BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig1807
         (1864 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY224544_1590741 Oryza sativa (japonica cultivar-group) isola...   859   0.0     
sp|P35007|SAHH_CATRO|SAHH_CATRO Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   858   0.0     Catharanthus roseus [chatas]
gb:A57643_1449818 Sequence 1 from Patent WO9632488.                   854   0.0     
sp|O23255|SAHH_ARATH|SAHH_ARATH Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   853   0.0     Arabidopsis thaliana [mouse-ear cress]
gb:AY085669_1570736 Arabidopsis thaliana clone 16846 mRNA, compl...   853   0.0     
sp|P50246|SAHH_MEDSA|SAHH_MEDSA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   853   0.0     Medicago sativa [alfalfa]
sp|P50248|SAHH_TOBAC|SAHH_TOBAC Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   852   0.0     Nicotiana tabacum [American tobacco]
gb:AY224189_1590621 Medicago truncatula adenosylhomocysteinase (...   849   0.0     
gb:AF428329_1799259 Arabidopsis thaliana AT3g23810/MYM9_15 mRNA,...   845   0.0     
gb:AY059888_1564732 Arabidopsis thaliana S-adenosyl L-homocystei...   844   0.0     
sp|P93253|SAHH_MESCR|SAHH_MESCR Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   843   0.0     Mesembryanthemum crystallinum
gb:AY094404_1575709 Arabidopsis thaliana AT3g23810/MYM9_15 mRNA,...   842   0.0     
gb:AY050783_1562292 Arabidopsis thaliana putative S-adenosyl-L-h...   841   0.0     
sp|P32112|SAHH_WHEAT|SAHH_WHEAT Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   840   0.0     Triticum aestivum [Canadian hard winter wheat]
gb:AY224188_1590620 Medicago truncatula adenosylhomocysteinase (...   840   0.0     
sp|Q9SP37|SAHH_LUPLU|SAHH_LUPLU Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   838   0.0     Lupinus luteus
sp|Q01781|SAHH_PETCR|SAHH_PETCR Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   837   0.0     Petroselinum crispum
sp|P50249|SAHH_PHASS|SAHH_PHASS Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   836   0.0     Phalaenopsis sp.
sp|Q9SWF5|SAHH_LYCES|SAHH_LYCES Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   825   0.0     Solanum lycopersicum
gb:ATSADLHH_1554140 Arabidopsis thaliana mRNA for S-adenosyl-L-h...   823   0.0     
gb:TOBCBP57B_1725376 Tobacco mRNA for cytokinin binding protein ...   803   0.0     
gb:AP006841_574982 Bacteroides fragilis YCH46 DNA, complete genome.   583   e-165   
sp|Q8A407|SAHH_BACTN|SAHH_BACTN Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   579   e-164   Bacteroides thetaiotaomicron
sp|Q82DC9|SAHH_STRAW|SAHH_STRAW Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   573   e-162   Streptomyces avermitilis
sp|Q9KZM1|SAHH_STRCO|SAHH_STRCO Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   573   e-162   
sp|Q8GGL7|SAHH_STRAZ|SAHH_STRAZ Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   568   e-160   Streptomyces atroolivaceus
gb:AB088224_11530 Streptomyces rochei plasmid pSLA2-L DNA, compl...   565   e-159   
sp|Q8KEG8|SAHH_CHLTE|SAHH_CHLTE Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   558   e-157   Chlorobaculum tepidum
gb:AF525293_1279200 Plasmodium falciparum 3D7 S-adenosyl-L-homoc...   558   e-157   
gb:AF212157_1777422 Allium cepa S-adenosylhomocysteine hydrolase...   555   e-157   
sp|Q936D6|SAHH_STRAA|SAHH_STRAA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   555   e-156   Streptomyces argillaceus
sp|P50250|SAHH_PLAF7|SAHH_PLAF7 Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   553   e-156   Plasmodium falciparum
sp|Q87EI8|SAHH_XYLFT|SAHH_XYLFT Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   551   e-155   Xylella fastidiosa
sp|Q9PEJ1|SAHH_XYLFA|SAHH_XYLFA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   550   e-155   Xylella fastidiosa
gb:AE017311_438861 Desulfovibrio vulgaris subsp. vulgaris str. H...   548   e-154   
sp|Q89HP6|SAHH_BRAJA|SAHH_BRAJA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   546   e-154   Bradyrhizobium japonicum
gb:BX248345_760633 Mycobacterium bovis subsp. bovis AF2122/97 co...   545   e-154   
sp|Q7TWW7|SAHH_MYCBO|SAHH_MYCBO Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   545   e-154   Mycobacterium tuberculosis variant bovis
gb:BX572606_803628 Rhodopseudomonas palustris CGA009 complete ge...   545   e-153   
pir|B70593|B70593 adenosylhomocysteinase (EC 3.3.1.1) - Mycobact...   545   e-153   Mycobacterium tuberculosis
sp|P60176|SAHH_MYCTU|SAHH_MYCTU Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   545   e-153   Mycobacterium tuberculosis
sp|Q9ABH0|SAHH_CAUCR|SAHH_CAUCR Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   545   e-153   Caulobacter vibrioides
sp|Q8PP84|SAHH_XANAC|SAHH_XANAC Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   543   e-153   Xanthomonas citri
gb:AE013598_297499 Xanthomonas oryzae pv. oryzae KACC10331, comp...   543   e-153   
gb:AP006618_561013 Nocardia farcinica IFM 10152 DNA, complete ge...   542   e-152   
sp|Q8PCH5|SAHH_XANCP|SAHH_XANCP Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   540   e-152   Xanthomonas campestris pv. campestris
sp|Q7NZF7|SAHH_CHRVO|SAHH_CHRVO Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   539   e-152   Chromobacterium violaceum
sp|P51540|SAHH_TRIVA|SAHH_TRIVA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   538   e-151   Trichomonas vaginalis
sp|Q9CCJ4|SAHH_MYCLE|SAHH_MYCLE Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   534   e-150   Mycobacterium leprae
sp|Q7U9Y3|SAHH_SYNPX|SAHH_SYNPX Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   533   e-150   Synechococcus sp.
sp|Q8Y387|SAHH_RALSO|SAHH_RALSO Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   533   e-150   Ralstonia solanacearum
sp|Q7V926|SAHH_PROMM|SAHH_PROMM Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   533   e-150   Prochlorococcus marinus
gb:AE017282_426974 Methylococcus capsulatus str. Bath, complete ...   532   e-149   
gb:AE017239_414067 Mycobacterium avium subsp. paratuberculosis s...   531   e-149   
sp|Q92TC1|SAHH_RHIME|SAHH_RHIME Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   531   e-149   Sinorhizobium meliloti
gb:CR555306_106425 Azoarcus sp. EbN1 complete genome.                 528   e-148   
sp|Q7WQX5|SAHH_BORBR|SAHH_BORBR Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   528   e-148   Bordetella bronchiseptica
sp|Q7VUL8|SAHH_BORPE|SAHH_BORPE Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   528   e-148   Bordetella pertussis
sp|P61617|SAHH_GEOSL|SAHH_GEOSL Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   527   e-148   Geobacter sulfurreducens
sp|Q98CM3|SAHH_RHILO|SAHH_RHILO Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   525   e-147   Mesorhizobium loti
sp|Q8EXV1|SAHH_LEPIN|SAHH_LEPIN Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   525   e-147   
pir|D82730|D82730 adenosylhomocysteinase XF1037 [imported] - Xyl...   523   e-147   Xylella fastidiosa
sp|Q8UJ99|SAHH_AGRT5|SAHH_AGRT5 Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   523   e-147   Agrobacterium tumefaciens
pir|AG3505|AG3505 adenosylhomocysteinase (EC 3.3.1.1) [imported]...   522   e-147   Brucella melitensis
sp|Q8FXZ7|SAHH_BRUSU|SAHH_BRUSU Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   522   e-147   Brucella suis bv. 1
sp|Q8YE49|SAHH_BRUME|SAHH_BRUME Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   522   e-147   
gb:CP000031_87847 Silicibacter pomeroyi DSS-3, complete genome.       521   e-146   
gb:AF307335_1784661 Petunia x hybrida cytokinin binding protein ...   520   e-146   
sp|P28183|SAHH_RHOCA|SAHH_RHOCA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   520   e-146   Rhodobacter capsulatus
gb:AE008692_239920 Zymomonas mobilis subsp. mobilis ZM4, complet...   520   e-146   
sp|Q8FRJ4|SAHH_COREF|SAHH_COREF Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   519   e-146   Corynebacterium efficiens
sp|Q82WL1|SAHH_NITEU|SAHH_NITEU Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   514   e-144   Nitrosomonas europaea
pir|A46035|A46035 adenosylhomocysteinase (EC 3.3.1.1) - Rhodobac...   513   e-144   Rhodobacter capsulatus
sp|Q9ZNA5|SAHH_ROSDE|SAHH_ROSDE Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   512   e-144   
sp|Q7V9P3|SAHH_PROMA|SAHH_PROMA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   512   e-143   Prochlorococcus marinus
gb:AX397890_1467047 Sequence 1 from Patent WO0220806.                 509   e-142   
gb:BX927150_832335 Corynebacterium glutamicum ATCC 13032, IS fin...   509   e-142   
sp|Q8NSC4|SAHH_CORGL|SAHH_CORGL Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   509   e-142   Corynebacterium glutamicum
gb:BX897699_826667 Bartonella henselae strain Houston-1, complet...   508   e-142   
sp|O50562|SAHH_RHOSH|SAHH_RHOSH Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   508   e-142   Rhodobacter sphaeroides
gb:BX571965_793091 Burkholderia pseudomallei strain K96243, chro...   507   e-142   
gb:CR628336_112119 Legionella pneumophila str. Paris complete ge...   507   e-142   
gb:AY593479_630666 Collimonas fungivorans fosmid CFUFOS19, compl...   507   e-142   
gb:CR628337_115202 Legionella pneumophila str. Lens complete gen...   506   e-142   
gb:AE017354_460376 Legionella pneumophila subsp. pneumophila str...   506   e-142   
gb:AY161083_1305326 Cryptosporidium parvum adenosylhomocysteinas...   506   e-142   
sp|Q7UZN3|SAHH_PROMP|SAHH_PROMP Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   503   e-141   Prochlorococcus marinus subsp. pastoris [high-light adapted Prochlorococcus]
gb:AE008921_246378 Uncultured proteobacterium clone EBAC000-60D0...   498   e-139   
sp|Q7TTZ5|SAHH_RHOBA|SAHH_RHOBA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   497   e-139   Rhodopirellula baltica
gb:BX897700_828277 Bartonella quintana str. Toulouse, complete g...   495   e-138   
gb:AY178804_595226 Agrobacterium tumefaciens S-adenosyl-L-homocy...   490   e-137   
sp|P61456|SAHH_CORDI|SAHH_CORDI Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   489   e-136   Corynebacterium diphtheriae
sp|P27604|SAHH_CAEEL|SAHH_CAEEL Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   484   e-135   Caenorhabditis elegans [roundworm]
gb:CP000009_863091 Gluconobacter oxydans 621H, complete genome.       483   e-135   
gb:AY398307_2531837 Danio rerio clone RK113A3C03 S-adenosylhomoc...   483   e-135   
sp|P36889|SAHH_LEIDO|SAHH_LEIDO Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   482   e-134   Leishmania donovani
gb:AY233397_1311518 Trypanosoma cruzi S-adenosylhomocysteine hyd...   482   e-134   
sp|Q83A77|SAHH_COXBU|SAHH_COXBU Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   482   e-134   Coxiella burnetii
pir|A45569|A45569 adenosylhomocysteinase (EC 3.3.1.1) - Leishman...   479   e-134   Leishmania donovani
sp|P51893|SAH1_XENLA|SAH1_XENLA Adenosylhomocysteinase 1 (EC 3.3.1.1) (S-ad...   478   e-133   Xenopus laevis [clawed frog]
sp|O93477|SAH2_XENLA|SAH2_XENLA Adenosylhomocysteinase 2 (EC 3.3.1.1) (S-ad...   476   e-133   Xenopus laevis [clawed frog]
gb:AE014298_1125742 Drosophila melanogaster chromosome X, comple...   469   e-131   
gb:AX063941_1458884 Sequence 223 from Patent WO0100843.>gb:AX244...   469   e-131   
sp|O13639|SAHH_SCHPO|SAHH_SCHPO Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   469   e-131   Schizosaccharomyces pombe
gb:AY278950_1315439 Branchiostoma belcheri tsingtaunese adenosyl...   468   e-130   
gb:AE016819_1749078 Ashbya gossypii (= Eremothecium gossypii) AT...   467   e-130   
gb:AE017344_1755987 Cryptococcus neoformans var. neoformans JEC2...   467   e-130   
gb:BC015304_2092144 Mus musculus S-adenosylhomocysteine hydrolas...   464   e-129   
gb:AY102668_1299071 Drosophila melanogaster GM02466 full insert ...   464   e-129   
sp|P50247|SAHH_MOUSE|SAHH_MOUSE Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   464   e-129   Mus musculus [mouse]
sp|O76757|SAHH_ANOGA|SAHH_ANOGA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   464   e-129   Anopheles gambiae
gb:MUSSAHH_2129955 Mus musculus (clone C7/B9) S-adenosyl homocys...   464   e-129   
gb:BC086781_2109794 Mus musculus cDNA clone MGC:102079 IMAGE:682...   464   e-129   
sp|Q27580|SAHH_DROME|SAHH_DROME Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   463   e-129   Drosophila melanogaster
gb:AJ853475_1814921 Nicotiana glauca partial mRNA for putative a...   463   e-129   
gb:SSC427478_1445205 Sus scrofa ASIP gene for agouti signalling ...   463   e-129   
pir|A26583|A26583 adenosylhomocysteinase (EC 3.3.1.1) - rat>gb:R...   463   e-129   Rattus norvegicus [brown rat]
sp|P10760|SAHH_RAT|SAHH_RAT Adenosylhomocysteinase (EC 3.3.1.1) (S-adenos...   463   e-129   Rattus norvegicus [brown rat]
gb:CR382121_1654313 Kluyveromyces lactis strain NRRL Y-1140 chro...   462   e-129   
sp|P39954|SAHH_YEAST|SAHH_YEAST Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   460   e-128   Saccharomyces cerevisiae [brewer's yeast]
gb:CR380949_1649503 Candida glabrata strain CBS138 chromosome C ...   457   e-127   
gb:BT007625_2150557 Synthetic construct Homo sapiens S-adenosylh...   457   e-127   
sp|P23526|SAHH_HUMAN|SAHH_HUMAN Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   457   e-127   Homo sapiens [man]
sp|P10819|SAHH_DICDI|SAHH_DICDI Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   457   e-127   Dictyostelium discoideum
gb:HUMAHCY_2029084 Human S-adenosylhomocysteine hydrolase (AHCY)...   455   e-126   
gb:CR382132_1665432 Yarrowia lipolytica chromosome F of strain C...   454   e-126   
gb:CR382139_1672908 Debaryomyces hansenii chromosome G of strain...   453   e-126   
gb:AY442190_1606331 Pichia pastoris S-adenosylhomocysteine hydro...   452   e-126   
gb:BX842649_824262 Bdellovibrio bacteriovorus complete genome, s...   449   e-125   
sp|Q12663|SAHH_PNECA|SAHH_PNECA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   426   e-118   Pneumocystis carinii
gb:BC059517_2552494 Danio rerio S-adenosylhomocysteine hydrolase...   401   e-110   
gb:CR859865_1183966 Pongo pygmaeus mRNA; cDNA DKFZp469J024 (from...   396   e-109   
gb:AK053527_1170463 Mus musculus 0 day neonate eyeball cDNA, RIK...   396   e-109   
gb:BC077247_2559964 Xenopus laevis MGC79134 protein, mRNA (cDNA ...   396   e-109   
gb:AK130743_1917676 Homo sapiens cDNA FLJ27233 fis, clone SYN064...   395   e-108   
gb:BC080079_2561511 Xenopus laevis MGC84148 protein, mRNA (cDNA ...   395   e-108   
gb:BC079660_2107648 Mus musculus RIKEN cDNA 4631427C17 gene, mRN...   395   e-108   
gb:AK122382_2069047 Mus musculus mRNA for mKIAA0828 protein.          395   e-108   
gb:AB020635_1865233 Homo sapiens mRNA for KIAA0828 protein, part...   395   e-108   
sp|Q96HN2|SAH3_HUMAN|SAH3_HUMAN Putative adenosylhomocysteinase 3 (EC 3.3.1...   395   e-108   Homo sapiens [man]
gb:CR543861_104166 Acinetobacter sp. ADP1 complete genome.            392   e-107   
gb:BC081269_2562161 Xenopus laevis MGC86404 protein, mRNA (cDNA ...   390   e-107   
gb:AE014296_1134419 Drosophila melanogaster chromosome 3L, compl...   388   e-106   
gb:AE017340_456250 Idiomarina loihiensis L2TR, complete genome.       387   e-106   
gb:BC054614_2551024 Danio rerio S-adenosylhomocysteine hydrolase...   387   e-106   
gb:BC065254_1986785 Homo sapiens cDNA clone IMAGE:6138596, parti...   387   e-106   
gb:AL772411_1932843 Human DNA sequence from clone RP11-180N18 on...   387   e-106   
gb:AF315687_1896429 Homo sapiens S-adenosylhomocysteine hydrolas...   387   e-106   
gb:AX029176_1457188 Sequence 1 from Patent WO9814562.                 387   e-106   
gb:HSM800298_1185800 Homo sapiens mRNA; cDNA DKFZp564A1523 (from...   387   e-106   
pir|T08681|T08681 adenosylhomocysteinase (EC 3.3.1.1) DKFZp564A1...   387   e-106   Homo sapiens [man]
sp|O43865|SAH2_HUMAN|SAH2_HUMAN Putative adenosylhomocysteinase 2 (EC 3.3.1...   387   e-106   Homo sapiens [man]
gb:BT010277_1357568 Drosophila melanogaster RE06911 full insert ...   386   e-106   
sp|Q9I685|SAHH_PSEAE|SAHH_PSEAE Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   385   e-105   Pseudomonas aeruginosa
sp|P50245|SAH2_DROME|SAH2_DROME Putative adenosylhomocysteinase (EC 3.3.1.1...   379   e-103   Drosophila melanogaster
sp|Q87V73|SAHH_PSESM|SAHH_PSESM Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   378   e-103   Pseudomonas syringae pv. tomato
gb:AE014297_1139957 Drosophila melanogaster chromosome 3R, compl...   376   e-103   
pir|T15035|T15035 adenosylhomocysteinase (EC 3.3.1.1) - parsley>...   376   e-102   Petroselinum crispum
gb:AF439722_1799980 Zea mays S-adenosyl-L-homocysteine hydrolase...   369   e-101   
pir|S01302|S01302 adenosylhomocysteinase (EC 3.3.1.1) - fruit fl...   367   e-100   Drosophila melanogaster
gb:AK075629_1170915 Mus musculus 18-day embryo whole body cDNA, ...   348   3e-94   
gb:AL356299_1924404 Human DNA sequence from clone CTD-3216D2 on ...   317   5e-85   
gb:AF181566_1774856 Solanum chacoense S-adenosyl-L-homocysteine ...   308   3e-82   
sp|Q9YEF2|SAHH_AERPE|SAHH_AERPE Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   300   7e-80   Aeropyrum pernix
pir|C90224|C90224 s-adenosyl-L-homocysteine hydrolase (ahcY) [im...   294   5e-78   Saccharolobus solfataricus
sp|P50252|SAHH_SULSO|SAHH_SULSO Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   294   5e-78   Saccharolobus solfataricus
sp|Q975T0|SAHH_SULTO|SAHH_SULTO Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   293   1e-77   Sulfurisphaera tokodaii
gb:AF105295_1768303 Alexandrium fundyense S-adenosyl-homocystein...   290   7e-77   
pir|B72649|B72649 probable adenosylhomocysteinase APE0624 - Aero...   286   8e-76   Aeropyrum pernix
gb:BX957221_844173 Methanococcus maripaludis S2 complete genome;...   285   3e-75   
sp|P58855|SAHH_METKA|SAHH_METKA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   277   5e-73   Methanopyrus kandleri
gb:AK131563_1918085 Homo sapiens cDNA FLJ16815 fis, clone THYMU3...   276   1e-72   
sp|Q58783|SAHH_METJA|SAHH_METJA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   273   7e-72   Methanocaldococcus jannaschii
sp|Q8ZTQ7|SAHH_PYRAE|SAHH_PYRAE Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   271   3e-71   Pyrobaculum aerophilum
gb:AP008231_580601 Synechococcus elongatus PCC 6301 DNA, complet...   268   3e-70   
sp|Q7NGI6|SAHH_GLOVI|SAHH_GLOVI Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   265   3e-69   Gloeobacter violaceus
sp|P74008|SAHH_SYNY3|SAHH_SYNY3 Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   264   5e-69   Synechocystis sp.
gb:CP000027_79518 Dehalococcoides ethenogenes 195, complete genome.   262   2e-68   
sp|Q8YX05|SAHH_ANASP|SAHH_ANASP Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   260   8e-68   Anabaena sp.
sp|O67240|SAHH_AQUAE|SAHH_AQUAE Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   259   1e-67   Aquifex aeolicus
sp|Q8DGC8|SAHH_SYNEL|SAHH_SYNEL Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   259   1e-67   Synechococcus elongatus
sp|O28279|SAHH_ARCFU|SAHH_ARCFU Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   259   2e-67   Archaeoglobus fulgidus
pir|H71167|H71167 probable S-adenosyl-L-homocysteine hydrolase -...   256   9e-67   Pyrococcus horikoshii
sp|O58275|SAHH_PYRHO|SAHH_PYRHO Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   256   1e-66   Pyrococcus horikoshii
sp|P50251|SAHH_PYRFU|SAHH_PYRFU Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   255   3e-66   Pyrococcus furiosus
gb:AP006878_575180 Thermococcus kodakaraensis strain KOD1 DNA, c...   254   3e-66   
gb:AY142857_592040 Heliobacillus mobilis Adenosylhomocysteinase ...   252   2e-65   
sp|O27673|SAHH_METTH|SAHH_METTH Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   252   2e-65   Methanothermobacter thermautotrophicus
sp|Q9UYK5|SAHH_PYRAB|SAHH_PYRAB Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   248   3e-64   Pyrococcus abyssi
gb:AP006840_568886 Symbiobacterium thermophilum DNA, complete ge...   243   1e-62   
gb:AF178115_485818 Mycobacterium bovis S-adenosyl-L-homocysteine...   239   1e-61   
sp|Q9HKX4|SAHH_THEAC|SAHH_THEAC Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   239   2e-61   Thermoplasma acidophilum
sp|Q979Z4|SAHH_THEVO|SAHH_THEVO Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   238   2e-61   Thermoplasma volcanium
sp|Q8PUQ4|SAHH_METMA|SAHH_METMA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   237   7e-61   Methanosarcina mazei
gb:AE017261_420287 Picrophilus torridus DSM 9790, complete genome.    233   1e-59   
sp|Q8TRA5|SAHH_METAC|SAHH_METAC Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   231   5e-59   Methanosarcina acetivorans
sp|O51933|SAHH_THEMA|SAHH_THEMA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   224   4e-57   Thermotoga maritima
gb:AF013268_468780 Thermotoga maritima S adenosylhomocysteine hy...   224   5e-57   
gb:AY596297_634056 Haloarcula marismortui ATCC 43049 chromosome ...   214   5e-54   
gb:AF129871_1770694 Gossypium hirsutum S-adenosyl-L-homocysteine...   198   4e-49   
gb:AF035319_1877930 Homo sapiens clone 23931 mRNA, partial cds.       197   6e-49   
sp|Q9HN50|SAHH_HALN1|SAHH_HALN1 Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   195   3e-48   Halobacterium sp.
gb:AF252255_1781009 Lupinus luteus S-adenosyl-L-homocysteinase I...   170   8e-41   
gb:PPI300723_1701349 Pinus pinaster partial mRNA for putative S-...   169   1e-40   
gb:BC003631_1968941 Homo sapiens S-adenosylhomocysteine hydrolas...   168   4e-40   
gb:AF178114_485817 Mycobacterium bovis S-adenosyl-L-homocysteine...   154   8e-36   
gb:BC051504_2100775 Mus musculus mRNA similar to KIAA0828 protei...   147   1e-33   
gb:DDAHCH_1376851 D. discoideum mRNA fragment for S-adenosyl-L-h...   144   8e-33   
gb:AE014295_311497 Bifidobacterium longum NCC2705, complete genome.   141   5e-32   
gb:AL356299_1924405 Human DNA sequence from clone CTD-3216D2 on ...   140   1e-31   
pir|S22958|S22958 adenosylhomocysteinase (EC 3.3.1.1) - Streptom...   124   7e-27   Streptomyces fradiae
sp|P26799|SAHH_STRFR|SAHH_STRFR Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   124   7e-27   Streptomyces fradiae
gb:AF206620_1776744 Cucumis melo adenosyl-homocysteinase mRNA, p...   114   5e-24   
gb:AF410884_508053 Mycobacterium avium subsp. paratuberculosis S...   113   2e-23   
gb:AX886059_1481512 Sequence 1922 from Patent EP1033401.               97   9e-19   
gb:PFAOR_157813 P.furiosus aor, cmo and ado-hcy genes.                 93   2e-17   
pir|F69360|F69360 adenosylhomocysteinase (EC 3.3.1.1) homolog ah...    87   2e-15   Archaeoglobus fulgidus
gb:SSU18930_191175 Sulfolobus solfataricus 281 kb genomic DNA fr...    75   4e-12   
gb:AY389748_1178355 Hyacinthus orientalis adenosylhomocysteinase...    64   1e-08   
gb:AE017354_460524 Legionella pneumophila subsp. pneumophila str...    54   8e-06   
gb:CR628336_112226 Legionella pneumophila str. Paris complete ge...    52   5e-05   
gb:BX640419_807254 Bordetella pertussis strain Tohama I, complet...    46   0.002   
gb:AE010604_264862 Fusobacterium nucleatum subsp. nucleatum ATCC...    46   0.003   
pir|D97262|D97262 probable phosphoglycerate dehydrogenase [impor...    45   0.004   Clostridium acetobutylicum
gb:NCB20D17_1689641 Neurospora crassa DNA linkage group V BAC cl...    43   0.025   
gb:AE016765_327392 Escherichia coli CFT073 section 11 of 18 of t...    42   0.033   
gb:REU80928_163175 Rhizobium etli strain CFN42 symbiotic plasmid...    42   0.033   
sp|Q59516|DHGY_METEX|DHGY_METEX Glycerate dehydrogenase (EC 1.1.1.29) (NADH...    42   0.033   Methylorubrum extorquens
gb:BX572099_798674 Prochlorococcus marinus MIT9313 complete geno...    42   0.057   
gb:MDI421476_143251 Methylobacterium dichloromethanicum gene for...    41   0.074   
gb:AE017282_428987 Methylococcus capsulatus str. Bath, complete ...    41   0.097   
gb:BA000012_670963 Mesorhizobium loti MAFF303099 DNA, complete g...    40   0.13    
gb:AE017261_419389 Picrophilus torridus DSM 9790, complete genome.     40   0.13    
gb:MLO672112_148428 Mesorhizobium loti R7A symbiosis island; seg...    40   0.13    
pir|I40211|I40211 probable sterol dehydrogenase (EC 1.1.1.-) - B...    40   0.17    Bradyrhizobium japonicum
sp|Q45219|YL46_BRAJA|YL46_BRAJA Probable short-chain type dehydrogenase/red...    40   0.17    Bradyrhizobium japonicum
gb:BA000040_732174 Bradyrhizobium japonicum USDA 110 DNA, comple...    40   0.22    
gb:AY820162_646722 Leuconostoc mesenteroides putative lactate de...    40   0.22    
pir|G75284|G75284 probable potassium channel - Deinococcus radio...    40   0.22    Deinococcus radiodurans
sp|P51011|LDHD_LEUMC|LDHD_LEUMC D-lactate dehydrogenase (EC 1.1.1.28) (D-LD...    40   0.22    Leuconostoc mesenteroides subsp. cremoris
gb:AF285781_1783144 Ophiostoma floccosum hydroxynaphthalene redu...    39   0.28    
gb:BA000035_717047 Corynebacterium efficiens YS-314 DNA, complet...    39   0.28    
pir|AD1285|AD1285 glycerate dehydrogenases homolog lmo1684 [impo...    39   0.28    Listeria monocytogenes
gb:AB120870_1527988 Alternaria brassicae Brn1 gene for 1,3,8-nap...    39   0.37    
pir|E86731|E86731 hypothetical protein folD [imported] - Lactoco...    39   0.37    Lactococcus lactis subsp. lactis
gb:AB120866_1527984 Alternaria brassicae Brn1 gene for 1,3,8-nap...    39   0.48    
gb:BA000045_743851 Gloeobacter violaceus PCC 7421 DNA, complete ...    39   0.48    
gb:BA000030_699253 Streptomyces avermitilis MA-4680 genomic DNA,...    39   0.48    
gb:AE017333_448789 Bacillus licheniformis DSM 13, complete genom...    39   0.48    
sp|P55541|Y4LA_RHISN|Y4LA_RHISN Putative short-chain type dehydrogenase/red...    39   0.48    Rhizobium sp.
gb:AB120884_1528002 Embellisia leptinellae Brn1 gene for 1,3,8-n...    38   0.63    
gb:AB120882_1528000 Embellisia hyacinthi Brn1 gene for 1,3,8-nap...    38   0.63    
gb:AB120881_1527999 Embellisia hyacinthi Brn1 gene for 1,3,8-nap...    38   0.63    
gb:AB120879_1527997 Embellisia chlamydospora Brn1 gene for 1,3,8...    38   0.63    
gb:AB120877_1527995 Embellisia chlamydospora Brn1 gene for 1,3,8...    38   0.63    
gb:AB120873_1527991 Embellisia allii Brn1 gene for 1,3,8-naphtha...    38   0.63    
gb:AB120868_1527986 Alternaria porri Brn1 gene for 1,3,8-naphtha...    38   0.63    
gb:AB120867_1527985 Alternaria iridicola Brn1 gene for 1,3,8-nap...    38   0.63    
gb:AB094667_1525271 Alternaria alternata Brm2 gene for 1,3,8-tri...    38   0.63    
gb:AB015743_1512725 Alternaria alternata gene for 1,3,8-trihydro...    38   0.63    
gb:AB011651_1511557 Bipolaris papendorfii gene for Brn1, partial...    38   0.63    
pir|S75499|S75499 D-isomer specific 2-hydroxyacid dehydrogenase ...    38   0.63    Synechocystis sp. PCC 6803
sp|P37253|ILVC_BACSU|ILVC_BACSU Ketol-acid reductoisomerase (EC 1.1.1.86) (...    38   0.63    Bacillus subtilis
gb:AF419330_1798408 Cochliobolus lunatus hydroxynaphthalene redu...    38   0.82    
gb:AB120876_1527994 Embellisia annulata Brn1 gene for 1,3,8-naph...    38   0.82    
gb:AB011644_1511550 Cochliobolus hawaiiensis gene for Brn1, part...    38   0.82    
gb:CP000001_854375 Bacillus cereus ZK, complete genome.                38   0.82    
gb:AE017355_465053 Bacillus thuringiensis serovar konkukian str....    38   0.82    
gb:AE017277_425269 Bacillus cereus ATCC 10987, section 14 of 18 ...    38   0.82    
gb:AE017037_384196 Bacillus anthracis str. Ames section 14 of 18...    38   0.82    
gb:AF317668_1785566 Ophiostoma floccosum reductase gene, complet...    37   1.1     
gb:AB083402_1524219 Bipolaris oryzae Bthr1 gene for reductase, c...    37   1.1     
gb:AB011663_1511569 Bipolaris sp. 4 gene for Brn1, partial cds.        37   1.1     
gb:AB011659_1511565 Curvularia intermedia gene for Brn1, partial...    37   1.1     
gb:AB011655_1511561 Bipolaris spicifera gene for Brn1, partial cds.    37   1.1     
gb:AB011653_1511559 Bipolaris sorokiniana gene for Brn1, partial...    37   1.1     
gb:AB011649_1511555 Bipolaris leersiae gene for Brn1, partial cds.     37   1.1     
gb:AB011643_1511549 Cochliobolus cynodontis gene for Brn1, parti...    37   1.1     
gb:AB011641_1511547 Bipolaris coicis gene for Brn1, partial cds.       37   1.1     
gb:AB011640_1511546 Bipolaris chloridis gene for Brn1, partial cds.    37   1.1     
gb:AB011639_1511545 Bipolaris bicolor gene for Brn1, partial cds...    37   1.1     
gb:AB011638_1511544 Cochliobolus australiensis gene for Brn1, pa...    37   1.1     
gb:AX105313_1461297 Sequence 6 from Patent WO0123596.                  37   1.1     
gb:BA000043_739236 Geobacillus kaustophilus HTA426 DNA, complete...    37   1.1     
gb:AY083837_588256 Geobacillus stearothermophilus strain ATCC 79...    37   1.1     
gb:AP006840_569016 Symbiobacterium thermophilum DNA, complete ge...    37   1.1     
gb:AE009924_257460 Pyrobaculum aerophilum strain IM2 section 179...    37   1.1     
sp|Q98KM7|ILVC_RHILO|ILVC_RHILO Ketol-acid reductoisomerase (EC 1.1.1.86) (...    37   1.1     
sp|Q02207|FOX2_YEAST|FOX2_YEAST Peroxisomal hydratase-dehydrogenase-epimera...    37   1.1     
gb:AB120885_1528003 Embellisia planifunda Brn1 gene for 1,3,8-na...    37   1.4     
gb:AB120869_1527987 Alternaria brassicae Brn1 gene for 1,3,8-nap...    37   1.4     
gb:AB011654_1511560 Bipolaris stenospila gene for Brn1, partial ...    37   1.4     
gb:AB011650_1511556 Bipolaris panici-miliacei gene for Brn1, par...    37   1.4     
gb:AB011646_1511552 Bipolaris kusanoi gene for Brn1, partial cds.      37   1.4     
gb:AB011642_1511548 Bipolaris cookei gene for Brn1, partial cds.       37   1.4     
gb:AB001564_1508474 Cochliobolus heterostrophus gene for Brn1, c...    37   1.4     
gb:AE013598_295844 Xanthomonas oryzae pv. oryzae KACC10331, comp...    37   1.4     
gb:SME591791_186564 Sinorhizobium meliloti 1021 complete chromos...    37   1.4     
gb:CP000026_76074 Salmonella enterica subsp. enterica serovar Pa...    37   1.4     
pir|D85648|D85648 probable oxidoreductase Z1533 [imported] - Esc...    37   1.4     
gb:AB120880_1527998 Embellisia conoidea Brn1 gene for 1,3,8-naph...    37   1.8     
gb:AB011648_1511554 Bipolaris nodulosa gene for Brn1, partial cds.     37   1.8     
gb:AB011645_1511551 Bipolaris heveae gene for Brn1, partial cds.       37   1.8     
gb:AX063939_1458883 Sequence 221 from Patent WO0100843.>gb:AX244...    37   1.8     
gb:CP000009_864161 Gluconobacter oxydans 621H, complete genome.        37   1.8     
gb:AP006618_557413 Nocardia farcinica IFM 10152 DNA, complete ge...    37   1.8     
gb:AF454951_512934 Brucella melitensis biovar Abortus flanking g...    37   1.8     
gb:AE017011_378892 Bacillus cereus ATCC 14579 section 14 of 18 o...    37   1.8     
pir|AC3537|AC3537 dipeptide transport system permease protein dp...    37   1.8     
pir|H95353|H95353 probable [imported] - Sinorhizobium meliloti (...    37   1.8     
pir|AC0664|AC0664 D-lactate dehydrogenase [imported] - Salmonell...    37   1.8     
gb:AP003329_1828000 Oryza sativa (japonica cultivar-group) genom...    36   2.4     
gb:CR382125_1658102 Kluyveromyces lactis strain NRRL Y-1140 chro...    36   2.4     
gb:AB120887_1528005 Pleospora tarda Brn1 gene for 1,3,8-naphthal...    36   2.4     
gb:AB120871_1527989 Embellisia abundans Brn1 gene for 1,3,8-naph...    36   2.4     
gb:BX569693_776639 Synechococcus sp. WH8102 complete genome; seg...    36   2.4     
gb:AE017327_444132 Listeria monocytogenes str. 4b F2365, section...    36   2.4     
pir|AG1656|AG1656 glycerate dehydrogenases homolog lin1792 [impo...    36   2.4     
gb:BT003469_1356871 Drosophila melanogaster RE70568 full insert ...    36   3.1     
gb:AE014134_1129702 Drosophila melanogaster chromosome 2L, compl...    36   3.1     
gb:BA000043_739842 Geobacillus kaustophilus HTA426 DNA, complete...    36   3.1     
pir|T06264|T06264 3-dehydroquinate dehydratase (EC 4.2.1.10) / s...    36   3.1     
pir|F83127|F83127 probable short-chain dehydrogenase PA4148 [imp...    36   3.1     
gb:AB120872_1527990 Embellisia allii Brn1 gene for 1,3,8-naphtha...    35   4.1     
gb:AF310894_1261394 Dictyostelium discoideum prespore-specific p...    35   4.1     
gb:AF104350_1241492 Dictyostelium discoideum prespore-specific p...    35   4.1     
gb:BX897700_829069 Bartonella quintana str. Toulouse, complete g...    35   4.1     
gb:BA000043_738009 Geobacillus kaustophilus HTA426 DNA, complete...    35   4.1     
gb:AE017283_431155 Propionibacterium acnes KPA171202, complete g...    35   4.1     
gb:SME591784_184646 Sinorhizobium meliloti 1021 complete chromos...    35   4.1     
gb:AB120883_1528001 Embellisia indefessa Brn1 gene for 1,3,8-nap...    35   5.3     
gb:CP000010_866092 Burkholderia mallei ATCC 23344 chromosome 1, ...    35   5.3     
gb:BX571965_790950 Burkholderia pseudomallei strain K96243, chro...    35   5.3     
gb:AE017229_411414 Mycobacterium avium subsp. paratuberculosis s...    35   5.3     
gb:AE011817_276777 Xanthomonas axonopodis pv. citri str. 306, se...    35   5.3     
pir|F64492|F64492 ketol-acid reductoisomerase (EC 1.1.1.86) - Me...    35   5.3     
sp|Q58938|ILVC_METJA|ILVC_METJA Ketol-acid reductoisomerase (EC 1.1.1.86) (...    35   5.3     
gb:AL683870_1932375 Human DNA sequence from clone RP11-261P4 on ...    35   6.9     
gb:AY340666_1600679 Cochliobolus lunatus StcQ-like protein and 1...    35   6.9     
gb:BX569694_776753 Synechococcus sp. WH8102 complete genome; seg...    35   6.9     
gb:BA000040_734236 Bradyrhizobium japonicum USDA 110 DNA, comple...    35   6.9     
gb:BA000012_666605 Mesorhizobium loti MAFF303099 DNA, complete g...    35   6.9     
gb:AE013598_295511 Xanthomonas oryzae pv. oryzae KACC10331, comp...    35   6.9     
gb:AE013166_289782 Thermoanaerobacter tengcongensis MB4, section...    35   6.9     
gb:AE012285_281070 Xanthomonas campestris pv. campestris str. AT...    35   6.9     
gb:CR555306_108390 Azoarcus sp. EbN1 complete genome.                  35   6.9     
gb:CR378663_93675 Photobacterium profundum SS9; segment 1/12.          35   6.9     
pir|H64531|H64531 phosphoglycerate dehydrogenase - Helicobacter ...    35   6.9     
gb:AF547435_2068060 Mus musculus phosphodiesterase 3B (Pde3b) mR...    34   9.1     
gb:EMEVERA1AA_1676657 Emericella nidulans (verA) gene, complete ...    34   9.1     
gb:CP000020_872282 Vibrio fischeri ES114 chromosome I, complete ...    34   9.1     
gb:CP000010_867202 Burkholderia mallei ATCC 23344 chromosome 1, ...    34   9.1     
gb:BX571965_790316 Burkholderia pseudomallei strain K96243, chro...    34   9.1     
gb:BA000030_699306 Streptomyces avermitilis MA-4680 genomic DNA,...    34   9.1     
gb:BA000012_666776 Mesorhizobium loti MAFF303099 DNA, complete g...    34   9.1     
gb:AY596296_631405 Haloarcula marismortui ATCC 43049 plasmid pNG...    34   9.1     
gb:AE017283_431572 Propionibacterium acnes KPA171202, complete g...    34   9.1     
gb:AE017164_395683 Prochlorococcus marinus subsp. marinus str. C...    34   9.1     
gb:AE016969_369791 Mycoplasma gallisepticum strain R section 3 o...    34   9.1     
gb:AE015531_315277 Shewanella oneidensis MR-1 section 80 of 457 ...    34   9.1     
gb:AE011946_277961 Xanthomonas axonopodis pv. citri str. 306, se...    34   9.1     
gb:CR555306_108719 Azoarcus sp. EbN1 complete genome.                  34   9.1     
pir|S50754|S50754 hypothetical protein WP6 - Chlamydomonas eugam...    34   9.1     
pir|D90241|D90241 d-3-phosphoglycerate dehydrogenase (serA-1) [i...    34   9.1     
pir|A54038|A54038 phenylalanine dehydrogenase (EC 1.4.1.20) - Rh...    34   9.1     
pir|S76754|A47037 ketol-acid reductoisomerase (EC 1.1.1.86) - Sy...    34   9.1     
sp|P29107|ILVC_SYNY3|ILVC_SYNY3 Ketol-acid reductoisomerase (EC 1.1.1.86) (...    34   9.1     
sp|Q9K8E7|ILVC_BACHD|ILVC_BACHD Ketol-acid reductoisomerase (EC 1.1.1.86) (...    34   9.1     
sp|Q8UDV0|ILVC_AGRT5|ILVC_AGRT5 Ketol-acid reductoisomerase (EC 1.1.1.86) (...    34   9.1     
sp|Q97YJ9|ILC2_SULSO|ILC2_SULSO Putative ketol-acid reductoisomerase 2 (EC ...    34   9.1     
sp|Q61409|CN3B_MOUSE|CN3B_MOUSE cGMP-inhibited 3',5'-cyclic phosphodiestera...    34   9.1     


