BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig1849
         (745 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|P21343|PFPB_SOLTU|PFPB_SOLTU Pyrophosphate--fructose 6-phosphate 1-phosp...   319   3e-86   Solanum tuberosum [potatoes]
gb:AF095520_1767765 Citrus X paradisi pyrophosphate-dependent ph...   293   2e-78   
sp|Q41141|PFPB_RICCO|PFPB_RICCO Pyrophosphate--fructose 6-phosphate 1-phosp...   280   2e-74   Ricinus communis
gb:AY062473_1565129 Arabidopsis thaliana Similar to pyrophosphat...   279   4e-74   
gb:AP004027_1836581 Oryza sativa (japonica cultivar-group) genom...   273   2e-72   
pir|T01470|T01470 diphosphate-fructose-6-phosphate 1-phosphotran...   268   6e-71   Arabidopsis thaliana [mouse-ear cress]
pir|A86255|A86255 hypothetical protein [imported] - Arabidopsis ...   267   1e-70   Arabidopsis thaliana [mouse-ear cress]
pir|B36094|B36094 diphosphate-fructose-6-phosphate 1-phosphotran...   221   2e-58   Solanum tuberosum [potatoes]
gb:AP006841_573622 Bacteroides fragilis YCH46 DNA, complete genome.   139   7e-32   
gb:AB039836_6354 Porphyromonas gingivalis pfk gene for phosphofr...   133   4e-30   
gb:AF307859_498259 Spirochaeta thermophila pyrophosphate-depende...   132   7e-30   
gb:AE017251_416594 Treponema denticola ATCC 35405, section 6 of ...   128   1e-28   
gb:CP000013_869259 Borrelia garinii PBi, complete genome.             125   6e-28   
gb:AE016927_359675 Bacteroides thetaiotaomicron VPI-5482, sectio...   124   2e-27   
gb:BX908798_830436 Parachlamydia-related symbiont UWE25, complet...   120   3e-26   
gb:AF422165_1269625 Hexamita inflata putative pyrophosphate-depe...   119   4e-26   
gb:BBU224475_747701 Borrelia burgdorferi left chromosomal subtel...   117   3e-25   
gb:AE001116_32001 Borrelia burgdorferi B31 (section 2 of 70) of ...   117   3e-25   
pir|D70102|D70102 pyrophosphate-fructose 6-phosphate 1-phosphotr...   117   3e-25   Borreliella burgdorferi
pir|S52081|S52081 diphosphate-fructose-6-phosphate 1-phosphotran...   116   5e-25   Giardia intestinalis
pir|C71312|C71312 probable pyrophosphate-fructose 6-phosphate 1-...   114   2e-24   Treponema pallidum
gb:AF013986_1231810 Entamoeba histolytica PPi-dependent phosphof...   108   1e-22   
pir|F72111|F72111 fructose-6-p phosphotransferase - Chlamydophil...   107   2e-22   Chlamydia pneumoniae
pir|H86510|H86510 fructose-6-P phosphotransferase [imported] - C...   107   2e-22   Chlamydia pneumoniae
gb:AE016996_374667 Chlamydophila caviae GPIC section 3 of 4 of t...   105   1e-21   
pir|E81698|E81698 pyrophosphate-fructose 6-phosphate 1-phosphotr...   105   1e-21   Chlamydia muridarum [agent of mouse pneumonitis]
gb:PFA929356_1393375 Plasmodium falciparum strain 3D7, chromosom...   103   3e-21   
pir|D86342|D86342 hypothetical protein F9H16.6 - Arabidopsis tha...   102   7e-21   Arabidopsis thaliana [mouse-ear cress]
pir|A71544|A71544 probable diphosphate-fructose-6-phosphate 1-ph...   102   1e-20   Chlamydia trachomatis
gb:AF095521_1767766 Citrus X paradisi pyrophosphate-dependent ph...   101   2e-20   
pir|E96793|E96793 hypothetical protein F14G6.15 [imported] - Ara...   100   3e-20   Arabidopsis thaliana [mouse-ear cress]
pir|H86516|H86516 fructose-6-P phosphotransferase [imported] - C...   100   5e-20   Chlamydia pneumoniae
sp|Q41140|PFPA_RICCO|PFPA_RICCO Pyrophosphate--fructose 6-phosphate 1-phosp...    99   6e-20   Ricinus communis
gb:AP004459_1841305 Oryza sativa (japonica cultivar-group) genom...    99   8e-20   
gb:AP004011_1836346 Oryza sativa (japonica cultivar-group) genom...    98   1e-19   
sp|P21342|PFPA_SOLTU|PFPA_SOLTU Pyrophosphate--fructose 6-phosphate 1-phosp...    98   2e-19   Solanum tuberosum [potatoes]
gb:AP004165_1838461 Oryza sativa (japonica cultivar-group) genom...    97   2e-19   
gb:AP004757_1844516 Oryza sativa (japonica cultivar-group) genom...    97   3e-19   
gb:AE014186_938257 Plasmodium falciparum 3D7 chromosome 11 compl...    93   6e-18   
gb:AE016996_374665 Chlamydophila caviae GPIC section 3 of 4 of t...    92   1e-17   
pir|C81698|C81698 pyrophosphate-fructose 6-phosphate 1-phosphotr...    91   3e-17   Chlamydia muridarum [agent of mouse pneumonitis]
pir|G71543|G71543 probable fructose-6-phosphate phosphotransfera...    91   3e-17   Chlamydia trachomatis
gb:AY224499_1590701 Oryza sativa (japonica cultivar-group) isola...    89   1e-16   
gb:BBPFPB_747520 B.burgdorferi pfpB gene.                              45   0.001   
gb:AF298119_497332 Amycolatopsis methanolica phosphofructokinase...    44   0.003   
sp|Q9KH71|PFP_DICTH|PFP_DICTH Pyrophosphate--fructose 6-phosphate 1-phosph...    43   0.007   Dictyoglomus thermophilum
gb:BA000030_705010 Streptomyces avermitilis MA-4680 genomic DNA,...    41   0.020   
gb:AE017263_420727 Mesoplasma florum L1 complete genome.               41   0.026   
gb:AY386314_615071 Bacillus methanolicus strain MGA3 plasmid pBM...    40   0.034   
gb:BX842642_822285 Mycoplasma mycoides subsp. mycoides SC genomi...    40   0.045   
gb:AP006840_568026 Symbiobacterium thermophilum DNA, complete ge...    40   0.045   
sp|Q9FC99|K6P3_STRCO|K6P3_STRCO 6-phosphofructokinase 3 (EC 2.7.1.11) (Phos...    40   0.045   Streptomyces coelicolor
gb:CP000033_89223 Lactobacillus acidophilus NCFM, complete genome.     39   0.100   
sp|Q9WY52|K6PF_THEMA|K6PF_THEMA 6-phosphofructokinase (EC 2.7.1.11) (Phosph...    38   0.22    Thermotoga maritima
gb:AE017306_437231 Thermus thermophilus HB27 section 6 of 7 of t...    37   0.38    
sp|Q8EPD6|K6PF_OCEIH|K6PF_OCEIH 6-phosphofructokinase (EC 2.7.1.11) (Phosph...    37   0.38    Oceanobacillus iheyensis
sp|P21777|K6P1_THETH|K6P1_THETH 6-phosphofructokinase isozyme 1 (EC 2.7.1.1...    37   0.38    Thermus thermophilus
gb:CP000020_872516 Vibrio fischeri ES114 chromosome I, complete ...    37   0.50    
gb:BX248357_762370 Corynebacterium diphtheriae gravis NCTC13129,...    37   0.50    
gb:BA000030_703969 Streptomyces avermitilis MA-4680 genomic DNA,...    37   0.50    
gb:BA000030_700708 Streptomyces avermitilis MA-4680 genomic DNA,...    37   0.50    
gb:AE017152_392029 Haemophilus ducreyi strain 35000HP section 2 ...    37   0.50    
gb:EHU12513_1384530 Entamoeba histolytica PPi-dependent phosphof...    36   0.65    
gb:AC109596_1738726 Oryza sativa (japonica cultivar-group) chrom...    36   0.84    
gb:AE017283_429882 Propionibacterium acnes KPA171202, complete g...    35   1.1     
pir|S49458|S49458 diphosphate-fructose-6-phosphate 1-phosphotran...    35   1.1     Entamoeba histolytica
sp|P20275|K6PF_SPICI|K6PF_SPICI 6-phosphofructokinase (EC 2.7.1.11) (Phosph...    35   1.1     Spiroplasma citri
sp|Q890Z2|K6PF_CLOTE|K6PF_CLOTE 6-phosphofructokinase (EC 2.7.1.11) (Phosph...    35   1.1     Clostridium tetani
sp|Q9K843|K6PF_BACHD|K6PF_BACHD 6-phosphofructokinase (EC 2.7.1.11) (Phosph...    35   1.1     Bacillus halodurans
gb:BX936398_834719 Yersinia pseudotuberculosis IP32953 genome, c...    35   1.4     
gb:BA000043_739317 Geobacillus kaustophilus HTA426 DNA, complete...    35   1.4     
gb:AP006628_566716 Onion yellows phytoplasma OY-M DNA, complete ...    35   1.4     
gb:AE011599_274707 Leptospira interrogans serovar lai str. 56601...    35   1.4     
sp|Q8ZJL6|K6PF_YERPE|K6PF_YERPE 6-phosphofructokinase (EC 2.7.1.11) (Phosph...    35   1.4     Yersinia pestis
sp|Q87KX0|K6PF_VIBPA|K6PF_VIBPA 6-phosphofructokinase (EC 2.7.1.11) (Phosph...    35   1.9     
sp|Q9Z6C3|K6PF_ENTCL|K6PF_ENTCL 6-phosphofructokinase (EC 2.7.1.11) (Phosph...    35   1.9     Enterobacter cloacae
sp|O34529|K6PF_BACSU|K6PF_BACSU 6-phosphofructokinase (EC 2.7.1.11) (Phosph...    35   1.9     Bacillus subtilis
sp|P00512|K6PF_BACST|K6PF_BACST 6-phosphofructokinase (EC 2.7.1.11) (Phosph...    35   1.9     Geobacillus stearothermophilus
sp|O67605|K6PF_AQUAE|K6PF_AQUAE 6-phosphofructokinase (EC 2.7.1.11) (Phosph...    35   1.9     Aquifex aeolicus
gb:BC059855_2103802 Mus musculus cDNA sequence BC053460, mRNA (c...    34   2.5     
gb:AK173222_2070156 Mus musculus premature mRNA for mKIAA1623 pr...    34   2.5     
gb:HSBRCA22_2011111 H.sapiens brca2 gene exon 2 (and joined codi...    34   2.5     
gb:HS92M18_1999785 Human DNA sequence from clone XX-92M18 on chr...    34   2.5     
gb:AY436640_1950656 Homo sapiens breast cancer 2, early onset (B...    34   2.5     
gb:AL137247_1919553 Human DNA sequence from clone RP11-298P3 on ...    34   2.5     
gb:AB016886_1513139 Arabidopsis thaliana genomic DNA, chromosome...    34   2.5     
gb:AE017180_400363 Geobacter sulfurreducens PCA, complete genome.      34   2.5     
pir|G02334|G02334 breast cancer tumor suppressor BRCA2 - human>g...    34   2.5     Homo sapiens [man]
sp|Q9L1L8|K6P2_STRCO|K6P2_STRCO 6-phosphofructokinase 2 (EC 2.7.1.11) (Phos...    34   2.5     Streptomyces coelicolor
sp|P51587|BRC2_HUMAN|BRC2_HUMAN Breast cancer type 2 susceptibility protein...    34   2.5     Homo sapiens [man]
gb:A62801_1450066 Sequence 42 from Patent WO9719110.                   33   4.2     
gb:HIVU52062_2428992 Human immunodeficiency virus type 1 envelop...    33   5.5     
gb:AP002972_1824069 Oryza sativa (japonica cultivar-group) genom...    33   5.5     
gb:BPTUIA_1505056 Bacteriophage TuIa 37 and 38 genes for recepto...    33   5.5     
gb:AY129332_1496561 Mycobacteriophage Bxz2, complete genome.           33   5.5     
gb:AP008231_580626 Synechococcus elongatus PCC 6301 DNA, complet...    33   5.5     
pir|S13237|S13237 tail fiber protein gp37 - phage TuIa (fragment)      33   5.5     Enterobacteria phage TuIa
sp|Q8A2E9|K6P3_BACTN|K6P3_BACTN 6-phosphofructokinase 3 (EC 2.7.1.11) (Phos...    33   5.5     Bacteroides thetaiotaomicron
gb:CR382126_1658970 Kluyveromyces lactis strain NRRL Y-1140 chro...    33   7.2     
gb:BX842655_826146 Bdellovibrio bacteriovorus complete genome, s...    33   7.2     
gb:AE016770_328833 Escherichia coli CFT073 section 16 of 18 of t...    33   7.2     
gb:AE012915_287070 Chlorobium tepidum TLS section 136 of 194 of ...    33   7.2     
gb:ECPFKA_132144 E. coli genes pfkA, sbp and cdh for phosphofruc...    33   7.2     
sp|Q8FBD0|K6PF_ECOL6|K6PF_ECOL6 6-phosphofructokinase (EC 2.7.1.11) (Phosph...    33   7.2     Escherichia coli O6
sp|P57391|K6PF_BUCAI|K6PF_BUCAI 6-phosphofructokinase (EC 2.7.1.11) (Phosph...    33   7.2     
sp|P06998|K6P1_ECOLI|K6P1_ECOLI 6-phosphofructokinase isozyme I (EC 2.7.1.1...    33   7.2     Escherichia coli [E. coli]
gb:BC046689_2549679 Xenopus laevis microtubule-associated protei...    32   9.3     
gb:AK173226_2070160 Mus musculus mRNA for mKIAA1637 protein.           32   9.3     
gb:AE017348_1758196 Cryptococcus neoformans var. neoformans JEC2...    32   9.3     
gb:ENU56097_1676794 Emericella nidulans acetate regulatory DNA b...    32   9.3     
gb:AK049242_1168679 Mus musculus ES cells cDNA, RIKEN full-lengt...    32   9.3     
gb:BX248586_764191 Blochmannia floridanus complete genome; segme...    32   9.3     
gb:AE016822_339900 Leifsonia xyli subsp. xyli str. CTCB07, compl...    32   9.3     
sp|Q91W39|NCO5_MOUSE|NCO5_MOUSE Nuclear receptor coactivator 5 (NCoA-5) (Co...    32   9.3     Mus musculus [mouse]
sp|Q8R914|K6PF_THETN|K6PF_THETN 6-phosphofructokinase (EC 2.7.1.11) (Phosph...    32   9.3     
sp|Q8XG19|K6PF_SALTY|K6PF_SALTY 6-phosphofructokinase (EC 2.7.1.11) (Phosph...    32   9.3     Salmonella enterica subsp. enterica serovar Typhimurium


>sp|P21343|PFPB_SOLTU Pyrophosphate--fructose 6-phosphate
           1-phosphotransferase beta subunit (EC 2.7.1.90) (PFP)
           (6-phosphofructokinase, pyrophosphate dependent)
           (Pyrophosphate-dependent 6-phosphofructose-1-kinase)
           (PPi-PFK).
          Length = 552

 Score =  319 bits (818), Expect = 3e-86
 Identities = 153/172 (88%), Positives = 161/172 (93%)
 Frame = +1

Query: 226 RYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAAL 405
           RYA+VYSEVQNSRLDHPLPLPSVL   FKVVDGP SSAAGHPEEIAKLFP L+GQP  +L
Sbjct: 8   RYAAVYSEVQNSRLDHPLPLPSVLGSPFKVVDGPPSSAAGHPEEIAKLFPSLYGQPHVSL 67

Query: 406 VPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMK 585
           VPDDSGDVAMN  LKIGVVLSGGQAPGGHNVISGIFDYLQ HCKGST+YGFRGGPAG+MK
Sbjct: 68  VPDDSGDVAMNQILKIGVVLSGGQAPGGHNVISGIFDYLQTHCKGSTMYGFRGGPAGVMK 127

Query: 586 CKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            KYV+LTPE+IYPYRNQGGFDMICSGRDKIETP+QFKQAEETAKKLDLDGLV
Sbjct: 128 GKYVVLTPEFIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAKKLDLDGLV 179



>gb:AF095520_1767765 Citrus X paradisi pyrophosphate-dependent
           phosphofructokinase beta subunit (PPi-PFKb) mRNA,
           complete cds.
          Length = 566

 Score =  293 bits (750), Expect = 2e-78
 Identities = 145/190 (76%), Positives = 162/190 (85%), Gaps = 2/190 (1%)
 Frame = +1

Query: 178 SLLANSDIASAKTST--GRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHP 351
           SL+AN+D++   + T  GR ASVYSE+Q SR+DH LPLPSVL+  FK+VDGPASSAAG+P
Sbjct: 4   SLVANADLSPVTSGTVKGRVASVYSELQTSRIDHALPLPSVLKNPFKIVDGPASSAAGNP 63

