30/65 (46%)
 Frame = +1

Query: 178 KGGKQASGSSTYPSVPDMTVHSAQGDGWEVYGKKSKNKAGTSGGRQYVPQNSAAVSTGNA 357
           +GG  A+G++  P     +  +    GW +YG      AG +GG    P  ++A   G A
Sbjct: 177 QGGAGANGAAGQPGKAGGSGGNGGAGGW-IYGHGGHGGAGGNGGNATAPGGASAGFDGGA 235

Query: 358 WGSSG 372
            G+ G
Sbjct: 236 GGNGG 240


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.316    0.129    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 675,141,380
Number of Sequences: 1806583
Number of extensions: 14343943
Number of successful extensions: 41990
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 40505
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 41941
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 37608185545
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)