>gb:AY224544_1590741 Oryza sativa (japonica cultivar-group) isolate
            23829 wheat adenosylhomocysteinase-like protein mRNA,
            complete cds.
          Length = 485

 Score =  859 bits (2220), Expect = 0.0
 Identities = 421/482 (87%), Positives = 437/482 (90%)
 Frame = +2

Query: 92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM 271
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHM
Sbjct: 4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHM 63

Query: 272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTER 451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETL+EYWWCTER
Sbjct: 64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER 123

Query: 452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD 631
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDP STDNAEF+IVLTIIRD
Sbjct: 124  CLDWGVGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNAEFKIVLTIIRD 183

Query: 632  GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG 811
            GLK+DP KY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYG
Sbjct: 184  GLKSDPSKYRKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYG 243

Query: 812  CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM 991
            CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct: 244  CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM 303

Query: 992  EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY 1171
            EGLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETY
Sbjct: 304  EGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETY 363

Query: 1172 PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL 1351
            PGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct: 364  PGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL 423

Query: 1352 WKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHY 1531
            WKEK+TGKYEKKVYVLPKHLDEKV                  QA YIS+PVEGPYKP HY
Sbjct: 424  WKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKSQADYISVPVEGPYKPAHY 483

Query: 1532 RY 1537
            RY
Sbjct: 484  RY 485



>sp|P35007|SAHH_CATRO Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>pir|S38379|S38379 adenosylhomocysteinase (EC
            3.3.1.1) - Madagascar periwinkle>gb:CRSAHH1_1673557
            C.roseus SAHH gene for S-adenosyl-L-homocysteine
            hydrolase.
          Length = 485

 Score =  858 bits (2218), Expect = 0.0
 Identities = 420/481 (87%), Positives = 436/481 (90%)
 Frame = +2

Query: 95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CRAEFGPSQPFKGA+ITGSLHMT
Sbjct: 5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGSLHMT 64

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
            IQTAVLIETLTALGAEVRWCSCNIFSTQ+H              WKGETLQEYWWCTERA
Sbjct: 65   IQTAVLIETLTALGAEVRWCSCNIFSTQEHAAAAIARDSAAVFAWKGETLQEYWWCTERA 124

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY KNG +PDPSSTDNAEFQIVLTIIRDG
Sbjct: 125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYKKNGALPDPSSTDNAEFQIVLTIIRDG 184

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
            LK+DP KYTRMKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct: 185  LKSDPTKYTRMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC 244

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            RHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAALKQAGARVIVTEIDPICALQA ME
Sbjct: 245  RHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQATME 304

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct: 305  GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP 364

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
            GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct: 365  GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 424

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
             E+ TGKYEKKVYVLPKHLDEKV                 +QA YIS+P+EGPYKP HYR
Sbjct: 425  NERKTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPIEGPYKPAHYR 484

Query: 1535 Y 1537
            Y
Sbjct: 485  Y 485



>gb:A57643_1449818 Sequence 1 from Patent WO9632488.
          Length = 485

 Score =  854 bits (2206), Expect = 0.0
 Identities = 414/481 (86%), Positives = 434/481 (90%)
 Frame = +2

Query: 95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHMT
Sbjct: 5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHMT 64

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
            IQTAVLIETLTALG EVRWCSCNIFSTQDH              WKGETLQEYWWCTERA
Sbjct: 65   IQTAVLIETLTALGPEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERA 124

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            LDWGPGGGPDLIVDDGGD TLLIHEGVKAEEEY K G +PDP+STDNAEFQIVLTIIRDG
Sbjct: 125  LDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEEYEKTGKMPDPASTDNAEFQIVLTIIRDG 184

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
            LK DP KY +MK+R+VGVSEETTTGVKRLYQMQ + +LLFPAINVNDSVTKSKFDNLYGC
Sbjct: 185  LKVDPTKYRKMKDRIVGVSEETTTGVKRLYQMQANNSLLFPAINVNDSVTKSKFDNLYGC 244

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            RHSLPDGLMRATDVMIAGKVAVVCGYGDVG+GCAAALKQAGARVIVTEIDPICALQALME
Sbjct: 245  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGEGCAAALKQAGARVIVTEIDPICALQALME 304

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            GLQVLTLEDVVSEADIFVTTTGNKDIIM+ HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct: 305  GLQVLTLEDVVSEADIFVTTTGNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP 364

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
            G+KRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct: 365  GIKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 424

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
             EK +GKYEKKVYVLPKHLDEKV                P QA YIS+P+EGPYKPPHYR
Sbjct: 425  NEKASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSPSQADYISVPIEGPYKPPHYR 484

Query: 1535 Y 1537
            Y
Sbjct: 485  Y 485



>sp|O23255|SAHH_ARATH Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>pir|C71400|C71400 adenosylhomocysteinase (EC
            3.3.1.1) [similarity] - Arabidopsis
            thaliana>gb:ATCHRIV37_1545158 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 37.>gb:ATFCA0_1551444
            Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
            fragment No. 0.>gb:AY042866_1560931 Arabidopsis thaliana
            adenosylhomocysteinase (Z97335.3) mRNA, complete
            cds.>gb:AY049279_1561921 Arabidopsis thaliana
            AT4g13940/dl3010w mRNA, complete cds.>gb:AY081468_1568728
            Arabidopsis thaliana adenosylhomocysteinase (Z97335.3)
            mRNA, complete cds.>gb:AY090284_1574036 Arabidopsis
            thaliana AT4g13940/dl3010w mRNA, complete
            cds.>gb:BT002404_1636007 Arabidopsis thaliana
            adenosylhomocysteinase (At4g13940) mRNA, complete
            cds.>gb:AF059581_1765051 Arabidopsis thaliana
            S-adenosyl-L-homocysteine hydrolase (SAHH) mRNA, complete
            cds.>gb:AF325037_1786491 Arabidopsis thaliana AT4g13940
            (AT4g13940/dl3010w) mRNA, complete cds.
          Length = 485

 Score =  853 bits (2205), Expect = 0.0
 Identities = 416/481 (86%), Positives = 435/481 (90%)
 Frame = +2

Query: 95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct: 5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT 64

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTERA
Sbjct: 65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA 124

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct: 125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG 184

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
            L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct: 185  LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGC 244

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct: 245  RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME 304

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct: 305  GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP 364

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
            GVKRITIKPQTDR+VFPETK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct: 365  GVKRITIKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 424

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
             EK +GKYEKKVYVLPKHLDEKV                 +Q+ Y+SIP+EGPYKPPHYR
Sbjct: 425  NEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYR 484

Query: 1535 Y 1537
            Y
Sbjct: 485  Y 485



>gb:AY085669_1570736 Arabidopsis thaliana clone 16846 mRNA, complete
            sequence.
          Length = 485

 Score =  853 bits (2204), Expect = 0.0
 Identities = 416/481 (86%), Positives = 434/481 (90%)
 Frame = +2

Query: 95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct: 5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT 64

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTERA
Sbjct: 65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA 124

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++G
Sbjct: 125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEG 184

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
            L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct: 185  LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGC 244

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct: 245  RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME 304

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            GLQVLTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct: 305  GLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP 364

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
            GVKRITIKPQTDR+VFPETK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct: 365  GVKRITIKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 424

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
             EK +GKYEKKVYVLPKHLDEKV                 +Q  Y+SIP+EGPYKPPHYR
Sbjct: 425  NEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQXDYVSIPIEGPYKPPHYR 484

Query: 1535 Y 1537
            Y
Sbjct: 485  Y 485



>sp|P50246|SAHH_MEDSA Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:ALFMSA2S_1818989 Medicago sativa
            adenosylhomocysteinase mRNA, complete cds.
          Length = 485

 Score =  853 bits (2204), Expect = 0.0
 Identities = 416/481 (86%), Positives = 433/481 (90%)
 Frame = +2

Query: 95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            VE T+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct: 5    VETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT 64

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWC+ERA
Sbjct: 65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERA 124

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            LDWGPGGGPDLIVDDGGD TLLIHEGVKAEE + K G +PDPSSTDNAE QIVLTIIRDG
Sbjct: 125  LDWGPGGGPDLIVDDGGDVTLLIHEGVKAEEVFEKTGQLPDPSSTDNAEMQIVLTIIRDG 184

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
            LK DPK+Y +MK R+VGVSEETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGC
Sbjct: 185  LKTDPKRYQKMKTRIVGVSEETTTGVKRLYQMQASGTLLFPAINVNDSVTKSKFDNLYGC 244

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQ GARVIVTEIDPICALQALME
Sbjct: 245  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQGGARVIVTEIDPICALQALME 304

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            GLQVLTLEDV+SEADIFVTTTGNKDIIMVS MKKMKNNAIVCNIGHFDNEIDMHGLETYP
Sbjct: 305  GLQVLTLEDVISEADIFVTTTGNKDIIMVSDMKKMKNNAIVCNIGHFDNEIDMHGLETYP 364

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
            GVKRITIKPQTDR+VFPETK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELW
Sbjct: 365  GVKRITIKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQIELW 424

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
            KEK +GKYEKKVYVLPKHLDEKV                 +QA YIS+PVEGPYKP HYR
Sbjct: 425  KEKTSGKYEKKVYVLPKHLDEKVAALHLGQLGAKLTKLSKDQADYISVPVEGPYKPAHYR 484

Query: 1535 Y 1537
            Y
Sbjct: 485  Y 485



>sp|P50248|SAHH_TOBAC Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase)
            (Cytokinin binding protein CBP57).>gb:D49804_1674629
            Nicotiana tabacum gene for S-adenosyl-L-homocysteine
            hydrolase, complete cds.>gb:TOBCBP57A_1725375 Tobacco
            mRNA for cytokinin binding protein CBP57
            (S-adenosyl-L-homocystein hydrolase), complete
            cds.>gb:TOBSALHHH_1725541 Nicotiana tabacum mRNA for
            S-adenosyl-L-homocysteine hydrolase, complete cds.
          Length = 485

 Score =  852 bits (2201), Expect = 0.0
 Identities = 414/481 (86%), Positives = 436/481 (90%)
 Frame = +2

Query: 95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct: 5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT 64

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTERA
Sbjct: 65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA 124

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGT+PDP+STDNAEFQ+VLTII++ 
Sbjct: 125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPNSTDNAEFQLVLTIIKES 184

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
            LK DP KYT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct: 185  LKTDPLKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC 244

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            RHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIVTEIDPICALQA ME
Sbjct: 245  RHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQATME 304

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            GLQVLTLEDVVS+ DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct: 305  GLQVLTLEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP 364

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
            GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct: 365  GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 424

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
             EK++GKYEKKVYVLPKHLDEKV                 +QA YIS+PVEGPYKP HYR
Sbjct: 425  NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYR 484

Query: 1535 Y 1537
            Y
Sbjct: 485  Y 485



>gb:AY224189_1590621 Medicago truncatula adenosylhomocysteinase (AHC2)
            gene, complete cds.
          Length = 485

 Score =  849 bits (2193), Expect = 0.0
 Identities = 414/481 (86%), Positives = 432/481 (89%)
 Frame = +2

Query: 95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            VE T+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct: 5    VETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT 64

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWC+ERA
Sbjct: 65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERA 124

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            LDWG GGGPDLIVDDGGD TLLIHEGVKAEE + K G +PDPSSTDNAE QIVLTIIRDG
Sbjct: 125  LDWGTGGGPDLIVDDGGDVTLLIHEGVKAEEVFEKTGQLPDPSSTDNAEMQIVLTIIRDG 184

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
            LK DPK+Y +MK R+VGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct: 185  LKTDPKRYQKMKTRIVGVSEETTTGVKRLYQMQATGTLLFPAINVNDSVTKSKFDNLYGC 244

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQ GARVIVTEIDPICALQALME
Sbjct: 245  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQGGARVIVTEIDPICALQALME 304

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            GLQVLTLEDV+SEADIFVTTTGNKDIIMVS MKKMKNNAIVCNIGHFDNEIDMHGLETYP
Sbjct: 305  GLQVLTLEDVISEADIFVTTTGNKDIIMVSDMKKMKNNAIVCNIGHFDNEIDMHGLETYP 364

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
            GVKRITIKPQTDR+VFPETK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELW
Sbjct: 365  GVKRITIKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQIELW 424

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
            KEK +GKYEKKVYVLPKHLDEKV                 +QA YIS+PVEGPYKP HYR
Sbjct: 425  KEKTSGKYEKKVYVLPKHLDEKVAALHLGQLGARLTKLSKDQADYISVPVEGPYKPAHYR 484

Query: 1535 Y 1537
            Y
Sbjct: 485  Y 485



>gb:AF428329_1799259 Arabidopsis thaliana AT3g23810/MYM9_15 mRNA,
            complete cds.
          Length = 485

 Score =  845 bits (2184), Expect = 0.0
 Identities = 412/481 (85%), Positives = 434/481 (90%)
 Frame = +2

Query: 95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C AEFGPSQP KGARITGSLHMT
Sbjct: 5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVAEFGPSQPLKGARITGSLHMT 64

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTERA
Sbjct: 65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA 124

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AKNGT PDP+STDN EFQIVL+II+DG
Sbjct: 125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVLSIIKDG 184

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
            L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGC
Sbjct: 185  LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGC 244

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct: 245  RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME 304

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            GLQVLTLEDVVSEADIF TTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct: 305  GLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP 364

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
            GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct: 365  GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 424

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
             EK++GKYEKKVYVLPKHLDEKV                 +Q+ Y+SIPVEGPYKP HYR
Sbjct: 425  NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYR 484

Query: 1535 Y 1537
            Y
Sbjct: 485  Y 485



>gb:AY059888_1564732 Arabidopsis thaliana S-adenosyl L-homocystein
            hydrolase (MYM9.16) mRNA, complete
            cds.>gb:AY093385_1575339 Arabidopsis thaliana S-adenosyl
            L-homocystein hydrolase (MYM9.16) mRNA, complete
            cds.>gb:AY150471_1585036 Arabidopsis thaliana putative
            S-adenosyl-L-homocysteinase (At3g23810) mRNA, complete
            cds.>gb:AP000377_1819855 Arabidopsis thaliana genomic
            DNA, chromosome 3, P1 clone: MYM9.
          Length = 485

 Score =  844 bits (2180), Expect = 0.0
 Identities = 411/481 (85%), Positives = 433/481 (90%)
 Frame = +2

Query: 95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct: 5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT 64

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTERA
Sbjct: 65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA 124

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AKNGT PDP+STDN EFQIVL+II+DG
Sbjct: 125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVLSIIKDG 184

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
            L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGC
Sbjct: 185  LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGC 244

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct: 245  RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME 304

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            GLQVLTLEDVVSEADIF TTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct: 305  GLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP 364

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
            GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct: 365  GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 424

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
             EK++GKYEKKVYVLPKHLDEKV                 +Q+ Y+SIPVEGPYKP HYR
Sbjct: 425  NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYR 484