Query: 352 EEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEH 531
           +EIAKLFP LFGQPSA LVP+ +  V  +  LKIGVVLSGGQAPGGHNVISGI+DYLQ+ 
Sbjct: 64  DEIAKLFPNLFGQPSALLVPNGADAVRSDEKLKIGVVLSGGQAPGGHNVISGIYDYLQDR 123

Query: 532 CKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEET 711
            KGS LYGFRGGPAGIMKCKYV LT  YIYPYRNQGGFDMICSGRDKIETP+QFKQA ET
Sbjct: 124 AKGSVLYGFRGGPAGIMKCKYVELTSNYIYPYRNQGGFDMICSGRDKIETPEQFKQATET 183

Query: 712 AKKLDLDGLV 741
           A KLDLDGLV
Sbjct: 184 AVKLDLDGLV 193



>sp|Q41141|PFPB_RICCO Pyrophosphate--fructose 6-phosphate
           1-phosphotransferase beta subunit (EC 2.7.1.90) (PFP)
           (6-phosphofructokinase, pyrophosphate-dependent)
           (Pyrophosphate-dependent 6-phosphofructose-1-kinase)
           (PPi-PFK).>pir|T10107|T10107
           diphosphate-fructose-6-phosphate 1-phosphotransferase
           (EC 2.7.1.90) beta chain - castor
           bean>gb:RCPDPBS_1703390 R.communis gene for
           pyrophosphate-dependent phosphofructokinase beta
           subunit.
          Length = 552

 Score =  280 bits (716), Expect = 2e-74
 Identities = 137/178 (76%), Positives = 153/178 (85%)
 Frame = +1

Query: 208 AKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFG 387
           A  ++GR ASVYSEVQ+SR++H LPLPSVL   FK+V GP SSAAG+P+EIAKLFP LFG
Sbjct: 2   ATPNSGRAASVYSEVQSSRIEHVLPLPSVLNHPFKIVQGPPSSAAGNPDEIAKLFPNLFG 61

Query: 388 QPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGG 567
           QPSA LVPD +  +  N  LKIG+VLSGGQAPGGHNVISGIFDYLQ+  KGS LYGFRGG
Sbjct: 62  QPSAMLVPDVADSLDSNQQLKIGLVLSGGQAPGGHNVISGIFDYLQDRAKGSILYGFRGG 121

Query: 568 PAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           PAGIMKC YV LT +YI+PYRNQGGFDMICSGRDKIETP+QFKQAEETA KLDL+GLV
Sbjct: 122 PAGIMKCNYVQLTADYIHPYRNQGGFDMICSGRDKIETPEQFKQAEETAGKLDLNGLV 179



>gb:AY062473_1565129 Arabidopsis thaliana Similar to
           pyrophosphate-dependent phosphofuctokinase beta subunit
           (At1g12000; F12F1.13) mRNA, complete
           cds.>gb:AY093260_1575214 Arabidopsis thaliana similar to
           pyrophosphate-dependent phosphofuctokinase beta subunit
           (At1g12000) mRNA, complete cds.
          Length = 566

 Score =  279 bits (713), Expect = 4e-74
 Identities = 141/195 (72%), Positives = 165/195 (84%), Gaps = 2/195 (1%)
 Frame = +1

Query: 163 MAPAISLLAN-SDIASAKTSTGR-YASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASS 336
           MAPA+++  + + + S + +  +  ASVYSEVQ+SR+++ LPLPSVL+ +FK+V+GPASS
Sbjct: 1   MAPALAVTRDLTAVGSPENAPAKGRASVYSEVQSSRINNTLPLPSVLKGAFKIVEGPASS 60

Query: 337 AAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFD 516
           AAG+P+EIAKLFPGL+GQPS A+VPD     +    LKIGVVLSGGQAPGGHNVISG+FD
Sbjct: 61  AAGNPDEIAKLFPGLYGQPSVAVVPDQDAPSSAP-KLKIGVVLSGGQAPGGHNVISGLFD 119

Query: 517 YLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFK 696
           YLQE  KGST YGF+GGPAGIMKCKYV L  EYI PYRNQGGFDMICSGRDKIETPDQFK
Sbjct: 120 YLQERAKGSTFYGFKGGPAGIMKCKYVELNAEYIQPYRNQGGFDMICSGRDKIETPDQFK 179

Query: 697 QAEETAKKLDLDGLV 741
           QAEETAKKLDLDGLV
Sbjct: 180 QAEETAKKLDLDGLV 194



>gb:AP004027_1836581 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OJ1136_C11.
          Length = 567

 Score =  273 bits (698), Expect = 2e-72
 Identities = 138/194 (71%), Positives = 154/194 (79%), Gaps = 2/194 (1%)
 Frame = +1

Query: 166 APAISLLANSDIASAKTSTG--RYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSA 339
           A A++     D A A  +    R ASVYSEVQ SRL H LPLPSVLR  F + DGPASSA
Sbjct: 3   AAAVAANGGGDGAQASNAPAPTRLASVYSEVQTSRLKHALPLPSVLRSPFALADGPASSA 62

Query: 340 AGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDY 519
           AG+P EIAKLFP LFGQPS +LVP  S + A    LK+GVVLSGGQAPGGHNVI GIFDY
Sbjct: 63  AGNPGEIAKLFPNLFGQPSVSLVP--SPEPASTRPLKVGVVLSGGQAPGGHNVICGIFDY 120

Query: 520 LQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQ 699
           LQE+ KGS +YGF+GGPAG+MKCKYV LT +Y+YPYRNQGGFDMICSGRDKIETP+QFKQ
Sbjct: 121 LQEYAKGSVMYGFKGGPAGVMKCKYVELTADYVYPYRNQGGFDMICSGRDKIETPEQFKQ 180

Query: 700 AEETAKKLDLDGLV 741
           AE+T  KLDLDGLV
Sbjct: 181 AEDTVNKLDLDGLV 194



>pir|T01470|T01470 diphosphate-fructose-6-phosphate
           1-phosphotransferase (EC 2.7.1.90) beta chain -
           Arabidopsis thaliana>gb:ATCHRIV11_1544248 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           11.>gb:T24H24_1723880 Arabidopsis thaliana BAC T24H24.
          Length = 583

 Score =  268 bits (686), Expect = 6e-71
 Identities = 136/212 (64%), Positives = 157/212 (74%), Gaps = 19/212 (8%)
 Frame = +1

Query: 163 MAPAISLLANSDIASAKTS---TGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPAS 333
           MA  + L+    IA    +     R  SVYSEVQ SR+DH LPLPSV +  FK++DGP S
Sbjct: 1   MASQLDLIGGDYIAGISINPPTNSRVTSVYSEVQASRIDHTLPLPSVFKTPFKIIDGPPS 60

Query: 334 SAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIF 513
           S+AGHPEEI KLFP LFGQPSA LVP+ S +V+ +  LKIGVVLSGGQAPGGHNVI GIF
Sbjct: 61  SSAGHPEEIEKLFPNLFGQPSALLVPNQSNEVSSDQKLKIGVVLSGGQAPGGHNVICGIF 120

Query: 514 ----------------DYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGF 645
                           DYLQE+ +GS+L+GFRGGPAGIMK KY+ LT E++YPYRNQGGF
Sbjct: 121 GFKNLICDCIFVVGLIDYLQEYARGSSLFGFRGGPAGIMKGKYIELTSEFVYPYRNQGGF 180

Query: 646 DMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           DMICSGRDKIETP+QFKQAEET  K+DLDGLV
Sbjct: 181 DMICSGRDKIETPEQFKQAEETVTKMDLDGLV 212



>pir|A86255|A86255 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_890215 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F12F1_1677344 Arabidopsis thaliana
           chromosome 1 BAC F12F1 sequence, complete sequence.
          Length = 574

 Score =  267 bits (683), Expect = 1e-70
 Identities = 141/203 (69%), Positives = 165/203 (81%), Gaps = 10/203 (4%)
 Frame = +1

Query: 163 MAPAISLLAN-SDIASAKTSTGR-YASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASS 336
           MAPA+++  + + + S + +  +  ASVYSEVQ+SR+++ LPLPSVL+ +FK+V+GPASS
Sbjct: 1   MAPALAVTRDLTAVGSPENAPAKGRASVYSEVQSSRINNTLPLPSVLKGAFKIVEGPASS 60

Query: 337 AAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIF- 513
           AAG+P+EIAKLFPGL+GQPS A+VPD     +    LKIGVVLSGGQAPGGHNVISG+F 
Sbjct: 61  AAGNPDEIAKLFPGLYGQPSVAVVPDQDAPSSAP-KLKIGVVLSGGQAPGGHNVISGLFG 119

Query: 514 -DYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQ 690
            DYLQE  KGST YGF+GGPAGIMKCKYV L  EYI PYRNQGGFDMICSGRDKIETPDQ
Sbjct: 120 KDYLQERAKGSTFYGFKGGPAGIMKCKYVELNAEYIQPYRNQGGFDMICSGRDKIETPDQ 179

Query: 691 ------FKQAEETAKKLDLDGLV 741
                 FKQAEETAKKLDLDGLV
Sbjct: 180 VEYFFVFKQAEETAKKLDLDGLV 202



>pir|B36094|B36094 diphosphate-fructose-6-phosphate
           1-phosphotransferase (EC 2.7.1.90) beta chain - potato
           (cv. Kennebec)>gb:POTPFPB_1701132 Potato
           pyrophosphate-fructose 6-phosphate 1-phosphotransferase
           (PFP) beta-subunit mRNA, complete cds.
          Length = 513

 Score =  221 bits (563), Expect(2) = 2e-58
 Identities = 104/114 (91%), Positives = 110/114 (96%)
 Frame = +1

Query: 400 ALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGI 579
           +LVPDDSGDVAMN  LKIGVVLSGGQAPGGHNVISGIFDYLQ HCKGST+YGFRGGPAG+
Sbjct: 27  SLVPDDSGDVAMNQILKIGVVLSGGQAPGGHNVISGIFDYLQTHCKGSTMYGFRGGPAGV 86

Query: 580 MKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           MK KYV+LTPE+IYPYRNQGGFDMICSGRDKIETP+QFKQAEETAKKLDLDGLV
Sbjct: 87  MKGKYVVLTPEFIYPYRNQGGFDMICSGRDKIETPEQFKQAEETAKKLDLDGLV 140



 Score = 27.7 bits (60), Expect(2) = 2e-58
 Identities = 13/20 (65%), Positives = 13/20 (65%)
 Frame = +2

Query: 335 LRPAIQRRLQSCFLAYLVNH 394
           L P  QRRLQS FL Y  NH
Sbjct: 6   LPPVTQRRLQSFFLPYTDNH 25



>gb:AP006841_573622 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 547

 Score =  139 bits (349), Expect = 7e-32
 Identities = 74/166 (44%), Positives = 102/166 (61%)
 Frame = +1

Query: 244 SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG 423
           S +Q +R  +   LP  L+ S K V+G A+ +    E I KLFP  +G P   L+  + G
Sbjct: 4   SALQIARAAYQPKLPKALKGSVKAVEGAATQSVADQEAIQKLFPNTYGMP---LIKFEEG 60

Query: 424 DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL 603
           +      + +GV+LSGGQAPGGHNVISG+FD ++   K + LYGF  GP G++   Y+ L
Sbjct: 61  EAIQLPAMNVGVILSGGQAPGGHNVISGLFDGIKTLNKDNKLYGFILGPGGLVDHNYMEL 120

Query: 604 TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           T + I  YRN GGFD+I SGR K+ETP+QF++  E   KL +  LV
Sbjct: 121 TADIIDEYRNTGGFDIIGSGRTKLETPEQFEKGLEIINKLGIKALV 166



>gb:AB039836_6354 Porphyromonas gingivalis pfk gene for
           phosphofructokinase, complete cds.>gb:AE017172_396543
           Porphyromonas gingivalis W83 section 1 of 8 of the
           complete genome.>gb:AE015924_1032154 Porphyromonas
           gingivalis W83 complete genome.
          Length = 549

 Score =  133 bits (334), Expect = 4e-30
 Identities = 70/166 (42%), Positives = 103/166 (62%)
 Frame = +1

Query: 244 SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG 423
           S +  +R+ +   +P+ L+ + K+++G A+ A    EEIA +FP  +G P  +  P   G
Sbjct: 4   SALHLARMSYQPKMPASLQGAVKIIEGKATEAVSDKEEIAAIFPRTYGLPLISFAP--GG 61

Query: 424 DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL 603
           +        +GV+LSGGQAPGGHNVI+G+FD ++     S L+GF  GP G+++ KY  L
Sbjct: 62  ERTEYPPTNVGVILSGGQAPGGHNVIAGLFDEMKLLNPDSRLFGFLMGPDGLIEHKYREL 121

Query: 604 TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           T E I  YRN GGFDMI SGR K++ P+QF+   E  ++LD+  LV
Sbjct: 122 TAEVIDEYRNTGGFDMIGSGRTKLDKPEQFEAGLEILRELDIKALV 167



>gb:AF307859_498259 Spirochaeta thermophila pyrophosphate-dependent
           phosphofructokinase gene, complete cds.
          Length = 554

 Score =  132 bits (332), Expect = 7e-30
 Identities = 73/169 (43%), Positives = 101/169 (59%), Gaps = 3/169 (1%)
 Frame = +1

Query: 244 SEVQNSRLDHPLPLPSVLRKSFKVVD---GPASSAAGHPEEIAKLFPGLFGQPSAALVPD 414
           S +Q +R  +   LP VL+     +    G  + A    E++ +LF   +G+P A L   
Sbjct: 5   SPLQKARYGYVPKLPPVLQDEIARIQAELGQPTEAVADREDLKRLFANTYGKPIATLTRG 64

Query: 415 DSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKY 594
            + +        +GV+LSGG APGGHNVI G+FD L++  + STL GF+GGP+GI+  ++
Sbjct: 65  SNPEAGRRRT--VGVILSGGPAPGGHNVICGLFDALKKANRESTLIGFKGGPSGILDDEW 122

Query: 595 VILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           +  T   I  YRN GGFD+I SGR KIETP+QF +A E AKK  LD LV
Sbjct: 123 IEFTDSLINQYRNTGGFDIIGSGRTKIETPEQFAKALENAKKHGLDALV 171



>gb:AE017251_416594 Treponema denticola ATCC 35405, section 6 of 10
           of the complete genome.>gb:AE017226_1070190 Treponema
           denticola ATCC 35405, complete genome.
          Length = 560

 Score =  128 bits (321), Expect = 1e-28
 Identities = 72/170 (42%), Positives = 100/170 (58%), Gaps = 4/170 (2%)
 Frame = +1

Query: 244 SEVQNSRLDHPLPLPSVLRKSFKVVD---GPASSAAGHPEEIAKLFPGLFGQPSAALVPD 414
           S +Q  R ++   +P V  +   ++    G A+ A  +  E+ ++FP  +G P    V  
Sbjct: 4   STMQRLRYNYEPKIPKVFAEPLSLIKPEIGEATHAQSNQAELKEIFPHTYGMPIIRFV-- 61

Query: 415 DSGDVAMNHN-LKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCK 591
             G   + H  LK GV+LSGGQAPGGHNVISG+FD L++    S LYGF  GP G++K +
Sbjct: 62  -KGKSEVEHKPLKFGVILSGGQAPGGHNVISGLFDALKKGNANSKLYGFLRGPEGLVKGR 120

Query: 592 YVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           YV +    I  YRN GGFD+I SGR KIET +Q + + +  KKL LD L+
Sbjct: 121 YVEIKKALIDKYRNTGGFDIIGSGRTKIETEEQIESSIQNVKKLKLDALI 170



>gb:CP000013_869259 Borrelia garinii PBi, complete genome.
          Length = 556

 Score =  125 bits (315), Expect = 6e-28
 Identities = 64/166 (38%), Positives = 101/166 (60%), Gaps = 3/166 (1%)
 Frame = +1

Query: 253 QNSRLDHPLPLPSVLRKSFK---VVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSG 423
           Q  R  +   LP++L+K FK   +V G  + A    + + + F   +G P  +    +S 
Sbjct: 7   QQERKKYVPKLPNILKKDFKNISLVYGEKTEAIQDRQALKEFFKNTYGLPIVSFTEGESS 66

Query: 424 DVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVIL 603
           +++ +  L IG++LSGG APGGHNVISGIFD +++    S L+GF+GGP G+++   + L
Sbjct: 67  NLSFSKALNIGIILSGGPAPGGHNVISGIFDAIKKFNANSKLFGFKGGPLGLLENDKIEL 126

Query: 604 TPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           T   +  YRN GGFD++ SGR KIET + + +A   AK+ +L+ +V
Sbjct: 127 TESLVNSYRNTGGFDIVSSGRTKIETEEHYDKALLVAKENNLNAIV 172



>gb:AE016927_359675 Bacteroides thetaiotaomicron VPI-5482, section 2
           of 21 of the complete genome.>gb:AE015928_986163
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 548

 Score =  124 bits (311), Expect = 2e-27
 Identities = 71/167 (42%), Positives = 99/167 (59%), Gaps = 1/167 (0%)
 Frame = +1