Query: 1535 Y 1537
            Y
Sbjct: 485  Y 485



>sp|P93253|SAHH_MESCR Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:MCU79766_1685874 Mesembryanthemum
            crystallinum S-adenosyl-L-homocystein hydrolase mRNA,
            complete cds.
          Length = 485

 Score =  843 bits (2178), Expect = 0.0
 Identities = 411/481 (85%), Positives = 427/481 (88%)
 Frame = +2

Query: 95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct: 5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT 64

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTERA
Sbjct: 65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA 124

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            LDWG GGGPDLIVDDGGDATLLIHEGVKAEEEY KNGT+PDP+STDN EFQ+VL +IRD 
Sbjct: 125  LDWGAGGGPDLIVDDGGDATLLIHEGVKAEEEYEKNGTIPDPTSTDNPEFQLVLGLIRDS 184

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
            LK DPK+Y +MK RLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct: 185  LKVDPKRYHKMKTRLVGVSEETTTGVKRLYQMQATGTLLFPAINVNDSVTKSKFDNLYGC 244

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            RHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA ALK AGARVIVTEIDPICALQALME
Sbjct: 245  RHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCALALKAAGARVIVTEIDPICALQALME 304

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            G Q+LTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YP
Sbjct: 305  GFQILTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYP 364

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
            GVKRITIKPQTDRFVFPET TGII+LAEGRLM LGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct: 365  GVKRITIKPQTDRFVFPETNTGIIVLAEGRLMKLGCATGHPSFVMSCSFTNQVIAQLELW 424

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
             E+ +GKYEKKVYVLPKHLDEKV                 +QA YIS+PVEGPYKP HYR
Sbjct: 425  NERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYR 484

Query: 1535 Y 1537
            Y
Sbjct: 485  Y 485



>gb:AY094404_1575709 Arabidopsis thaliana AT3g23810/MYM9_15 mRNA,
            complete cds.
          Length = 485

 Score =  842 bits (2174), Expect = 0.0
 Identities = 410/481 (85%), Positives = 432/481 (89%)
 Frame = +2

Query: 95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct: 5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT 64

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTERA
Sbjct: 65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA 124

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  +AKNGT PDP+STDN EFQIVL+II+DG
Sbjct: 125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEAIFAKNGTFPDPTSTDNPEFQIVLSIIKDG 184

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
            L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGC
Sbjct: 185  LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGC 244

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct: 245  RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME 304

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            GLQVLTLEDVVSEADIF TTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct: 305  GLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP 364

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
            GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct: 365  GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 424

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
             EK++GKYEKKVYVLPKHLDEKV                 +Q+ Y+SIPVEGPYKP HYR
Sbjct: 425  NEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYR 484

Query: 1535 Y 1537
            Y
Sbjct: 485  Y 485



>gb:AY050783_1562292 Arabidopsis thaliana putative
            S-adenosyl-L-homocysteinas protein (At3g23810) mRNA,
            complete cds.
          Length = 485

 Score =  841 bits (2172), Expect = 0.0
 Identities = 410/481 (85%), Positives = 432/481 (89%)
 Frame = +2

Query: 95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct: 5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT 64

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTERA
Sbjct: 65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA 124

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AKNGT PDP+STDN EFQIVL+II+DG
Sbjct: 125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVLSIIKDG 184

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
            L+ DPKKY +MKERLVGVSEETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGC
Sbjct: 185  LQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGC 244

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            RHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALME
Sbjct: 245  RHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALME 304

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            GLQVLTLEDVVSEADIF TTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYP
Sbjct: 305  GLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYP 364

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
            GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct: 365  GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 424

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
             EK++GKYEKKVYVLPK LDEKV                 +Q+ Y+SIPVEGPYKP HYR
Sbjct: 425  NEKSSGKYEKKVYVLPKRLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYR 484

Query: 1535 Y 1537
            Y
Sbjct: 485  Y 485



>sp|P32112|SAHH_WHEAT Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>pir|T06764|T06764 adenosylhomocysteinase (EC
            3.3.1.1) - wheat>gb:WHTSHH_1727713 Triticum aestivum
            S-adenosyl-L-homocysteine hydrolase (SH6.2) mRNA,
            complete cds.
          Length = 485

 Score =  840 bits (2171), Expect = 0.0
 Identities = 413/482 (85%), Positives = 431/482 (89%)
 Frame = +2

Query: 92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM 271
            +VEKTSSGREYKVKD+ QADFGRLELELAEVEMPGLMACR EFGPSQPFKGARI+GSLHM
Sbjct: 4    SVEKTSSGREYKVKDLFQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARISGSLHM 63

Query: 272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTER 451
            TIQTAVLIETLTALGAEVRWCSCNIFS+QDH              WKGETL+EYWWCTER
Sbjct: 64   TIQTAVLIETLTALGAEVRWCSCNIFSSQDHAAAAIARDSAAVFAWKGETLEEYWWCTER 123

Query: 452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD 631
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDP STDN EF+IVLTIIRD
Sbjct: 124  CLDWGVGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNPEFKIVLTIIRD 183

Query: 632  GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG 811
            GLK D  KY +MKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG
Sbjct: 184  GLKTDASKYRKMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG 243

Query: 812  CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM 991
            CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct: 244  CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM 303

Query: 992  EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY 1171
            EG+Q+LTLEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETY
Sbjct: 304  EGIQILTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETY 363

Query: 1172 PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL 1351
            PGVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct: 364  PGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL 423

Query: 1352 WKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHY 1531
            W EK +GKYEKKVYVLPKHLDEKV                  Q+ YISIP+EGPYK   Y
Sbjct: 424  WNEKASGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKSQSDYISIPIEGPYKLRLY 483

Query: 1532 RY 1537
            RY
Sbjct: 484  RY 485



>gb:AY224188_1590620 Medicago truncatula adenosylhomocysteinase (AHC1)
            gene, complete cds.
          Length = 485

 Score =  840 bits (2170), Expect = 0.0
 Identities = 409/482 (84%), Positives = 427/482 (88%)
 Frame = +2

Query: 92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM 271
            TVEKT +GREYKV+D+SQADFGRLE+ELAE+EMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct: 4    TVEKTQAGREYKVRDLSQADFGRLEIELAEIEMPGLMSCRTEFGPSQPFKGARITGSLHM 63

Query: 272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTER 451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTER
Sbjct: 64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER 123

Query: 452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD 631
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDPSSTDNAEFQ+VLTIIRD
Sbjct: 124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGEVPDPSSTDNAEFQLVLTIIRD 183

Query: 632  GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG 811
            GLK DPK+Y +MK+RLVGVSEETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYG
Sbjct: 184  GLKTDPKRYRKMKDRLVGVSEETTTGVKRLYQMQASGTLLFPAINVNDSVTKSKFDNLYG 243

Query: 812  CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM 991
            CRHSLPDGLMRATDVMIAGKV VV GYGDVGKGCA ALKQAGARVIVTEIDPICALQALM
Sbjct: 244  CRHSLPDGLMRATDVMIAGKVGVVAGYGDVGKGCAVALKQAGARVIVTEIDPICALQALM 303

Query: 992  EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY 1171
            EG QVLTL+DVVS ADIFVTTTGNKDIIMV  M+KMKNNAIVCNIGHFDNEIDM GLE Y
Sbjct: 304  EGFQVLTLDDVVSYADIFVTTTGNKDIIMVDDMRKMKNNAIVCNIGHFDNEIDMSGLENY 363

Query: 1172 PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL 1351
            PGVKR+TIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct: 364  PGVKRVTIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL 423

Query: 1352 WKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHY 1531
            W E+ +GKYEKKVYVLPKHLDEKV                  QA YIS+PVEGPYKP HY
Sbjct: 424  WNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSQSQADYISVPVEGPYKPAHY 483

Query: 1532 RY 1537
            RY
Sbjct: 484  RY 485



>sp|Q9SP37|SAHH_LUPLU Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:AF185635_1775127 Lupinus luteus
            S-adenosyl-L-homocysteinase (SHH) mRNA, complete cds.
          Length = 485

 Score =  838 bits (2164), Expect = 0.0
 Identities = 411/481 (85%), Positives = 432/481 (89%)
 Frame = +2

Query: 95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA R+EFGPSQPFKGA+ITGSLHMT
Sbjct: 5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRSEFGPSQPFKGAKITGSLHMT 64

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTERA
Sbjct: 65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA 124

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            LDWGPGGGPDLIVDDGGD TLLIHEGVKAEE Y K+G  PDP STDNAEF+IVL+II++G
Sbjct: 125  LDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEIYEKSGQFPDPDSTDNAEFKIVLSIIKEG 184

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
            LK DPK+Y +MK+R+VGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGC
Sbjct: 185  LKTDPKRYHKMKDRVVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGC 244

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            RHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAALKQAGARVIVTEIDPICALQA ME
Sbjct: 245  RHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQATME 304

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            GLQVLTLEDVVSEADIFVTTTGNKDIIM+ HMKKMKNNAIVCNIGHFDNEIDM GLET+P
Sbjct: 305  GLQVLTLEDVVSEADIFVTTTGNKDIIMLDHMKKMKNNAIVCNIGHFDNEIDMLGLETHP 364

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
            GVKRITIKPQTDR+VFPET TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct: 365  GVKRITIKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 424

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
             EK++GKYEKKVYVLPKHLDEKV                 +QA YIS+PVEGPYKP HYR
Sbjct: 425  NEKSSGKYEKKVYVLPKHLDEKVAALHLEKLGAKLTKLSKDQADYISVPVEGPYKPFHYR 484

Query: 1535 Y 1537
            Y
Sbjct: 485  Y 485



>sp|Q01781|SAHH_PETCR Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:PUMSHHB_1702881 Parsley
            S-adenosylhomocysteine hydrolase (SHH) mRNA, complete
            cds.
          Length = 485

 Score =  837 bits (2162), Expect = 0.0
 Identities = 409/482 (84%), Positives = 432/482 (89%)
 Frame = +2

Query: 92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM 271
            +VEKT++GREYKVKDMS ADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct: 4    SVEKTAAGREYKVKDMSLADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM 63

Query: 272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTER 451
            TIQT VLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTER
Sbjct: 64   TIQTGVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSCAVFAWKGETLQEYWWCTER 123

Query: 452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD 631
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K+G +PDP+STDNAEFQIVL+IIRD
Sbjct: 124  ALDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYKKSGAIPDPASTDNAEFQIVLSIIRD 183

Query: 632  GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG 811
            GLK+DP KY +MK+RLVGVSEETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYG
Sbjct: 184  GLKSDPMKYHKMKDRLVGVSEETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYG 243

Query: 812  CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM 991
            CRHSLPDGLMRATDVMIAGKVA++ GYGDVGKGCAAA+KQAGARVIVTEIDPICALQA M
Sbjct: 244  CRHSLPDGLMRATDVMIAGKVALIAGYGDVGKGCAAAMKQAGARVIVTEIDPICALQATM 303

Query: 992  EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY 1171
            EGLQVL LEDVVSE DIFVTTTGNKDIIMVS M+KMKNNAIVCNIGHFDNEIDM GLETY
Sbjct: 304  EGLQVLPLEDVVSEVDIFVTTTGNKDIIMVSDMRKMKNNAIVCNIGHFDNEIDMLGLETY 363

Query: 1172 PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL 1351
            PGVKRITIKPQTDR+VFP+T  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL
Sbjct: 364  PGVKRITIKPQTDRWVFPDTGRGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL 423

Query: 1352 WKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHY 1531
            W EK++GKYEKKVYVLPKHLDEKV                 +QA YIS+PVEGPYKP HY
Sbjct: 424  WNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHY 483

Query: 1532 RY 1537
            RY
Sbjct: 484  RY 485



>sp|P50249|SAHH_PHASS Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>pir|S71621|S71621 adenosylhomocysteinase (EC
            3.3.1.1) - Phalaenopsis sp.>gb:PSSADHY_1702392
            Phalaenopsis sp. 'pSPORT1' mRNA for S-adenosyhomocysteine
            hydrolase.
          Length = 485

 Score =  836 bits (2159), Expect = 0.0
 Identities = 410/481 (85%), Positives = 428/481 (88%)
 Frame = +2

Query: 95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHMT
Sbjct: 5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHMT 64

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTER 
Sbjct: 65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC 124

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            L+WG GGGPDLIVDDGGDATLLIHEGVKAEEEY KNG +PDP+STDNAEFQIVL +IRD 
Sbjct: 125  LEWGAGGGPDLIVDDGGDATLLIHEGVKAEEEYEKNGKIPDPASTDNAEFQIVLGLIRDS 184

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
            L  DPKKY RMKERLVGVSEETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGC
Sbjct: 185  LSVDPKKYRRMKERLVGVSEETTTGVKRLYQMQYSGTLLFPAINVNDSVTKSKFDNLYGC 244

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            RHSLPDGLMRATDVMIAGKVAVVCGYGDVG GCAAALK AGARVIVTEIDPICALQALME
Sbjct: 245  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGLGCAAALKTAGARVIVTEIDPICALQALME 304

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            GL VL LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE++P
Sbjct: 305  GLPVLRLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLESFP 364

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
            GVKRITIKPQTDR VFP+T +GI++LAEGRLMNLGCATGHPSFVMS SFTNQVIAQLELW
Sbjct: 365  GVKRITIKPQTDRRVFPDTNSGILVLAEGRLMNLGCATGHPSFVMSSSFTNQVIAQLELW 424

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
            KE+ +GKYEKKVYVLPKHLDEKV                P QA YIS+PVEGPYKP HYR
Sbjct: 425  KERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQADYISVPVEGPYKPAHYR 484

Query: 1535 Y 1537
            Y
Sbjct: 485  Y 485



>sp|Q9SWF5|SAHH_LYCES Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:AF161705_1773413 Lycopersicon esculentum
            S-adenosyl-l-homocysteine hydrolase (SAHH) mRNA, complete
            cds.
          Length = 485

 Score =  825 bits (2132), Expect = 0.0
 Identities = 402/481 (83%), Positives = 428/481 (88%)
 Frame = +2

Query: 95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA RAEFGPSQP KGA+IT SLHMT
Sbjct: 5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGPSQPVKGAKITCSLHMT 64

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
            IQTA LIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTERA
Sbjct: 65   IQTAFLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA 124

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGTVPDP+STDN EFQ+VLTII++ 
Sbjct: 125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTVPDPTSTDNVEFQLVLTIIKES 184

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
            LK DP +YT+MKERLVGVSEETTTGVK+LYQM  +G+LLF  INVNDSVTKSKFDNLYGC
Sbjct: 185  LKTDPLRYTKMKERLVGVSEETTTGVKKLYQMPANGSLLFLPINVNDSVTKSKFDNLYGC 244

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            RHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAA+KQAGARVIVTEIDPICALQA ME
Sbjct: 245  RHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAAMKQAGARVIVTEIDPICALQATME 304

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            GLQVL LEDVVSE DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+P
Sbjct: 305  GLQVLFLEDVVSEVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFP 364

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
            GVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW
Sbjct: 365  GVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 424

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
             E+++GKYEKKVYVLPKHLDEKV                 +QA YI +PVEGPYKP HYR
Sbjct: 425  NERSSGKYEKKVYVLPKHLDEKVAALHLGKFGAKLTKLTKDQADYIYVPVEGPYKPAHYR 484

Query: 1535 Y 1537
            Y
Sbjct: 485  Y 485



>gb:ATSADLHH_1554140 Arabidopsis thaliana mRNA for
            S-adenosyl-L-homocysteine hydrolase.
          Length = 467

 Score =  823 bits (2127), Expect = 0.0
 Identities = 400/467 (85%), Positives = 421/467 (90%)
 Frame = +2

Query: 137  MSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALG 316
            MSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMTIQTAVLIETLTALG
Sbjct: 1    MSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALG 60

Query: 317  AEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGPDLIVD 496
            A+VRWCSCNIFSTQDH              WKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct: 61   AQVRWCSCNIFSTQDHARAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVD 120

Query: 497  DGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKER 676
            DGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++GL+ DPKKY +MKER
Sbjct: 121  DGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQVDPKKYHKMKER 180

Query: 677  LVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDV 856
            LVGVSEETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDV
Sbjct: 181  LVGVSEETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDV 240

Query: 857  MIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEA 1036
            MIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQALMEGLQVLTLEDVVSEA
Sbjct: 241  MIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEA 300

Query: 1037 DIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRF 1216
            DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+
Sbjct: 301  DIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRW 360

Query: 1217 VFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYV 1396
            VFPETK GII+LA+GRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYV
Sbjct: 361  VFPETKAGIIVLAQGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYV 420

Query: 1397 LPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            LPKHLDEKV                 +Q+ Y+SIP+EGPYKPPHYRY
Sbjct: 421  LPKHLDEKVALLHLGKLGARLRKLSKDQSDYVSIPIEGPYKPPHYRY 467



>gb:TOBCBP57B_1725376 Tobacco mRNA for cytokinin binding protein
            CBP57, complete cds.
          Length = 450

 Score =  803 bits (2074), Expect = 0.0
 Identities = 390/450 (86%), Positives = 407/450 (90%)
 Frame = +2

Query: 188  MPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHX 367
            MPGLMACR EFGPSQPFKGA+ITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH 
Sbjct: 1    MPGLMACRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHA 60

Query: 368  XXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 547
                         WKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE
Sbjct: 61   AAAIARDSRAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 120

Query: 548  EYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQ 727
            EYAK+G +PDPSSTDNAEFQ+VLTIIRDGLK DP KYT+MKERLVGVSEETTTGVKRLYQ
Sbjct: 121  EYAKSGKLPDPSSTDNAEFQLVLTIIRDGLKTDPLKYTKMKERLVGVSEETTTGVKRLYQ 180

Query: 728  MQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGK 907
            MQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVA+V GYGDVGK
Sbjct: 181  MQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVALVAGYGDVGK 240

Query: 908  GCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSH 1087
            GCAAALKQAGARVIVTEIDPICALQA MEGLQVLTLEDVVS+ DIFVTTTGNKDIIMV H
Sbjct: 241  GCAAALKQAGARVIVTEIDPICALQATMEGLQVLTLEDVVSDVDIFVTTTGNKDIIMVDH 300

Query: 1088 MKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRL 1267
            M+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRL
Sbjct: 301  MRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRL 360

Query: 1268 MNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXX 1447
            MNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKV        
Sbjct: 361  MNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKL 420

Query: 1448 XXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
                     +QA YIS+PVEGPYKPPHYRY
Sbjct: 421  GARLTKLSKDQADYISVPVEGPYKPPHYRY 450



>gb:AP006841_574982 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 487

 Score =  583 bits (1504), Expect = e-165
 Identities = 295/473 (62%), Positives = 353/473 (74%), Gaps = 1/473 (0%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D++ ADFGR E++LAE EMPGLMA R ++G S+P KGARI GSLHMTIQTAVLIET
Sbjct: 26   YKVADITLADFGRKEIDLAEKEMPGLMALREKYGESKPLKGARIMGSLHMTIQTAVLIET 85

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L ALGAEVRWCSCNI+STQDH              WKGETL +YWWCT +AL++  G GP
Sbjct: 86   LVALGAEVRWCSCNIYSTQDHAAAAIAASGVAVFAWKGETLADYWWCTLQALNFEGGKGP 145

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLT-IIRDGLKADPKKY 658
             +IVDDGGDAT++IH G +AE     N  V D     +AE +I L  I++  L  D +++
Sbjct: 146  TVIVDDGGDATMMIHVGYEAEN----NAAVLDKEV--HAEDEIELNAILKKVLAEDKERW 199

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
             R+   + GVSEETTTGV RLYQMQE G LLFPA NVNDSVTKSKFDNLYGCR SL DG+
Sbjct: 200  HRVAAEVRGVSEETTTGVHRLYQMQEEGKLLFPAFNVNDSVTKSKFDNLYGCRESLADGI 259

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLE 1018
             RATDVMIAGKV VVCGYGDVGKGC+ +++  GARV+VTE+DPICALQA MEG +V+T+E
Sbjct: 260  KRATDVMIAGKVVVVCGYGDVGKGCSHSMRSYGARVLVTEVDPICALQAAMEGFEVVTME 319

Query: 1019 DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIK 1198
            D   E +IFVTTTGN DII + HM++MK+ AIVCNIGHFDNEI +  L+ YPG+KR+ IK
Sbjct: 320  DACKEGNIFVTTTGNIDIIRIDHMEQMKDQAIVCNIGHFDNEIQVDALKHYPGIKRVNIK 379

Query: 1199 PQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKY 1378
            PQ DR+ FP+  + II+LA+GRL+NLGCATGHPSFVMS SFTNQ +AQ+EL+ +    KY
Sbjct: 380  PQVDRYYFPDGHS-IILLADGRLVNLGCATGHPSFVMSNSFTNQTLAQIELFNK----KY 434

Query: 1379 EKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            +  VY LPKHLDE+V                PEQAAYI + V+GPYK  HYRY
Sbjct: 435  DINVYRLPKHLDEEVARLHLEKIGVKLTKLTPEQAAYIGVSVDGPYKADHYRY 487



>sp|Q8A407|SAHH_BACTN Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:AE016937_362164 Bacteroides
            thetaiotaomicron VPI-5482, section 12 of 21 of the
            complete genome.>gb:AE015928_988652 Bacteroides
            thetaiotaomicron VPI-5482, complete genome.
          Length = 476

 Score =  579 bits (1493), Expect = e-164
 Identities = 294/473 (62%), Positives = 352/473 (74%), Gaps = 1/473 (0%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D++ ADFGR E++LAE EMPGLMA R ++G S+P KGARI GSLHMTIQTAVLIET
Sbjct: 15   YKVADITLADFGRKEIDLAEKEMPGLMALREKYGESKPLKGARIMGSLHMTIQTAVLIET 74

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L ALGAEVRWCSCNI+STQDH              WKGE L +YWWCT +AL++  G GP
Sbjct: 75   LVALGAEVRWCSCNIYSTQDHAAAAIAASGVAVFAWKGENLADYWWCTLQALNFPGGKGP 134

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLT-IIRDGLKADPKKY 658
            ++IVDDGGDAT++IH G  AE + A    V D     +AE +I L  I++  L  D  ++
Sbjct: 135  NVIVDDGGDATMMIHVGYDAENDAA----VLDKEV--HAEDEIELNAILKKVLAEDKTRW 188

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
             R+ E + GVSEETTTGV RLYQMQE G LLFPA NVNDSVTKSKFDNLYGCR SL DG+
Sbjct: 189  HRVAEEMRGVSEETTTGVHRLYQMQEEGKLLFPAFNVNDSVTKSKFDNLYGCRESLADGI 248

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLE 1018
             RATDVMIAGKV VVCGYGDVGKGC+ +++  GARV+VTE+DPICALQA MEG +V+T+E
Sbjct: 249  KRATDVMIAGKVVVVCGYGDVGKGCSHSMRSYGARVLVTEVDPICALQAAMEGFEVVTME 308

Query: 1019 DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIK 1198
            D  +E +IFVTTTGN DII + HM+KMK+ AIVCNIGHFDNEI +  L+ Y G+K + IK
Sbjct: 309  DACTEGNIFVTTTGNIDIIRIDHMEKMKDQAIVCNIGHFDNEIQVDALKHYSGIKCVNIK 368

Query: 1199 PQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKY 1378
            PQ DR+ FP+  + I++LA+GRL+NLGCATGHPSFVMS SFTNQ +AQ+EL+ +    KY
Sbjct: 369  PQVDRYYFPDGHS-ILLLADGRLVNLGCATGHPSFVMSNSFTNQTLAQIELFNK----KY 423

Query: 1379 EKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            E  VY LPKHLDE+V                PEQAAYI + V+GPYK  HYRY
Sbjct: 424  EVNVYRLPKHLDEEVARLHLEKIGVKLTKLTPEQAAYIGVSVDGPYKAEHYRY 476



>sp|Q82DC9|SAHH_STRAW Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:BA000030_702940 Streptomyces avermitilis
            MA-4680 genomic DNA, complete genome.
          Length = 485

 Score =  573 bits (1478), Expect = e-162
 Identities = 290/485 (59%), Positives = 354/485 (72%), Gaps = 11/485 (2%)
 Frame = +2

Query: 116  REYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLI 295
            +++KV D+S A+FGR E+ LAE EMPGLM+ R E+  +QP  GAR+TGSLHMT+QTAVLI
Sbjct: 8    QDFKVADLSLAEFGRKEITLAEHEMPGLMSIRKEYAEAQPLAGARVTGSLHMTVQTAVLI 67

Query: 296  ETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXX---------XXWKGETLQEYWWCTE 448
            ETL ALGAEVRW SCNIFSTQDH                       WKGETL+EYWWCTE
Sbjct: 68   ETLVALGAEVRWASCNIFSTQDHAAAAIAVGPNGTPDNPQGVPVFAWKGETLEEYWWCTE 127

Query: 449  RALDWG--PGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTI 622
            +AL W   P GGP++I+DDGGDATLL+H+GV    EY K+G VP   + ++ E +++L +
Sbjct: 128  QALTWPNTPTGGPNMILDDGGDATLLVHKGV----EYEKDGKVPSVDTAESDEHRVILEL 183

Query: 623  IRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDN 802
            +   +    +K+T++   + GV+EETTTGV RLY+M   GTLLFPAINVND+VTKSKFDN
Sbjct: 184  LHRTITDGSQKWTQLASEIRGVTEETTTGVHRLYEMHRDGTLLFPAINVNDAVTKSKFDN 243

Query: 803  LYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQ 982
             YGCRHSL DG+ RATDV+I GK AVVCGYGDVGKGCA +L+  GARVIVTEIDPICALQ
Sbjct: 244  KYGCRHSLIDGINRATDVLIGGKTAVVCGYGDVGKGCAESLRGQGARVIVTEIDPICALQ 303

Query: 983  ALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGL 1162
            A M+G QV TL++V+ +ADIFVTTTGNKDIIM S M KMK+ AIV NIGHFDNEIDM GL
Sbjct: 304  AAMDGYQVTTLDEVIDKADIFVTTTGNKDIIMASDMAKMKHQAIVGNIGHFDNEIDMAGL 363

Query: 1163 ETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ 1342
               PG+ +  +KPQ   + FP+ K  +I+L+EGRL+NLG ATGHPSFVMS SF +Q +AQ
Sbjct: 364  AQIPGIVKDEVKPQVHTWKFPDGKV-LIVLSEGRLLNLGNATGHPSFVMSNSFADQTLAQ 422

Query: 1343 LELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKP 1522
            +EL+ + +  +Y   VYVLPKHLDEKV                PEQAAYI + VEGP+K 
Sbjct: 423  IELFTKPD--EYPTDVYVLPKHLDEKVARLHLDSLGVKLTTLRPEQAAYIGVEVEGPFKS 480

Query: 1523 PHYRY 1537
             HYRY
Sbjct: 481  DHYRY 485



>sp|Q9KZM1|SAHH_STRCO Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:SCO939114_176696 Streptomyces coelicolor
            A3(2) complete genome; segment 11/29.
          Length = 485

 Score =  573 bits (1477), Expect = e-162
 Identities = 290/485 (59%), Positives = 352/485 (72%), Gaps = 11/485 (2%)
 Frame = +2

Query: 116  REYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLI 295
            +++KV D+S A FGR E+ LAE EMPGLMA R E+  +QP  GAR+TGSLHMT+QTAVLI
Sbjct: 8    QDFKVADLSLAAFGRKEITLAEHEMPGLMAIRKEYAEAQPLAGARVTGSLHMTVQTAVLI 67

Query: 296  ETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXX---------XXWKGETLQEYWWCTE 448
            ETL ALGAEVRW SCNIFSTQDH                       WKGETL+EYWWCTE
Sbjct: 68   ETLVALGAEVRWASCNIFSTQDHAAAAIAVGPNGTPDNPQGVPVFAWKGETLEEYWWCTE 127

Query: 449  RALDWG--PGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTI 622
            +AL W   P GGP++I+DDGGDATLL+H+GV    EY K+G VP   + ++ E +++L +
Sbjct: 128  QALTWPNTPTGGPNMILDDGGDATLLVHKGV----EYEKDGKVPSVDTAESDEHRVILEL 183

Query: 623  IRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDN 802
            +   +   P+K+T++   + GV+EETTTGV RLY+M   GTLLFPAINVND+VTKSKFDN
Sbjct: 184  LTRTVGESPQKWTQLASEIRGVTEETTTGVHRLYEMHRDGTLLFPAINVNDAVTKSKFDN 243