Query: 244 SEVQNSRLDHPLPLPSVLRK-SFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDS 420
           S +Q +R  +   LP  L   + K V G A+ +    E I  LFP  +G P   L+  ++
Sbjct: 4   SALQIARAAYQPKLPKALATGAVKAVAGAATQSVADQEAIKALFPNTYGMP---LITFEA 60

Query: 421 GDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVI 600
           G+      + +GV+LSGGQAPGGHNVISG+FD +++    S LYGF  GP G++   Y+ 
Sbjct: 61  GEAVQLPAMNVGVILSGGQAPGGHNVISGLFDGIKKLNPESKLYGFILGPGGLVDHNYME 120

Query: 601 LTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           LT + I  YRN GGFD+I SGR K+ET  QF++  E  K+L +  LV
Sbjct: 121 LTADIIDEYRNTGGFDIIGSGRTKLETEAQFEKGFEIIKELGIKALV 167



>gb:BX908798_830436 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 553

 Score =  120 bits (301), Expect = 3e-26
 Identities = 75/167 (44%), Positives = 95/167 (56%)
 Frame = +1

Query: 241 YSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDS 420
           +S +Q  RL +   LP +L+    +      S       + + FP  F QP   ++    
Sbjct: 12  FSPLQIHRLKYQPQLPLLLQDLSVIAANFEKSICLSDSALQEQFPQTFQQP---IITFRR 68

Query: 421 GDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVI 600
           G+      LK+GVVLSGGQAPGGHNVI+G+FD L++    S L GF  GP GI+K   + 
Sbjct: 69  GNKKEATPLKVGVVLSGGQAPGGHNVIAGLFDALKQIHPESILLGFLDGPLGILKNTSIE 128

Query: 601 LTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           LT   I  YRNQGGFDMI SGR KIETP Q + A  T + L LDGLV
Sbjct: 129 LTKMVIDSYRNQGGFDMIGSGRTKIETPAQLEAAMLTVQTLALDGLV 175



>gb:AF422165_1269625 Hexamita inflata putative
           pyrophosphate-dependent phosphofructokinase (pp-pfk)
           gene, complete cds.
          Length = 545

 Score =  119 bits (299), Expect = 4e-26
 Identities = 68/157 (43%), Positives = 88/157 (56%)
 Frame = +1

Query: 271 HPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLK 450
           +PL   S+    + +  G   +     EEIAK FP     P+ ++ P       +   L 
Sbjct: 12  NPLLPASLQGTGYTLKKGEPMAPVADGEEIAKQFPMTTNLPAISIEPSTEQSKLLEP-LT 70

Query: 451 IGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYR 630
           IGV+ SGGQAPGGHNV+ G++D LQ+    S L GF GGP G+M  K++ILT EY+  +R
Sbjct: 71  IGVIFSGGQAPGGHNVLCGLYDKLQQLAPNSKLLGFLGGPKGLMDNKHMILTKEYLATFR 130

Query: 631 NQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           N GGF  I SGRDKI +   F  A  TA    LDGLV
Sbjct: 131 NMGGFHAIGSGRDKIASTKDFDAAANTAAVEKLDGLV 167



>gb:BBU224475_747701 Borrelia burgdorferi left chromosomal
           subtelomeric region (pfpB gene).
          Length = 555

 Score =  117 bits (292), Expect = 3e-25
 Identities = 60/156 (38%), Positives = 96/156 (61%), Gaps = 3/156 (1%)
 Frame = +1

Query: 283 LPSVLRKSFK---VVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKI 453
           LP++L+K F    +V G  + A    + + + F   +G P  +    +S  ++ +  L I
Sbjct: 17  LPNILKKDFNNISLVYGENTEAIQDRQALKEFFKNTYGLPIISFTEGESS-LSFSKALNI 75

Query: 454 GVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRN 633
           G++LSGG APGGHNVISG+FD +++    S L+GF+GGP G+++   + LT   I  YRN
Sbjct: 76  GIILSGGPAPGGHNVISGVFDAIKKFNPNSKLFGFKGGPLGLLENDKIELTESLINSYRN 135

Query: 634 QGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            GGFD++ SGR KIET + + +A   AK+ +L+ ++
Sbjct: 136 TGGFDIVSSGRTKIETEEHYNKALFVAKENNLNAII 171



>gb:AE001116_32001 Borrelia burgdorferi B31 (section 2 of 70) of the
           complete genome.>gb:AE000783_1119652 Borrelia
           burgdorferi B31 complete genome.
          Length = 555

 Score =  117 bits (292), Expect = 3e-25
 Identities = 60/156 (38%), Positives = 96/156 (61%), Gaps = 3/156 (1%)
 Frame = +1

Query: 283 LPSVLRKSFK---VVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKI 453
           LP++L+K F    +V G  + A    + + + F   +G P  +    +S  ++ +  L I
Sbjct: 17  LPNILKKDFNNISLVYGENTEAIQDRQALKEFFKNTYGLPIISFTEGESS-LSFSKALNI 75

Query: 454 GVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRN 633
           G++LSGG APGGHNVISG+FD +++    S L+GF+GGP G+++   + LT   I  YRN
Sbjct: 76  GIILSGGPAPGGHNVISGVFDAIKKFNPNSKLFGFKGGPLGLLENDKIELTESLINSYRN 135

Query: 634 QGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            GGFD++ SGR KIET + + +A   AK+ +L+ ++
Sbjct: 136 TGGFDIVSSGRTKIETEEHYNKALFVAKENNLNAII 171



>pir|D70102|D70102 pyrophosphate-fructose 6-phosphate
           1-phosphotransferase, beta subunit (pfpB) homolog - Lyme
           disease spirochete
          Length = 555

 Score =  117 bits (292), Expect = 3e-25
 Identities = 60/156 (38%), Positives = 96/156 (61%), Gaps = 3/156 (1%)
 Frame = +1

Query: 283 LPSVLRKSFK---VVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKI 453
           LP++L+K F    +V G  + A    + + + F   +G P  +    +S  ++ +  L I
Sbjct: 17  LPNILKKDFNNISLVYGENTEAIQDRQALKEFFKNTYGLPIISFTEGESS-LSFSKALNI 75

Query: 454 GVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRN 633
           G++LSGG APGGHNVISG+FD +++    S L+GF+GGP G+++   + LT   I  YRN
Sbjct: 76  GIILSGGPAPGGHNVISGVFDAIKKFNPNSKLFGFKGGPLGLLENDKIELTESLINSYRN 135

Query: 634 QGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            GGFD++ SGR KIET + + +A   AK+ +L+ ++
Sbjct: 136 TGGFDIVSSGRTKIETEEHYNKALFVAKENNLNAII 171



>pir|S52081|S52081 diphosphate-fructose-6-phosphate
           1-phosphotransferase (EC 2.7.1.90) - Giardia
           lamblia>gb:GLU12337_1385381 Giardia lamblia WB inorganic
           pyrophosphate-linked phosphofructokinase (GLPFK) gene,
           complete cds.
          Length = 544

 Score =  116 bits (290), Expect = 5e-25
 Identities = 60/127 (47%), Positives = 81/127 (63%)
 Frame = +1

Query: 352 EEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEH 531
           ++IA LFP     P   + PD +G   +    ++GV+ SGGQAPGGHNV+ G++D LQ+ 
Sbjct: 39  QDIAALFPKTTHLPLLDIQPD-TGAPKLLEPKRVGVIFSGGQAPGGHNVLCGLYDKLQQI 97

Query: 532 CKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEET 711
              S L GF+ GP G+M  KYV LT +++ P+RN GGF  I SGRDKI  P+ F  A +T
Sbjct: 98  APKSVLLGFQNGPKGLMTNKYVELTEKFLEPFRNMGGFHAIGSGRDKIAKPEDFDAAAKT 157

Query: 712 AKKLDLD 732
           AK  +LD
Sbjct: 158 AKDNNLD 164



>pir|C71312|C71312 probable pyrophosphate-fructose 6-phosphate
           1-phosphotransferase, beta subunit - syphilis
           spirochete>gb:AE001229_33367 Treponema pallidum subsp.
           pallidum str. Nichols section 45 of 87 of the complete
           genome.>gb:AE000520_1049595 Treponema pallidum subsp.
           pallidum str. Nichols complete genome.
          Length = 573

 Score =  114 bits (284), Expect = 2e-24
 Identities = 68/176 (38%), Positives = 99/176 (56%), Gaps = 10/176 (5%)
 Frame = +1

Query: 244 SEVQNSRLDHPLPLPSVLRKSFKVV---DGPASSAAGHPEEIAKLFPGLFGQPSAALV-- 408
           S +Q  R  +   +P +LR  F+ V    G +++A    + +  LF   +GQP    V  
Sbjct: 4   SLLQQERHRYLPKVPDLLRGDFRRVCARRGLSTTAVADYDALRSLFARTYGQPLVNFVNA 63

Query: 409 PDDSGDVAMN-----HNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPA 573
            + + D  M        L++ +VLSGGQAPGGHNVI+G+FD L+     S L GF GGPA
Sbjct: 64  SEKNEDSPMETAPEPRGLRVAIVLSGGQAPGGHNVIAGLFDGLKRWHADSVLIGFLGGPA 123

Query: 574 GIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           G++   ++ +  + +  YRN GGFD+I SGR KIE+  QF  A +T  ++ LD LV
Sbjct: 124 GVLSGDHIEICADRVDAYRNTGGFDLIGSGRTKIESESQFAAAAQTVTRMALDALV 179



>gb:AF013986_1231810 Entamoeba histolytica PPi-dependent
           phosphofructokinase (ehpfk) mRNA, complete cds.
          Length = 546

 Score =  108 bits (269), Expect = 1e-22
 Identities = 60/168 (35%), Positives = 97/168 (57%), Gaps = 2/168 (1%)
 Frame = +1

Query: 244 SEVQNSRLDHPLPLPSVLRK--SFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDD 417
           S +   RL +   LP  +    +  + +G  + +A + +E+++LF   +G P   +V   
Sbjct: 4   SALHKYRLQYKPVLPKHIADIDNITIEEGAKTQSAVNQKELSELFKHTYGLPICNIVAGK 63

Query: 418 SGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYV 597
           + D+  +  ++ G +LSGG A GGHNV++G+FD L +  K + LYGFR G  GI+   Y+
Sbjct: 64  NADI--HRVIRCGFILSGGPAAGGHNVVAGLFDGLMKGNKENKLYGFRCGAGGILSNDYI 121

Query: 598 ILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            +T E +  +RN GGFD++ SGR KIET +QF  A +    L L+ +V
Sbjct: 122 EITAELVDKHRNTGGFDLVGSGRTKIETEEQFATAFKHITALKLNAMV 169



>pir|F72111|F72111 fructose-6-p phosphotransferase - Chlamydophila
           pneumoniae  (strain CWL029)>gb:AE001603_37025 Chlamydia
           pneumoniae section 19 of 103 of the complete
           genome.>gb:AE001363_941582 Chlamydia pneumoniae,
           complete genome.
          Length = 555

 Score =  107 bits (267), Expect = 2e-22
 Identities = 60/137 (43%), Positives = 79/137 (57%)
 Frame = +1

Query: 331 SSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGI 510
           SS    P E+ K  P L   P  ++  +       +  LKIGV+LSGGQAPGGHNV+ G+
Sbjct: 38  SSPPSPPPELQKHIPNLCRIPEVSIYTEQE---TSSKPLKIGVLLSGGQAPGGHNVVIGL 94

Query: 511 FDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQ 690
           FD L+     + L+GF  GP G+ +  Y  L    IY Y N GGFDM+ S R+KI+T +Q
Sbjct: 95  FDALRVFNPKTRLFGFIKGPLGLTRGLYKDLDISVIYDYYNMGGFDMLSSSREKIKTEEQ 154

Query: 691 FKQAEETAKKLDLDGLV 741
            K    T K+L LDGL+
Sbjct: 155 KKNILNTVKQLKLDGLL 171



>pir|H86510|H86510 fructose-6-P phosphotransferase [imported] -
           Chlamydophila pneumoniae (strain J138)>pir|A81560|A81560
           pyrophosphate-fructose 6-phosphate 1-phosphotransferase,
           beta chain CP0611 [imported] - Chlamydophila pneumoniae 
           (strain AR39)>gb:AE002218_44088 Chlamydophila pneumoniae
           AR39, section 46 of 94 of the complete
           genome.>gb:AE017157_393506 Chlamydophila pneumoniae
           TW-183, section 1 of 4 of the complete
           genome.>gb:BA000008_663533 Chlamydophila pneumoniae J138
           genomic DNA, complete sequence.>gb:AE002161_886213
           Chlamydophila pneumoniae AR39, complete
           genome.>gb:AE009440_1027768 Chlamydophila pneumoniae
           TW-183, complete genome.
          Length = 544

 Score =  107 bits (267), Expect = 2e-22
 Identities = 60/137 (43%), Positives = 79/137 (57%)
 Frame = +1

Query: 331 SSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGI 510
           SS    P E+ K  P L   P  ++  +       +  LKIGV+LSGGQAPGGHNV+ G+
Sbjct: 38  SSPPSPPPELQKHIPNLCRIPEVSIYTEQE---TSSKPLKIGVLLSGGQAPGGHNVVIGL 94

Query: 511 FDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQ 690
           FD L+     + L+GF  GP G+ +  Y  L    IY Y N GGFDM+ S R+KI+T +Q
Sbjct: 95  FDALRVFNPKTRLFGFIKGPLGLTRGLYKDLDISVIYDYYNMGGFDMLSSSREKIKTEEQ 154

Query: 691 FKQAEETAKKLDLDGLV 741
            K    T K+L LDGL+
Sbjct: 155 KKNILNTVKQLKLDGLL 171



>gb:AE016996_374667 Chlamydophila caviae GPIC section 3 of 4 of the
           complete genome.>gb:AE015925_994346 Chlamydophila caviae
           GPIC complete genome.
          Length = 539

 Score =  105 bits (261), Expect = 1e-21
 Identities = 60/146 (41%), Positives = 82/146 (56%)
 Frame = +1

Query: 304 SFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAP 483
           S  +VD     A   P+ + +  P L   P   +   + G+   +  LKIGV+LSGGQAP
Sbjct: 31  SLHIVDSTEPPAI--PKNLQEHIPNLCSIPEVTI---EKGEATPSQPLKIGVLLSGGQAP 85

Query: 484 GGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSG 663
           GGHNV+ G+F+ L+     + LYGF  GP G+ +  Y  L    IY Y N GGFDM+ S 
Sbjct: 86  GGHNVVIGLFEGLRAFNPKTKLYGFIQGPLGLTRGLYKDLDISVIYDYYNVGGFDMLSSS 145

Query: 664 RDKIETPDQFKQAEETAKKLDLDGLV 741
           ++KI+T +Q      T KKL LDGL+
Sbjct: 146 KEKIKTKEQKSTILTTVKKLKLDGLL 171



>pir|E81698|E81698 pyrophosphate-fructose 6-phosphate
           1-phosphotransferase, beta chain TC0479 [imported] -
           Chlamydia muridarum (strain Nigg)>gb:AE002316_45066
           Chlamydia muridarum Nigg section 47 of 85 of the
           complete genome.>gb:AE002160_1149206 Chlamydia muridarum
           Nigg, complete genome.
          Length = 548

 Score =  105 bits (261), Expect = 1e-21
 Identities = 57/138 (41%), Positives = 84/138 (60%)
 Frame = +1

Query: 328 ASSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISG 507
           ++S+  +P  +AK  P L   P+  +     GD + +  L+IGV+LSGGQAPGGHNV+ G
Sbjct: 37  SASSEPNPGLLAKHIPHLCALPNLTI---QKGDRSSSEPLRIGVLLSGGQAPGGHNVVIG 93

Query: 508 IFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPD 687
           +F+ L+   K + L+GF  GP G+++  Y  L    IY Y N GGFDM+ S ++KI+T +
Sbjct: 94  LFEGLRAFNKETKLFGFIKGPLGLIRGLYKDLDISVIYDYYNAGGFDMLSSSKEKIKTKE 153

Query: 688 QFKQAEETAKKLDLDGLV 741
           Q      T KK+ L GL+
Sbjct: 154 QKSAILSTVKKMKLHGLL 171



>gb:PFA929356_1393375 Plasmodium falciparum strain 3D7, chromosome
           9; segment 2/5.
          Length = 1418

 Score =  103 bits (257), Expect = 3e-21
 Identities = 60/170 (35%), Positives = 89/170 (52%), Gaps = 4/170 (2%)
 Frame = +1

Query: 244 SEVQNSRLDHPLPLPSVLRKSFKVVD---GPASSAAGHPEEIAKLFPGLFGQPSAALVPD 414
           S +Q  R  +   LP  L   ++++D   G         E++ +    L   P   +   
Sbjct: 109 SPLQYERTKYIPSLPKALASEYQILDENYGDEFINKNDYEDVKRFLKNLHNLPMLNVKDS 168

Query: 415 DSGDVAMNHN-LKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCK 591
           ++ +     N LKIG++LSGG APGGHNVISGI+DY + + + S + GF GG  G+    
Sbjct: 169 NNNESFKGGNILKIGIILSGGPAPGGHNVISGIYDYAKRYNEQSQVIGFLGGIDGLYSKN 228

Query: 592 YVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           YV +T   +  +RN GGF+M+ SGR K++  D     E    KL L+GLV
Sbjct: 229 YVTITDSMMNRFRNLGGFNMLWSGRGKVKNKDDLIAIENIVAKLKLNGLV 278



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 47/172 (27%), Positives = 80/172 (46%), Gaps = 6/172 (3%)
 Frame = +1

Query: 244  SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHP---EEIAKLFPGLFGQPSAAL--V 408
            SE+Q SRL + L LP +       V       +  P   ++I   +P +  +    +  +
Sbjct: 779  SELQTSRLYNKLELPELCSDLKAKVRAGKQYISNDPYTQKQILSNYPHMSYENKFQIQEI 838

Query: 409  PDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKC 588
              D     ++  ++IG+V    QAPG  NV+ G++  L +  KG  +  +  G  G++  
Sbjct: 839  FHDKYASPISFEIRIGIVFLSRQAPGAMNVLCGLYRRL-KLLKGVCIAFY--GLYGLLHN 895

Query: 589  KYVILTPEYIYPYRNQGGFDMI-CSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            KY+I+  + I  Y NQGG ++   S    +   +   +  ET  KL L+GLV
Sbjct: 896  KYIIIDDDNIAKYVNQGGLELTGNSPEHSLFDKENRNKVCETVTKLQLNGLV 947



>pir|D86342|D86342 hypothetical protein F9H16.6 - Arabidopsis
           thaliana>gb:AE005172_891055 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC007369_1535806 Arabidopsis thaliana
           chromosome I BAC F9H16 genomic sequence, complete
           sequence.>gb:AY059855_1564699 Arabidopsis thaliana
           pyrophosphate-dependent phosphofructokinase alpha
           subunit (At1g20950; F9H16.6) mRNA, complete
           cds.>gb:BT008374_1639591 Arabidopsis thaliana At1g20950
           gene, complete cds.
          Length = 614

 Score =  102 bits (254), Expect = 7e-21
 Identities = 63/175 (36%), Positives = 96/175 (54%), Gaps = 9/175 (5%)
 Frame = +1

Query: 244 SEVQNSRLDHPLPLPSVLRKS---FKVVDGPASSAAGHPEEIAKLFPGLFGQPSA----- 399
           S +Q  R  +   LP  L+ +    ++ DG   + A     +A+ FP   GQP A     
Sbjct: 12  SPLQQLRSQYKPELPPCLQGTTVRVELGDGTTVAEAADSHTMARAFPHTLGQPLAHFLRE 71

Query: 400 -ALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAG 576
            A VPD +  +    ++++G+V  G QAPGGHNVI G+F+ L+ H   STL GF GG  G
Sbjct: 72  TAQVPD-AHIITELPSVRVGIVFCGRQAPGGHNVIWGLFEALKVHNAKSTLLGFLGGSEG 130

Query: 577 IMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           +   K + +T + +  Y+NQGG+D++   +D+I+T +Q   A +    L LDGLV
Sbjct: 131 LFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIKTTEQVNAALKACTDLKLDGLV 185



>pir|A71544|A71544 probable diphosphate-fructose-6-phosphate
           1-phosphotransferase (EC 2.7.1.90) - Chlamydia
           trachomatis  (serotype D, strain
           UW3/Cx)>gb:AE001294_34134 Chlamydia trachomatis
           D/UW-3/CX section 21 of 87 of the complete
           genome.>gb:AE001273_1098160 Chlamydia trachomatis
           D/UW-3/CX, complete genome.
          Length = 548

 Score =  102 bits (253), Expect = 1e-20
 Identities = 60/146 (41%), Positives = 83/146 (56%)
 Frame = +1

Query: 304 SFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAP 483
           S  + + P+S  A   + +AK  P L   P   L  D       +  L+IGV+LSGGQAP
Sbjct: 31  SMHIQEKPSSEPAS--DLLAKHIPHLCALPDLTLQKDAPSS---SEPLRIGVLLSGGQAP 85

Query: 484 GGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSG 663
           GGHNV+ G+F+ L+   K + L+GF  GP G+++  Y  L    IY Y N GGFDM+ S 
Sbjct: 86  GGHNVVIGLFEGLRAFNKETKLFGFIKGPLGLIRGLYKDLDISVIYDYYNAGGFDMLSSS 145

Query: 664 RDKIETPDQFKQAEETAKKLDLDGLV 741
           R+KI+T +Q      T KK+ L GL+
Sbjct: 146 REKIKTKEQKSAILATVKKMKLHGLL 171



>gb:AF095521_1767766 Citrus X paradisi pyrophosphate-dependent
           phosphofructokinase alpha subunit (PPi-PFKa) mRNA,
           complete cds.
          Length = 615

 Score =  101 bits (251), Expect = 2e-20
 Identities = 64/176 (36%), Positives = 95/176 (53%), Gaps = 10/176 (5%)
 Frame = +1

Query: 244 SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEE---IAKLFPGLFGQPSA----- 399
           S +Q  R  +   LP  L+ +   V+   S+    P +   I++ FP  +GQP A     
Sbjct: 12  SGLQQLRSLYQPELPPCLQGTTVRVEFGDSTTTADPADTHSISRSFPHTYGQPLAHFLRA 71

Query: 400 -ALVPDDSGDVAMNHN-LKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPA 573
            A VPD    +   H  +++G+V  G Q+PGGHNV+ G++D ++ H   STL GF GG  
Sbjct: 72  TAKVPD--AQIITEHPAIRVGIVFCGRQSPGGHNVVWGLYDAIKLHNPKSTLLGFLGGSE 129

Query: 574 GIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           G+   K + +T E    Y+NQGG+DM+   +D+I T +Q   A    K L+LDGLV
Sbjct: 130 GLFAQKTLEVTKEIFSTYKNQGGYDMLGRTKDQIRTTEQVNAALTACKNLNLDGLV 185



>pir|E96793|E96793 hypothetical protein F14G6.15 [imported] -
           Arabidopsis thaliana>gb:AE005173_895186 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC015450_1538047 Arabidopsis thaliana
           chromosome 1 BAC F14G6 genomic sequence, complete
           sequence.
          Length = 617

 Score =  100 bits (249), Expect = 3e-20
 Identities = 62/174 (35%), Positives = 91/174 (52%), Gaps = 8/174 (4%)
 Frame = +1

Query: 244 SEVQNSRLDHPLPLPSVLRKS---FKVVDGPASSAAGHPEEIAKLFPGLFGQPSA----A 402
           S +Q  R  +   LP  L+ +    ++ DG   + AG    IA+ FP   GQP A    A
Sbjct: 12  SPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAGDAHIIARAFPHTLGQPLAHFLRA 71

Query: 403 LVPDDSGDVAMNHNLK-IGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGI 579
                   +   H +K +G+V  G QAPGGHNV+ G+++ L+ H   +TL GF GG  G+
Sbjct: 72  TAKVADAQIITEHPVKRVGIVFCGRQAPGGHNVVWGLYEALKVHNAKNTLLGFLGGSEGL 131

Query: 580 MKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
              K + +T E +  Y+NQGG+DM+   +D+I T +Q   A +    L LD LV
Sbjct: 132 FAQKTLEITDEVLQTYKNQGGYDMLGRTKDQIRTTEQVNAALKACTDLKLDSLV 185



>pir|H86516|H86516 fructose-6-P phosphotransferase [imported] -
           Chlamydophila pneumoniae (strain J138)>pir|A72106|A72106
           pyrophosphate-fructose 6-phosphate 1-phosphotransferase,
           beta chain CP0559 [imported] - Chlamydophila pneumoniae 
           (strains CWL029 and AR39)>gb:AE001607_37073 Chlamydia
           pneumoniae section 23 of 103 of the complete
           genome.>gb:AE002214_44037 Chlamydophila pneumoniae AR39,
           section 42 of 94 of the complete
           genome.>gb:AE017157_393557 Chlamydophila pneumoniae
           TW-183, section 1 of 4 of the complete
           genome.>gb:BA000008_663581 Chlamydophila pneumoniae J138
           genomic DNA, complete sequence.>gb:AE002161_886162
           Chlamydophila pneumoniae AR39, complete
           genome.>gb:AE001363_941630 Chlamydia pneumoniae,
           complete genome.>gb:AE009440_1027819 Chlamydophila
           pneumoniae TW-183, complete genome.
          Length = 550

 Score = 99.8 bits (247), Expect = 5e-20
 Identities = 59/158 (37%), Positives = 90/158 (56%), Gaps = 4/158 (2%)
 Frame = +1

Query: 280 PLPSVLRKSFKVVDGPASSAAGHPEEIAK----LFPGLFGQPSAALVPDDSGDVAMNHNL 447
           PLP   +++  ++  P +S   H + +      LFP  +  P    V    G+  ++  L
Sbjct: 18  PLPKEFQEAASLIAVPDTS---HSKPVVPGVKTLFPQTYHLPYLKFV---QGENVVHTPL 71

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           K+GV+ SGG APGGHNVI G+F+ L++    S+L GF     G+   K + +T E++  +
Sbjct: 72  KVGVMFSGGPAPGGHNVIQGLFNSLKDFHPDSSLVGFVNNGDGLTNNKSIDITEEFLSKF 131

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           RN GGF+ I +GR KI TP+  +   +TA+ LDLDGLV
Sbjct: 132 RNSGGFNCIGTGRKKIVTPEAKEACLKTAEALDLDGLV 169



>sp|Q41140|PFPA_RICCO Pyrophosphate--fructose 6-phosphate
           1-phosphotransferase alpha subunit (EC 2.7.1.90) (PFP)
           (6-phosphofructokinase, pyrophosphate dependent)
           (Pyrophosphate-dependent 6-phosphofructose-1-kinase)
           (PPi-PFK).>pir|T10102|T10102
           diphosphate-fructose-6-phosphate 1-phosphotransferase
           (EC 2.7.1.90) alpha chain - castor
           bean>gb:RCPDPAS_1703389 R.communis gene for
           pyrophosphate-dependent phosphofructokinase alpha
           subunit.
          Length = 617

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 59/174 (33%), Positives = 96/174 (55%), Gaps = 8/174 (4%)
 Frame = +1

Query: 244 SEVQNSRLDHPLPLPSVLRKS---FKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPD 414
           S++Q  R  +   LP  L+ +    ++ DG  + +      I++ FP  +GQP A  +  
Sbjct: 12  SDLQKLRSLYKPELPPCLQGTTVRVELGDGTTACSEAGAHTISRSFPHTYGQPLAHFLRA 71

Query: 415 -----DSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGI 579
                D+  ++ +  +++GVV  G Q+PGGHNV+ G+ + L+ H   STL GF GG  G+
Sbjct: 72  TAKVADAHIISEHPAMRVGVVFCGRQSPGGHNVVWGLHNALKIHNPNSTLLGFLGGSEGL 131

Query: 580 MKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
              K + +T + +  Y+NQGG+D++   +D+I T +Q   A  T K L LDGLV
Sbjct: 132 FAQKTLEVTDDILSTYKNQGGYDLLGRTKDQIRTTEQVHAALTTCKNLKLDGLV 185



>gb:AP004459_1841305 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0410E11.
          Length = 617

 Score = 99.0 bits (245), Expect = 8e-20
 Identities = 62/167 (37%), Positives = 89/167 (53%), Gaps = 4/167 (2%)
 Frame = +1

Query: 253 QNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHP--EEIAKLFPGLFGQPSAALV--PDDS 420
           Q   L  P   P +   + KV  G A++         +A+ FP  +GQP  + V  P D+
Sbjct: 17  QRRSLYQPTLPPCLQGATVKVEYGDATTTIDPTCANVVAQAFPRTYGQPLVSFVAPPPDA 76

Query: 421 GDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVI 600
            D      +++GVV SG Q+PGGHNVI G+ D L+ +   S LYGF GG  G+   K + 
Sbjct: 77  VDKD-RAPIRVGVVFSGRQSPGGHNVIWGLHDALKAYNPHSVLYGFVGGTEGLFANKTIE 135

Query: 601 LTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           +T + +  Y+NQGGFD++    D+I +  Q   A  T   L+LDGLV
Sbjct: 136 ITDDVLASYKNQGGFDLLGRSIDQIRSTKQVNAAMTTCNNLNLDGLV 182



>gb:AP004011_1836346 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC
           clone:OJ1381_H04.>gb:AP004756_1844495 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, PAC
           clone:P0592C05.
          Length = 618

 Score = 98.2 bits (243), Expect = 1e-19
 Identities = 65/190 (34%), Positives = 95/190 (50%), Gaps = 6/190 (3%)
 Frame = +1

Query: 190 NSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLR-KSFKVVDGPASSAAGHP--EEI 360
           N+D+   +  TG        +Q  R  +   LP  L  K+ +V  G +++         +
Sbjct: 2   NADLGKPRELTG--------LQQRRALYQPELPPCLEGKAIRVEFGDSTTTIDPTCANMV 53

Query: 361 AKLFPGLFGQPSAALVPDDSGDVAMNHN---LKIGVVLSGGQAPGGHNVISGIFDYLQEH 531
            + FP  FGQP    +  +  D   N     +++GVV SG Q+PGGHNVI GI+D ++  
Sbjct: 54  VQEFPNTFGQPLVHFLKPNKMDAQANDEHPPIRVGVVFSGRQSPGGHNVIWGIYDAMKTQ 113

Query: 532 CKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEET 711
              S L GF GG  G+   + + +T + +  YRNQGGFD +    D+I T +Q   A  T
Sbjct: 114 NLQSVLLGFIGGTEGLFANQTLEITDDVLSAYRNQGGFDFLGRTVDQIHTTEQVNAAMST 173

Query: 712 AKKLDLDGLV 741
              LDLDGLV
Sbjct: 174 CCDLDLDGLV 183



>sp|P21342|PFPA_SOLTU Pyrophosphate--fructose 6-phosphate
           1-phosphotransferase alpha subunit (EC 2.7.1.90) (PFP)
           (6-phosphofructokinase, pyrophosphate-dependent)
           (Pyrophosphate-dependent 6-phosphofructose-1-kinase)
           (PPi-PFK).>pir|A36094|A36094
           diphosphate-fructose-6-phosphate 1-phosphotransferase
           (EC 2.7.1.90) alpha chain - potato (cv.
           Kennebec)>gb:POTPFPA_1701131 Potato
           pyrophosphate-fructose 6-phosphate 1-phosphotransferase
           (PFP) alpha-subunit mRNA, complete cds.
          Length = 616

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 63/176 (35%), Positives = 93/176 (52%), Gaps = 10/176 (5%)
 Frame = +1

Query: 244 SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHP---EEIAKLFPGLFGQPSA----- 399
           S++Q  R  +   LP  L+ +   V+   ++ A  P     I + FP  +GQP A     
Sbjct: 12  SDLQKLRSHYHPELPPCLQGTTVRVELRDATTAADPAGEHTIKRFFPHTYGQPLAHFLRA 71

Query: 400 -ALVPDDSGDVAMNHN-LKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPA 573
            A VPD    +   H  +++GV+  G Q+PGGHNVI G+ D L+ H   + L GF GG  
Sbjct: 72  TAKVPD--AQIITEHPAIRVGVLFCGRQSPGGHNVIWGLHDALKVHNPKNILLGFLGGSE 129

Query: 574 GIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           G+   K + +T + +  Y+NQGG+DM+   +D+I T +Q   A    K L LDGLV
Sbjct: 130 GLFAQKTLEITDDVLATYKNQGGYDMLGRTKDQIRTTEQVNAAMAACKALKLDGLV 185



>gb:AP004165_1838461 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1479_B12.
          Length = 617

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 63/175 (36%), Positives = 96/175 (54%), Gaps = 9/175 (5%)
 Frame = +1

Query: 244 SEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHP---EEIAKLFPGLFGQPSA----- 399
           SEVQ  R  +   LP  L+ +   V+   ++ A  P     I+  FP  +GQP A     
Sbjct: 12  SEVQKKRALYQPELPPCLQGTTVRVEYGDAAIAADPAGAHVISHAFPHTYGQPLAHFLRK 71

Query: 400 -ALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAG 576
            A VPD +  ++ +  +++GVV  G Q+PGGHNVI G+ + ++ H   S L GF GG  G
Sbjct: 72  TANVPDATV-ISEHPVVRVGVVFCGRQSPGGHNVIWGLHEAIKAHNPNSKLIGFLGGSDG 130

Query: 577 IMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           ++  K + +T E +  Y+NQGG+DM+   +D+I T +Q   A  + + L LD LV
Sbjct: 131 LLAQKTLEITDEVLSSYKNQGGYDMLGRTKDQIRTTEQVNGAMASCQALKLDALV 185



>gb:AP004757_1844516 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0652D10.
          Length = 617