Query: 803  LYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQ 982
             YGCRHSL DG+ RATDV+I GK AVVCGYGDVGKGCA +L+  GARVI+TEIDPICALQ
Sbjct: 244  KYGCRHSLIDGINRATDVLIGGKTAVVCGYGDVGKGCAESLRGQGARVIITEIDPICALQ 303

Query: 983  ALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGL 1162
            A M+G QV TL++VV +ADIFVTTTGNKDIIM   M KMK+ AIV NIGHFDNEIDM GL
Sbjct: 304  AAMDGFQVTTLDEVVDKADIFVTTTGNKDIIMAKDMAKMKHQAIVGNIGHFDNEIDMAGL 363

Query: 1163 ETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ 1342
               PG+ +  +KPQ   + +P+ K  +I+L+EGRL+NLG ATGHPSFVMS SF +Q +AQ
Sbjct: 364  AQTPGIVKDEVKPQVHTWTYPDGKV-LIVLSEGRLLNLGNATGHPSFVMSNSFADQTLAQ 422

Query: 1343 LELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKP 1522
            +EL+ + +  +Y   VYVLPKHLDEKV                PEQA YI + VEGPYK 
Sbjct: 423  IELFTKPD--EYPTDVYVLPKHLDEKVARLHLDSLGVKLTTLRPEQADYIGVKVEGPYKA 480

Query: 1523 PHYRY 1537
             HYRY
Sbjct: 481  DHYRY 485



>sp|Q8GGL7|SAHH_STRAZ Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:AF484556_514900 Streptomyces
            atroolivaceus leinamycin biosynthetic gene cluster,
            complete sequence.
          Length = 469

 Score =  568 bits (1465), Expect = e-160
 Identities = 290/474 (61%), Positives = 347/474 (73%), Gaps = 1/474 (0%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            ++KV D+S A FGR E+ LAE EMPGLM+ R E+  +QP  GARITGSLHMT+QTAVLIE
Sbjct: 11   DFKVADLSLAAFGRKEITLAEHEMPGLMSIREEYAAAQPLAGARITGSLHMTVQTAVLIE 70

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG 478
            TL ALGA+VRW SCNI+STQDH              WKGETL+EYWWCTE+AL W    G
Sbjct: 71   TLVALGADVRWVSCNIYSTQDHAAAAIAAAGIPVFAWKGETLEEYWWCTEQALTWPGHTG 130

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII-RDGLKADPKK 655
            P++I+DDGGDATLL+H+GV    EY K G +P+    +N E  +V  ++ R GL      
Sbjct: 131  PNMILDDGGDATLLVHKGV----EYRKTGILPE---AENEELAVVRALLDRSGLD----- 178

Query: 656  YTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDG 835
            +T M   + GV+EETTTGV RLY+M   GTLLFPAINVND+VTKSKFDN YGCRHSL DG
Sbjct: 179  WTAMSSEIRGVTEETTTGVHRLYEMHRDGTLLFPAINVNDAVTKSKFDNKYGCRHSLIDG 238

Query: 836  LMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTL 1015
            + RATDV+I GK AVVCGYGDVGKGCA +L+  GARVI+TEIDPICALQA M+G QV TL
Sbjct: 239  INRATDVLIGGKTAVVCGYGDVGKGCAESLRGQGARVIITEIDPICALQAAMDGYQVATL 298

Query: 1016 EDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITI 1195
            ++VV +ADIFVTTTGNKDIIM S M KMK+ AIV NIGHFDNEIDM GL   PG+ +  +
Sbjct: 299  DEVVDKADIFVTTTGNKDIIMASDMAKMKHQAIVGNIGHFDNEIDMAGLAQIPGIVKDEV 358

Query: 1196 KPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGK 1375
            KPQ   + FP+ K  +I+L+EGRL+NLG ATGHPSFVMS SF +Q +AQ+EL+ + +  +
Sbjct: 359  KPQVHTWKFPDGKV-LIVLSEGRLLNLGNATGHPSFVMSNSFADQTLAQIELFTKPD--E 415

Query: 1376 YEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            Y   VYVLPKHLDEKV                PEQA+YI + V+GPYKP HYRY
Sbjct: 416  YPTDVYVLPKHLDEKVARLHLDALGVKLTTLRPEQASYIGVEVDGPYKPDHYRY 469



>gb:AB088224_11530 Streptomyces rochei plasmid pSLA2-L DNA, complete
            sequence.
          Length = 476

 Score =  565 bits (1455), Expect = e-159
 Identities = 296/484 (61%), Positives = 343/484 (70%), Gaps = 11/484 (2%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            ++KV D+S A+FGR E+ LAE EMPGLMA R E+    P  GARITGSLHMT+QTAVLIE
Sbjct: 7    DFKVADLSLAEFGRKEITLAEHEMPGLMAIRKEYAGEPPLAGARITGSLHMTVQTAVLIE 66

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXX---------XXWKGETLQEYWWCTER 451
            TL ALGAEVRW SCNIFSTQDH                       WKGETL+EYWWCTE+
Sbjct: 67   TLVALGAEVRWASCNIFSTQDHAAAAIAVGPDGTPDNPRGVPVFAWKGETLEEYWWCTEQ 126

Query: 452  ALDW--GPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII 625
            AL W   P GGP++I+DDGGDATLL+H+GV    EY K G +P     DN E   V  + 
Sbjct: 127  ALTWPDSPTGGPNMILDDGGDATLLVHKGV----EYRKTGELPP---ADNEELAAVAAL- 178

Query: 626  RDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNL 805
               LKA    +T +   + GV+EETTTGV RLY+MQ  G LLFPAINVND+VTKSKFDN 
Sbjct: 179  ---LKASNLDWTGIASEIRGVTEETTTGVHRLYEMQRDGVLLFPAINVNDAVTKSKFDNK 235

Query: 806  YGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 985
            YGCRHSL DG+ RATDV+I GK AVVCGYGDVGKGCA +L+  GARVIVTEIDPICALQA
Sbjct: 236  YGCRHSLVDGINRATDVLIGGKTAVVCGYGDVGKGCAESLRGQGARVIVTEIDPICALQA 295

Query: 986  LMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLE 1165
             M+G QV TL++VV  ADIFVTTTGNKDIIM S M +MK+ AIV NIGHFDNEIDM GL 
Sbjct: 296  AMDGYQVTTLDEVVETADIFVTTTGNKDIIMASDMARMKHQAIVGNIGHFDNEIDMAGLA 355

Query: 1166 TYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQL 1345
              PG+ +  +KPQ   + FP+ K  II+L+EGRL+NLG ATGHPSFVMS SF +Q +AQ+
Sbjct: 356  RVPGIVKDEVKPQVHTWTFPDGKV-IIVLSEGRLLNLGNATGHPSFVMSNSFADQTLAQI 414

Query: 1346 ELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPP 1525
            EL+ + +  +Y   VY LPKHLDEKV                PEQAAYI + VEGPYKP 
Sbjct: 415  ELFTKPD--QYPTGVYTLPKHLDEKVARLHLDALGVKLTTLRPEQAAYIGVEVEGPYKPD 472

Query: 1526 HYRY 1537
            HYRY
Sbjct: 473  HYRY 476



>sp|Q8KEG8|SAHH_CHLTE Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:AE012843_286200 Chlorobium tepidum TLS
            section 64 of 194 of the complete
            genome.>gb:AE006470_933368 Chlorobium tepidum TLS
            complete genome.
          Length = 471

 Score =  558 bits (1439), Expect = e-157
 Identities = 287/477 (60%), Positives = 338/477 (70%), Gaps = 4/477 (0%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            +YKV D+S A++GR E+E+AE EMPGLMA R ++   +P  GARI GSLHMTIQTAVLIE
Sbjct: 9    DYKVADISLAEWGRKEIEIAEKEMPGLMATRKKYEGKKPLAGARIAGSLHMTIQTAVLIE 68

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG 478
            TL  LGA+VRW SCNIFSTQDH              WKGETL EYWWCT + L++  G G
Sbjct: 69   TLVELGADVRWASCNIFSTQDHAAAAIAAAGVPVFAWKGETLDEYWWCTRQILEFEGGLG 128

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTD----NAEFQIVLTIIRDGLKAD 646
            P+LIVDDGGDATL+IH G K E          DPS  D    NAE + +L  ++     D
Sbjct: 129  PNLIVDDGGDATLMIHFGYKIEN---------DPSMLDKTPGNAEEKALLQQLKAVFAED 179

Query: 647  PKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSL 826
             +++ ++   + GVSEETTTGV RLYQM E G LLFPAINVNDSVTKSKFDNLYGCR SL
Sbjct: 180  NQRWHKVAAGMKGVSEETTTGVHRLYQMMEKGELLFPAINVNDSVTKSKFDNLYGCRESL 239

Query: 827  PDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQV 1006
             DG+ RATDVMIAGKV VV GYGDVGKGCA +++  GARVIVTEIDPICALQA MEG +V
Sbjct: 240  ADGIKRATDVMIAGKVVVVLGYGDVGKGCAHSMRSYGARVIVTEIDPICALQAAMEGFEV 299

Query: 1007 LTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKR 1186
             T+E+ V E +IFVT TGNKD+I + H+K+M++ AIVCNIGHFDNEI +  L  + G  R
Sbjct: 300  TTMEEAVKEGNIFVTATGNKDVITLDHIKQMRDEAIVCNIGHFDNEIQVDALNNFKGATR 359

Query: 1187 ITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKN 1366
            I IKPQ D++VF E    I +LAEGRL+NLGCATGHPSFVMS SFTNQ +AQ+ELW+   
Sbjct: 360  INIKPQVDKYVF-ENGNCIYLLAEGRLVNLGCATGHPSFVMSNSFTNQTLAQIELWQ--- 415

Query: 1367 TGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
               Y+  VY LPK LDE+V                 EQA YI +PVEGPYKP HYRY
Sbjct: 416  -NDYKVGVYRLPKKLDEEVARLHLGQIGAKLTTLTKEQADYIGVPVEGPYKPEHYRY 471



>gb:AF525293_1279200 Plasmodium falciparum 3D7
            S-adenosyl-L-homocysteine hydrolase gene, complete
            cds.>gb:PFA929353_1393112 Plasmodium falciparum strain
            3D7, chromosome 5, segment 3/4.
          Length = 479

 Score =  558 bits (1437), Expect = e-157
 Identities = 262/474 (55%), Positives = 340/474 (71%), Gaps = 3/474 (0%)
 Frame = +2

Query: 125  KVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETL 304
            KVKD+S A FG++++E++E EMPGLM  R E+G  QP K A+ITG LHMT++ A+LIETL
Sbjct: 7    KVKDISLAPFGKMQMEISENEMPGLMRIREEYGKDQPLKNAKITGCLHMTVECALLIETL 66

Query: 305  TALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXX-XWKGETLQEYWWCTERALDWGPG--G 475
              LGA++RWCSCNI+ST D+               WK ETL+EYWWC E AL WG G   
Sbjct: 67   QKLGAQIRWCSCNIYSTADYAAAAVSTLENVTVFAWKNETLEEYWWCVESALTWGDGDDN 126

Query: 476  GPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKK 655
            GPD+IVDDGGDATLL+H+GV+ E+ Y +   +PDP    N E +  LT++++ +  +PKK
Sbjct: 127  GPDMIVDDGGDATLLVHKGVEYEKLYEEKNILPDPEKAKNEEERCFLTLLKNSILKNPKK 186

Query: 656  YTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDG 835
            +T + ++++GVSEETTTGV RL +M +   LLF AINVND+VTK K+DN+YGCRHSLPDG
Sbjct: 187  WTNIAKKIIGVSEETTTGVLRLKKMDKQNELLFTAINVNDAVTKQKYDNVYGCRHSLPDG 246

Query: 836  LMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTL 1015
            LMRATD +I+GK+ V+CGYGDVGKGCA+++K  GARV +TEIDPICA+QA+MEG  V+TL
Sbjct: 247  LMRATDFLISGKIVVICGYGDVGKGCASSMKGLGARVYITEIDPICAIQAVMEGFNVVTL 306

Query: 1016 EDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITI 1195
            +++V + D F+T TGN D+I + H+ KMKNNA+V NIGHFD+EI ++ L  Y G+    +
Sbjct: 307  DEIVDKGDFFITCTGNVDVIKLEHLLKMKNNAVVGNIGHFDDEIQVNELFNYKGIHIENV 366

Query: 1196 KPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGK 1375
            KPQ DR   P     II+LA GRL+NLGCATGHP+FVMS SF NQ  AQL+LW+ K+T K
Sbjct: 367  KPQVDRITLPNGNK-IIVLARGRLLNLGCATGHPAFVMSFSFCNQTFAQLDLWQNKDTNK 425

Query: 1376 YEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            YE KVY+LPKHLDEKV                  Q  ++ +   GP+K   YRY
Sbjct: 426  YENKVYLLPKHLDEKVALYHLKKLNASLTELDDNQCQFLGVNKSGPFKSNEYRY 479



>gb:AF212157_1777422 Allium cepa S-adenosylhomocysteine hydrolase
            mRNA, partial cds.
          Length = 312

 Score =  555 bits (1431), Expect = e-157
 Identities = 275/308 (89%), Positives = 280/308 (90%)
 Frame = +2

Query: 95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            VEKTSSGREYKVKDMSQADFGRLELELAEV+MPGLMACR EFGPSQPFKGARITGSL MT
Sbjct: 5    VEKTSSGREYKVKDMSQADFGRLELELAEVDMPGLMACRTEFGPSQPFKGARITGSLLMT 64

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTERA
Sbjct: 65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA 124

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEY KNGT+PDPSSTDNAEFQIVLTIIRDG
Sbjct: 125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKNGTLPDPSSTDNAEFQIVLTIIRDG 184

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
            LK DP KY +MKERLVGVSEETTTGVKRLYQMQ SG LLFPAINVNDSVTKSKFDNLYGC
Sbjct: 185  LKVDPTKYRKMKERLVGVSEETTTGVKRLYQMQASGALLFPAINVNDSVTKSKFDNLYGC 244

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            RHSLPDGLMRATDVMIAGKVA V GYGDVGKGCAAALKQAGARVIV+EIDPICALQ   +
Sbjct: 245  RHSLPDGLMRATDVMIAGKVAFVAGYGDVGKGCAAALKQAGARVIVSEIDPICALQPQWK 304

Query: 995  GLQVLTLE 1018
            GLQVL LE
Sbjct: 305  GLQVLPLE 312



>sp|Q936D6|SAHH_STRAA Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:SAR416377_171813 Streptomyces argillaceus
            mtmZ gene, mtmA gene and mtmH gene.
          Length = 482

 Score =  555 bits (1430), Expect = e-156
 Identities = 285/484 (58%), Positives = 347/484 (71%), Gaps = 11/484 (2%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            ++KV D+S A+FGR E+ LAE EMPGLM+ R E+  +QP  GAR+TGSLHMT+QTAVLIE
Sbjct: 7    DFKVADLSLAEFGRKEITLAEHEMPGLMSIRREYAEAQPLAGARVTGSLHMTVQTAVLIE 66

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXX---------XXWKGETLQEYWWCTER 451
            TL ALGA+VRW SCNIFSTQ H                       WKGETL+EYWWCTE+
Sbjct: 67   TLVALGAQVRWASCNIFSTQGHAAAAIAVGPDGTPDNPRAVPVFAWKGETLEEYWWCTEQ 126

Query: 452  ALDW--GPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTII 625
            AL W   P GGP++I+DDGGDATLL+H+GV    EY K+G VP   + +N E +++L ++
Sbjct: 127  ALTWPDSPTGGPNMILDDGGDATLLVHKGV----EYEKDGKVPSVDTAENDEHRVILELL 182

Query: 626  RDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNL 805
               +    +K+T++   + GV+EETTTGV RLY+MQ  G LLFPAINVND+VTKSKFDN 
Sbjct: 183  NRTITDGSQKWTQLASEIRGVTEETTTGVHRLYEMQRDGVLLFPAINVNDAVTKSKFDNK 242

Query: 806  YGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 985
            YGCRHSL DG+ RATDV+I GK AVV GYGDVGK  A +L+  GARVIVTEIDPICALQA
Sbjct: 243  YGCRHSLIDGINRATDVLIGGKTAVVFGYGDVGK-AARSLRGQGARVIVTEIDPICALQA 301

Query: 986  LMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLE 1165
             M+G QV TL++VV +ADIF+TTTGNKDIIM + M +MK+ AIV NIGHFDNEIDM GL 
Sbjct: 302  AMDGYQVTTLDEVVDKADIFITTTGNKDIIMAADMARMKHQAIVGNIGHFDNEIDMAGLA 361

Query: 1166 TYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQL 1345
              PG+ +  IKPQ   + FP+ K  II+L+EGRL+NLG ATGHPSFVMS SF +Q +AQ+
Sbjct: 362  KVPGIVKDEIKPQVHTWTFPDGKK-IIVLSEGRLLNLGNATGHPSFVMSNSFADQTLAQI 420

Query: 1346 ELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPP 1525
            EL+ +   G Y   VY LPKHLDEKV                PEQA+YI + V+GPYK  
Sbjct: 421  ELFTK--PGDYPTGVYTLPKHLDEKVARLHLDALGVKLTTLRPEQASYIGVDVDGPYKSD 478

Query: 1526 HYRY 1537
            HYRY
Sbjct: 479  HYRY 482



>sp|P50250|SAHH_PLAF7 Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>pir|A54040|A54040 adenosylhomocysteinase (EC
            3.3.1.1) - malaria parasite  (Plasmodium
            falciparum)>gb:PFU07365_1394999 Plasmodium falciparum
            S-adenosylhomocysteine hydrolase mRNA, complete cds.
          Length = 479

 Score =  553 bits (1424), Expect = e-156
 Identities = 260/474 (54%), Positives = 338/474 (71%), Gaps = 3/474 (0%)
 Frame = +2

Query: 125  KVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETL 304
            KVKD+S A FG++++E++E EMPGLM  R E+G  QP K A+ITG LHMT++ A+LIETL
Sbjct: 7    KVKDISLAPFGKMQMEISENEMPGLMRIREEYGKDQPLKNAKITGCLHMTVECALLIETL 66

Query: 305  TALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXX-XWKGETLQEYWWCTERALDWGPG--G 475
              LGA++RWCSCNI+ST D+               WK ETL+EYWWC E AL WG G   
Sbjct: 67   QKLGAQIRWCSCNIYSTADYAAAAVSTLENVTVFAWKNETLEEYWWCVESALTWGDGDDN 126

Query: 476  GPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKK 655
            GPD+IVDDGGDATLL+H+GV+ E+ Y +   +PDP    N E +  LT++++ +  +PKK
Sbjct: 127  GPDMIVDDGGDATLLVHKGVEYEKLYEEKNILPDPEKAKNEEERCFLTLLKNSILKNPKK 186

Query: 656  YTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDG 835
            +T + ++++GVSEETTTGV RL +M +   LLF AINVND+VTK K+DN+YGCRHS  DG
Sbjct: 187  WTNIAKKIIGVSEETTTGVLRLKKMDKQNELLFTAINVNDAVTKQKYDNVYGCRHSYTDG 246

Query: 836  LMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTL 1015
            LMRATD +I+GK+ V+CGYGDVGKGCA+++K  GARV +TEIDPICA+QA+MEG  V+TL
Sbjct: 247  LMRATDFLISGKIVVICGYGDVGKGCASSMKGLGARVYITEIDPICAIQAVMEGFNVVTL 306

Query: 1016 EDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITI 1195
            +++V + D F+T TGN D+I + H+ KMKNNA+V NIGHFD+EI ++ L  Y G+    +
Sbjct: 307  DEIVDKGDFFITCTGNVDVIKLEHLLKMKNNAVVGNIGHFDDEIQVNELFNYKGIHIENV 366

Query: 1196 KPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGK 1375
            KPQ DR   P     II+LA GRL+NLGCATGHP+FVMS SF NQ  AQL+LW+ K+T K
Sbjct: 367  KPQVDRITLPNGNK-IIVLARGRLLNLGCATGHPAFVMSFSFCNQTFAQLDLWQNKDTNK 425

Query: 1376 YEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            YE KVY+LPKHLDEKV                  Q  ++ +   GP+K   YRY
Sbjct: 426  YENKVYLLPKHLDEKVALYHLKKLNASLTELDDNQCQFLGVNKSGPFKSNEYRY 479



>sp|Q87EI8|SAHH_XYLFT Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:AE012554_283751 Xylella fastidiosa
            Temecula1, section 2 of 9 of the complete
            genome.>gb:AE009442_960327 Xylella fastidiosa Temecula1,
            complete genome.
          Length = 480

 Score =  551 bits (1420), Expect = e-155
 Identities = 283/486 (58%), Positives = 342/486 (70%), Gaps = 4/486 (0%)
 Frame = +2

Query: 92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM 271
            T  +TS    YK+ D+S AD+GR E+++AE EMPGLM+ R ++   QP KG R+TGSLHM
Sbjct: 3    THPQTSPNTHYKIADISLADWGRKEIDIAEHEMPGLMSIRRKYASKQPLKGVRVTGSLHM 62

Query: 272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTER 451
            TIQTAVLIETL  +GA+VRW SCNIFSTQDH              WKGETL+EYW CT +
Sbjct: 63   TIQTAVLIETLKDIGADVRWASCNIFSTQDHAAAAIATSGTPVFAWKGETLEEYWDCTLQ 122

Query: 452  ALDW----GPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLT 619
            AL +    G   GP+LIVDDGGDATLLIH+G + E     NG+      +D+ E Q++  
Sbjct: 123  ALTFTLADGTLTGPELIVDDGGDATLLIHKGYELE-----NGSTWVDEPSDSLEEQVIKR 177

Query: 620  IIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFD 799
            +++      P  +TR+     GVSEETTTGV RLYQ+  +G LL PAINVNDSVTKSKFD
Sbjct: 178  LLKRIAIERPGYWTRVVNDWKGVSEETTTGVHRLYQIAATGRLLVPAINVNDSVTKSKFD 237

Query: 800  NLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICAL 979
            NLYGCR SL DGL RA DVM+AGK+AVVCGYGDVGKG A +L+  GARVIVTEIDPICAL
Sbjct: 238  NLYGCRESLADGLKRAMDVMLAGKLAVVCGYGDVGKGSAHSLRAYGARVIVTEIDPICAL 297

Query: 980  QALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHG 1159
            QA MEG +V T+ED + +ADI+VTTTGNKD+I + HM  MK+  IVCNIGHFDNEI +  
Sbjct: 298  QAAMEGFEVTTVEDTLGQADIYVTTTGNKDVIRIEHMTAMKDQVIVCNIGHFDNEIQVDA 357

Query: 1160 LETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIA 1339
            L    GV++I IKPQ D+F+ P   T + +LAEGRL+NLGCATGHPSFVMS SF NQ +A
Sbjct: 358  LNALTGVQKINIKPQVDKFILPNGNT-LFLLAEGRLVNLGCATGHPSFVMSNSFANQTLA 416

Query: 1340 QLELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYK 1519
            Q++LW+ K+   YEK VY LPK LDE+V                  QAAY+ I VEGP+K
Sbjct: 417  QIDLWQNKDV--YEKNVYRLPKKLDEEVARLHLEKIGVKLTTLTANQAAYLGISVEGPFK 474

Query: 1520 PPHYRY 1537
            P HYRY
Sbjct: 475  PEHYRY 480



>sp|Q9PEJ1|SAHH_XYLFA Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase).
          Length = 480

 Score =  550 bits (1416), Expect = e-155
 Identities = 282/486 (58%), Positives = 341/486 (70%), Gaps = 4/486 (0%)
 Frame = +2

Query: 92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM 271
            T  +TS    YK+ D+S  D+GR E+++AE EMPGLM+ R ++   QP KG R+TGSLHM
Sbjct: 3    THPQTSPNTHYKIADISLTDWGRKEIDIAEHEMPGLMSIRRKYASKQPLKGVRVTGSLHM 62

Query: 272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTER 451
            TIQTAVLIETL  +GA+VRW SCNIFSTQDH              WKGETL+EYW CT +
Sbjct: 63   TIQTAVLIETLKDIGADVRWASCNIFSTQDHAAAAIATSGTPVFAWKGETLEEYWDCTLQ 122

Query: 452  ALDW----GPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLT 619
            AL +    G   GP+LIVDDGGDATLLIH+G + E     NG+      +D+ E Q++  
Sbjct: 123  ALTFTLSDGTLTGPELIVDDGGDATLLIHKGYELE-----NGSTWVDEPSDSLEEQVIKR 177

Query: 620  IIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFD 799
            +++      P  +TR+     GVSEETTTGV RLYQ+  +G LL PAINVNDSVTKSKFD
Sbjct: 178  LLKRIAIERPGYWTRVVNDWKGVSEETTTGVHRLYQIAATGRLLVPAINVNDSVTKSKFD 237

Query: 800  NLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICAL 979
            NLYGCR SL DGL RA DVM+AGK+AVVCGYGDVGKG A +L+  GARVIVTEIDPICAL
Sbjct: 238  NLYGCRESLADGLKRAMDVMLAGKLAVVCGYGDVGKGSAHSLRAYGARVIVTEIDPICAL 297

Query: 980  QALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHG 1159
            QA MEG +V T+ED + +ADI+VTTTGNKD+I + HM  MK+  IVCNIGHFDNEI +  
Sbjct: 298  QAAMEGFEVTTVEDTLGQADIYVTTTGNKDVIRIEHMTAMKDQVIVCNIGHFDNEIQVDA 357

Query: 1160 LETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIA 1339
            L    GV++I IKPQ D+F+ P   T + +LAEGRL+NLGCATGHPSFVMS SF NQ +A
Sbjct: 358  LNALAGVQKINIKPQVDKFILPNGNT-LFLLAEGRLVNLGCATGHPSFVMSNSFANQTLA 416

Query: 1340 QLELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYK 1519
            Q++LW+ K+   YEK VY LPK LDE+V                  QAAY+ I VEGP+K
Sbjct: 417  QIDLWQNKDV--YEKNVYRLPKKLDEEVARLHLEKIGVKLTTLTANQAAYLGISVEGPFK 474

Query: 1520 PPHYRY 1537
            P HYRY
Sbjct: 475  PEHYRY 480



>gb:AE017311_438861 Desulfovibrio vulgaris subsp. vulgaris str.
            Hildenborough, section 3 of 12 of the complete
            genome.>gb:AE017285_1072022 Desulfovibrio vulgaris subsp.
            vulgaris str. Hildenborough, complete genome.
          Length = 479

 Score =  548 bits (1413), Expect = e-154
 Identities = 278/485 (57%), Positives = 341/485 (70%), Gaps = 5/485 (1%)
 Frame = +2

Query: 98   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI 277
            +K     ++KV DMS AD+GR +L+L+E EMPGLM    ++G ++P KG ++TGSLHMTI
Sbjct: 8    QKLDLSLDHKVADMSLADYGRKDLQLSEREMPGLMELIRKYGGTKPLKGLKVTGSLHMTI 67

Query: 278  QTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXX-XWKGETLQEYWWCTERA 454
            QTA+LI TL  LGA++RW SCNIFSTQDH               WKGETL++YWWCTE A
Sbjct: 68   QTAMLIRTLYELGADIRWASCNIFSTQDHAAAAIAASGMAKVFAWKGETLEDYWWCTEMA 127

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPS----STDNAEFQIVLTI 622
            L W  G GPDL+VDDGGDATL IH+GV+ E          DPS    + DN EFQI++  
Sbjct: 128  LTWPDGSGPDLLVDDGGDATLFIHKGVEVEN---------DPSLLKKAYDNKEFQIIMDR 178

Query: 623  IRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDN 802
            +    + DP ++ R+  ++ GVSEETTTGV RLYQ+++ G LLFPAINVND+VTKSKFDN
Sbjct: 179  LALAYEQDPGRWQRVAAKVRGVSEETTTGVHRLYQLEQEGKLLFPAINVNDAVTKSKFDN 238

Query: 803  LYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQ 982
            LYGCR SL DG+ RATDVM+AGKV VV GYGDVGKGCA +++  GARV+VTEIDPICALQ
Sbjct: 239  LYGCRESLADGIKRATDVMVAGKVVVVAGYGDVGKGCAQSMRGFGARVLVTEIDPICALQ 298

Query: 983  ALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGL 1162
            A MEG +V T+E+ V   DIFVT TGN ++I  +HM+ MK+ AIVCNIGHFDNEIDMH L
Sbjct: 299  AAMEGYEVTTMEEAVRTGDIFVTATGNCNVITGAHMEAMKDEAIVCNIGHFDNEIDMHYL 358