 Score = 97.1 bits (240), Expect = 3e-19
 Identities = 67/176 (38%), Positives = 95/176 (53%), Gaps = 10/176 (5%)
 Frame = +1

Query: 244 SEVQNSRLDHPLPLPSVLR-KSFKVVDGPASSAA--GHPEEIAKLFPGLFGQPSA----- 399
           S +Q +R  +   LP  L+  + KV  G A+ AA       I+  FP  +GQP A     
Sbjct: 12  SALQKARALYRPDLPPCLQGTTVKVEYGDAAIAADVAGAHVISHAFPHTYGQPLAHFLRK 71

Query: 400 -ALVPDDSGDVAMNHNL-KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPA 573
            A VPD +  V   H + ++GVV SG Q+PGGHNVI G+ D ++ H   S L GF GG  
Sbjct: 72  TAAVPDAT--VITEHPVVRVGVVFSGRQSPGGHNVIWGLHDAIKAHNANSKLIGFLGGTD 129

Query: 574 GIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           G+   K + ++ E +  Y+NQGG+D++   RD+I T +Q   A    + L LD LV
Sbjct: 130 GLFAQKTLEISDEVLSSYKNQGGYDLLGRTRDQIRTTEQVNAAMTACQALKLDALV 185



>gb:AE014186_938257 Plasmodium falciparum 3D7 chromosome 11 complete
           sequence.>gb:AE014840_1228991 Plasmodium falciparum 3D7
           chromosome 11 section 5 of 8 of the complete sequence.
          Length = 1570

 Score = 92.8 bits (229), Expect = 6e-18
 Identities = 46/102 (45%), Positives = 67/102 (65%)
 Frame = +1

Query: 436 NHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEY 615
           +  L IG++ +G Q PGGHN+I G+FD L++  K +TLYGF  G  G++K  ++ L  EY
Sbjct: 129 HEKLNIGILFTGQQTPGGHNIICGVFDCLKKKNKKNTLYGFMNGFQGMLKYNFMELKNEY 188

Query: 616 IYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           I  +RN GGFDMI S   +I   DQ K+  +  ++L+L+GLV
Sbjct: 189 ISMFRNSGGFDMIKSSDIQIINEDQKKKCFKICRQLNLNGLV 230



>gb:AE016996_374665 Chlamydophila caviae GPIC section 3 of 4 of the
           complete genome.>gb:AE015925_994344 Chlamydophila caviae
           GPIC complete genome.
          Length = 551

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 61/157 (38%), Positives = 84/157 (53%), Gaps = 3/157 (1%)
 Frame = +1

Query: 280 PLPSVLRKSFKVVDGPASSAAGHPE---EIAKLFPGLFGQPSAALVPDDSGDVAMNHNLK 450
           PLP  L+K   +V    S     P+   ++AKLFP  +  P        SG +     LK
Sbjct: 18  PLPRELQKFPSLV--ATSDQRFSPKFDADVAKLFPNTYDSPYLKFT---SGTLPTLQPLK 72

Query: 451 IGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYR 630
           +GV+LSGG APGGHNVI G+   L++    S+L GF     GI+    V +T E++  +R
Sbjct: 73  VGVMLSGGPAPGGHNVIWGLLHSLKKIHPDSSLIGFLDNGQGILNNNTVEITEEFMECFR 132

Query: 631 NQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           N GGF+ I +GR  I T +      +T K L+LDGLV
Sbjct: 133 NSGGFNCIGTGRTNIITEENKAACLKTVKALNLDGLV 169



>pir|C81698|C81698 pyrophosphate-fructose 6-phosphate
           1-phosphotransferase, beta chain TC0477 [imported] -
           Chlamydia muridarum (strain Nigg)>gb:AE002316_45064
           Chlamydia muridarum Nigg section 47 of 85 of the
           complete genome.>gb:AE002160_1149204 Chlamydia muridarum
           Nigg, complete genome.
          Length = 553

 Score = 90.5 bits (223), Expect = 3e-17
 Identities = 54/132 (40%), Positives = 77/132 (58%), Gaps = 2/132 (1%)
 Frame = +1

Query: 352 EEIAKLFPGLFGQPSAALVP--DDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQ 525
           E +A+LFP  +  P    +P  D   D+A    LK+GV+LSGG APGGHNVI G+   ++
Sbjct: 43  ETVAQLFPCTYESPYRKFIPKSDLPLDIAP---LKVGVMLSGGPAPGGHNVILGLLHSIK 99

Query: 526 EHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAE 705
           +    S L GF     G++    V +T E++  +RN GGF+ I +GR  I T +   +  
Sbjct: 100 KLHPHSKLLGFIRNGHGLLNNNTVEITEEFMKEFRNSGGFNCIGTGRTNIITEENKARCL 159

Query: 706 ETAKKLDLDGLV 741
           +TA +LDLDGLV
Sbjct: 160 QTANQLDLDGLV 171



>pir|G71543|G71543 probable fructose-6-phosphate phosphotransferase
           - Chlamydia trachomatis (serotype D, strain
           UW3/Cx)>gb:AE001294_34132 Chlamydia trachomatis
           D/UW-3/CX section 21 of 87 of the complete
           genome.>gb:AE001273_1098158 Chlamydia trachomatis
           D/UW-3/CX, complete genome.
          Length = 553

 Score = 90.5 bits (223), Expect = 3e-17
 Identities = 52/130 (40%), Positives = 74/130 (56%)
 Frame = +1

Query: 352 EEIAKLFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEH 531
           + +A+LFP  +  P    +   S   A    LK+GV+LSGG APGGHNVI G+   +++ 
Sbjct: 43  DSVAELFPCTYNSPYYKFI-SKSDLSAETSPLKVGVMLSGGPAPGGHNVILGLLHSIKKL 101

Query: 532 CKGSTLYGFRGGPAGIMKCKYVILTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEET 711
              S L GF     G++    V +T E+I  +RN GGF+ I +GR  I T +   +  +T
Sbjct: 102 HPNSQLLGFIRNGEGLLNNNTVEITDEFIEEFRNSGGFNCIGTGRTNIITEENKARCLQT 161

Query: 712 AKKLDLDGLV 741
           A +LDLDGLV
Sbjct: 162 ANELDLDGLV 171



>gb:AY224499_1590701 Oryza sativa (japonica cultivar-group) isolate
           31121 fructose-6-phosphate 1-phosphotransferase mRNA,
           partial cds.
          Length = 449

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 44/98 (44%), Positives = 61/98 (62%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           ++GVV SG Q+PGGHNVI G+ D L+ +   S LYGF GG  G+   K + +T + +  Y
Sbjct: 29  RVGVVFSGRQSPGGHNVIWGLHDALKAYNPHSVLYGFVGGTEGLFANKTIEITDDVLASY 88

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           +NQGGFD++    D+I +  Q   A  T   L+LDGLV
Sbjct: 89  KNQGGFDLLGRSIDQIRSTKQVNAAMTTCNNLNLDGLV 126



>gb:BBPFPB_747520 B.burgdorferi pfpB gene.
          Length = 439

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 21/47 (44%), Positives = 31/47 (65%)
 Frame = +1

Query: 601 LTPEYIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           LT   I  YRN GGFD++ SGR KIET + + +A   AK+ +L+ ++
Sbjct: 9   LTESLINSYRNTGGFDIVSSGRTKIETEEHYNKALFVAKENNLNAII 55



>gb:AF298119_497332 Amycolatopsis methanolica phosphofructokinase
           (pfk) gene, complete cds.
          Length = 459

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 25/65 (38%), Positives = 32/65 (49%), Gaps = 2/65 (3%)
 Frame = +1

Query: 454 GVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGP--AGIMKCKYVILTPEYIYPY 627
           G+V  GG  PG +NVI G+   L  H +   + GFR GP      +   V LTPE +   
Sbjct: 83  GIVTCGGLCPGLNNVIRGLVQELSVHYRVKRIVGFRNGPGLTAAHRDDTVELTPEVVRDI 142

Query: 628 RNQGG 642
            N GG
Sbjct: 143 HNLGG 147



>sp|Q9KH71|PFP_DICTH Pyrophosphate--fructose 6-phosphate
           1-phosphotransferase (EC 2.7.1.90)
           (6-phosphofructokinase, pyrophosphate dependent)
           (Pyrophosphate- dependent 6-phosphofructose-1-kinase)
           (PPi-dependent phosphofructokinase)
           (PPi-PFK).>gb:AF268276_494080 Dictyoglomus thermophilum
           ppi-dependent phosphofructokinase (pfp) gene, complete
           cds.
          Length = 346

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 28/99 (28%), Positives = 49/99 (49%)
 Frame = +1

Query: 445 LKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYP 624
           ++IGV+  GG  PG +  I GI     ++  G  + G + G AG++K   + L+ E +  
Sbjct: 4   MRIGVLTGGGDCPGLNPAIRGIVMRALDY--GDEVIGLKYGWAGLLKADTMPLSLEMVED 61

Query: 625 YRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
               GG  +  S  +  +  +  ++  E  KKL+LD L+
Sbjct: 62  ILEIGGTILGSSRTNPFKKEEDVQKCVENFKKLNLDALI 100



>gb:BA000030_705010 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 341

 Score = 41.2 bits (95), Expect = 0.020
 Identities = 29/100 (29%), Positives = 50/100 (50%), Gaps = 1/100 (1%)
 Frame = +1

Query: 445 LKIGVVLSGGQAPGGHNVI-SGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIY 621
           ++IGV+ SGG  PG + VI S +   + +H  G  + GFR G  G+++C Y+ L  + + 
Sbjct: 1   MRIGVLTSGGDCPGLNAVIRSVVHRAVVDH--GDEVIGFRDGWKGLLECDYLKLDLDAVS 58

Query: 622 PYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
               +GG  +  S        D  ++A     +L LD ++
Sbjct: 59  GILARGGTILGSSRVQPAHLRDGVERARGHVAELGLDAII 98



>gb:AE017263_420727 Mesoplasma florum L1 complete genome.
          Length = 323

 Score = 40.8 bits (94), Expect = 0.026
 Identities = 26/98 (26%), Positives = 50/98 (51%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           +IGV+ SGG APG +N I+G+    +   +G  +YG R G  G++   +  L  ++    
Sbjct: 3   RIGVLTSGGDAPGMNNAIAGVVKAAE--AQGIEVYGVRDGYKGLINGWFEKLDSKFALEI 60

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            ++GG  +  +   + +     ++A +  K  D++ LV
Sbjct: 61  ISKGGTVLGSARLPEFKEESVRQKAVDQLKAHDIEALV 98



>gb:AY386314_615071 Bacillus methanolicus strain MGA3 plasmid pBM19,
           complete sequence.
          Length = 322

 Score = 40.4 bits (93), Expect = 0.034
 Identities = 31/103 (30%), Positives = 49/103 (47%), Gaps = 5/103 (4%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVIS-----GIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPE 612
           KI V+ SGG APG +  I      GIF       KG  +YG + G  G+M   +V +   
Sbjct: 3   KIAVLTSGGDAPGMNAAIRAVVRRGIF-------KGLDVYGVKNGYKGLMNGNFVSMNLG 55

Query: 613 YIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            +    ++GG  +  +   + +T +  +QA    KK  +DGL+
Sbjct: 56  SVGDIIHRGGTILQTTRCKEFKTAEGQQQALAQLKKEGIDGLI 98



>gb:BX842642_822285 Mycoplasma mycoides subsp. mycoides SC genomic
           DNA, complete sequence; segment 1/4.
          Length = 363

 Score = 40.0 bits (92), Expect = 0.045
 Identities = 27/98 (27%), Positives = 47/98 (47%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           KIG++ SGG APG +N I+G+        KG  +YG   G  G++   +  L  E     
Sbjct: 41  KIGILTSGGDAPGMNNAIAGVVKTAAS--KGIEVYGINDGYKGLVNGWFEKLNVEKTLDI 98

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            ++GG  +  +   + +  +  ++A    KK  ++ LV
Sbjct: 99  LSRGGTYLGSARLPEFKELEVRQKAVANLKKAGIEALV 136



>gb:AP006840_568026 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 323

 Score = 40.0 bits (92), Expect = 0.045
 Identities = 29/98 (29%), Positives = 49/98 (50%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           KIGV+ SGG APG +  +       +    G+ + G R G AG++  ++V L    +   
Sbjct: 6   KIGVLTSGGDAPGMNAAVRAAVR--RGISLGAEVVGVRRGYAGLIAGEFVDLGVSSVGDI 63

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            ++GG  +  +  D   TP+   QA   A++  ++GLV
Sbjct: 64  IHRGGTFLQTARSDHFLTPEGQAQALAKAREAGIEGLV 101



>sp|Q9FC99|K6P3_STRCO 6-phosphofructokinase 3 (EC 2.7.1.11)
           (Phosphofructokinase 3) (Phosphohexokinase
           3).>gb:SCO939108_174889 Streptomyces coelicolor A3(2)
           complete genome; segment 5/29.
          Length = 341

 Score = 40.0 bits (92), Expect = 0.045
 Identities = 29/100 (29%), Positives = 51/100 (51%), Gaps = 1/100 (1%)
 Frame = +1

Query: 445 LKIGVVLSGGQAPGGHNVI-SGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIY 621
           ++IGV+ SGG  PG + VI S +   + +H  G  + GFR G  G+++C Y+ L  + + 
Sbjct: 1   MRIGVLTSGGDCPGLNAVIRSVVHRAVVDH--GDEVIGFRDGWKGLLECDYLKLDLDAVG 58

Query: 622 PYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
               +GG  +  S        D  ++A    ++L LD ++
Sbjct: 59  GILARGGTILGSSRVRPEHLRDGVERARGHVEELGLDAII 98



>gb:CP000033_89223 Lactobacillus acidophilus NCFM, complete genome.
          Length = 320

 Score = 38.9 bits (89), Expect = 0.100
 Identities = 25/98 (25%), Positives = 48/98 (48%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           +IG++ SGG APG +  I  +      H  G  ++G R G AG++   ++ LT E +   
Sbjct: 3   RIGILTSGGDAPGMNAAIRAVTKTAIHH--GLEVFGIRYGFAGLVAGDFIPLTTENVDHK 60

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            ++GG  +  +   +    +  ++  E  KK  +D ++
Sbjct: 61  ISEGGTFLYSARFPEFAQEEVQQKGVEQLKKHGIDAVI 98



>sp|Q9WY52|K6PF_THEMA 6-phosphofructokinase (EC 2.7.1.11)
           (Phosphofructokinase)
           (Phosphohexokinase).>pir|C72406|C72406
           6-phosphofructokinase - Thermotoga maritima (strain
           MSB8)>gb:AE001705_38129 Thermotoga maritima MSB8 section
           17 of 136 of the complete genome.>gb:AE000512_1112602
           Thermotoga maritima MSB8, complete genome.
          Length = 319

 Score = 37.7 bits (86), Expect = 0.22
 Identities = 27/98 (27%), Positives = 49/98 (50%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           KI V+ SGG APG +  +  +  Y     +G  + G R G +G++   +V L  + +   
Sbjct: 3   KIAVLTSGGDAPGMNAAVRAVVRYGVR--QGLEVIGVRRGYSGLIDGDFVKLEYKDVAGI 60

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
             +GG  +  S  ++ +T +  + A +  KK  ++GLV
Sbjct: 61  TEKGGTILRTSRCEEFKTEEGRELAAKQIKKHGIEGLV 98



>gb:AE017306_437231 Thermus thermophilus HB27 section 6 of 7 of the
           complete genome.>gb:AP008226_579419 Thermus thermophilus
           HB8 genomic DNA, complete genome.>gb:AE017221_1079209
           Thermus thermophilus HB27 complete genome.
          Length = 322

 Score = 37.0 bits (84), Expect = 0.38
 Identities = 27/98 (27%), Positives = 46/98 (46%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           +IGV  SGG APG +  I  +    Q H  G  + G R G AG+++ + V L    +   
Sbjct: 3   RIGVFTSGGDAPGMNAAIRAVVR--QAHALGVEVIGIRRGYAGMIQGEMVPLGVRDVANI 60

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
             +GG  ++ +   +  T +   +A    +   ++GLV
Sbjct: 61  IQRGGTILLTARSQEFLTEEGRAKAYAKLQAAGIEGLV 98



>sp|Q8EPD6|K6PF_OCEIH 6-phosphofructokinase (EC 2.7.1.11)
           (Phosphofructokinase)
           (Phosphohexokinase).>gb:BA000028_696559 Oceanobacillus
           iheyensis HTE831 DNA, complete genome.
          Length = 319

 Score = 37.0 bits (84), Expect = 0.38
 Identities = 26/98 (26%), Positives = 47/98 (47%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           +IGV+ SGG +PG +  I  +      H     +YG + G  G+M      +T   +   
Sbjct: 3   RIGVLTSGGDSPGMNAAIRAVVRKAIYH--DLEVYGIKNGYQGLMDGNIEKMTLGSVGDI 60

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            ++GG  +  +  ++ +T +   +A E   K ++DGLV
Sbjct: 61  IHRGGTILFSARSEEFKTDEGQFRAIEQLNKHNIDGLV 98



>sp|P21777|K6P1_THETH 6-phosphofructokinase isozyme 1 (EC 2.7.1.11)
           (Phosphofructokinase-1) (PFK1) (Phosphohexokinase
           1).>pir|JQ1028|JQ1028 6-phosphofructokinase (EC
           2.7.1.11) 1 - Thermus aquaticus>gb:TTHPFK1A_198552
           T.thermophilus phosphofructokinase 1 (PFK1) gene,
           complete cds.
          Length = 322

 Score = 37.0 bits (84), Expect = 0.38
 Identities = 27/98 (27%), Positives = 46/98 (46%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           +IGV  SGG APG +  I  +    Q H  G  + G R G AG+++ + V L    +   
Sbjct: 3   RIGVFTSGGDAPGMNAAIRAVVR--QAHALGVEVIGIRRGYAGMIQGEMVPLGVRDVANI 60

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
             +GG  ++ +   +  T +   +A    +   ++GLV
Sbjct: 61  IQRGGTILLTARSQEFLTEEGRAKAYAKLQAAGIEGLV 98



>gb:CP000020_872516 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 320

 Score = 36.6 bits (83), Expect = 0.50
 Identities = 26/98 (26%), Positives = 47/98 (47%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           KIGV+ SGG APG +  + G+        +G  ++G   G  G+++ +   L    +   
Sbjct: 4   KIGVLTSGGDAPGMNAAVRGV--VRTALTEGLEVFGIHDGYLGLVEDRIEKLERHSVSDM 61

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            N+GG  +  +   + +     ++A E  KK D+D L+
Sbjct: 62  INRGGTFLGSARFPEFKEVAVREKAIENLKKHDIDALI 99



>gb:BX248357_762370 Corynebacterium diphtheriae gravis NCTC13129,
           complete genome; segment 4/8.
          Length = 342

 Score = 36.6 bits (83), Expect = 0.50
 Identities = 28/91 (30%), Positives = 45/91 (49%)
 Frame = +1

Query: 445 LKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYP 624
           ++I  + SGG  PG + VI GI     E+  GST+ G++ G  G+M+ K + L  +    
Sbjct: 1   MRIATLTSGGDCPGLNAVIRGIVRTCSEY--GSTVVGYQDGWVGLMEDKRIQLYDDENID 58

Query: 625 YRNQGGFDMICSGRDKIETPDQFKQAEETAK 717
                G  ++ +GR     PD+FK   +  K
Sbjct: 59  RILLRGGTILGTGR---LHPDKFKSGLDQIK 86



>gb:BA000030_703969 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 342

 Score = 36.6 bits (83), Expect = 0.50
 Identities = 27/100 (27%), Positives = 49/100 (49%), Gaps = 1/100 (1%)
 Frame = +1

Query: 445 LKIGVVLSGGQAPGGHNVISGIF-DYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIY 621
           +++GV+  GG  PG + VI G+    +QE+  G    GFR G  G ++   V L    + 
Sbjct: 1   MRVGVLTGGGDCPGLNAVIRGVVRKGVQEY--GYDFVGFRDGWRGPLEGDAVRLDIPAVR 58

Query: 622 PYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
               +GG  +  S  + ++  D  ++ +E   K ++D L+
Sbjct: 59  GILPRGGTILGSSRTNPLKLDDGIRRIKENLAKQEVDALI 98



>gb:BA000030_700708 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 341

 Score = 36.6 bits (83), Expect = 0.50
 Identities = 24/99 (24%), Positives = 47/99 (47%)
 Frame = +1

Query: 445 LKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYP 624
           ++IGV+ +GG  PG + VI  +  +      G  + GF  G AG++  +Y  L    +  
Sbjct: 1   MRIGVLTAGGDCPGLNAVIRSVV-HRAVTMYGDEVIGFEDGYAGLLDGRYRALDLNAVSG 59

Query: 625 YRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
              +GG  +  S   +    +  + A++ A++  +D L+
Sbjct: 60  ILARGGTILGSSRLQRDRLREACENAQDMAREFGIDALI 98



>gb:AE017152_392029 Haemophilus ducreyi strain 35000HP section 2 of
           6 of the complete genome.>gb:AF536817_520336 Haemophilus
           ducreyi 6-phosphofructokinase (pfkA),
           N-acetylglucosamine glycosyltransferase (lgtA), and
           conserved hypothetical protein Hd0467 genes, complete
           cds.>gb:AE017143_1026291 Haemophilus ducreyi strain
           35000HP complete genome.
          Length = 324

 Score = 36.6 bits (83), Expect = 0.50
 Identities = 27/98 (27%), Positives = 46/98 (46%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           KI V+ SGG APG +  I G+        +G  ++G + G  G+   K + L    +   
Sbjct: 7   KIAVLTSGGDAPGMNAAIRGVVRAALN--EGLEIFGVQDGYYGLYHDKVIPLDRRSVSEI 64

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            N+GG  +  +   + +  +  KQA +   K ++D LV
Sbjct: 65  INRGGTFLGSARFPQFKDIEVRKQAVKILAKYEIDALV 102



>gb:EHU12513_1384530 Entamoeba histolytica PPi-dependent
           phosphofructo-1-kinase (PFK) gene, complete cds.
          Length = 382

 Score = 36.2 bits (82), Expect = 0.65
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 2/67 (2%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMK--CKYVILTPEYIY 621
           K+ +V  GG  PG +NVI G+   L      + ++G R G  G++    +   LTPE + 
Sbjct: 37  KVAIVTCGGLCPGLNNVIRGLVLNLYNRYHVNNIFGLRWGYEGLVPELSEVQRLTPEIVS 96

Query: 622 PYRNQGG 642
               +GG
Sbjct: 97  DIHQKGG 103



>gb:AC109596_1738726 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1593_C11, complete
           sequence.>gb:AC144740_1744201 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBa0075A10,
           complete sequence.
          Length = 567

 Score = 35.8 bits (81), Expect = 0.84
 Identities = 20/66 (30%), Positives = 30/66 (45%)
 Frame = +1

Query: 445 LKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYP 624
           +K  +V  GG  PG + VI  +   L      S +YG + G  G     Y+ LTP+ +  
Sbjct: 164 VKACIVTCGGLCPGLNTVIRELVCGLAHMYNVSKIYGIQNGYKGFYSSNYLTLTPKSVDD 223

Query: 625 YRNQGG 642
              +GG
Sbjct: 224 IHKRGG 229



>gb:AE017283_429882 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 402

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 31/112 (27%), Positives = 47/112 (41%), Gaps = 7/112 (6%)
 Frame = +1

Query: 427 VAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILT 606
           V M+   K+G++ +GG  PG +  I G F           L G + G  G+   + + L 
Sbjct: 26  VVMSKKKKVGILTAGGDCPGLNAAIRG-FGKAAIRQHDMELIGIQDGFLGLAGNRTISLD 84

Query: 607 PEYIYPYRNQGGFDMICSGRDKI-------ETPDQFKQAEETAKKLDLDGLV 741
           P  +      GG  ++ + RDK+       E  D      E  +KL LD LV
Sbjct: 85  PRALSGILTVGG-TILGTSRDKVNHMIIDGEERDMVPTIVENYEKLGLDALV 135



>pir|S49458|S49458 diphosphate-fructose-6-phosphate
           1-phosphotransferase (EC 2.7.1.90) [validated] -
           Entamoeba histolytica>gb:EHPPIPFK_1384518 E.histolytica
           mRNA for pyrophosphate-dependent phosphofructokinase.
          Length = 436

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 2/67 (2%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMK--CKYVILTPEYIY 621
           K+ +V  GG  PG +NVI G+   L      + ++G R G  G++    +   LTPE + 
Sbjct: 82  KVAIVTCGGLCPGLNNVIRGLVLNLYNAYHVNNIFGLRWGYEGLVPELSEVQRLTPEIVS 141

Query: 622 PYRNQGG 642
               +GG
Sbjct: 142 DIHQKGG 148



>sp|P20275|K6PF_SPICI 6-phosphofructokinase (EC 2.7.1.11)
           (Phosphofructokinase)
           (Phosphohexokinase).>pir|E35270|E35270
           6-phosphofructokinase (EC 2.7.1.11) - Spiroplasma
           citri>gb:AF012877_468708 Spiroplasma citri ribosomal
           protein S2 (rpsB), elongation factor Ts (tsf), spiralin
           (spi), and 6-phosphofructokinase (pfkA) genes, complete
           cds; and pyruvate kinase (pyk) gene, partial cds.
          Length = 327

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 25/98 (25%), Positives = 45/98 (45%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           KIG++ SGG + G +  I+G+      H KG   Y  R G  G++     ++   +    
Sbjct: 4   KIGILTSGGDSQGMNAAIAGVIK--TAHAKGLETYIIRDGYLGLINNWIEVVDNNFADSI 61

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
              GG  +  +   + + P+  K+A +  KK ++  LV
Sbjct: 62  MLLGGTVIGSARLPEFKDPEVQKKAVDILKKQEIAALV 99



>sp|Q890Z2|K6PF_CLOTE 6-phosphofructokinase (EC 2.7.1.11)
           (Phosphofructokinase)
           (Phosphohexokinase).>gb:AE015944_321515 Clostridium
           tetani E88, section 9 of 10 of the complete
           genome.>gb:AE015927_964304 Clostridium tetani E88,
           complete genome.
          Length = 319

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 25/98 (25%), Positives = 47/98 (47%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           KI V+ SGG APG +  I  +     +  KG T+ G   G  G++  +   +T   +   
Sbjct: 3   KIAVLTSGGDAPGMNAAIRAVVRTGLD--KGITVLGIERGFDGLLNGEIFEMTRRSVADI 60

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
             +GG  +  +  ++ +T +  K+A +  +   ++GLV
Sbjct: 61  IQRGGTILRTARSEEFKTEEGQKKATDILRVFGVEGLV 98



>sp|Q9K843|K6PF_BACHD 6-phosphofructokinase (EC 2.7.1.11)
           (Phosphofructokinase)
           (Phosphohexokinase).>pir|D84045|D84045
           6-phosphofructokinase pfk [imported] - Bacillus
           halodurans  (strain C-125)>gb:BA000004_657110 Bacillus
           halodurans C-125 DNA, complete genome.
          Length = 319

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 26/98 (26%), Positives = 47/98 (47%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           +IGV+ SGG +PG +  I  +      H  G  +YG   G AG++      +    +   
Sbjct: 3   RIGVLTSGGDSPGMNAAIRAVVRKAIYH--GVEVYGIYQGYAGLISGDIRKMELGSVGDI 60

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            ++GG  +  +  ++ +T +  K+  E  KK  ++GLV
Sbjct: 61  IHRGGTILYTARCEEFKTLEGQKKGIEQLKKFGIEGLV 98



>gb:BX936398_834719 Yersinia pseudotuberculosis IP32953 genome,
           complete sequence.
          Length = 327

 Score = 35.0 bits (79), Expect = 1.4
 Identities = 27/98 (27%), Positives = 44/98 (44%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           KIGV+ SGG APG +  I G+         G  ++G   G  G+ + +   L    +   
Sbjct: 4   KIGVLTSGGDAPGMNAAIRGVVRAALS--AGLDVFGIEDGYLGLYENRMKKLDRYSVSDM 61

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            N+GG  +  +   +   P+  K A +   +  +DGLV
Sbjct: 62  INRGGTFLGSARFPEFRDPEVRKVALKNMHERGIDGLV 99



>gb:BA000043_739317 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 319

 Score = 35.0 bits (79), Expect = 1.4
 Identities = 27/98 (27%), Positives = 46/98 (46%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           +IGV+ SGG +PG +  I  +      H  G  +YG   G AG++      L    +   
Sbjct: 3   RIGVLTSGGDSPGMNAAIRAVVRKAIYH--GVEVYGIYHGYAGLIAGNIKKLEVGDVGDI 60

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            ++GG  +  +   + +T +  K+  E  KK  ++GLV
Sbjct: 61  IHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLV 98



>gb:AP006628_566716 Onion yellows phytoplasma OY-M DNA, complete
           genome.
          Length = 332

 Score = 35.0 bits (79), Expect = 1.4
 Identities = 30/101 (29%), Positives = 44/101 (43%), Gaps = 1/101 (0%)
 Frame = +1

Query: 442 NLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIY 621
           N KI V+ SGG APG +  I  +    +   +G  ++G + G  G+   +  IL P+   
Sbjct: 15  NKKIAVLTSGGDAPGMNAAIRAL--VFESAKQGFEVFGVKDGYLGLFNNQIEILNPQTFP 72

Query: 622 PYRNQGGFDMICSG-RDKIETPDQFKQAEETAKKLDLDGLV 741
              N  G  +  S   D     D  KQ  +  K L +D LV
Sbjct: 73  RVLNVSGTFLGTSRFLDFQNNLDVRKQCAQNLKTLGIDKLV 113



>gb:AE011599_274707 Leptospira interrogans serovar lai str. 56601
           chromosome II, section 11 of 34 of the complete
           sequence.>gb:AE016824_341450 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome II,
           complete sequence.>gb:AE010301_1003381 Leptospira
           interrogans serovar lai str. 56601 chromosome II,
           complete sequence.
          Length = 431

 Score = 35.0 bits (79), Expect = 1.4
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 4/83 (4%)
 Frame = +1

Query: 454 GVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKY----VILTPEYIY 621
           G+V  GG  PG ++VI GI   L      S + GF  G  G++K +Y    + LTPE + 
Sbjct: 71  GIVTCGGLCPGINDVIRGIVMELYYRYGVSRILGFPYGYQGLVK-RYSHQPIELTPEKVA 129

Query: 622 PYRNQGGFDMICSGRDKIETPDQ 690
              ++GG  M+ S R   ++P++
Sbjct: 130 HIVDEGG-SMLSSSRGN-QSPEE 150



>sp|Q8ZJL6|K6PF_YERPE 6-phosphofructokinase (EC 2.7.1.11)
           (Phosphofructokinase)
           (Phosphohexokinase).>pir|AF0010|AF0010
           6-phosphofructokinase (EC 2.7.1.11) [imported] -
           Yersinia pestis (strain CO92)>gb:AE013607_298396
           Yersinia pestis KIM section 7 of 415 of the complete
           genome.>gb:AE017127_385937 Yersinia pestis biovar
           Medievalis str. 91001 section 1 of 16 of the complete
           genome.>gb:AJ414141_521937 Yersinia pestis strain CO92
           complete genome; segment 1/20.>gb:AE009952_928579
           Yersinia pestis KIM complete genome.>gb:AE017042_1142503
           Yersinia pestis biovar Medievalis str. 91001 complete
           genome.
          Length = 327

 Score = 35.0 bits (79), Expect = 1.4
 Identities = 27/98 (27%), Positives = 44/98 (44%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           KIGV+ SGG APG +  I G+         G  ++G   G  G+ + +   L    +   
Sbjct: 4   KIGVLTSGGDAPGMNAAIRGVVRAALS--AGLDVFGIEDGYLGLYENRMKKLDRYSVSDM 61

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            N+GG  +  +   +   P+  K A +   +  +DGLV
Sbjct: 62  INRGGTFLGSARFPEFRDPEVRKVALKNMHERGIDGLV 99



>sp|Q87KX0|K6PF_VIBPA 6-phosphofructokinase (EC 2.7.1.11)
           (Phosphofructokinase)
           (Phosphohexokinase).>gb:BA000031_708315 Vibrio
           parahaemolyticus RIMD 2210633 DNA, chromosome 1,
           complete sequence.
          Length = 320

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 27/98 (27%), Positives = 46/98 (46%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           KIGV+ SGG APG +  I G+        +G  ++G   G  G+ + +   L    +   
Sbjct: 4   KIGVLTSGGDAPGMNAAIRGVVRTALS--EGLEVFGVYDGYLGLYEGRIEKLDRSSVSDV 61

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            N+GG  +  +   + +  +  ++A E  KK  +D LV
Sbjct: 62  INKGGTFLGSARFPEFKQVEVREKAIENLKKHGIDALV 99



>sp|Q9Z6C3|K6PF_ENTCL 6-phosphofructokinase (EC 2.7.1.11)
           (Phosphofructokinase)
           (Phosphohexokinase).>gb:AF098509_478922 Enterobacter
           cloacae phosphofructokinase (pfkA), putative
           sulfur-binding protein (sbp), putative CDP-diglyceride
           hydrolase (cdh), and triose phosphate isomerase (tpi)
           genes, complete cds; and unknown genes.
          Length = 320

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 29/98 (29%), Positives = 44/98 (44%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           KIGV+ SGG APG +  I G+        +G  ++G   G  G+ + + V L    +   
Sbjct: 4   KIGVLTSGGDAPGMNAAIRGV--VRAALTEGLEVFGVYDGYLGLYEDRMVQLDRYSVSDM 61

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            N+GG  +  +   +       + A E  KK  LD LV
Sbjct: 62  INRGGTFLGSARFPEFRDEHVREVAIENMKKRGLDALV 99