Query: 1163 ETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ 1342
            E   G   + IKPQ D++     ++ II+LAEGRL+NLGCATGHPSFVMS SFTNQ +AQ
Sbjct: 359  ENTEGCVCLNIKPQVDKWTLRSGRS-IIVLAEGRLVNLGCATGHPSFVMSASFTNQTLAQ 417

Query: 1343 LELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKP 1522
            +EL         E+KVY LPK LDE+V                 +QA YI +  EGP+KP
Sbjct: 418  IEL---ATNPDLERKVYTLPKKLDEEVARLHLDRLGVKLTRLSKDQADYIGVSPEGPFKP 474

Query: 1523 PHYRY 1537
             HYRY
Sbjct: 475  DHYRY 479



>sp|Q89HP6|SAHH_BRAJA Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:BA000040_734204 Bradyrhizobium japonicum
            USDA 110 DNA, complete genome.
          Length = 473

 Score =  546 bits (1406), Expect = e-154
 Identities = 281/474 (59%), Positives = 335/474 (70%), Gaps = 1/474 (0%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            +Y VKD+S ADFGR EL LAE EMPGLMA R EFGP QP KGARI GSLHMTIQT VLIE
Sbjct: 9    DYIVKDISLADFGRKELSLAETEMPGLMATREEFGPKQPLKGARIAGSLHMTIQTGVLIE 68

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG 478
            TL ALGA++RW SCNI+STQDH               KGETL EYW  T +  DW  GG 
Sbjct: 69   TLAALGADIRWVSCNIYSTQDHAAAAIAAAGIPVFAVKGETLTEYWDYTAKLFDWHGGGH 128

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKY 658
            P++I+DDGGDAT+ +H G++AE     NG         + E ++   +++  LK  PK Y
Sbjct: 129  PNMILDDGGDATMYVHLGLRAE-----NGDTAFLDKPGSEEEEVFFALLKKQLKEKPKGY 183

Query: 659  -TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDG 835
               + + + GVSEETTTGV RLY MQ++GTLL+PAINVNDSVTKSKFDNLYGCR SL DG
Sbjct: 184  FAEIAKSIKGVSEETTTGVHRLYDMQKAGTLLWPAINVNDSVTKSKFDNLYGCRESLVDG 243

Query: 836  LMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTL 1015
            + R TDVM++GKVA+V G+GDVGKG AA+L+QAG RV+V+E+DPICALQA MEG +V+T+
Sbjct: 244  IRRGTDVMMSGKVAMVAGFGDVGKGSAASLRQAGCRVMVSEVDPICALQAAMEGYEVVTM 303

Query: 1016 EDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITI 1195
            ED    ADIFVT TGNKDII + HM+ MK+ AIVCNIGHFDNEI + GL     +K   I
Sbjct: 304  EDAAPRADIFVTATGNKDIITIEHMRAMKDRAIVCNIGHFDNEIQIAGLR---NLKWTNI 360

Query: 1196 KPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGK 1375
            KPQ D   FP+ K  II+L+EGRL+NLG A GHPSFVMS SFTNQ +AQ+EL+     GK
Sbjct: 361  KPQVDEIEFPD-KHRIIMLSEGRLVNLGNAMGHPSFVMSASFTNQTLAQIELFANNKDGK 419

Query: 1376 YEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            Y+K+VYVLPK LDEKV                 +QA YI +  EGPYK  HYRY
Sbjct: 420  YKKEVYVLPKTLDEKVARLHLAKIGVKLTELRKDQADYIGVKQEGPYKSDHYRY 473



>gb:BX248345_760633 Mycobacterium bovis subsp. bovis AF2122/97
            complete genome; segment 12/14.
          Length = 495

 Score =  545 bits (1405), Expect = e-154
 Identities = 279/486 (57%), Positives = 340/486 (69%), Gaps = 10/486 (2%)
 Frame = +2

Query: 110  SGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAV 289
            +G ++K+ D+S ADFGR EL +AE EMPGLM+ R E+   QP KGARI+GSLHMT+QTAV
Sbjct: 17   NGIDFKIADLSLADFGRKELRIAEHEMPGLMSLRREYAEVQPLKGARISGSLHMTVQTAV 76

Query: 290  LIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXX---------XXWKGETLQEYWWC 442
            LIETLTALGAEVRW SCNIFSTQDH                       WKGETL+EYWW 
Sbjct: 77   LIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPDEPKGVPVFAWKGETLEEYWWA 136

Query: 443  TERALDW-GPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLT 619
             E+ L W  P    ++I+DDGGDAT+L+  G+    +Y K G VP     D AE++I L 
Sbjct: 137  AEQMLTWPDPDKPANMILDDGGDATMLVLRGM----QYEKAGVVPPAEEDDPAEWKIFLN 192

Query: 620  IIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFD 799
            ++R   + D  K+T++ E + GV+EETTTGV RLYQ   +G L FPAINVNDSVTKSKFD
Sbjct: 193  LLRTRFETDKDKWTKIAESVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFD 252

Query: 800  NLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICAL 979
            N YG RHSL DG+ R TD +I GK  ++CGYGDVGKGCA A+K  GARV VTEIDPI AL
Sbjct: 253  NKYGTRHSLIDGINRGTDALIGGKKVLICGYGDVGKGCAEAMKGQGARVSVTEIDPINAL 312

Query: 980  QALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHG 1159
            QA+MEG  V+T+E+ + +ADI VT TGNKDIIM+ H+K MK++AI+ NIGHFDNEIDM G
Sbjct: 313  QAMMEGFDVVTVEEAIGDADIVVTATGNKDIIMLEHIKAMKDHAILGNIGHFDNEIDMAG 372

Query: 1160 LETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIA 1339
            LE   G  R+ +KPQ D + F +T   II+L+EGRL+NLG ATGHPSFVMS SF NQ IA
Sbjct: 373  LER-SGATRVNVKPQVDLWTFGDTGRSIIVLSEGRLLNLGNATGHPSFVMSNSFANQTIA 431

Query: 1340 QLELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYK 1519
            Q+ELW + +  +Y+ +VY LPKHLDEKV                 EQA Y+ + VEGPYK
Sbjct: 432  QIELWTKND--EYDNEVYRLPKHLDEKVARIHVEALGGHLTKLTKEQAEYLGVDVEGPYK 489

Query: 1520 PPHYRY 1537
            P HYRY
Sbjct: 490  PDHYRY 495



>sp|Q7TWW7|SAHH_MYCBO Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase).
          Length = 494

 Score =  545 bits (1405), Expect = e-154
 Identities = 279/486 (57%), Positives = 340/486 (69%), Gaps = 10/486 (2%)
 Frame = +2

Query: 110  SGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAV 289
            +G ++K+ D+S ADFGR EL +AE EMPGLM+ R E+   QP KGARI+GSLHMT+QTAV
Sbjct: 16   NGIDFKIADLSLADFGRKELRIAEHEMPGLMSLRREYAEVQPLKGARISGSLHMTVQTAV 75

Query: 290  LIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXX---------XXWKGETLQEYWWC 442
            LIETLTALGAEVRW SCNIFSTQDH                       WKGETL+EYWW 
Sbjct: 76   LIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPDEPKGVPVFAWKGETLEEYWWA 135

Query: 443  TERALDW-GPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLT 619
             E+ L W  P    ++I+DDGGDAT+L+  G+    +Y K G VP     D AE++I L 
Sbjct: 136  AEQMLTWPDPDKPANMILDDGGDATMLVLRGM----QYEKAGVVPPAEEDDPAEWKIFLN 191

Query: 620  IIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFD 799
            ++R   + D  K+T++ E + GV+EETTTGV RLYQ   +G L FPAINVNDSVTKSKFD
Sbjct: 192  LLRTRFETDKDKWTKIAESVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFD 251

Query: 800  NLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICAL 979
            N YG RHSL DG+ R TD +I GK  ++CGYGDVGKGCA A+K  GARV VTEIDPI AL
Sbjct: 252  NKYGTRHSLIDGINRGTDALIGGKKVLICGYGDVGKGCAEAMKGQGARVSVTEIDPINAL 311

Query: 980  QALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHG 1159
            QA+MEG  V+T+E+ + +ADI VT TGNKDIIM+ H+K MK++AI+ NIGHFDNEIDM G
Sbjct: 312  QAMMEGFDVVTVEEAIGDADIVVTATGNKDIIMLEHIKAMKDHAILGNIGHFDNEIDMAG 371

Query: 1160 LETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIA 1339
            LE   G  R+ +KPQ D + F +T   II+L+EGRL+NLG ATGHPSFVMS SF NQ IA
Sbjct: 372  LER-SGATRVNVKPQVDLWTFGDTGRSIIVLSEGRLLNLGNATGHPSFVMSNSFANQTIA 430

Query: 1340 QLELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYK 1519
            Q+ELW + +  +Y+ +VY LPKHLDEKV                 EQA Y+ + VEGPYK
Sbjct: 431  QIELWTKND--EYDNEVYRLPKHLDEKVARIHVEALGGHLTKLTKEQAEYLGVDVEGPYK 488

Query: 1520 PPHYRY 1537
            P HYRY
Sbjct: 489  PDHYRY 494



>gb:BX572606_803628 Rhodopseudomonas palustris CGA009 complete genome;
            segment 14/16.
          Length = 469

 Score =  545 bits (1404), Expect = e-153
 Identities = 282/479 (58%), Positives = 341/479 (71%), Gaps = 1/479 (0%)
 Frame = +2

Query: 104  TSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQT 283
            T+   +Y VKD+  A+FGR E+ LAE EMPGLMA R E+GP QP KGA+I GSLHMTIQT
Sbjct: 2    TAKFTDYIVKDIGLAEFGRKEISLAETEMPGLMATREEYGPKQPLKGAKIAGSLHMTIQT 61

Query: 284  AVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDW 463
            AVLIETL ALGAEVRW SCNI+STQDH               KGETL++YW  T +  DW
Sbjct: 62   AVLIETLVALGAEVRWVSCNIYSTQDHAAAAIAAAGIPVFAVKGETLKDYWDYTAKLFDW 121

Query: 464  GPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKA 643
              GG P++I+DDGGDAT+ +H+G++AE     NG        ++ E +I   +I+  LK 
Sbjct: 122  SDGGTPNMILDDGGDATMFVHQGLRAE-----NGDTMFLDQHNSEEEEIFFALIKRILKE 176

Query: 644  DPKKY-TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRH 820
             PK Y   + + + GVSEETTTGV RLY M+++G LLFPAINVNDSVTKSKFDNLYGCR 
Sbjct: 177  KPKGYFATLAKNIKGVSEETTTGVHRLYDMEKAGKLLFPAINVNDSVTKSKFDNLYGCRE 236

Query: 821  SLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGL 1000
            SL DG+ R TDVM++GKVA+V G+GDVGKG AA+L+QAG RV+V+E+DPICALQA MEG 
Sbjct: 237  SLVDGIRRGTDVMLSGKVAMVAGFGDVGKGSAASLRQAGCRVMVSEVDPICALQAAMEGY 296

Query: 1001 QVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGV 1180
            QV+T+ED    ADIFVT TGNKDII + HM+ MK+ AIVCNIGHFDNEI    + T   +
Sbjct: 297  QVVTMEDAAPIADIFVTATGNKDIITIEHMRAMKDRAIVCNIGHFDNEIQ---VATLKNM 353

Query: 1181 KRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE 1360
            K   IKPQ D   FP+ K  +I+L+EGRL+NLG A GHPSFVMS SFTNQ +AQ+EL+  
Sbjct: 354  KWDNIKPQVDEITFPDGKR-MILLSEGRLVNLGNAMGHPSFVMSASFTNQTLAQIELF-- 410

Query: 1361 KNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            +N GKYEKKVYVLPK LDEKV                 +QA YI + VEGP+K  HYRY
Sbjct: 411  QNQGKYEKKVYVLPKTLDEKVARLHLAKIGVKLTELRKDQADYIGVKVEGPFKADHYRY 469



>pir|B70593|B70593 adenosylhomocysteinase (EC 3.3.1.1) - Mycobacterium
            tuberculosis (strain H37RV)>gb:AE000516_23458
            Mycobacterium tuberculosis CDC1551, complete
            genome.>gb:AF262755_493518 Mycobacterium bovis
            S-adenosyl-L-homocysteine hydrolase gene, complete
            cds.>gb:BX842582_821352 Mycobacterium tuberculosis H37Rv
            complete genome; segment 11/13.>gb:AX023852_1456779
            Sequence 23 from Patent WO0021983.
          Length = 495

 Score =  545 bits (1404), Expect = e-153
 Identities = 278/486 (57%), Positives = 340/486 (69%), Gaps = 10/486 (2%)
 Frame = +2

Query: 110  SGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAV 289
            +G ++K+ D+S ADFGR EL +AE EMPGLM+ R E+   QP KGARI+GSLHMT+QTAV
Sbjct: 17   NGIDFKIADLSLADFGRKELRIAEHEMPGLMSLRREYAEVQPLKGARISGSLHMTVQTAV 76

Query: 290  LIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXX---------XXWKGETLQEYWWC 442
            LIETLTALGAEVRW SCNIFSTQDH                       WKGETL+EYWW 
Sbjct: 77   LIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPDEPKGVPVFAWKGETLEEYWWA 136

Query: 443  TERALDW-GPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLT 619
             E+ L W  P    ++I+DDGGDAT+L+  G+    +Y K G VP     D AE+++ L 
Sbjct: 137  AEQMLTWPDPDKPANMILDDGGDATMLVLRGM----QYEKAGVVPPAEEDDPAEWKVFLN 192

Query: 620  IIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFD 799
            ++R   + D  K+T++ E + GV+EETTTGV RLYQ   +G L FPAINVNDSVTKSKFD
Sbjct: 193  LLRTRFETDKDKWTKIAESVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFD 252

Query: 800  NLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICAL 979
            N YG RHSL DG+ R TD +I GK  ++CGYGDVGKGCA A+K  GARV VTEIDPI AL
Sbjct: 253  NKYGTRHSLIDGINRGTDALIGGKKVLICGYGDVGKGCAEAMKGQGARVSVTEIDPINAL 312

Query: 980  QALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHG 1159
            QA+MEG  V+T+E+ + +ADI VT TGNKDIIM+ H+K MK++AI+ NIGHFDNEIDM G
Sbjct: 313  QAMMEGFDVVTVEEAIGDADIVVTATGNKDIIMLEHIKAMKDHAILGNIGHFDNEIDMAG 372

Query: 1160 LETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIA 1339
            LE   G  R+ +KPQ D + F +T   II+L+EGRL+NLG ATGHPSFVMS SF NQ IA
Sbjct: 373  LER-SGATRVNVKPQVDLWTFGDTGRSIIVLSEGRLLNLGNATGHPSFVMSNSFANQTIA 431

Query: 1340 QLELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYK 1519
            Q+ELW + +  +Y+ +VY LPKHLDEKV                 EQA Y+ + VEGPYK
Sbjct: 432  QIELWTKND--EYDNEVYRLPKHLDEKVARIHVEALGGHLTKLTKEQAEYLGVDVEGPYK 489

Query: 1520 PPHYRY 1537
            P HYRY
Sbjct: 490  PDHYRY 495



>sp|P60176|SAHH_MYCTU Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase).
          Length = 494

 Score =  545 bits (1404), Expect = e-153
 Identities = 278/486 (57%), Positives = 340/486 (69%), Gaps = 10/486 (2%)
 Frame = +2

Query: 110  SGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAV 289
            +G ++K+ D+S ADFGR EL +AE EMPGLM+ R E+   QP KGARI+GSLHMT+QTAV
Sbjct: 16   NGIDFKIADLSLADFGRKELRIAEHEMPGLMSLRREYAEVQPLKGARISGSLHMTVQTAV 75

Query: 290  LIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXX---------XXWKGETLQEYWWC 442
            LIETLTALGAEVRW SCNIFSTQDH                       WKGETL+EYWW 
Sbjct: 76   LIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPDEPKGVPVFAWKGETLEEYWWA 135

Query: 443  TERALDW-GPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLT 619
             E+ L W  P    ++I+DDGGDAT+L+  G+    +Y K G VP     D AE+++ L 
Sbjct: 136  AEQMLTWPDPDKPANMILDDGGDATMLVLRGM----QYEKAGVVPPAEEDDPAEWKVFLN 191

Query: 620  IIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFD 799
            ++R   + D  K+T++ E + GV+EETTTGV RLYQ   +G L FPAINVNDSVTKSKFD
Sbjct: 192  LLRTRFETDKDKWTKIAESVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFD 251

Query: 800  NLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICAL 979
            N YG RHSL DG+ R TD +I GK  ++CGYGDVGKGCA A+K  GARV VTEIDPI AL
Sbjct: 252  NKYGTRHSLIDGINRGTDALIGGKKVLICGYGDVGKGCAEAMKGQGARVSVTEIDPINAL 311

Query: 980  QALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHG 1159
            QA+MEG  V+T+E+ + +ADI VT TGNKDIIM+ H+K MK++AI+ NIGHFDNEIDM G
Sbjct: 312  QAMMEGFDVVTVEEAIGDADIVVTATGNKDIIMLEHIKAMKDHAILGNIGHFDNEIDMAG 371

Query: 1160 LETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIA 1339
            LE   G  R+ +KPQ D + F +T   II+L+EGRL+NLG ATGHPSFVMS SF NQ IA
Sbjct: 372  LER-SGATRVNVKPQVDLWTFGDTGRSIIVLSEGRLLNLGNATGHPSFVMSNSFANQTIA 430

Query: 1340 QLELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYK 1519
            Q+ELW + +  +Y+ +VY LPKHLDEKV                 EQA Y+ + VEGPYK
Sbjct: 431  QIELWTKND--EYDNEVYRLPKHLDEKVARIHVEALGGHLTKLTKEQAEYLGVDVEGPYK 488

Query: 1520 PPHYRY 1537
            P HYRY
Sbjct: 489  PDHYRY 494



>sp|Q9ABH0|SAHH_CAUCR Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>pir|H87280|H87280 adenosylhomocysteinase
            [imported] - Caulobacter crescentus>gb:AE005699_74274
            Caulobacter crescentus CB15 section 25 of 359 of the
            complete genome.>gb:AE005673_921306 Caulobacter
            crescentus CB15 complete genome.
          Length = 463

 Score =  545 bits (1404), Expect = e-153
 Identities = 287/476 (60%), Positives = 333/476 (69%), Gaps = 3/476 (0%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            +Y VKD+S ADFGR E+ +AE EMPGLMA RAE+GP Q  KGARI GSLHMTIQTAVLIE
Sbjct: 3    DYIVKDISLADFGRKEIAIAETEMPGLMATRAEYGPQQILKGARIAGSLHMTIQTAVLIE 62

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG 478
            TLTALGAEVRW SCNIFSTQDH              +KGE L EYW    +  +W  GG 
Sbjct: 63   TLTALGAEVRWASCNIFSTQDHAAAAIAAAGVPVFAFKGENLVEYWEYAHKIFEWHDGGY 122

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPS---STDNAEFQIVLTIIRDGLKADP 649
            P+LI+DDGGDATLL   G KAE+         DPS   +  N E + +  +++  L   P
Sbjct: 123  PNLILDDGGDATLLCVLGPKAEK---------DPSILNNPQNEEEEALYAVMKKYLAEKP 173

Query: 650  KKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLP 829
              Y+ ++  + GVSEETTTGV RLYQM +   L FPAINVNDSVTKSKFDNLYGCR SL 
Sbjct: 174  GFYSAIRAAIGGVSEETTTGVHRLYQMAQKDELPFPAINVNDSVTKSKFDNLYGCRESLV 233

Query: 830  DGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVL 1009
            D + R TDVM++GKVAVVCGYGDVGKG AA+L+Q GARVIVTE+DPICALQA MEG +V 
Sbjct: 234  DAIRRGTDVMLSGKVAVVCGYGDVGKGSAASLRQGGARVIVTEVDPICALQAAMEGYEVQ 293

Query: 1010 TLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRI 1189
            TL DV  +ADIFVT TGNKD+I V  M+KMKNNAIVCNIGHFD+EI + GL  +   K  
Sbjct: 294  TLNDVADKADIFVTATGNKDVITVDDMRKMKNNAIVCNIGHFDSEIQIAGLRNF---KWD 350

Query: 1190 TIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNT 1369
             IKPQ     FP+ K  +I+L+EGRL+NLG ATGHPSFVMS SFTNQ +AQ+ELW   N 
Sbjct: 351  EIKPQVHHVEFPDGKK-LIVLSEGRLVNLGNATGHPSFVMSASFTNQTLAQIELW--TNK 407

Query: 1370 GKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
             KYE +VY LPKHLDEKV                 +QA YI +P  GP+KP HYRY
Sbjct: 408  AKYENQVYTLPKHLDEKVAFLHLEKLGAKLTTLRKDQADYIGVPEAGPFKPDHYRY 463



>sp|Q8PP84|SAHH_XANAC Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:AE011711_275763 Xanthomonas axonopodis
            pv. citri str. 306, section 89 of 469 of the complete
            genome.>gb:AE008923_917538 Xanthomonas axonopodis pv.
            citri str. 306, complete genome.
          Length = 480

 Score =  543 bits (1400), Expect = e-153
 Identities = 284/487 (58%), Positives = 348/487 (71%), Gaps = 6/487 (1%)
 Frame = +2

Query: 95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            V K +   +YK+ D+S AD+GR EL++AE EMPGLM+ R +   ++P K  RITGSLHMT
Sbjct: 4    VTKITPHTDYKIADISLADWGRKELDIAEHEMPGLMSIRRKHAQTKPLKDVRITGSLHMT 63

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
            IQTAVLIETL  +GA+VRW SCNIFSTQDH              WKGETL+EYW CT  A
Sbjct: 64   IQTAVLIETLKDIGADVRWASCNIFSTQDHAAAAIAATGTPVFAWKGETLEEYWDCTLDA 123

Query: 455  LDWG-PGG---GPDLIVDDGGDATLLIHEGVKAEEEYAKNGT--VPDPSSTDNAEFQIVL 616
            L +  P G   GP+L+VDDGGD TLLIH+G + E     NG+  V +P+S+   E  ++ 
Sbjct: 124  LTFTLPDGTLTGPELVVDDGGDVTLLIHKGYELE-----NGSTWVDEPASSH--EEGVIK 176

Query: 617  TIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKF 796
             +++      P  + R+ +   GVSEETTTGV RLYQ+ E+G LL PAINVNDSVTKSKF
Sbjct: 177  ALLKRVAVERPGYWGRVVKDWKGVSEETTTGVHRLYQIAEAGKLLIPAINVNDSVTKSKF 236

Query: 797  DNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICA 976
            DNLYGCR SL DGL RA DVM+AGKVAVVCGYGDVGKG AA+L+  GARVIVTEIDPICA
Sbjct: 237  DNLYGCRESLADGLKRAMDVMLAGKVAVVCGYGDVGKGSAASLRAYGARVIVTEIDPICA 296

Query: 977  LQALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMH 1156
            LQA MEG +V T+E  +  ADI+VTTTGNKDII V H++ MK+ AIVCNIGHFDNEI + 
Sbjct: 297  LQASMEGFEVNTIESTLGRADIYVTTTGNKDIITVEHLQAMKDQAIVCNIGHFDNEIQVD 356

Query: 1157 GLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVI 1336
             L+    V++I IKPQ D++VFP     I +LA+GRL+NLGCATGHPSFVMS SF NQ +
Sbjct: 357  ALKALKDVQKINIKPQVDKYVFP-NGNAIFLLADGRLVNLGCATGHPSFVMSNSFANQTL 415

Query: 1337 AQLELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPY 1516
            AQ++LW++++T  YEKKVY+LPKHLDE+V                 +QA Y+ + V GPY
Sbjct: 416  AQIDLWEKRDT--YEKKVYILPKHLDEEVARLHLEKIGVKLTTLTKDQADYLGVDVAGPY 473

Query: 1517 KPPHYRY 1537
            KP HYRY
Sbjct: 474  KPDHYRY 480



>gb:AE013598_297499 Xanthomonas oryzae pv. oryzae KACC10331, complete
            genome.
          Length = 511

 Score =  543 bits (1399), Expect = e-153
 Identities = 283/487 (58%), Positives = 346/487 (71%), Gaps = 6/487 (1%)
 Frame = +2

Query: 95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            V K +   +YK+ D+S AD+GR EL++AE EMPGLM+ R +   + P K  RITGSLHMT
Sbjct: 35   VTKITPHADYKIADISLADWGRKELDIAEHEMPGLMSIRRKHAQTTPLKDVRITGSLHMT 94

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
            IQTAVLIETL  +GA VRW SCNIFSTQDH              WKGETL+EYW CT  A
Sbjct: 95   IQTAVLIETLKDIGANVRWASCNIFSTQDHAAAAIAATGTPVFAWKGETLEEYWDCTLDA 154

Query: 455  LDWG-PGG---GPDLIVDDGGDATLLIHEGVKAEEEYAKNGT--VPDPSSTDNAEFQIVL 616
            L +  P G   GP+L+VDDGGD TLLIH+G + E     NG+  V +P+S+   E  ++ 
Sbjct: 155  LTFTLPDGTLTGPELVVDDGGDVTLLIHKGYELE-----NGSTWVDEPASSH--EESVIK 207

Query: 617  TIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKF 796
             +++      P  + R+ +   GVSEETTTGV RLYQ+ E+G LL PAINVNDSVTKSKF
Sbjct: 208  ALLKRVAVERPGYWARVVKDWKGVSEETTTGVHRLYQIAEAGKLLIPAINVNDSVTKSKF 267

Query: 797  DNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICA 976
            DNLYGCR SL DGL RA DVM+AGKVAVVCGYGDVGKG AA+L+  GARV+VTEIDPICA
Sbjct: 268  DNLYGCRESLADGLKRAMDVMLAGKVAVVCGYGDVGKGSAASLRAYGARVVVTEIDPICA 327

Query: 977  LQALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMH 1156
            LQA MEG +V T+E  +  ADI+VTTTGNKDII V H++ MK+ AIVCNIGHFDNEI + 
Sbjct: 328  LQASMEGFEVNTIESTLGRADIYVTTTGNKDIITVEHLQAMKDQAIVCNIGHFDNEIQVD 387

Query: 1157 GLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVI 1336
             L+    V++I IKPQ D++VFP     I +LA+GRL+NLGCATGHPSFVMS SF NQ +
Sbjct: 388  ALKALKDVQKINIKPQVDKYVFP-NGNAIFLLADGRLVNLGCATGHPSFVMSNSFANQTL 446

Query: 1337 AQLELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPY 1516
            AQ++LW++++T  YEKKVY+LPKHLDE+V                 +QA Y+ + V GPY
Sbjct: 447  AQIDLWEKRDT--YEKKVYILPKHLDEEVARLHLEKIGVKLTTLTKDQADYLGVDVAGPY 504

Query: 1517 KPPHYRY 1537
            KP HYRY
Sbjct: 505  KPDHYRY 511



>gb:AP006618_561013 Nocardia farcinica IFM 10152 DNA, complete genome.
          Length = 494

 Score =  542 bits (1396), Expect = e-152
 Identities = 280/485 (57%), Positives = 340/485 (70%), Gaps = 9/485 (1%)
 Frame = +2

Query: 110  SGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAV 289
            +G +YKV D++ A+FGR E+ LAE EMPGLMA R E+   QP KGARI+GSLHMT+QTAV
Sbjct: 18   NGIDYKVADLTLAEFGRKEIRLAEHEMPGLMALRREYADVQPLKGARISGSLHMTVQTAV 77

Query: 290  LIETLTALGAEVRWCSCNIFSTQDHXXXXXXXX---------XXXXXXWKGETLQEYWWC 442
            LIETLTALGA+VRW SCNIFSTQDH                       WKGETL+EYWW 
Sbjct: 78   LIETLTALGAQVRWASCNIFSTQDHAAAAVVVGPHGTVEEPKGVSVFAWKGETLEEYWWA 137

Query: 443  TERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTI 622
             E+ L W PG   ++I+DDGGDAT+L+  G + E    K G VP   +  +AE+++ L +
Sbjct: 138  AEQMLTW-PGEPANMILDDGGDATMLVLRGAQFE----KAGVVPPEDADHSAEYKVFLNL 192

Query: 623  IRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDN 802
            +R+  + D  K+T + E + GV+EETTTGV RLYQ   +G L+FPAINVNDSVTKSKFDN
Sbjct: 193  LRERFETDRGKWTAIAESVRGVTEETTTGVLRLYQFAAAGELVFPAINVNDSVTKSKFDN 252