>sp|O34529|K6PF_BACSU 6-phosphofructokinase (EC 2.7.1.11)
           (Phosphofructokinase)
           (Phosphohexokinase).>pir|A69675|A69675
           6-phosphofructokinase pfk - Bacillus
           subtilis>gb:AF008220_468122 Bacillus subtilis rrnB-dnaB
           genomic region.>gb:BSUB0015_754884 Bacillus subtilis
           complete genome (section 15 of 21): from 2812801 to
           3013507.
          Length = 319

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 25/98 (25%), Positives = 46/98 (46%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           +IGV+ SGG +PG +  +  +      H     +YG   G AG++  K   L    +   
Sbjct: 3   RIGVLTSGGDSPGMNAAVRAVVRKAIYH--DVEVYGIYNGYAGLISGKIEKLELGSVGDI 60

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            ++GG  +  +   + +T +  ++     KKL ++GLV
Sbjct: 61  IHRGGTKLYTARCPEFKTVEGREKGIANLKKLGIEGLV 98



>sp|P00512|K6PF_BACST 6-phosphofructokinase (EC 2.7.1.11)
           (Phosphofructokinase)
           (Phosphohexokinase).>pir|A27474|KIBSFF
           6-phosphofructokinase (EC 2.7.1.11) - Bacillus
           stearothermophilus>gb:BACPFK_746057 B.stearothermophilus
           6-phosphofructo-1-kinase gene, complete
           cds.>gb:BACPK_746076 B. stearothermophilus
           phosphofructokinase and pyruvate kinase genes.
          Length = 319

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 27/98 (27%), Positives = 46/98 (46%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           +IGV+ SGG +PG +  I  +      H  G  +YG   G AG++      L    +   
Sbjct: 3   RIGVLTSGGDSPGMNAAIRSVVRKAIYH--GVEVYGVYHGYAGLIAGNIKKLEVGDVGDI 60

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            ++GG  +  +   + +T +  K+  E  KK  ++GLV
Sbjct: 61  IHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLV 98



>sp|O67605|K6PF_AQUAE 6-phosphofructokinase (EC 2.7.1.11)
           (Phosphofructokinase)
           (Phosphohexokinase).>pir|C70447|C70447
           phosphofructokinase - Aquifex aeolicus>gb:AE000752_26959
           Aquifex aeolicus VF5 section 84 of 109 of the complete
           genome.>gb:AE000657_977490 Aquifex aeolicus VF5 complete
           genome.
          Length = 321

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 20/99 (20%), Positives = 51/99 (51%)
 Frame = +1

Query: 445 LKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYP 624
           ++IG++ +GG APG + VI  +    +   +G  + G + G  G+++  ++ LT   +  
Sbjct: 1   MRIGILTAGGDAPGMNAVIRAVVRSAER--EGHEVIGIKRGYKGLIEGDFIKLTSRDVGG 58

Query: 625 YRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
             ++GG  ++ S   + +  +  ++A +   +  ++ L+
Sbjct: 59  ILDRGGTILLSSRDPRYKKLEYREKAYKNLNEQGIEALI 97



>gb:BC059855_2103802 Mus musculus cDNA sequence BC053460, mRNA (cDNA
           clone IMAGE:6411827), partial cds.
          Length = 640

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 26/83 (31%), Positives = 37/83 (44%), Gaps = 1/83 (1%)
 Frame = -3

Query: 581 MIPAGPPLNPYNVLPLQCSCK*SKIPEITLC-PPGAWPPDKTTPIFKLWFIATSPESSGT 405
           ++P GP L    ++PLQ     ++ P  T C PP   P D   P F       +PE   +
Sbjct: 535 LLPPGPVLRLKQIIPLQ-----TRPPAPTGCAPPPRSPADTRLPAFLSLRFLKAPERGPS 589

Query: 404 NAADG*PNKPGNNFAISSGWPAA 336
                 P +PG  FA S+  P+A
Sbjct: 590 ------PPRPGKLFAFSAREPSA 606



>gb:AK173222_2070156 Mus musculus premature mRNA for mKIAA1623
            protein.
          Length = 1116

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 26/83 (31%), Positives = 37/83 (44%), Gaps = 1/83 (1%)
 Frame = -3

Query: 581  MIPAGPPLNPYNVLPLQCSCK*SKIPEITLC-PPGAWPPDKTTPIFKLWFIATSPESSGT 405
            ++P GP L    ++PLQ     ++ P  T C PP   P D   P F       +PE   +
Sbjct: 1014 LLPPGPVLRLKQIIPLQ-----TRPPAPTGCAPPPRSPADTRLPAFLSLRFLKAPERGPS 1068

Query: 404  NAADG*PNKPGNNFAISSGWPAA 336
                  P +PG  FA S+  P+A
Sbjct: 1069 ------PPRPGKLFAFSAREPSA 1085



>gb:HSBRCA22_2011111 H.sapiens brca2 gene exon 2 (and joined coding
            region).
          Length = 3418

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 17/38 (44%), Positives = 21/38 (55%)
 Frame = -2

Query: 597  HILALHDPSWSTPEPIQCASFAMLLQIIENSGNNIMPS 484
            HIL  +DP WSTP    C S     QII  +GN ++ S
Sbjct: 3182 HILHANDPKWSTPTK-DCTSGPYTAQIIPGTGNKLLMS 3218



>gb:HS92M18_1999785 Human DNA sequence from clone XX-92M18 on
           chromosome 13. Contains the 3' end of the BRCA2 gene for
           early onset breast cancer 2 susceptibility protein, two
           novel genes, ESTs, STSs, GSSs and a CpG island, complete
           sequence.
          Length = 334

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 17/38 (44%), Positives = 21/38 (55%)
 Frame = -2

Query: 597 HILALHDPSWSTPEPIQCASFAMLLQIIENSGNNIMPS 484
           HIL  +DP WSTP    C S     QII  +GN ++ S
Sbjct: 96  HILHANDPKWSTPTK-DCTSGPYTAQIIPGTGNKLLVS 132



>gb:AY436640_1950656 Homo sapiens breast cancer 2, early onset (BRCA2)
            gene, complete cds.
          Length = 3418

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 17/38 (44%), Positives = 21/38 (55%)
 Frame = -2

Query: 597  HILALHDPSWSTPEPIQCASFAMLLQIIENSGNNIMPS 484
            HIL  +DP WSTP    C S     QII  +GN ++ S
Sbjct: 3182 HILHANDPKWSTPTK-DCTSGPYTAQIIPGTGNKLLMS 3218



>gb:AL137247_1919553 Human DNA sequence from clone RP11-298P3 on
            chromosome 13 Contains the 3' end of the BRCA2 gene for
            early onset breast cancer 2, the 3' end of a novel gene,
            part of an ATPase pseudogene and a CpG island, complete
            sequence.>gb:AL445212_1927407 Human DNA sequence from
            clone RP11-37E23 on chromosome 13 Contains the 3' end of
            a novel gene (CG003, 13CDNA73), 2 novel genes, the 5' end
            of the BRCA2 gene for breast cancer 2, early onset and a
            interferon-induced protein with tetratricopeptide repeats
            1 (IFIT1) pseudogene, complete sequence.
          Length = 3418

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 17/38 (44%), Positives = 21/38 (55%)
 Frame = -2

Query: 597  HILALHDPSWSTPEPIQCASFAMLLQIIENSGNNIMPS 484
            HIL  +DP WSTP    C S     QII  +GN ++ S
Sbjct: 3182 HILHANDPKWSTPTK-DCTSGPYTAQIIPGTGNKLLMS 3218



>gb:AB016886_1513139 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MCA23.>gb:AY056779_1563828 Arabidopsis thaliana
           AT5g47810/MCA23_13 mRNA, complete
           cds.>gb:AY090379_1574126 Arabidopsis thaliana
           AT5g47810/MCA23_13 mRNA, complete cds.
          Length = 444

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 20/66 (30%), Positives = 30/66 (45%)
 Frame = +1

Query: 445 LKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYP 624
           +K  +V  GG  PG + VI  +   L E      +YG   G  G    K V L P+ ++ 
Sbjct: 77  VKAAIVTCGGLCPGMNTVIRELVVGLWELYGVREIYGIPAGYRGFYSMKAVKLDPKAVHD 136

Query: 625 YRNQGG 642
           +  +GG
Sbjct: 137 WHKKGG 142



>gb:AE017180_400363 Geobacter sulfurreducens PCA, complete genome.
          Length = 319

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 25/99 (25%), Positives = 50/99 (50%), Gaps = 1/99 (1%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVI-SGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYP 624
           KIG++ SGG   G +  I + +   ++ + +   + GFR G  G+MK   + L  + +  
Sbjct: 3   KIGILTSGGDCSGMNAAIRAAVRTAIRMNIE---VVGFRKGYLGLMKGDAIPLDTKAVSG 59

Query: 625 YRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
             ++GG  +  +   + +TP+  + A    K L ++G+V
Sbjct: 60  ILHRGGTFLQSARSPEFKTPEGQRTALNNLKALGVEGMV 98



>pir|G02334|G02334 breast cancer tumor suppressor BRCA2 -
            human>gb:HSU43746_2024297 Human breast cancer
            susceptibility (BRCA2) mRNA, complete cds.
          Length = 3418

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 17/38 (44%), Positives = 21/38 (55%)
 Frame = -2

Query: 597  HILALHDPSWSTPEPIQCASFAMLLQIIENSGNNIMPS 484
            HIL  +DP WSTP    C S     QII  +GN ++ S
Sbjct: 3182 HILHANDPKWSTPTK-DCTSGPYTAQIIPGTGNKLLMS 3218



>sp|Q9L1L8|K6P2_STRCO 6-phosphofructokinase 2 (EC 2.7.1.11)
           (Phosphofructokinase 2) (Phosphohexokinase
           2).>gb:SCO939123_179097 Streptomyces coelicolor A3(2)
           complete genome; segment 20/29.
          Length = 341

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 23/99 (23%), Positives = 46/99 (46%)
 Frame = +1

Query: 445 LKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYP 624
           ++IGV+ +GG  PG + VI  +     ++  G  + GF  G AG++  +Y  L    +  
Sbjct: 1   MRIGVLTAGGDCPGLNAVIRSVVHRAVDN-YGDEVIGFEDGYAGLLDGRYRALDLNAVSG 59

Query: 625 YRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
              +GG  +  S  ++    +  + A +  +   +D L+
Sbjct: 60  ILARGGTILGSSRLERDRLREACENAGDMIQNFGIDALI 98



>sp|P51587|BRC2_HUMAN Breast cancer type 2 susceptibility
            protein.>gb:AX600694_1471360 Sequence 1 from Patent
            EP1260520.
          Length = 3418

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 17/38 (44%), Positives = 21/38 (55%)
 Frame = -2

Query: 597  HILALHDPSWSTPEPIQCASFAMLLQIIENSGNNIMPS 484
            HIL  +DP WSTP    C S     QII  +GN ++ S
Sbjct: 3182 HILHANDPKWSTPTK-DCTSGPYTAQIIPGTGNKLLMS 3218



>gb:A62801_1450066 Sequence 42 from Patent WO9719110.
          Length = 49

 Score = 33.5 bits (75), Expect = 4.2
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = -2

Query: 597 HILALHDPSWSTPEPIQCASFAMLLQIIENSGNNIM 490
           HIL  +DP WSTP    C S     QII  +GN ++
Sbjct: 15  HILHANDPKWSTPTK-DCTSGPYTAQIIPGTGNKLL 49



>gb:HIVU52062_2428992 Human immunodeficiency virus type 1 envelope
           glycoprotein (env) gene, V3-V4 region, partial cds.
          Length = 139

 Score = 33.1 bits (74), Expect = 5.5
 Identities = 15/58 (25%), Positives = 31/58 (53%)
 Frame = -2

Query: 498 NIMPSRCLATRQNHSNLQIMVHCNITRIIWHQCC*WLTK*ARKQLCNLLWMAGRRAGG 325
           +I P R     +   N+++M+HCNI++  W++    + +  R+Q  N   +  + +GG
Sbjct: 43  HIGPGRAFYATEIIGNIRLMLHCNISKARWNRTLEQIVRKLREQFGNKTIVFNQSSGG 100



>gb:AP002972_1824069 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0638D12.>gb:AP003218_1825444 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OSJNBb0021A09.
          Length = 560

 Score = 33.1 bits (74), Expect = 5.5
 Identities = 17/69 (24%), Positives = 32/69 (46%)
 Frame = +1

Query: 436 NHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEY 615
           + ++K  +V  GG  PG + VI  +   L      + ++G + G  G     Y+ +TP+ 
Sbjct: 159 SEDVKACIVTCGGLCPGLNTVIRELVCGLSHMYNVNDIFGIQNGYKGFYSSNYLPMTPKS 218

Query: 616 IYPYRNQGG 642
           +     +GG
Sbjct: 219 VNDIHKRGG 227



>gb:BPTUIA_1505056 Bacteriophage TuIa 37 and 38 genes for
           receptor-recognizing proteins 37 and 38 (respectively),
           partial cds.
          Length = 382

 Score = 33.1 bits (74), Expect = 5.5
 Identities = 26/99 (26%), Positives = 39/99 (39%)
 Frame = +1

Query: 187 ANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAK 366
           +N+D+ +  TS+  Y +  +    S  D+     +        V G  SSA  H    A+
Sbjct: 209 SNTDLGTKTTSSFDYGTKTT----SSFDYGTKTSNTTGNHNHTVSGTTSSAGAHQH--AR 262

Query: 367 LFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAP 483
             P L    S  + PD   DV  N+N K    + G   P
Sbjct: 263 SGPQLSNGISTNIFPDGYSDVGTNYNSKFSGTVIGSSVP 301



>gb:AY129332_1496561 Mycobacteriophage Bxz2, complete genome.
          Length = 97

 Score = 33.1 bits (74), Expect = 5.5
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 4/39 (10%)
 Frame = +1

Query: 289 SVLRKSFKVVDGPASSAAGHPEE----IAKLFPGLFGQP 393
           S+L ++ +++ GP +   GHP E    IA LF G  GQP
Sbjct: 4   SILEEAQRLIHGPRNKNYGHPRENFADIAALFSGYLGQP 42



>gb:AP008231_580626 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 360

 Score = 33.1 bits (74), Expect = 5.5
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           K+GV+ SGG  PG + VI  I  +   +  G  L+G      G++K + + L+P +   +
Sbjct: 5   KLGVLTSGGDCPGLNAVIRAIARHAVGN-YGWELWGIAYATQGLLKRQAIALSPHH---F 60

Query: 628 RNQGGFDMICSG 663
             Q    ++CSG
Sbjct: 61  DRQSLDPLLCSG 72



>pir|S13237|S13237 tail fiber protein gp37 - phage TuIa (fragment)
          Length = 382

 Score = 33.1 bits (74), Expect = 5.5
 Identities = 26/99 (26%), Positives = 39/99 (39%)
 Frame = +1

Query: 187 ANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAK 366
           +N+D+ +  TS+  Y +  +    S  D+     +        V G  SSA  H    A+
Sbjct: 209 SNTDLGTKTTSSFDYGTKTT----SSFDYGTKTSNTTGNHNHTVSGTTSSAGAHQH--AR 262

Query: 367 LFPGLFGQPSAALVPDDSGDVAMNHNLKIGVVLSGGQAP 483
             P L    S  + PD   DV  N+N K    + G   P
Sbjct: 263 SGPQLSNGISTNIFPDGYSDVGTNYNSKFSGTVIGSSVP 301



>sp|Q8A2E9|K6P3_BACTN 6-phosphofructokinase 3 (EC 2.7.1.11)
           (Phosphofructokinase 3) (Phosphohexokinase
           3).>gb:AE016940_362723 Bacteroides thetaiotaomicron
           VPI-5482, section 15 of 21 of the complete
           genome.>gb:AE015928_989211 Bacteroides thetaiotaomicron
           VPI-5482, complete genome.
          Length = 336

 Score = 33.1 bits (74), Expect = 5.5
 Identities = 22/76 (28%), Positives = 36/76 (47%)
 Frame = +1

Query: 445 LKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYP 624
           ++IG++ SGG  PG +  I G+      H  G  + G   G  G++       T + +  
Sbjct: 1   MRIGILTSGGDCPGINATIRGVCKTAINH-YGMEVIGIHSGFQGLLTKDIESFTDKSLSG 59

Query: 625 YRNQGGFDMICSGRDK 672
             NQGG  M+ + R+K
Sbjct: 60  LLNQGG-TMLGTSREK 74



>gb:CR382126_1658970 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 579

 Score = 32.7 bits (73), Expect = 7.2
 Identities = 19/62 (30%), Positives = 34/62 (54%)
 Frame = +1

Query: 190 NSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKL 369
           NSD  S+ +STG + SV++  + ++L+  L  P++ R + K      S+ A  P  + K+
Sbjct: 226 NSDHTSSNSSTGEFGSVWTTEEYTKLNDMLSTPNLSRNNSKTYLN--SNIAWSPSNMMKM 283

Query: 370 FP 375
            P
Sbjct: 284 DP 285



>gb:BX842655_826146 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 10/11.
          Length = 329

 Score = 32.7 bits (73), Expect = 7.2
 Identities = 30/103 (29%), Positives = 43/103 (41%), Gaps = 5/103 (4%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVIS-----GIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPE 612
           KIGV  SGG APG +  I      GI   L+       +YG   G  G+++ K   L   
Sbjct: 10  KIGVYTSGGDAPGMNAAIRAVVRVGISQKLE-------VYGIHNGYVGMIENKIEPLQLR 62

Query: 613 YIYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            +     +GG  +      +   P+   +A +  K L LD LV
Sbjct: 63  DMANIIQRGGTILKTGRSTEFMRPEGRARAAQNIKNLGLDALV 105



>gb:AE016770_328833 Escherichia coli CFT073 section 16 of 18 of the
           complete genome.>gb:AE014075_959417 Escherichia coli
           CFT073 complete genome.
          Length = 352

 Score = 32.7 bits (73), Expect = 7.2
 Identities = 28/98 (28%), Positives = 43/98 (43%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           KIGV+ SGG APG +  I G+        +G  + G   G  G+ + + V L    +   
Sbjct: 36  KIGVLTSGGDAPGMNAAIRGV--VRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDM 93

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            N+GG  +  +   +    +    A E  KK  +D LV
Sbjct: 94  INRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALV 131



>gb:AE012915_287070 Chlorobium tepidum TLS section 136 of 194 of the
           complete genome.>gb:AE006470_934238 Chlorobium tepidum
           TLS complete genome.
          Length = 401

 Score = 32.7 bits (73), Expect = 7.2
 Identities = 31/109 (28%), Positives = 47/109 (43%), Gaps = 11/109 (10%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           KIG++ SGG   G + VI G    L    KG  LY    G AG+    Y +L  + +   
Sbjct: 3   KIGILTSGGDCGGLNAVIKGAA--LMALNKGLELYVIPNGYAGL----YNLLNQDRLVRL 56

Query: 628 RN------QGGFDMICSGRDKIE-----TPDQFKQAEETAKKLDLDGLV 741
                   Q  F    +G  +++      PD++ + +   KK DLD L+
Sbjct: 57  DEARLDQFQASFAGSEAGHSRVKIKAISNPDKYNRIKVGMKKFDLDALI 105



>gb:ECPFKA_132144 E. coli genes pfkA, sbp and cdh for
           phosphofructokinase-1, sulphate binding protein and
           cdp-diglyceride hydrolase.
          Length = 320

 Score = 32.7 bits (73), Expect = 7.2
 Identities = 28/98 (28%), Positives = 43/98 (43%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           KIGV+ SGG APG +  I G+        +G  + G   G  G+ + + V L    +   
Sbjct: 4   KIGVLTSGGDAPGMNAAIRGV--VRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDM 61

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            N+GG  +  +   +    +    A E  KK  +D LV
Sbjct: 62  INRGGTFLGSARCPEFRDENIRAVAIENLKKRGIDALV 99



>sp|Q8FBD0|K6PF_ECOL6 6-phosphofructokinase (EC 2.7.1.11)
           (Phosphofructokinase) (Phosphohexokinase).
          Length = 320

 Score = 32.7 bits (73), Expect = 7.2
 Identities = 28/98 (28%), Positives = 43/98 (43%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           KIGV+ SGG APG +  I G+        +G  + G   G  G+ + + V L    +   
Sbjct: 4   KIGVLTSGGDAPGMNAAIRGV--VRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDM 61

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            N+GG  +  +   +    +    A E  KK  +D LV
Sbjct: 62  INRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALV 99



>sp|P57391|K6PF_BUCAI 6-phosphofructokinase (EC 2.7.1.11)
           (Phosphofructokinase)
           (Phosphohexokinase).>pir|F84965|F84965
           6-phosphofructokinase (EC 2.7.1.11) [imported] -
           Buchnera sp. (strain APS)>gb:BA000003_653668 Buchnera
           aphidicola str. APS (Acyrthosiphon pisum) genomic DNA,
           complete sequence.
          Length = 320

 Score = 32.7 bits (73), Expect = 7.2
 Identities = 31/100 (31%), Positives = 47/100 (47%), Gaps = 2/100 (2%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIF-DYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYP 624
           KIGV+ SGG APG +  I G+    L E  +   ++G   G  G+ + + V L    +  
Sbjct: 4   KIGVLTSGGDAPGMNAAIRGVVRTALSERLE---VFGIYDGYLGLYENRMVQLDRYSVSD 60

Query: 625 YRNQGGFDMICSGRDKIETPDQFKQ-AEETAKKLDLDGLV 741
             N+GG   + S R      D+ +  A +  KK  +D LV
Sbjct: 61  MINRGG-TFLGSARFASFYQDKIRSIAVQNIKKRKIDALV 99



>sp|P06998|K6P1_ECOLI 6-phosphofructokinase isozyme I (EC 2.7.1.11)
           (Phosphofructokinase-1)
           (Phosphohexokinase-1).>pir|G65197|KIECFA
           6-phosphofructokinase (EC 2.7.1.11) 1 - Escherichia coli
            (strain K-12)>pir|A86081|A86081 6-phosphofructokinase I
           [imported] - Escherichia coli  (strain O157:H7,
           substrain EDL933)>pir|A98234|A98234
           6-phosphofructokinase I [imported] - Escherichia coli
           (strain O157:H7, substrain RIMD
           0509952)>gb:AE005174_69108 Escherichia coli O157:H7
           EDL933, complete genome.>gb:ECOUW87_131458 E. coli
           chromosomal region from 87.2 to 89.2
           minutes.>gb:U00096_202892 Escherichia coli K-12 MG1655
           complete genome.>gb:BA000007_662853 Escherichia coli
           O157:H7 DNA, complete genome.
          Length = 320

 Score = 32.7 bits (73), Expect = 7.2
 Identities = 28/98 (28%), Positives = 43/98 (43%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           KIGV+ SGG APG +  I G+        +G  + G   G  G+ + + V L    +   
Sbjct: 4   KIGVLTSGGDAPGMNAAIRGV--VRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDM 61

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            N+GG  +  +   +    +    A E  KK  +D LV
Sbjct: 62  INRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALV 99



>gb:BC046689_2549679 Xenopus laevis microtubule-associated protein
           2, mRNA (cDNA clone MGC:53131 IMAGE:5542545), complete
           cds.
          Length = 429

 Score = 32.3 bits (72), Expect = 9.3
 Identities = 33/121 (27%), Positives = 43/121 (35%)
 Frame = +1

Query: 61  SAAHRKPLRKIYFSSELFFSYLPHSLSPLGENQSMAPAISLLANSDIASAKTSTGRYASV 240
           S+AHR P  +I        S  P   S L    S+ P   +  + +  S  TST    SV
Sbjct: 121 SSAHRHPRDRIVDG----VSKSPEKRSSLPRPSSIHPIRKVYTDKEDNSFSTST----SV 172

Query: 241 YSEVQNSRLDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAALVPDDS 420
            S V+ +    P         S     G  +   G P   A   PG  G PS +  P   
Sbjct: 173 SSSVRRTTRSEPWSRTGKSGTSTPTTPGSTAITPGTPPSYASRTPGTPGTPSYSRTPRTP 232

Query: 421 G 423
           G
Sbjct: 233 G 233



>gb:AK173226_2070160 Mus musculus mRNA for mKIAA1637 protein.
          Length = 368

 Score = 32.3 bits (72), Expect = 9.3
 Identities = 32/131 (24%), Positives = 46/131 (35%), Gaps = 5/131 (3%)
 Frame = +1

Query: 34  RHVTGP*NDSAAHRKPLRKIYFSSELFFSYLPHSLSPLGENQSMAPAISLLANSDIASAK 213
           R   G  + S+   +P  +   S ++  S  P   +P    Q +   I  L NS   +A 
Sbjct: 177 RQPLGAASGSSLKSQPSSQPLQSGQVLPSATPTPAAPPTSQQELQAKILSLFNSGAVAAN 236

Query: 214 TSTGRYASVYSEVQNSRLD-----HPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPG 378
           +S+   +      QN          P   P         + G A SA            G
Sbjct: 237 SSSASPSVATGSSQNQNFSTAANSQPQQRPQASGNQPPNIVGQAGSARNMGPRPGAPSQG 296

Query: 379 LFGQPSAALVP 411
           LFGQPS+ L P
Sbjct: 297 LFGQPSSRLAP 307



>gb:AE017348_1758196 Cryptococcus neoformans var. neoformans JEC21
            chromosome 8, complete sequence.
          Length = 955

 Score = 32.3 bits (72), Expect = 9.3
 Identities = 30/107 (28%), Positives = 44/107 (41%)
 Frame = +1

Query: 85   RKIYFSSELFFSYLPHSLSPLGENQSMAPAISLLANSDIASAKTSTGRYASVYSEVQNSR 264
            R  YF+S    +  PH LSP  E+ S++ + S       ASA TS    +S+ S   N  
Sbjct: 791  RSRYFASPPLSTSNPHKLSPT-ESASVSASAS-------ASASTSVSAGSSLNSNTTNGL 842

Query: 265  LDHPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPGLFGQPSAAL 405
                LP P        +    + S+       +   P  FGQPS ++
Sbjct: 843  STTGLPTPGGAGVGVPIPSSSSRSSTSARSTASAFQP--FGQPSTSI 887



>gb:ENU56097_1676794 Emericella nidulans acetate regulatory DNA
           binding protein FacB (facB) gene, complete cds.
          Length = 867

 Score = 32.3 bits (72), Expect = 9.3
 Identities = 26/71 (36%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
 Frame = +1

Query: 124 LPHSLSPLGENQSMAP-AISLLANSDIASAKTSTGRYASVYSEVQNSRLDHPLPLPSVLR 300
           LP SL+   E Q ++P A S  ++SD+A       +  SVYS+      DH L LPS + 
Sbjct: 769 LPPSLTSSDELQGLSPEAWSATSSSDMAQPPELAAQ--SVYSDGSLGSRDHSLSLPSTM- 825

Query: 301 KSFKVVDGPAS 333
             F + D P S
Sbjct: 826 -PFPMEDRPGS 835



>gb:AK049242_1168679 Mus musculus ES cells cDNA, RIKEN full-length
           enriched library, clone:C330016E20 product:SIMILAR TO
           COACTIVATOR INDEPENDENT OF AF-2 homolog [Mus musculus],
           full insert sequence.
          Length = 422

 Score = 32.3 bits (72), Expect = 9.3
 Identities = 32/131 (24%), Positives = 46/131 (35%), Gaps = 5/131 (3%)
 Frame = +1

Query: 34  RHVTGP*NDSAAHRKPLRKIYFSSELFFSYLPHSLSPLGENQSMAPAISLLANSDIASAK 213
           R   G  + S+   +P  +   S ++  S  P   +P    Q +   I  L NS   +A 
Sbjct: 231 RQPLGAASGSSLKSQPSSQPLQSGQVLPSATPTPAAPPTSQQELQAKILSLFNSGAVAAN 290

Query: 214 TSTGRYASVYSEVQNSRLD-----HPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPG 378
           +S+   +      QN          P   P         + G A SA            G
Sbjct: 291 SSSASPSVATGSSQNQNFSTAANSQPQQRPQASGNQPPNIVGQAGSARNMGPRPGAPSQG 350

Query: 379 LFGQPSAALVP 411
           LFGQPS+ L P
Sbjct: 351 LFGQPSSRLAP 361



>gb:BX248586_764191 Blochmannia floridanus complete genome; segment
           3/3.
          Length = 320

 Score = 32.3 bits (72), Expect = 9.3
 Identities = 20/65 (30%), Positives = 34/65 (52%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           KIGV+ SGG +PG +  I G+        +G  +YG   G  G+ + + ++L+   +   
Sbjct: 4   KIGVLTSGGDSPGMNAAIRGV--VRAGLSEGIEVYGIYDGYLGLFQNRMMLLSYCSVSDI 61

Query: 628 RNQGG 642
            N+GG
Sbjct: 62  INKGG 66



>gb:AE016822_339900 Leifsonia xyli subsp. xyli str. CTCB07, complete
           genome.
          Length = 358

 Score = 32.3 bits (72), Expect = 9.3
 Identities = 22/77 (28%), Positives = 35/77 (45%)
 Frame = +1

Query: 412 DDSGDVAMNHNLKIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCK 591
           D +G      ++KIG++ SGG  PG + VI G      +    +   GFR G  G+++  
Sbjct: 6   DKAGGDEKRSSMKIGILTSGGDCPGLNAVIRGAV-LKGDRVLDAEFAGFRYGWRGVVEGD 64

Query: 592 YVILTPEYIYPYRNQGG 642
            + L    +     QGG
Sbjct: 65  IMPLDRHSVRGLSRQGG 81



>sp|Q91W39|NCO5_MOUSE Nuclear receptor coactivator 5 (NCoA-5)
           (Coactivator independent of AF-2)
           (CIA).>gb:BC017152_2092451 Mus musculus nuclear receptor
           coactivator 5, mRNA (cDNA clone MGC:28864
           IMAGE:4511696), complete cds.
          Length = 579

 Score = 32.3 bits (72), Expect = 9.3
 Identities = 32/131 (24%), Positives = 46/131 (35%), Gaps = 5/131 (3%)
 Frame = +1

Query: 34  RHVTGP*NDSAAHRKPLRKIYFSSELFFSYLPHSLSPLGENQSMAPAISLLANSDIASAK 213
           R   G  + S+   +P  +   S ++  S  P   +P    Q +   I  L NS   +A 
Sbjct: 388 RQPLGAASGSSLKSQPSSQPLQSGQVLPSATPTPAAPPTSQQELQAKILSLFNSGAVAAN 447

Query: 214 TSTGRYASVYSEVQNSRLD-----HPLPLPSVLRKSFKVVDGPASSAAGHPEEIAKLFPG 378
           +S+   +      QN          P   P         + G A SA            G
Sbjct: 448 SSSASPSVATGSSQNQNFSTAANSQPQQRPQASGNQPPNIVGQAGSARNMGPRPGAPSQG 507

Query: 379 LFGQPSAALVP 411
           LFGQPS+ L P
Sbjct: 508 LFGQPSSRLAP 518



>sp|Q8R914|K6PF_THETN 6-phosphofructokinase (EC 2.7.1.11)
           (Phosphofructokinase)
           (Phosphohexokinase).>gb:AE013134_289433
           Thermoanaerobacter tengcongensis MB4, section 161 of 244
           of the complete genome.>gb:AE008691_1111498
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 321

 Score = 32.3 bits (72), Expect = 9.3
 Identities = 27/102 (26%), Positives = 50/102 (49%), Gaps = 5/102 (4%)
 Frame = +1

Query: 451 IGVVLSGGQAPGGHNVI-----SGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEY 615
           IG++ SGG APG +  I     +GI+        G  + G   G AG+++ + + L    
Sbjct: 4   IGILTSGGDAPGMNAAIRAVVRTGIY-------YGLKVKGIMRGFAGLVEDEVIDLGLSS 56

Query: 616 IYPYRNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
           +     +GG  +  +  ++ +  +  K+A ET +K  ++GLV
Sbjct: 57  VGDIIQKGGTILRTARCEEFKQKEVRKKAYETLQKHGIEGLV 98



>sp|Q8XG19|K6PF_SALTY 6-phosphofructokinase (EC 2.7.1.11)
           (Phosphofructokinase)
           (Phosphohexokinase).>pir|AH0942|AH0942
           6-phosphofructokinase [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain
           CT18)>gb:CP000026_78555 Salmonella enterica subsp.
           enterica serovar Paratypi A str. ATCC
           9150.>gb:AE008889_245675 Salmonella typhimurium LT2,
           section 193 of 220 of the complete
           genome.>gb:AE016846_347518 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, section 13 of 16 of the
           complete genome.>gb:AL627279_543856 Salmonella enterica
           serovar Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 15/20.>gb:AE014613_984850 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, complete
           genome.>gb:AE006468_1002757 Salmonella typhimurium LT2,
           complete genome.
          Length = 320

 Score = 32.3 bits (72), Expect = 9.3
 Identities = 28/98 (28%), Positives = 43/98 (43%)
 Frame = +1

Query: 448 KIGVVLSGGQAPGGHNVISGIFDYLQEHCKGSTLYGFRGGPAGIMKCKYVILTPEYIYPY 627
           KIGV+ SGG APG +  I G+        +G  + G   G  G+ + + V L    +   
Sbjct: 4   KIGVLTSGGDAPGMNAAIRGV--VRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDM 61

Query: 628 RNQGGFDMICSGRDKIETPDQFKQAEETAKKLDLDGLV 741
            N+GG  +  +   +    +    A E  KK  +D LV
Sbjct: 62  INRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALV 99


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 837,133,739
Number of Sequences: 1806583
Number of extensions: 19625998
Number of successful extensions: 67599
Number of sequences better than 10.0: 116
Number of HSP's better than 10.0 without gapping: 64752
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 67515
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 45778500432
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)