Query: 803  LYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQ 982
             YG RHSL DG+ R TDV+I GK  ++CGYGDVGKGCA +L   GARV VTEIDPI ALQ
Sbjct: 253  KYGTRHSLIDGINRGTDVLIGGKKVLICGYGDVGKGCAESLAGQGARVQVTEIDPINALQ 312

Query: 983  ALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGL 1162
            ALM+G  V+T+E  + EADI +T TGNKDII + HMK MK+ AI+ NIGHFDNEIDM  L
Sbjct: 313  ALMDGYDVVTVEQAIGEADIVITATGNKDIITLDHMKAMKDQAILGNIGHFDNEIDMAAL 372

Query: 1163 ETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ 1342
            E   G  R+TIKPQ D + F E+   II+L+EGRL+NLG ATGHPSFVMS SF+NQVIAQ
Sbjct: 373  ER-SGATRLTIKPQVDLWTFGESGKSIIVLSEGRLLNLGNATGHPSFVMSNSFSNQVIAQ 431

Query: 1343 LELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKP 1522
            +ELW +    +Y+ +VY LPKHLDEKV                 +QA YI + VEGPYKP
Sbjct: 432  IELWTKPE--EYDNEVYRLPKHLDEKVARIHVEALGGTLTKLTKDQAEYIGVDVEGPYKP 489

Query: 1523 PHYRY 1537
             HYRY
Sbjct: 490  EHYRY 494



>sp|Q8PCH5|SAHH_XANCP Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:AE012174_280023 Xanthomonas campestris
            pv. campestris str. ATCC 33913, section 82 of 460 of the
            complete genome.>gb:AE008922_913305 Xanthomonas
            campestris pv. campestris str. ATCC 33913, complete
            genome.
          Length = 480

 Score =  540 bits (1392), Expect = e-152
 Identities = 283/487 (58%), Positives = 345/487 (70%), Gaps = 6/487 (1%)
 Frame = +2

Query: 95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            V KT    +YK+ D+S AD+GR EL++AE EMPGLM+ R +   ++P K  RITGSLHMT
Sbjct: 4    VAKTVPHTDYKIADISLADWGRKELDIAEHEMPGLMSIRRKHAQTKPLKDVRITGSLHMT 63

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
            IQTAVLIETL  +GA VRW SCNIFSTQDH              WKGETL+EYW CT  A
Sbjct: 64   IQTAVLIETLKDIGANVRWASCNIFSTQDHAAAAIAATGTPVFAWKGETLEEYWDCTLDA 123

Query: 455  LDWG-PGG---GPDLIVDDGGDATLLIHEGVKAEEEYAKNGT--VPDPSSTDNAEFQIVL 616
            L +  P G   GP+L+VDDGGD TLLIH+G + E     NG+  V +P+S+   E  ++ 
Sbjct: 124  LTFTLPDGTLTGPELVVDDGGDVTLLIHKGYELE-----NGSTWVDEPASSH--EEGVIK 176

Query: 617  TIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKF 796
             +++      P  + R+ +   GVSEETTTGV RLYQ+ E+G LL PAINVNDSVTKSKF
Sbjct: 177  ALLKRVAVERPGYWARVVKDWKGVSEETTTGVHRLYQIAEAGKLLIPAINVNDSVTKSKF 236

Query: 797  DNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICA 976
            DNLYGCR SL DGL RA DVM+AGKVAVVCGYGDVGKG AA+L+  GARVIVTEIDPICA
Sbjct: 237  DNLYGCRESLADGLKRAMDVMLAGKVAVVCGYGDVGKGSAASLRAYGARVIVTEIDPICA 296

Query: 977  LQALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMH 1156
            LQA MEG +V T+E  +   DI+VTTTGNKDII V H++ MK+ AIVCNIGHFDNEI + 
Sbjct: 297  LQASMEGFEVNTIESTLGRGDIYVTTTGNKDIITVEHLQAMKDQAIVCNIGHFDNEIQVD 356

Query: 1157 GLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVI 1336
             L    GV++I IKPQ D++VF      I +LA+GRL+NLGCATGHPSFVMS SF NQ +
Sbjct: 357  ALNALKGVEKINIKPQVDKYVF-GNGNAIFLLADGRLVNLGCATGHPSFVMSNSFANQTL 415

Query: 1337 AQLELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPY 1516
            AQ++LW+++++  YEKKVY+LPKHLDE+V                 +QA Y+ + V GPY
Sbjct: 416  AQIDLWEKRDS--YEKKVYILPKHLDEEVARLHLEKIGVKLTTLTKDQADYLGVDVAGPY 473

Query: 1517 KPPHYRY 1537
            KP HYRY
Sbjct: 474  KPDHYRY 480



>sp|Q7NZF7|SAHH_CHRVO Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:AE016913_355926 Chromobacterium violaceum
            ATCC 12472 section 4 of 16 of the complete
            genome.>gb:AE016825_1041080 Chromobacterium violaceum
            ATCC 12472 complete genome.
          Length = 466

 Score =  539 bits (1388), Expect = e-152
 Identities = 279/473 (58%), Positives = 339/473 (71%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            ++ V D++ A +GR EL +AE EMPGLMA R E+  +QP +GARI GSLHMT+QTAVLIE
Sbjct: 6    DFHVADIALAGWGRKELNIAETEMPGLMATRDEYHAAQPLRGARIAGSLHMTVQTAVLIE 65

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG 478
            TLTALGAEVRW SCNIFSTQDH              +KGE+L EYW  + +  +W  G  
Sbjct: 66   TLTALGAEVRWASCNIFSTQDHAAAAIAAAGIPVFAFKGESLDEYWEFSHKIFEWPEGQP 125

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKY 658
             ++I+DDGGDATLL+  G KAE++    G +  P+   N E   +   I+  L  DP  Y
Sbjct: 126  ANMILDDGGDATLLLMLGSKAEKDI---GVIAHPT---NEEETALFASIKRHLAIDPHWY 179

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
            ++  E + GV+EETTTGV RLYQ+++ G L FPAINVNDSVTKSKFDNLYGCR SL DG+
Sbjct: 180  SKRLEHIQGVTEETTTGVHRLYQLEKDGHLPFPAINVNDSVTKSKFDNLYGCRESLVDGI 239

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLE 1018
             RATDVM+AGKVAVV GYGDVGKGCA +L+  GA V VTEIDPICALQA MEG +V+ ++
Sbjct: 240  KRATDVMVAGKVAVVLGYGDVGKGCAQSLRGLGATVWVTEIDPICALQAAMEGYRVVRMD 299

Query: 1019 DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIK 1198
            +V  +ADIFVT TGN  +I   HMKKM+NNAI+CNIGHFD+EI++  L  Y   +   IK
Sbjct: 300  EVADQADIFVTATGNVGVITHEHMKKMRNNAIICNIGHFDSEIEVASLRQY---QWENIK 356

Query: 1199 PQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKY 1378
            PQ D  +FP+ K  +I+LAEGRL+NLGCATGHPSFVMS SFTNQV+AQ+EL+   N  KY
Sbjct: 357  PQVDHIIFPDGKR-VILLAEGRLVNLGCATGHPSFVMSNSFTNQVLAQIELF--ANGHKY 413

Query: 1379 EKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            EKKVYVLPKHLDEKV                 +QAAYIS+P +GPYKP HYRY
Sbjct: 414  EKKVYVLPKHLDEKVARLHLARIGARLTELSDQQAAYISVPKQGPYKPDHYRY 466



>sp|P51540|SAHH_TRIVA Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:TVU40872_1401280 Trichomonas vaginalis
            S-adenosyl-L-homocysteine hydrolase gene, complete cds.
          Length = 486

 Score =  538 bits (1387), Expect = e-151
 Identities = 279/482 (57%), Positives = 335/482 (69%), Gaps = 9/482 (1%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            EY++ D++    GR EL LAE EMPGLM  R  +  S+P KG RI+GSLHMT+QTAVLIE
Sbjct: 12   EYRIADINLHVLGRKELTLAEKEMPGLMVLRERYSASKPLKGVRISGSLHMTVQTAVLIE 71

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXX---------XXWKGETLQEYWWCTER 451
            TLTALGA+VRW SCNIFSTQD                        WKGETL EYW  T R
Sbjct: 72   TLTALGADVRWASCNIFSTQDTAAAAIVVGPTGTPEKPAGIPVFAWKGETLPEYWENTYR 131

Query: 452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD 631
            AL W  G GP  +VDDGGDATLLI +G     E+   G VP+P+  DN E++ VL  ++ 
Sbjct: 132  ALTWPDGQGPQQVVDDGGDATLLISKGF----EFETAGAVPEPTEADNLEYRCVLATLKQ 187

Query: 632  GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG 811
                D   +  +   + GVSEETTTGV RLYQ+++ G LLFPAINVND+VTKSKFDN+YG
Sbjct: 188  VFNQDKNHWHTVAAGMNGVSEETTTGVHRLYQLEKEGKLLFPAINVNDAVTKSKFDNIYG 247

Query: 812  CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM 991
            CRHSL DG+ RA+DVMI GK A+V GYGDVGKGCA +L+  GARVI+TE+DPICALQA+M
Sbjct: 248  CRHSLIDGINRASDVMIGGKTALVMGYGDVGKGCAQSLRGQGARVIITEVDPICALQAVM 307

Query: 992  EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY 1171
            EG QV  +E+VV + DIFVT TGN DII V  M +MK+ AIV NIGHFDNEID  GL  Y
Sbjct: 308  EGYQVRRIEEVVKDVDIFVTCTGNCDIISVDMMAQMKDKAIVGNIGHFDNEIDTDGLMKY 367

Query: 1172 PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL 1351
            PG+K I IKP+ D + FP+    I++LAEGRL+NLGCATGHPSFVMS SFTNQ +AQL+L
Sbjct: 368  PGIKHIPIKPEYDMWEFPDGH-AILLLAEGRLLNLGCATGHPSFVMSMSFTNQTLAQLDL 426

Query: 1352 WKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHY 1531
            ++++  G  E KVY LPKHLDE+V                 +QA YI++PVEGPYK   Y
Sbjct: 427  YEKR--GNLEMKVYTLPKHLDEEVVRLHLGSLDVHLTKLTQKQADYINVPVEGPYKSDAY 484

Query: 1532 RY 1537
            RY
Sbjct: 485  RY 486



>sp|Q9CCJ4|SAHH_MYCLE Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>pir|D87005|D87005 probable
            S-adenosyl-L-homocysteine hydrolase [imported] -
            Mycobacterium leprae>gb:MLEPRTN3_146572 Mycobacterium
            leprae strain TN complete genome; segment 3/10.
          Length = 492

 Score =  534 bits (1375), Expect = e-150
 Identities = 275/486 (56%), Positives = 339/486 (69%), Gaps = 10/486 (2%)
 Frame = +2

Query: 110  SGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAV 289
            +G ++KV D+S A+FGR EL+LAE EMPGLM+ R E+   QP KGARI+GSLHMT+QTAV
Sbjct: 14   NGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEYAEVQPLKGARISGSLHMTVQTAV 73

Query: 290  LIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXX---------XXWKGETLQEYWWC 442
            LIETLTALGAEVRW SCNIFSTQDH                       WKGETL+EYWW 
Sbjct: 74   LIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWA 133

Query: 443  TERALDWGPGGGP-DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLT 619
             E+ L W     P ++I+DDGGDAT+L+  GV    +Y K G VP     D+AE+++ L 
Sbjct: 134  AEQMLTWPDPDKPVNMILDDGGDATMLVLRGV----QYEKAGVVPPAEVDDSAEWKVFLN 189

Query: 620  IIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFD 799
            ++R   + D  K+T++ + + GV+EETTTGV RLYQ   +G L FPAINVNDSVTKSKFD
Sbjct: 190  LLRKRFETDKGKWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFD 249

Query: 800  NLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICAL 979
            N YG RHSL DG+ R TD +I GK  ++CGYGDVGKGCA A K  GARV +TEIDPI AL
Sbjct: 250  NKYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTITEIDPINAL 309

Query: 980  QALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHG 1159
            QALMEG  V  +EDV++++DI VT TGNKDII++ HMK MK++AI+ NIGHFDNEIDM  
Sbjct: 310  QALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMKDHAILGNIGHFDNEIDMAA 369

Query: 1160 LETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIA 1339
            LE   G  R+ IKPQ D + F ++   II+L+EGRL+NLG ATGHPSFVMS SF NQ IA
Sbjct: 370  LER-SGATRLNIKPQVDLWTFGDSGKSIIVLSEGRLLNLGNATGHPSFVMSNSFANQTIA 428

Query: 1340 QLELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYK 1519
            Q+ELW + +   Y+ +VY LPKHLDEKV                 +QA Y+ + V+GP+K
Sbjct: 429  QIELWTKND--DYDNEVYRLPKHLDEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFK 486

Query: 1520 PPHYRY 1537
            P HYRY
Sbjct: 487  PDHYRY 492



>sp|Q7U9Y3|SAHH_SYNPX Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:BX569689_775021 Synechococcus sp. WH8102
            complete genome; segment 1/7.
          Length = 476

 Score =  533 bits (1374), Expect = e-150
 Identities = 282/482 (58%), Positives = 336/482 (69%)
 Frame = +2

Query: 92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM 271
            T  +   G +  + D++QA FGR EL++AE EMPGLMA R ++G  +P KGARI GSLHM
Sbjct: 7    TATELKLGVDCVIADINQAAFGRKELDIAETEMPGLMALREKYGTEKPLKGARIAGSLHM 66

Query: 272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTER 451
            TIQTA LIETL  LGAEVRW SCNIFSTQDH               KGETL+EYW  T R
Sbjct: 67   TIQTACLIETLVELGAEVRWASCNIFSTQDHAAAAIAAQNIPVFAVKGETLEEYWEYTHR 126

Query: 452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD 631
             L+WG GG P++I+DDGGDAT L+  G KAE++     TV D  S +   F  +   I+ 
Sbjct: 127  ILEWGDGGSPNMILDDGGDATGLVMLGSKAEQDI----TVLDNPSNEEETF--LFASIKK 180

Query: 632  GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG 811
             L  DP  Y+R K  + GV+EETTTGV RLY+MQ+SG L FPAINVNDSVTKSKFDNLYG
Sbjct: 181  KLAQDPTFYSRTKAEIQGVTEETTTGVARLYKMQKSGELPFPAINVNDSVTKSKFDNLYG 240

Query: 812  CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM 991
            CR SL D + RATDVM+AGK A+V GYGDVGKG A +L+  GA V + E+DPICALQA M
Sbjct: 241  CRESLVDSIKRATDVMVAGKQALVMGYGDVGKGSAQSLRGLGATVCIAEVDPICALQAAM 300

Query: 992  EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY 1171
            EG +V+ LEDVV E DIFVT TGN  +I   H++KMK+ AIVCNIGHFDNEID+  L+  
Sbjct: 301  EGYRVVRLEDVVEEMDIFVTATGNYQVIRNEHLEKMKDEAIVCNIGHFDNEIDVASLK-- 358

Query: 1172 PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL 1351
             G +   IKPQ D    P +   II+LAEGRL+NLGCATGHPSFVMS SFTNQV+AQ+EL
Sbjct: 359  -GYEWDNIKPQVDHITLP-SGNRIILLAEGRLVNLGCATGHPSFVMSNSFTNQVLAQIEL 416

Query: 1352 WKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHY 1531
            + + N  +Y K+VYVLPKHLDE V                 +QA YI++PVEGPYKP HY
Sbjct: 417  FTKGN--EYGKEVYVLPKHLDEMVARLHLDRIGAKLTELSKDQADYINVPVEGPYKPDHY 474

Query: 1532 RY 1537
            RY
Sbjct: 475  RY 476



>sp|Q8Y387|SAHH_RALSO Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:AL646057_545021 Ralstonia solanacearum
            GMI1000 chromosome, complete sequence; segment 1/19.
          Length = 474

 Score =  533 bits (1374), Expect = e-150
 Identities = 281/480 (58%), Positives = 329/480 (68%), Gaps = 2/480 (0%)
 Frame = +2

Query: 104  TSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQT 283
            T    +Y V D+  AD+GR E+ +AE EMPGLMA R EF  SQP KGARI GSLHMTIQT
Sbjct: 5    TDLKHDYLVADIKLADWGRKEIAIAETEMPGLMAIRDEFAASQPLKGARIAGSLHMTIQT 64

Query: 284  AVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDW 463
            AVLIETL ALGA+VRW SCNIFSTQDH              +KGE+L+EYW  T R  +W
Sbjct: 65   AVLIETLKALGADVRWASCNIFSTQDHAAAAIAASGTPVFAFKGESLKEYWDFTHRIFEW 124

Query: 464  GPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKA 643
              GG P++I+DDGGDATLL+H G KAE++ +    +  P S +      +   I++ L  
Sbjct: 125  ADGGTPNMILDDGGDATLLLHLGAKAEQDAS---VIAKPGSEEET---FLFAAIKEKLAK 178

Query: 644  DPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHS 823
            D   Y+R  + + GV+EETTTGV RLYQM + G L FPAINVNDSVTKSKFDNLYGCR S
Sbjct: 179  DATFYSRNLDAIKGVTEETTTGVHRLYQMAQRGELRFPAINVNDSVTKSKFDNLYGCRES 238

Query: 824  LPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQ 1003
            L DG+ RATDVMIAGKVAVV GYGDVGKG A AL+   A+V VTEIDPICALQA MEG +
Sbjct: 239  LVDGIKRATDVMIAGKVAVVAGYGDVGKGSAQALRALSAQVWVTEIDPICALQAAMEGYR 298

Query: 1004 VLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVK 1183
            V+T++      DIFVT TGN  +I   HM KMK+ AIVCNIGHFDNEID+  +E Y   +
Sbjct: 299  VVTMDYAAEHGDIFVTCTGNYHVITHDHMAKMKDQAIVCNIGHFDNEIDIASVEQYQWEE 358

Query: 1184 RITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE- 1360
               IKPQ D  +FP+ K  IIILA+GRL+NLGCATGHPS+VMS SF NQ IAQ+ELW E 
Sbjct: 359  ---IKPQVDHVIFPDGKK-IIILAKGRLVNLGCATGHPSYVMSSSFANQTIAQIELWTEA 414

Query: 1361 -KNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
             K + KY   VY LPKHLDEKV                 +QAAYI +  EGPYK  HYRY
Sbjct: 415  QKGSSKYPVGVYTLPKHLDEKVARLQLKKLNAQLTVLTDKQAAYIGVSKEGPYKADHYRY 474



>sp|Q7V926|SAHH_PROMM Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:BX572095_797480 Prochlorococcus marinus
            MIT9313 complete genome; segment 1/7.
          Length = 476

 Score =  533 bits (1372), Expect = e-150
 Identities = 279/473 (58%), Positives = 333/473 (70%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            +Y V D+  ADFGR EL +AE EMPGL+A R ++G  +P KGARI GSLHMTIQT VLIE
Sbjct: 16   QYVVADIDLADFGRKELSIAETEMPGLIALRIKYGSEKPLKGARIAGSLHMTIQTGVLIE 75

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG 478
            TL ALGA+VRW SCNIFSTQDH               KGETL EYW  T R L+WG GG 
Sbjct: 76   TLVALGADVRWASCNIFSTQDHAAAAIAASGVPVFATKGETLDEYWAYTHRILEWGDGGT 135

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKY 658
            P++I+DDGGDAT L+  G KAE +   +  + +P    N E   +   IR  L  D   Y
Sbjct: 136  PNMILDDGGDATGLVMLGSKAESD---SSVLDNPG---NEEETALFASIRTKLAEDSSFY 189

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
            +R+K  + GV+EETTTGV RLYQMQ+SG L FPAINVNDSVTKSKFDNLYGCR SL DG+
Sbjct: 190  SRIKSSIQGVTEETTTGVARLYQMQKSGELPFPAINVNDSVTKSKFDNLYGCRESLVDGI 249

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLE 1018
             RATDVM+AGKVA+V GYGDVGKG A +L+  GA V++ EIDPICALQA MEG +V+ L+
Sbjct: 250  KRATDVMVAGKVALVMGYGDVGKGSAQSLRGLGATVMIAEIDPICALQAAMEGYRVVRLD 309

Query: 1019 DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIK 1198
            +VV + DIFVT+TGN  +I   H+ +MK+ AIVCNIGHFDNEID+  L+ YP      IK
Sbjct: 310  EVVQDVDIFVTSTGNFQVIRHEHLIRMKDEAIVCNIGHFDNEIDVASLKDYPWE---NIK 366

Query: 1199 PQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKY 1378
            PQ D    P +   II+LAEGRL+NLGCATGHPSFVMS SFTNQV+AQ+EL+ + +  +Y
Sbjct: 367  PQVDHITLP-SGNKIILLAEGRLVNLGCATGHPSFVMSNSFTNQVLAQIELFSKGD--QY 423

Query: 1379 EKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
              +VYVLPKHLDE V                 +QA YIS+PVEGPYKP HYRY
Sbjct: 424  ADQVYVLPKHLDEMVARLHLEKIGARLTELTKQQADYISVPVEGPYKPDHYRY 476



>gb:AE017282_426974 Methylococcus capsulatus str. Bath, complete
            genome.
          Length = 472

 Score =  532 bits (1370), Expect = e-149
 Identities = 279/481 (58%), Positives = 338/481 (70%)
 Frame = +2

Query: 95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            V   +S  ++KV D+S A +GR E+ +AE EMPGLMA R E+  +QP KGARI GSLHMT
Sbjct: 4    VANAASFDDHKVADLSLAGWGRKEIAIAETEMPGLMAIREEYRAAQPLKGARIAGSLHMT 63

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
            IQTAVLIETL ALGAEVRW SCNIFSTQDH              +KGE+L +YW  T R 
Sbjct: 64   IQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAADGIPVFAYKGESLDDYWEYTHRI 123

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            L+W    GP++I+DDGGDATLL+  G +AE++ +    + +P+  +    +++   IR  
Sbjct: 124  LEWPGDVGPNMILDDGGDATLLVTLGARAEKDAS---LLANPTCEEE---EVLFAAIRKR 177

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
            L A P  Y+R++  + GV+EETTTGV RLY+MQ  G L FPAINVNDSVTKSKFDNLYGC
Sbjct: 178  LAAKPGWYSRIQAGIKGVTEETTTGVHRLYEMQAKGRLPFPAINVNDSVTKSKFDNLYGC 237

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            R SL DG+ RATDVMIAGK+AVV GYGDVGKGCA +L+  GA V +TEIDPICALQA ME
Sbjct: 238  RESLVDGIKRATDVMIAGKIAVVLGYGDVGKGCAQSLRGLGATVWITEIDPICALQAAME 297

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            G +V+T+++   +ADIFVT TGN  +I   HM KMK+ AIVCNIGHFD+EI++  +  Y 
Sbjct: 298  GYRVVTMDEACDKADIFVTATGNVGVITHDHMVKMKDQAIVCNIGHFDSEIEVAAMRQYT 357

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
                  IKPQ D  V P  +  II+LAEGRL+NLGCATGHPSFVMS SFTNQ +AQ+EL+
Sbjct: 358  WE---NIKPQVDHIVLPNGRR-IILLAEGRLVNLGCATGHPSFVMSNSFTNQTLAQIELF 413

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
               +  KYE KVYVLPKHLDEKV                 EQAAYI +P EGPYKP HYR
Sbjct: 414  --CHGAKYENKVYVLPKHLDEKVARLHLKKIGARLTELSDEQAAYIGVPKEGPYKPDHYR 471

Query: 1535 Y 1537
            Y
Sbjct: 472  Y 472



>gb:AE017239_414067 Mycobacterium avium subsp. paratuberculosis str.
            k10, section 13 of 16 of the complete
            genome.>gb:AE016958_1057471 Mycobacterium avium subsp.
            paratuberculosis str. k10, complete genome.
          Length = 496

 Score =  531 bits (1369), Expect = e-149
 Identities = 277/490 (56%), Positives = 335/490 (68%), Gaps = 14/490 (2%)
 Frame = +2

Query: 110  SGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAV 289
            +G E+KV D+S AD+GR ++EL+E EMPGLM+ R E+   QP KGARI+GSLHMT+QTAV
Sbjct: 14   NGIEFKVADLSLADYGRRDIELSEQEMPGLMSLRREYHDVQPLKGARISGSLHMTVQTAV 73

Query: 290  LIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXX---------XXWKGETLQEYWWC 442
            LIETL ALGAEVRW SCNIFSTQDH                       WKGETL+EYWW 
Sbjct: 74   LIETLVALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPEEPRGVPVFAWKGETLEEYWWA 133

Query: 443  TERALDWGP-----GGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQ 607
             E+AL W P         ++I+DDGGDAT+L+  G     +Y K G VP     D+AE +
Sbjct: 134  AEQALTWPPLADGTEAPANMILDDGGDATMLVLRGA----QYEKAGVVPPDDEDDSAEHR 189

Query: 608  IVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTK 787
            + L ++R   + D  K+T++ E + GV+EETTTGV RLYQ   +G L FPAINVNDSVTK
Sbjct: 190  VFLNLLRARFETDKTKWTKISESIKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTK 249

Query: 788  SKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDP 967
            SKFDN YGCRHSL DG+ R TDV+I GK  +VCGYGDVGKG   +L   GARV VTEIDP
Sbjct: 250  SKFDNKYGCRHSLIDGINRGTDVLIGGKNVLVCGYGDVGKGSVESLAGQGARVTVTEIDP 309

Query: 968  ICALQALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEI 1147
            I ALQALMEG  V  +EDV+ EADI +T TGNKDII + HMK MK+ AI+ NIGHFDNEI
Sbjct: 310  INALQALMEGYNVKRVEDVIGEADIVITATGNKDIITLEHMKAMKDKAILGNIGHFDNEI 369

Query: 1148 DMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTN 1327
             +  LE   G  +  I+PQ D + FP+T   II+L+EGRL+NLG ATGHPSFVMS SF+N
Sbjct: 370  QIARLEK-SGAIKTNIRPQVDLWTFPDTGKSIIVLSEGRLLNLGNATGHPSFVMSNSFSN 428

Query: 1328 QVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVE 1507
            QVIAQ+ELW + +  +Y+ +VY LPKHLDEKV                 EQA YI + V+
Sbjct: 429  QVIAQIELWTKND--EYDNEVYRLPKHLDEKVARIHVEALGGELTKLTKEQAEYIGVDVD 486

Query: 1508 GPYKPPHYRY 1537
            GPYK  HYRY
Sbjct: 487  GPYKADHYRY 496



>sp|Q92TC1|SAHH_RHIME Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:SME591782_184057 Sinorhizobium meliloti
            1021 complete chromosome; segment 1/12.
          Length = 466

 Score =  531 bits (1368), Expect = e-149
 Identities = 278/477 (58%), Positives = 337/477 (70%)
 Frame = +2

Query: 107  SSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTA 286
            S+ ++Y V D+  ADFGR E+ +AE EMPGLMACR EFG S+P KGARITGSLHMTIQTA
Sbjct: 2    SATQDYIVADIGLADFGRKEIAIAETEMPGLMACREEFGASKPLKGARITGSLHMTIQTA 61

Query: 287  VLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWG 466
            VLIETL ALGAEVRW SCNIFSTQDH               KGETL+EYW  T++   W 
Sbjct: 62   VLIETLVALGAEVRWASCNIFSTQDHAAAAIAASGVPVFAVKGETLEEYWTYTDKIFQWA 121

Query: 467  PGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKAD 646
             GG  ++I+DDGGDAT+ I  G +AE   A    + +P S +    +I+   I+  L A 
Sbjct: 122  DGGVSNMILDDGGDATMYILLGARAE---AGENILTNPGSEEE---EILFAQIKKRLAAT 175

Query: 647  PKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSL 826
            P  +TR ++ + GV+EETTTGV RLYQ+Q  G L FPAINVNDSVTKSKFDN YGC+ SL
Sbjct: 176  PGWFTRQRDAIKGVTEETTTGVNRLYQLQAKGLLPFPAINVNDSVTKSKFDNKYGCKESL 235

Query: 827  PDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQV 1006
             DG+ R TDVM+AGKVAVVCGYGDVGKG AA+L  AGARV VTE+DPICALQA M+G +V
Sbjct: 236  VDGIRRGTDVMMAGKVAVVCGYGDVGKGSAASLSGAGARVKVTEVDPICALQAAMDGYEV 295

Query: 1007 LTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKR 1186
            + LEDVVS ADIF+TTTGNKD+I + HM+ MK+ AIV NIGHFDNEI +  L     +K 
Sbjct: 296  VQLEDVVSSADIFITTTGNKDVIRIEHMRAMKDMAIVGNIGHFDNEIQVSALR---NLKW 352

Query: 1187 ITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKN 1366
              +KPQ D   FP+    II+L+EGRL+NLG ATGHPSFVMS SF+NQV+AQ+EL+ +  
Sbjct: 353  TNVKPQVDLIEFPKGNR-IILLSEGRLLNLGNATGHPSFVMSASFSNQVLAQIELFTKGE 411

Query: 1367 TGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
              +Y+ +VYVLPK LDEKV                 EQA+YI +  +GP+K  HYRY
Sbjct: 412  --QYKNEVYVLPKQLDEKVARLHLAKLGAKLTELSEEQASYIGVKQQGPFKAEHYRY 466



>gb:CR555306_106425 Azoarcus sp. EbN1 complete genome.
          Length = 470

 Score =  528 bits (1361), Expect = e-148
 Identities = 279/473 (58%), Positives = 329/473 (69%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            +Y V D++ A +GR E+ +AE EMPGLMA R EF   QP KGARITGSLHMTIQTAVLIE
Sbjct: 10   DYVVADLALAGWGRKEIRIAETEMPGLMAIREEFAVVQPLKGARITGSLHMTIQTAVLIE 69

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG 478
            TLTALGAEVRW SCNIFSTQDH               KGE+L +YW  T R  +W  GG 
Sbjct: 70   TLTALGAEVRWASCNIFSTQDHAAAAIAASGVPVFAVKGESLADYWDYTHRIFEWRDGGY 129

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKY 658
             ++I+DDGGDATLL+H G +AE++ +    +  P S +    +++   IR  L +DP  Y
Sbjct: 130  SNMILDDGGDATLLLHLGARAEKDVS---VLAKPGSEEE---RVLFAAIRAKLASDPTWY 183

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
            +     + GV+EETTTGV RLYQM E G L FPAINVNDSVTKSKFDNLYGCR SL DG+
Sbjct: 184  SVRLAAIRGVTEETTTGVHRLYQMFERGELKFPAINVNDSVTKSKFDNLYGCRESLVDGI 243

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLE 1018
             RATDVM+AGKVAVVCGYGDVGKG A AL+   A+V VTEIDPICALQA MEG +V+T++
Sbjct: 244  KRATDVMVAGKVAVVCGYGDVGKGSAQALRALSAQVWVTEIDPICALQAAMEGYRVVTMD 303

Query: 1019 DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIK 1198
                 ADIFVT TGN  +I   HM +MK+ AIVCNIGHFDNEID+  +E Y   +   IK
Sbjct: 304  YAAEHADIFVTCTGNYHVIRHDHMARMKDQAIVCNIGHFDNEIDVASIEGYEWEE---IK 360

Query: 1199 PQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKY 1378
            PQ D  +FP+ K  II+LA+GRL+NLGCATGHPS+VMS SF NQ IAQ+EL+    T  Y
Sbjct: 361  PQVDHVIFPDGKR-IILLAKGRLVNLGCATGHPSYVMSSSFANQTIAQIELF--TRTADY 417

Query: 1379 EKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
               VY LPKHLDEKV                P+QAAYI +PVEGPYK  HYRY
Sbjct: 418  PVGVYTLPKHLDEKVARLQLKKLNAQLTELRPDQAAYIGVPVEGPYKSAHYRY 470



>sp|Q7WQX5|SAHH_BORBR Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>sp|Q7W1Z7|SAHH_BORPA Adenosylhomocysteinase
            (EC 3.3.1.1) (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:BX640423_808449 Bordetella parapertussis
            strain 12822, complete genome; segment
            1/14.>gb:BX640437_812851 Bordetella bronchiseptica strain
            RB50, complete genome; segment 1/16.
          Length = 472

 Score =  528 bits (1361), Expect = e-148
 Identities = 276/473 (58%), Positives = 330/473 (69%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            +Y V DM+ A +GR EL +AE EMPGLMA R E+  SQP KGARI GSLHMTIQT VLIE
Sbjct: 11   DYIVADMALAGWGRRELAIAETEMPGLMAIRDEYAASQPLKGARIAGSLHMTIQTGVLIE 70

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG 478
            TL ALGAEVRW SCNIFSTQDH               KGETL+EYW  T +  +W  G  
Sbjct: 71   TLVALGAEVRWASCNIFSTQDHAAAAIAATGTPVFAIKGETLEEYWQYTHKIFEWPEGRH 130

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKY 658
             ++I+DDGGDATLL+H G +AE++ +    +  P S +    +++   I++ L  DPK Y
Sbjct: 131  ANMILDDGGDATLLLHLGARAEQDIS---VLAKPGSEEE---RVLFAAIKETLARDPKWY 184

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
            +    ++ GV+EETTTGV RLYQM + G L F AINVNDSVTKSKFDNLYGCR SL DG+
Sbjct: 185  STRLAQIKGVTEETTTGVHRLYQMSQKGELAFAAINVNDSVTKSKFDNLYGCRESLVDGI 244

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLE 1018
             RATDVM+AGK+AVV GYGDVGKGCA AL    A+V VTEIDPICALQA MEG +V+T+E
Sbjct: 245  KRATDVMVAGKIAVVAGYGDVGKGCAQALAALRAQVWVTEIDPICALQAAMEGFKVVTME 304

Query: 1019 DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIK 1198
            +  + ADIFVT TGN  +I   HM+ MK+ AIVCNIGHFDNEID+ GLE     +   IK
Sbjct: 305  EAAAHADIFVTATGNYHVITRQHMEAMKDQAIVCNIGHFDNEIDVAGLENCQWEE---IK 361

Query: 1199 PQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKY 1378
            PQ D  +FP+ K  II+LA+GRL+NLGCATGHPSFVMS SF NQ IAQ+EL+  +N    
Sbjct: 362  PQVDHVIFPDGKR-IILLAKGRLVNLGCATGHPSFVMSSSFANQTIAQIELF-TRNEAYT 419

Query: 1379 EKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
              +VYVLPKHLDEKV                 +QA YI +PVEGP+KP HYRY
Sbjct: 420  TGQVYVLPKHLDEKVARLHLKKLGAKLSTLSKQQADYIGVPVEGPFKPGHYRY 472



>sp|Q7VUL8|SAHH_BORPE Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:BX640420_807465 Bordetella pertussis
            strain Tohama I, complete genome; segment 10/12.
          Length = 472

 Score =  528 bits (1359), Expect = e-148
 Identities = 276/473 (58%), Positives = 330/473 (69%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            +Y V DM+ A +GR EL +AE EMPGLMA R E+  SQP KGARI GSLHMTIQT VLIE
Sbjct: 11   DYIVADMALAGWGRRELAIAETEMPGLMAIRDEYAASQPLKGARIAGSLHMTIQTGVLIE 70

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG 478
            TL ALGAEVRW SCNIFSTQDH               KGETL+EYW  T +  +W  G  
Sbjct: 71   TLVALGAEVRWASCNIFSTQDHAAAAIAATGTPVFAIKGETLEEYWQYTHKIFEWPEGRH 130

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKY 658
             ++I+DDGGDATLL+H G +AE++ +    +  P S +    +++   I++ L  DPK Y
Sbjct: 131  ANMILDDGGDATLLLHLGARAEQDIS---VLAKPGSEEE---RVLFAAIKETLGRDPKWY 184

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
            +    ++ GV+EETTTGV RLYQM + G L F AINVNDSVTKSKFDNLYGCR SL DG+
Sbjct: 185  STRLAQIKGVTEETTTGVHRLYQMSQKGELAFAAINVNDSVTKSKFDNLYGCRESLVDGI 244

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLE 1018
             RATDVM+AGK+AVV GYGDVGKGCA AL    A+V VTEIDPICALQA MEG +V+T+E
Sbjct: 245  KRATDVMVAGKIAVVAGYGDVGKGCAQALVALRAQVWVTEIDPICALQAAMEGFKVVTME 304

Query: 1019 DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIK 1198
            +  + ADIFVT TGN  +I   HM+ MK+ AIVCNIGHFDNEID+ GLE     +   IK
Sbjct: 305  EAAAHADIFVTATGNYHVITRQHMEAMKDQAIVCNIGHFDNEIDVAGLENCQWEE---IK 361

Query: 1199 PQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKY 1378
            PQ D  +FP+ K  II+LA+GRL+NLGCATGHPSFVMS SF NQ IAQ+EL+  +N    
Sbjct: 362  PQVDHVIFPDGKR-IILLAKGRLVNLGCATGHPSFVMSSSFANQTIAQIELF-TRNEAYT 419

Query: 1379 EKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
              +VYVLPKHLDEKV                 +QA YI +PVEGP+KP HYRY
Sbjct: 420  TGQVYVLPKHLDEKVARLHLKKLGVKLSTLSKQQADYIGVPVEGPFKPDHYRY 472



>sp|P61617|SAHH_GEOSL Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:AE017180_400170 Geobacter sulfurreducens
            PCA, complete genome.
          Length = 475

 Score =  527 bits (1357), Expect = e-148
 Identities = 276/476 (57%), Positives = 332/476 (69%), Gaps = 3/476 (0%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            +Y + D+S A +GR E+ +AE EMPGLMA R E+  ++P +GARI GSLHMTIQTA+LIE
Sbjct: 15   DYCISDISLAAWGRKEMIIAETEMPGLMAIREEYAATRPLQGARIAGSLHMTIQTAMLIE 74

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG 478
            TL ALGAEVRW SCNIFSTQDH              +KGE+L+EYW  T R  +W  GG 
Sbjct: 75   TLVALGAEVRWASCNIFSTQDHAAAAIAAAGIPVFAYKGESLEEYWEFTHRIFEWHDGGT 134

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNA---EFQIVLTIIRDGLKADP 649
            P++I+DDGGDATLL+H G  AE+         DPS   N    E Q +   I+  L   P
Sbjct: 135  PNMILDDGGDATLLLHLGSDAEK---------DPSVIANPTCEEEQYLFASIKKRLAEKP 185

Query: 650  KKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLP 829
              Y++    + GV+EETTTGV RLYQM E G L FPAINVNDSVTKSKFDN+YGCR SL 
Sbjct: 186  GWYSKTAAAIKGVTEETTTGVHRLYQMHEKGKLKFPAINVNDSVTKSKFDNIYGCRESLV 245

Query: 830  DGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVL 1009
            DG+ RATDVMIAGKVAV+CGYG+VGKGCA A++   A+V VTEIDPICALQA MEG +V+
Sbjct: 246  DGIKRATDVMIAGKVAVICGYGEVGKGCAQAMRGLQAQVWVTEIDPICALQAAMEGYRVV 305

Query: 1010 TLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRI 1189
            T+E    +ADIFVTTTGN ++I   HMK M++NAIVCNIGHFDNEI++  L+ Y   +  
Sbjct: 306  TMEYAADKADIFVTTTGNINVITHDHMKAMRHNAIVCNIGHFDNEIEVAALKQY---QWE 362

Query: 1190 TIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNT 1369
             IKPQ D  +FP++K  II+LAEGRL+NLGCATGHPS+VMS SF NQ +AQ+EL+   N 
Sbjct: 363  NIKPQVDHIIFPDSKR-IILLAEGRLVNLGCATGHPSYVMSSSFANQTLAQIELF--CNP 419

Query: 1370 GKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            GKY   VY+LPK LDEKV                 EQAAYI +P  GPYK  HYRY
Sbjct: 420  GKYPVGVYMLPKELDEKVARLQLKTLGAMLTELTDEQAAYIGVPKNGPYKSAHYRY 475



>sp|Q98CM3|SAHH_RHILO Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:BA000012_669885 Mesorhizobium loti
            MAFF303099 DNA, complete genome.
          Length = 466

 Score =  525 bits (1352), Expect = e-147
 Identities = 271/477 (56%), Positives = 334/477 (70%)
 Frame = +2

Query: 107  SSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTA 286
            +  ++Y V D+S A +GR EL++AE EMPGLMACR EFG  +P KGARITGSLHMTIQTA
Sbjct: 2    TGSKDYVVADISLAGWGRKELDIAETEMPGLMACREEFGAKKPLKGARITGSLHMTIQTA 61

Query: 287  VLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWG 466
            VLIETL ALGA++RW SCNIFSTQDH               KGE+L++YW  T+R   W 
Sbjct: 62   VLIETLKALGADIRWASCNIFSTQDHAAAAIAEAGIPVFAVKGESLEQYWDYTDRIFQWA 121

Query: 467  PGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKAD 646
             GG  ++I+DDGGDAT+ I  G +AE   A    + +P S +   F      ++  LKA 
Sbjct: 122  DGGLSNMILDDGGDATMYILIGARAE---AGEDVLSNPQSEEEEYFYAQ---VKKRLKAS 175

Query: 647  PKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSL 826
            P  +T+ K  + GV+EETTTGV RLYQ+Q+ G L FPAINVNDSVTKSKFDN YGC+ SL
Sbjct: 176  PGFFTKQKAAIRGVTEETTTGVNRLYQLQKKGLLPFPAINVNDSVTKSKFDNKYGCKESL 235

Query: 827  PDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQV 1006
             DG+ R TD M+AGKVAVVCGYGDVGKG +A+LK AGARV VTE+DPICALQA M+G +V
Sbjct: 236  VDGIRRGTDTMMAGKVAVVCGYGDVGKGSSASLKGAGARVKVTEVDPICALQAAMDGFEV 295

Query: 1007 LTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKR 1186
            +TLED    ADI +TTTGNKD++ + HM+ MK+  IV NIGHFDNEI +  L     +K 
Sbjct: 296  VTLEDAAPTADIVITTTGNKDVVTLDHMRSMKDMVIVGNIGHFDNEIQVASLR---NLKW 352

Query: 1187 ITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKN 1366
              +KPQ D   FP+ K  +I+L+EGRL+NLG ATGHPSFVMS SFTNQV+AQ+EL+ +  
Sbjct: 353  TNVKPQVDMITFPDGKR-MILLSEGRLLNLGNATGHPSFVMSASFTNQVLAQIELFTKGE 411

Query: 1367 TGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
              +Y+ +VYVLPKHLDEKV                 EQAAYI +  +GP+KP HYRY
Sbjct: 412  --QYQNQVYVLPKHLDEKVARLHLDKLGARLTELSGEQAAYIGVTPQGPFKPEHYRY 466



>sp|Q8EXV1|SAHH_LEPIN Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:AE011599_274702 Leptospira interrogans
            serovar lai str. 56601 chromosome II, section 11 of 34 of
            the complete sequence.>gb:AE016824_341445 Leptospira
            interrogans serovar Copenhageni str. Fiocruz L1-130,
            chromosome II, complete sequence.>gb:AE010301_1003376
            Leptospira interrogans serovar lai str. 56601 chromosome
            II, complete sequence.
          Length = 436

 Score =  525 bits (1352), Expect = e-147
 Identities = 271/472 (57%), Positives = 319/472 (67%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKVKD+SQA++GR E+ LAE EMPGLMA R E+   +P  GARI GSLHMTIQTAVLIET
Sbjct: 12   YKVKDLSQAEWGRQEIILAEKEMPGLMALRQEYKGKKPLAGARIAGSLHMTIQTAVLIET 71

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            LT LGAEVRW SCNIFSTQDH              WKGET +EYWWC E+ + +G  G P
Sbjct: 72   LTELGAEVRWSSCNIFSTQDHAAAAIAKAGIPVFAWKGETEEEYWWCIEQTIFFGDKG-P 130

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGD T  IHE                                         KY 
Sbjct: 131  NMILDDGGDLTAYIHE-----------------------------------------KYP 149

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
            ++   + G+SEETTTGVK LY++ + G L  PA NVNDSVTKSKFDNLYGCR SL DG+ 
Sbjct: 150  KLLSEIRGISEETTTGVKSLYKLLKKGELKVPAFNVNDSVTKSKFDNLYGCRESLADGIK 209

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATDVM+AGKVA+VCG+GDVGKG AA+L+  GARVIVTEIDPICALQA MEG QVL +ED
Sbjct: 210  RATDVMLAGKVALVCGFGDVGKGSAASLRNFGARVIVTEIDPICALQASMEGYQVLRVED 269

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
            ++ + DI VT TGN DII + HMK MK+ AI+CNIGHFD EI M  L    GV +  IKP
Sbjct: 270  IIEQVDIVVTATGNDDIITLEHMKAMKDGAILCNIGHFDTEIQMSRLNNEKGVTKKEIKP 329

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYE 1381
            Q D++ FP+ K+ II+LAEGRL+NLGCATGHPSFVMSCSFTNQV+AQ+EL+      KYE
Sbjct: 330  QVDKYTFPDGKS-IIVLAEGRLVNLGCATGHPSFVMSCSFTNQVLAQIELY----NNKYE 384

Query: 1382 KKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
              VY LPKHLDEKV                 +QA Y+ +P+ GP+KP HYRY
Sbjct: 385  LGVYTLPKHLDEKVAALHLEQLGVRLTKLNQKQADYLGVPINGPFKPDHYRY 436



>pir|D82730|D82730 adenosylhomocysteinase XF1037 [imported] - Xylella
            fastidiosa (strain 9a5c)>gb:AE003941_48676 Xylella
            fastidiosa 9a5c, section 87 of 229 of the complete
            genome.>gb:AE003849_1115886 Xylella fastidiosa 9a5c,
            complete genome.
          Length = 446

 Score =  523 bits (1346), Expect = e-147
 Identities = 268/454 (59%), Positives = 320/454 (70%), Gaps = 4/454 (0%)
 Frame = +2

Query: 188  MPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHX 367
            MPGLM+ R ++   QP KG R+TGSLHMTIQTAVLIETL  +GA+VRW SCNIFSTQDH 
Sbjct: 1    MPGLMSIRRKYASKQPLKGVRVTGSLHMTIQTAVLIETLKDIGADVRWASCNIFSTQDHA 60

Query: 368  XXXXXXXXXXXXXWKGETLQEYWWCTERALDW----GPGGGPDLIVDDGGDATLLIHEGV 535
                         WKGETL+EYW CT +AL +    G   GP+LIVDDGGDATLLIH+G 
Sbjct: 61   AAAIATSGTPVFAWKGETLEEYWDCTLQALTFTLSDGTLTGPELIVDDGGDATLLIHKGY 120

Query: 536  KAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVK 715
            + E     NG+      +D+ E Q++  +++      P  +TR+     GVSEETTTGV 
Sbjct: 121  ELE-----NGSTWVDEPSDSLEEQVIKRLLKRIAIERPGYWTRVVNDWKGVSEETTTGVH 175

Query: 716  RLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYG 895
            RLYQ+  +G LL PAINVNDSVTKSKFDNLYGCR SL DGL RA DVM+AGK+AVVCGYG
Sbjct: 176  RLYQIAATGRLLVPAINVNDSVTKSKFDNLYGCRESLADGLKRAMDVMLAGKLAVVCGYG 235

Query: 896  DVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIFVTTTGNKDII 1075
            DVGKG A +L+  GARVIVTEIDPICALQA MEG +V T+ED + +ADI+VTTTGNKD+I
Sbjct: 236  DVGKGSAHSLRAYGARVIVTEIDPICALQAAMEGFEVTTVEDTLGQADIYVTTTGNKDVI 295

Query: 1076 MVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILA 1255
             + HM  MK+  IVCNIGHFDNEI +  L    GV++I IKPQ D+F+ P   T + +LA
Sbjct: 296  RIEHMTAMKDQVIVCNIGHFDNEIQVDALNALAGVQKINIKPQVDKFILPNGNT-LFLLA 354

Query: 1256 EGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVXXXX 1435
            EGRL+NLGCATGHPSFVMS SF NQ +AQ++LW+ K+   YEK VY LPK LDE+V    
Sbjct: 355  EGRLVNLGCATGHPSFVMSNSFANQTLAQIDLWQNKDV--YEKNVYRLPKKLDEEVARLH 412

Query: 1436 XXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
                          QAAY+ I VEGP+KP HYRY
Sbjct: 413  LEKIGVKLTTLTANQAAYLGISVEGPFKPEHYRY 446



>sp|Q8UJ99|SAHH_AGRT5 Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>pir|AF2580|AF2580 S-adenosylhomocysteine
            hydrolase ahcY [imported] - Agrobacterium tumefaciens
            (strain C58, Dupont)>pir|D97362|D97362
            adenosylhomocysteinase (S-adenosyl-l-homocysteine
            hydrolase) (adohcyase) [imported] - Agrobacterium
            tumefaciens (strain C58, Cereon)>gb:AE007946_231793
            Agrobacterium tumefaciens str. C58 circular chromosome,
            section 4 of 254 of the complete
            sequence.>gb:AE008977_247087 Agrobacterium tumefaciens
            str. C58 circular chromosome, section 3 of 256 of the
            complete sequence.>gb:AE007869_1081462 Agrobacterium
            tumefaciens str. C58 circular chromosome, complete
            sequence.>gb:AE008688_1084930 Agrobacterium tumefaciens
            str. C58 circular chromosome, complete sequence.
          Length = 466

 Score =  523 bits (1346), Expect = e-147
 Identities = 276/474 (58%), Positives = 334/474 (70%)
 Frame = +2

Query: 116  REYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLI 295
            ++Y V D++ A FGR EL++AE EMPGLM+CR EFG S+P KGARITGSLHMTIQT VLI
Sbjct: 5    KDYIVADINLAAFGRKELDIAETEMPGLMSCRKEFGESKPLKGARITGSLHMTIQTGVLI 64

Query: 296  ETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGG 475
            ETL  LGAE+RW SCNIFSTQDH               KGE+L EYW  T++   W  GG
Sbjct: 65   ETLKELGAEIRWASCNIFSTQDHAAAAIAAAGIPVFAVKGESLTEYWEYTDKIFQWTDGG 124

Query: 476  GPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKK 655
              ++I+DDGGDAT+ I  G +AE   A    + +P S +    +I+   I   LKA P  
Sbjct: 125  LSNMILDDGGDATMYILLGARAE---AGEDVLSNPGSEEE---EILFAQINKRLKASPGW 178

Query: 656  YTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDG 835
            +T+ ++ L GV+EETTTGV RLY + + G L FPAINVNDSVTKSKFDN YGC+ SL DG
Sbjct: 179  FTKQRDALKGVTEETTTGVHRLYDLAKKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDG 238

Query: 836  LMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTL 1015
            + RATDVM+AGKVAVVCGYGDVGKG AA+L+ AGARV VTEIDPICALQA M+G +V+ L
Sbjct: 239  IRRATDVMMAGKVAVVCGYGDVGKGSAASLQGAGARVKVTEIDPICALQAAMDGFEVVRL 298

Query: 1016 EDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITI 1195
            EDVVS ADIF+TTTGNKD+I + HM++MK+ AIV NIGHFDNEI +  L     +K   I
Sbjct: 299  EDVVSSADIFITTTGNKDVIRIEHMREMKDMAIVGNIGHFDNEIQVASLR---NLKWTNI 355

Query: 1196 KPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGK 1375
            KPQ D   FP+    II+L+EGRL+NLG ATGHPSFVMS SFTNQV+ Q+EL+ +   G+
Sbjct: 356  KPQVDMIEFPKGNR-IILLSEGRLLNLGNATGHPSFVMSASFTNQVLGQIELFTK--PGE 412

Query: 1376 YEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            Y+ +VYVLPKHLDEKV                  QA YI I  +GP+K  HYRY
Sbjct: 413  YKNEVYVLPKHLDEKVARLHLEKLGVRLTELSDLQADYIGISKQGPFKAEHYRY 466



>pir|AG3505|AG3505 adenosylhomocysteinase (EC 3.3.1.1) [imported] -
            Brucella melitensis (strain 16M)>gb:AE009636_253947
            Brucella melitensis 16M chromosome I, section 193 of 195
            of the complete sequence.>gb:AE008917_979859 Brucella
            melitensis 16M chromosome I, complete sequence.
          Length = 481

 Score =  522 bits (1345), Expect = e-147
 Identities = 272/477 (57%), Positives = 334/477 (70%)
 Frame = +2

Query: 107  SSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTA 286
            ++ +++ VKD+S AD+GR EL++AE EMPGLMA R EFG SQP KGARI+GSLHMTIQTA
Sbjct: 17   TASQDFVVKDISLADWGRRELDIAETEMPGLMAAREEFGKSQPLKGARISGSLHMTIQTA 76

Query: 287  VLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWG 466
            VLIETL  LGAEVRW SCNIFSTQDH               KGETL+EYW  T++   W 
Sbjct: 77   VLIETLKVLGAEVRWASCNIFSTQDHAAAAIAATGTPVFAVKGETLEEYWTYTDQIFQWP 136

Query: 467  PGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKAD 646
             G   ++I+DDGGDAT+ I  G +AE   A    + +P S +    +++   I+  + A 
Sbjct: 137  DGEPSNMILDDGGDATMYILIGARAE---AGEDVLSNPQSEEE---EVLFAQIKKRMAAT 190

Query: 647  PKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSL 826
            P  +T+ +  + GV+EETTTGV RLYQ+Q+ G L FPAINVNDSVTKSKFDN YGC+ SL
Sbjct: 191  PGFFTKQRAAIKGVTEETTTGVNRLYQLQKKGLLPFPAINVNDSVTKSKFDNKYGCKESL 250

Query: 827  PDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQV 1006
             DG+ R TDVM+AGKVAVVCGYGDVGKG A +L  AGARV VTE+DPICALQA M+G +V
Sbjct: 251  VDGIRRGTDVMMAGKVAVVCGYGDVGKGSAQSLAGAGARVKVTEVDPICALQAAMDGFEV 310

Query: 1007 LTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKR 1186
            +TL+D  S ADI VTTTGNKD+I + HM+KMK+  IV NIGHFDNEI +  L     +K 
Sbjct: 311  VTLDDAASTADIVVTTTGNKDVITIDHMRKMKDMCIVGNIGHFDNEIQVAALR---NLKW 367

Query: 1187 ITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKN 1366
              +KPQ D   FP+ K  +I+L+EGRL+NLG ATGHPSFVMS SFTNQV+ Q+EL+    
Sbjct: 368  TNVKPQVDLIEFPDGKR-LILLSEGRLLNLGNATGHPSFVMSASFTNQVLGQIELF--TR 424

Query: 1367 TGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            T  Y+ +VYVLPKHLDEKV                 EQAAYI +  +GP+K  HYRY
Sbjct: 425  TDAYKNEVYVLPKHLDEKVARLHLDKLGAKLTVLSEEQAAYIGVTPQGPFKSEHYRY 481



>sp|Q8FXZ7|SAHH_BRUSU Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:AE014291_309501 Brucella suis 1330
            chromosome I, complete sequence.
          Length = 466

 Score =  522 bits (1345), Expect = e-147
 Identities = 272/477 (57%), Positives = 334/477 (70%)
 Frame = +2

Query: 107  SSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTA 286
            ++ +++ VKD+S AD+GR EL++AE EMPGLMA R EFG SQP KGARI+GSLHMTIQTA
Sbjct: 2    TASQDFVVKDISLADWGRKELDIAETEMPGLMAAREEFGKSQPLKGARISGSLHMTIQTA 61

Query: 287  VLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWG 466
            VLIETL  LGAEVRW SCNIFSTQDH               KGETL+EYW  T++   W 
Sbjct: 62   VLIETLKVLGAEVRWASCNIFSTQDHAAAAIAATGTPVFAVKGETLEEYWTYTDQIFQWP 121

Query: 467  PGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKAD 646
             G   ++I+DDGGDAT+ I  G +AE   A    + +P S +    +++   I+  + A 
Sbjct: 122  DGEPSNMILDDGGDATMYILIGARAE---AGEDVLSNPQSEEE---EVLFAQIKKRMAAT 175

Query: 647  PKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSL 826
            P  +T+ +  + GV+EETTTGV RLYQ+Q+ G L FPAINVNDSVTKSKFDN YGC+ SL
Sbjct: 176  PGFFTKQRAAIKGVTEETTTGVNRLYQLQKKGLLPFPAINVNDSVTKSKFDNKYGCKESL 235

Query: 827  PDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQV 1006
             DG+ R TDVM+AGKVAVVCGYGDVGKG A +L  AGARV VTE+DPICALQA M+G +V
Sbjct: 236  VDGIRRGTDVMMAGKVAVVCGYGDVGKGSAQSLAGAGARVKVTEVDPICALQAAMDGFEV 295

Query: 1007 LTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKR 1186
            +TL+D  S ADI VTTTGNKD+I + HM+KMK+  IV NIGHFDNEI +  L     +K 
Sbjct: 296  VTLDDAASTADIVVTTTGNKDVITIDHMRKMKDMCIVGNIGHFDNEIQVAALR---NLKW 352

Query: 1187 ITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKN 1366
              +KPQ D   FP+ K  +I+L+EGRL+NLG ATGHPSFVMS SFTNQV+ Q+EL+    
Sbjct: 353  TNVKPQVDLIEFPDGKR-LILLSEGRLLNLGNATGHPSFVMSASFTNQVLGQIELF--TR 409

Query: 1367 TGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            T  Y+ +VYVLPKHLDEKV                 EQAAYI +  +GP+K  HYRY
Sbjct: 410  TDAYKNEVYVLPKHLDEKVARLHLDKLGAKLTVLSEEQAAYIGVTPQGPFKSEHYRY 466



>sp|Q8YE49|SAHH_BRUME Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase).
          Length = 466

 Score =  522 bits (1345), Expect = e-147
 Identities = 272/477 (57%), Positives = 334/477 (70%)
 Frame = +2

Query: 107  SSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTA 286
            ++ +++ VKD+S AD+GR EL++AE EMPGLMA R EFG SQP KGARI+GSLHMTIQTA
Sbjct: 2    TASQDFVVKDISLADWGRRELDIAETEMPGLMAAREEFGKSQPLKGARISGSLHMTIQTA 61

Query: 287  VLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWG 466
            VLIETL  LGAEVRW SCNIFSTQDH               KGETL+EYW  T++   W 
Sbjct: 62   VLIETLKVLGAEVRWASCNIFSTQDHAAAAIAATGTPVFAVKGETLEEYWTYTDQIFQWP 121

Query: 467  PGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKAD 646
             G   ++I+DDGGDAT+ I  G +AE   A    + +P S +    +++   I+  + A 
Sbjct: 122  DGEPSNMILDDGGDATMYILIGARAE---AGEDVLSNPQSEEE---EVLFAQIKKRMAAT 175

Query: 647  PKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSL 826
            P  +T+ +  + GV+EETTTGV RLYQ+Q+ G L FPAINVNDSVTKSKFDN YGC+ SL
Sbjct: 176  PGFFTKQRAAIKGVTEETTTGVNRLYQLQKKGLLPFPAINVNDSVTKSKFDNKYGCKESL 235

Query: 827  PDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQV 1006
             DG+ R TDVM+AGKVAVVCGYGDVGKG A +L  AGARV VTE+DPICALQA M+G +V
Sbjct: 236  VDGIRRGTDVMMAGKVAVVCGYGDVGKGSAQSLAGAGARVKVTEVDPICALQAAMDGFEV 295

Query: 1007 LTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKR 1186
            +TL+D  S ADI VTTTGNKD+I + HM+KMK+  IV NIGHFDNEI +  L     +K 
Sbjct: 296  VTLDDAASTADIVVTTTGNKDVITIDHMRKMKDMCIVGNIGHFDNEIQVAALR---NLKW 352

Query: 1187 ITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKN 1366
              +KPQ D   FP+ K  +I+L+EGRL+NLG ATGHPSFVMS SFTNQV+ Q+EL+    
Sbjct: 353  TNVKPQVDLIEFPDGKR-LILLSEGRLLNLGNATGHPSFVMSASFTNQVLGQIELF--TR 409

Query: 1367 TGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            T  Y+ +VYVLPKHLDEKV                 EQAAYI +  +GP+K  HYRY
Sbjct: 410  TDAYKNEVYVLPKHLDEKVARLHLDKLGAKLTVLSEEQAAYIGVTPQGPFKSEHYRY 466



>gb:CP000031_87847 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 462

 Score =  521 bits (1341), Expect = e-146
 Identities = 274/473 (57%), Positives = 338/473 (71%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            +Y VKD+S A FGR EL++AE EMPGLM  R E+G +QP KGARI GSLHMTIQTAVLIE
Sbjct: 4    DYIVKDISLAGFGRKELDIAETEMPGLMTLREEYGKAQPLKGARIVGSLHMTIQTAVLIE 63

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG 478
            TL ALGA+VRW SCNIFSTQDH               KG+TL+E+W   +++  +  G  
Sbjct: 64   TLVALGADVRWASCNIFSTQDHAAAAIAAAGIPVFAIKGQTLEEHWDYLDKSFLFDEG-- 121

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKY 658
            P++I+DDGGDATL I  G +AE   A    +P P S +    +++   I   + A P  +
Sbjct: 122  PNMILDDGGDATLYILLGARAE---AGEDIIPVPGSEEE---EVIKKQIAKRMAASPGWF 175

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
            T+M++++ GVSEETTTGV RLYQ+ + G L FPAINVNDSVTKSKFDN YGC+ SL DG+
Sbjct: 176  TKMRDQIQGVSEETTTGVNRLYQLVKDGHLPFPAINVNDSVTKSKFDNKYGCKESLVDGI 235

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLE 1018
             RATD M+AGKVAVVCGYGDVGKG AA+L+ AGARV VTE+DPICALQA M+G +V TLE
Sbjct: 236  RRATDTMMAGKVAVVCGYGDVGKGSAASLRGAGARVKVTEVDPICALQAAMDGFEVTTLE 295

Query: 1019 DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIK 1198
            D V+ ADIF+TTTGNKD+I + HM++MKN AIV NIGHFDNEI +  L+ +   K   IK
Sbjct: 296  DEVASADIFITTTGNKDVIRIEHMREMKNMAIVGNIGHFDNEIQVAALKNH---KWTNIK 352

Query: 1199 PQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKY 1378
             Q D    P +   II+L+EGRL+NLG ATGHPSFVMS SFTNQV+AQ+EL+ + +  +Y
Sbjct: 353  EQVDMIEMP-SGNKIILLSEGRLLNLGNATGHPSFVMSASFTNQVLAQIELFTKGD--QY 409

Query: 1379 EKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            E KVY+LPKHLDEKV                P+QA+YI +  EGP+KP HYRY
Sbjct: 410  ENKVYILPKHLDEKVARLHLARIGVKLTQLSPDQASYIGVKPEGPFKPEHYRY 462



>gb:AF307335_1784661 Petunia x hybrida cytokinin binding protein
            (PETCBP) mRNA, complete cds.
          Length = 431

 Score =  520 bits (1340), Expect = e-146
 Identities = 278/450 (61%), Positives = 315/450 (70%)
 Frame = +2

Query: 188  MPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHX 367
            M GLMACR EFGPSQPFKGA+ITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH 
Sbjct: 1    MAGLMACRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHA 60

Query: 368  XXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 547
                          KGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA        K+  
Sbjct: 61   AAAIARDSRAVFAPKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDAYTFDSSRCKSSR 120

Query: 548  EYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQ 727
                       S       +I+++  R          T    R   +S+ T    K  Y 
Sbjct: 121  GIC--------SIWARGSLEILISERRQQPFNFRGSVTSHFSR-TNISQGTKC--KSNYI 169

Query: 728  MQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGK 907
            +     +LF  I     VTKSKFDNLY  +H   +  +       + KVAVV GYG+ G+
Sbjct: 170  LVRVIKILFYRI-----VTKSKFDNLYCNQH---ENFLSFIKQQHSTKVAVVAGYGEFGE 221

Query: 908  GCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSH 1087
            GCA+ALKQAGARVIVTEIDPICALQALMEGLQVLTL+DVVS A IFVTTTG KDIIMV H
Sbjct: 222  GCASALKQAGARVIVTEIDPICALQALMEGLQVLTLQDVVSAAAIFVTTTGTKDIIMVHH 281

Query: 1088 MKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRL 1267
            ++K+KNN  +CNIGHF +EIDM GL+T+PGVKRITIKPQT R+VFP+T +GII+LAEGRL
Sbjct: 282  IRKIKNNGALCNIGHFHHEIDMLGLQTFPGVKRITIKPQTHRWVFPDTNSGIIVLAEGRL 341

Query: 1268 MNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXX 1447
            +NLGCATGHP FVMSCSFT+QVIAQ  LWKEK+TGKY+KKVYVLPKHL EKV        
Sbjct: 342  INLGCATGHPRFVMSCSFTHQVIAQSSLWKEKSTGKYQKKVYVLPKHLHEKVAALHLGKL 401

Query: 1448 XXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
                     +Q+ YI +PV+GPYKP HYRY
Sbjct: 402  GARLTKLRKDQSDYIRVPVQGPYKPAHYRY 431



>sp|P28183|SAHH_RHOCA Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:RCAAHCY_162417 Rhodobacter capsulatus
            adenosyl homocysteine hydrolase (ahcY) gene, complete
            cds.
          Length = 463

 Score =  520 bits (1340), Expect = e-146
 Identities = 274/473 (57%), Positives = 333/473 (70%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            +Y VKD+  A+FGR EL++AE EMPGLMACR EFGPSQP KGARI GSLHMTIQTAVLIE
Sbjct: 3    DYIVKDIKLAEFGRKELDIAETEMPGLMACREEFGPSQPLKGARIAGSLHMTIQTAVLIE 62

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG 478
            TL ALGA+VRW SCNIFSTQDH               KGETL+EYW  T++   + P G 
Sbjct: 63   TLKALGADVRWASCNIFSTQDHAAAAIAAGGTPVFAVKGETLEEYWAYTDKIFQF-PEGT 121

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKY 658
             ++I+DDGGDATL I  G + E    +   +  P+S D      +   I+  +   P  +
Sbjct: 122  CNMILDDGGDATLYILLGARVEA--GETDLIATPTSEDEV---CLFNQIKKRMVESPGWF 176

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
            T+ +  + GVSEETTTGV RLY + + G L FPAINVNDSVTKSKFDN YGC+ SL DG+
Sbjct: 177  TQQRAAIKGVSEETTTGVHRLYDLHKKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI 236

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLE 1018
             RATDVM+AGKVAVVCGYGDVGKG AA+L+ AGARV VTE+DPICALQA M+G +V+ LE
Sbjct: 237  RRATDVMMAGKVAVVCGYGDVGKGSAASLRGAGARVKVTEVDPICALQAAMDGFEVVVLE 296

Query: 1019 DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIK 1198
            DVV++ADIF+TTTGNKD+I + HM++MK+ AIV NIGHFDNEI +  L+ +   K   IK
Sbjct: 297  DVVADADIFITTTGNKDVIRIEHMREMKDMAIVGNIGHFDNEIQVAALKNH---KWTNIK 353

Query: 1199 PQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKY 1378
             Q D    P +   II+L+EGRL+NLG ATGHPSFVMS SFTNQV+AQ+ELW +    +Y
Sbjct: 354  DQVDMIEMP-SGARIILLSEGRLLNLGNATGHPSFVMSASFTNQVLAQIELWTK--GAEY 410

Query: 1379 EKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            +  VY+LPK LDEKV                P+QA YI + VEGP+K  HYRY
Sbjct: 411  QPGVYILPKSLDEKVARLHLKKIGVKLTTLRPDQAEYIGVTVEGPFKSDHYRY 463



>gb:AE008692_239920 Zymomonas mobilis subsp. mobilis ZM4, complete
            genome.
          Length = 464

 Score =  520 bits (1338), Expect = e-146
 Identities = 274/472 (58%), Positives = 329/472 (69%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            Y V+D+S A +GR E+++AE EMPGLMA R E+   +P KGARITGSLHMTIQTAVLIET
Sbjct: 6    YIVRDISLAGWGRKEIDIAEGEMPGLMALREEYAAKKPLKGARITGSLHMTIQTAVLIET 65

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L  LGAEVRW SCNIFSTQDH               KGE+L+EYW   +R  DWG G   
Sbjct: 66   LVDLGAEVRWASCNIFSTQDHAAAAIAEQNIPVFAVKGESLEEYWDYVDRIFDWGKGETA 125

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGDAT+ +  G K E         P P    N E +I    +R  + A P   T
Sbjct: 126  NMILDDGGDATMFVLWGAKLEAGVE----FPAPQ---NEEEEIFQKTVRRRVAATPGFLT 178

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
            +  + + GVSEETTTGV RLY++ + G LLFPAINVNDSVTKSKFDNLYGC+ SL D + 
Sbjct: 179  KTAKAIKGVSEETTTGVHRLYEIAKKGELLFPAINVNDSVTKSKFDNLYGCKESLVDAIR 238

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATDVM+AGKVA V G+GDVGKG AA+L+  GARV+VTE+DPICALQA MEG +V+TLE+
Sbjct: 239  RATDVMLAGKVACVAGFGDVGKGSAASLRNGGARVLVTEVDPICALQAAMEGYEVVTLEE 298

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
                ADIFVT TGN DII + HM+ MK +AIVCNIGHFD+EI ++ L     +K   IKP
Sbjct: 299  AAPRADIFVTCTGNADIITLDHMRAMKQHAIVCNIGHFDSEIQINSL---ANMKWTEIKP 355

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYE 1381
            Q D   FP+ K  II+LA+GRL+NLGCATGHPSFVMS SFTNQV+AQ+EL+   NT KY+
Sbjct: 356  QVDLVKFPDGKE-IIVLAKGRLVNLGCATGHPSFVMSASFTNQVLAQIELF--CNTDKYQ 412

Query: 1382 KKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            K VY+LPKHLDEKV                 +QA YI +PV GP+KP HYRY
Sbjct: 413  KDVYMLPKHLDEKVAALHLPKLGVHLSKLTQKQADYIGVPVNGPFKPDHYRY 464



>sp|Q8FRJ4|SAHH_COREF Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:BA000035_715552 Corynebacterium efficiens
            YS-314 DNA, complete genome.
          Length = 478

 Score =  519 bits (1337), Expect = e-146
 Identities = 269/481 (55%), Positives = 328/481 (68%), Gaps = 8/481 (1%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            ++KV D+S A+ GR ++ LAE EMPGLM  R E+   QP KGARI GS+HMT+QTAVLIE
Sbjct: 6    DFKVADLSLAEAGRHQIRLAEYEMPGLMQLRREYAEEQPLKGARIAGSIHMTVQTAVLIE 65

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXX--------XXXWKGETLQEYWWCTERA 454
            TLTALGAEVRW SCNIFSTQD                       WKGETL EYWWC  + 
Sbjct: 66   TLTALGAEVRWASCNIFSTQDEAAAAIVVGDGTPEDPQGVPVFAWKGETLDEYWWCINQI 125

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
              W  G  P++I+DDGGDAT+ +  G     EY K G VP P + D+ E+   L ++R+ 
Sbjct: 126  FSW-EGELPNMILDDGGDATMAVIRG----REYEKAGVVPQPEANDSDEYIAFLGMLREV 180

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
            L  +P K+TR+ + + GV+EETTTGV RLY   E G L FPA+NVND+VTKSKFDN YG 
Sbjct: 181  LAEEPDKWTRLADSIKGVTEETTTGVHRLYHFAEEGVLPFPAMNVNDAVTKSKFDNKYGT 240

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            RHSL DG+ RATD+++ GK  +VCGYGDVGKGCA A    GARV VTE DPI ALQALM+
Sbjct: 241  RHSLIDGINRATDMLMGGKNVLVCGYGDVGKGCAEAFDGQGARVRVTEADPINALQALMD 300

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            G  V+T+++ +++ADI +T TGNKDII    M KMK++A++ NIGHFDNEIDMH L    
Sbjct: 301  GYSVVTVDEAIADADIVITATGNKDIISYEQMLKMKDHALLGNIGHFDNEIDMHSLLHRD 360

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
             V R TIKPQ D F FP  K+ II+L+EGRL+NLG ATGHPSFVMS SF +Q IAQ+EL+
Sbjct: 361  DVIRTTIKPQVDEFTFPNGKS-IIVLSEGRLLNLGNATGHPSFVMSTSFADQTIAQIELF 419

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
              +N G+YE +VY LPK LDEKV                 EQA YI + V GP+KP HYR
Sbjct: 420  --QNEGQYENQVYRLPKILDEKVARIHVEALGGKLTELTKEQAEYIGVDVAGPFKPEHYR 477

Query: 1535 Y 1537
            Y
Sbjct: 478  Y 478



>sp|Q82WL1|SAHH_NITEU Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:BX321858_772988 Nitrosomonas europaea
            ATCC 19718, complete genome; segment 3/10.
          Length = 478

 Score =  514 bits (1324), Expect = e-144
 Identities = 270/473 (57%), Positives = 330/473 (69%), Gaps = 2/473 (0%)
 Frame = +2

Query: 125  KVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETL 304
            KV D+S AD+GR E+ +AE EMPGLMA R ++   +P  GARI GSLHMTIQTAVLIETL
Sbjct: 18   KVADLSLADWGRKEIAIAETEMPGLMALREQYADKKPLAGARIAGSLHMTIQTAVLIETL 77

Query: 305  TALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG-- 478
             ALGAEVRW SCNIFSTQDH              +KGE+L+EYW    +  +W   G   
Sbjct: 78   VALGAEVRWASCNIFSTQDHAAAAIAARNIPVFAYKGESLEEYWDYAHQIFEWASDGSHT 137

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKY 658
             ++I+DDGGDATLL+  G KAE + +    + +P+   N E Q++   IR  L + P  Y
Sbjct: 138  ANMILDDGGDATLLLILGSKAERDPS---VIANPT---NEEEQVLFASIRSRLASHPGWY 191

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
            +R    + GV+EETTTGV RLY+M++ G L FPAINVNDSVTKSKFDNLYGCR SL DG+
Sbjct: 192  SRNLAAIRGVTEETTTGVHRLYEMEKKGELPFPAINVNDSVTKSKFDNLYGCRESLVDGI 251

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLE 1018
             RATDVMIAGK+AVVCGYGDVGKGCA +L+  GA V +TEIDPICALQA MEG +V+T++
Sbjct: 252  KRATDVMIAGKIAVVCGYGDVGKGCAQSLRGLGATVWITEIDPICALQAAMEGYRVVTMD 311

Query: 1019 DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIK 1198
            D   +ADIFVT TGN  +I   HM KMK+ +I+CNIGHFD+EID+  ++ Y   +   IK
Sbjct: 312  DACDKADIFVTATGNLRVITHDHMLKMKDQSIICNIGHFDSEIDIASVQKY---QWENIK 368

Query: 1199 PQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKY 1378
            PQ D  +FP T   II+LA+GRL+NLGCATGHPSFVMS SFTNQV+AQ+ELW  +N   Y
Sbjct: 369  PQVDHVIFP-TGRRIIVLAQGRLVNLGCATGHPSFVMSSSFTNQVLAQIELW--QNGKDY 425

Query: 1379 EKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            +KKVYVLPK LDE V                 EQA Y+++   GPYKP  YRY
Sbjct: 426  QKKVYVLPKRLDEMVARLHLGKLGVKLTELTDEQAHYLNLDKNGPYKPEMYRY 478



>pir|A46035|A46035 adenosylhomocysteinase (EC 3.3.1.1) - Rhodobacter
            capsulatus
          Length = 462

 Score =  513 bits (1322), Expect = e-144
 Identities = 273/473 (57%), Positives = 332/473 (70%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            +Y VKD+  A+FGR EL++AE EMPGLMACR EFGPSQP KGARI GSLHMTIQTAVLIE
Sbjct: 3    DYIVKDIKLAEFGRKELDIAETEMPGLMACREEFGPSQPLKGARIAGSLHMTIQTAVLIE 62

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG 478
            TL ALGA+VRW SCNIFSTQDH               KGETL+EYW  T++   + P G 
Sbjct: 63   TLKALGADVRWASCNIFSTQDHAAAAIAAGGTPVFAVKGETLEEYWAYTDKIFQF-PEGT 121

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKY 658
             ++I+DDGGDATL I  G + E    +   +  P+S D      +   I+  +   P  +
Sbjct: 122  CNMILDDGGDATLYILLGARVEA--GETDLIATPTSEDEV---CLFNQIKKRMVESPGWF 176

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
            T+ +  + GVSEETTTGV RLY + + G L FPAINVNDSVTKSKFDN YGC+ SL DG+
Sbjct: 177  TQQRAAIKGVSEETTTGVHRLYDLHKKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI 236

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLE 1018
             RATDVM+AGKVAVVCGYGDVGKG AA+L+ AGARV VTE+DPICALQA M+G +V+ LE
Sbjct: 237  RRATDVMMAGKVAVVCGYGDVGKGSAASLRGAGARVKVTEVDPICALQAAMDGFEVVVLE 296

Query: 1019 DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIK 1198
            DVV++A IF+TTTGNKD+I + HM++MK+ AIV NIGHFDNEI +  L+ +   K   IK
Sbjct: 297  DVVADA-IFITTTGNKDVIRIEHMREMKDMAIVGNIGHFDNEIQVAALKNH---KWTNIK 352

Query: 1199 PQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKY 1378
             Q D    P +   II+L+EGRL+NLG ATGHPSFVMS SFTNQV+AQ+ELW +    +Y
Sbjct: 353  DQVDMIEMP-SGARIILLSEGRLLNLGNATGHPSFVMSASFTNQVLAQIELWTK--GAEY 409

Query: 1379 EKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            +  VY+LPK LDEKV                P+QA YI + VEGP+K  HYRY
Sbjct: 410  QPGVYILPKSLDEKVARLHLKKIGVKLTTLRPDQAEYIGVTVEGPFKSDHYRY 462



>sp|Q9ZNA5|SAHH_ROSDE Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:AB020211_3549 Roseobacter denitrificans
            gene for S-adenosyl L-homocystein hydrolase and 4 ORFs,
            complete cds.
          Length = 462

 Score =  512 bits (1319), Expect = e-144
 Identities = 269/474 (56%), Positives = 336/474 (70%)
 Frame = +2

Query: 116  REYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLI 295
            +++ VKD++ A+FGR EL++AE EMPGLMA RAE+G S+P  GARI GSLHMTIQTAVLI
Sbjct: 3    KDFIVKDIALAEFGRKELDIAETEMPGLMALRAEYGDSKPLAGARIVGSLHMTIQTAVLI 62

Query: 296  ETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGG 475
            ETL ALGA+VRW SCNIFSTQDH               KG++L+E+W   +R+  +  G 
Sbjct: 63   ETLVALGADVRWASCNIFSTQDHAAAAIAAGGTPVFAIKGQSLEEHWDYLDRSFMFEDG- 121

Query: 476  GPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKK 655
             P+LI+DDGGDATL +  G +AE   A    +P P+S +    + +   I+  + A P  
Sbjct: 122  -PNLILDDGGDATLYVLLGARAE---AGEEIIPVPTSEEE---EAIKAQIKKRMAASPGW 174

Query: 656  YTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDG 835
            +T++++++ GVSEETTTGV RLY + + G L FPAINVNDSVTKSKFDN YGC+ SL DG
Sbjct: 175  FTKVRDQIKGVSEETTTGVHRLYDLVKQGQLPFPAINVNDSVTKSKFDNKYGCKESLVDG 234

Query: 836  LMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTL 1015
            + RATD M+AGKVAVV GYGDVGKG AA+L+ AGARV VTE+DPICALQA M+G +V+ L
Sbjct: 235  IRRATDTMMAGKVAVVMGYGDVGKGSAASLRGAGARVKVTEVDPICALQAAMDGFEVVLL 294

Query: 1016 EDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITI 1195
            EDVV  ADIF+TTTGNKD+I + HM+ MK+ AIV NIGHFDNEI +  L+ +   K   I
Sbjct: 295  EDVVGSADIFITTTGNKDVIRIEHMRAMKDMAIVGNIGHFDNEIQVAALKNH---KWTNI 351

Query: 1196 KPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGK 1375
            K Q D    P     +I+L+EGRL+NLG ATGHPSFVMS SFTNQV+AQ+ELW   +   
Sbjct: 352  KEQVDMIEMPNGNR-LILLSEGRLLNLGNATGHPSFVMSASFTNQVLAQIELWTRADA-- 408

Query: 1376 YEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            Y+ +VY+LPKHLDEKV                PEQAAYI +  EGP+KP HYRY
Sbjct: 409  YDNEVYILPKHLDEKVARLHLDRIGVKLTPLDPEQAAYIGVKPEGPFKPEHYRY 462



>sp|Q7V9P3|SAHH_PROMA Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:AE017166_396241 Prochlorococcus marinus
            subsp. marinus str. CCMP1375 section 6 of 6 of the
            complete genome.>gb:AE017126_1031910 Prochlorococcus
            marinus subsp. marinus str. CCMP1375 complete genome.
          Length = 476

 Score =  512 bits (1318), Expect = e-143
 Identities = 271/473 (57%), Positives = 333/473 (70%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            ++ V D++ ADFGR EL +AE EMPGLM+ R ++G  +P +GARI GSLHMTIQT VLIE
Sbjct: 16   DFVVADITLADFGRKELAIAEKEMPGLMSLRDKYGQEKPLQGARIAGSLHMTIQTGVLIE 75

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG 478
            TL ALGA+VRW SCNIFSTQDH               KGETL EYW  T   L+W    G
Sbjct: 76   TLVALGAQVRWASCNIFSTQDHAAAAIAKAGVPVFAKKGETLSEYWSFTHSILEWSGEQG 135

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKY 658
            P++I+DDGGDAT L+  G KAE++ +    + +PS   N E   +   I+  L  D   Y
Sbjct: 136  PNMILDDGGDATGLVILGSKAEKDIS---VLDNPS---NEEEIALYASIKSKLSTDKSFY 189

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
            +R+K+ ++GV+EETTTGV RLYQMQ++G L FPAINVNDSVTKSKFDNLYGCR SL DG+
Sbjct: 190  SRIKKIILGVTEETTTGVARLYQMQKNGELPFPAINVNDSVTKSKFDNLYGCRESLVDGI 249

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLE 1018
             RATDVM+AGKVA+V GYGDVGKG A +L+  GA V++ EIDPICALQA MEG +V+ L+
Sbjct: 250  KRATDVMVAGKVALVIGYGDVGKGSAQSLRGLGATVMIAEIDPICALQAAMEGYRVVRLD 309

Query: 1019 DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIK 1198
            DVV E DIFVT TGN  +I   H+ +MK+ AIV NIGHFDNEID+  L++Y   +   IK
Sbjct: 310  DVVEEIDIFVTATGNFQVICHDHLIRMKDEAIVSNIGHFDNEIDVASLKSY---QWENIK 366

Query: 1199 PQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKY 1378
            PQ D    P +   II+LAEGRL+NLGCATGHPSFVMS SFTNQV+AQ+EL+K+ ++  Y
Sbjct: 367  PQVDHITLP-SGNKIILLAEGRLVNLGCATGHPSFVMSNSFTNQVLAQIELFKKGDS--Y 423

Query: 1379 EKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            +  VYVLPKHLDE V                 EQA YI++P+EGPYK   YRY
Sbjct: 424  QNNVYVLPKHLDEMVARLHLDKIGANLTELSKEQADYINVPIEGPYKSEQYRY 476



>gb:AX397890_1467047 Sequence 1 from Patent WO0220806.
          Length = 498

 Score =  509 bits (1310), Expect = e-142
 Identities = 266/481 (55%), Positives = 325/481 (67%), Gaps = 8/481 (1%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            ++KV D+S A+ GR ++ LAE EMPGLM  R EF   QP KGARI GS+HMT+QTAVLIE
Sbjct: 26   DFKVADLSLAEAGRHQIRLAEYEMPGLMQLRKEFADEQPLKGARIAGSIHMTVQTAVLIE 85

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXX--------XWKGETLQEYWWCTERA 454
            TLTALGAEVRW SCNIFSTQD                       WKGE+L+EYWWC  + 
Sbjct: 86   TLTALGAEVRWASCNIFSTQDEAAAAIVVGSGTVEEPAGVPVFAWKGESLEEYWWCINQI 145

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
              WG    P++I+DDGGDAT+ +  G     EY + G VP   + D+ E+   L ++R+ 
Sbjct: 146  FSWGDEL-PNMILDDGGDATMAVIRG----REYEQAGLVPPAEANDSDEYIAFLGMLREV 200

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
            L A+P K+ ++ E + GV+EETTTGV RLY   E G L FPA+NVND+VTKSKFDN YG 
Sbjct: 201  LAAEPGKWGKIAEAVKGVTEETTTGVHRLYHFAEEGVLPFPAMNVNDAVTKSKFDNKYGT 260

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            RHSL DG+ RATD+++ GK  +VCGYGDVGKGCA A    GARV VTE DPI ALQALM+
Sbjct: 261  RHSLIDGINRATDMLMGGKNVLVCGYGDVGKGCAEAFDGQGARVKVTEADPINALQALMD 320

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            G  V+T+++ + +ADI +T TGNKDII    M KMK++A++ NIGHFDNEIDMH L    
Sbjct: 321  GYSVVTVDEAIEDADIVITATGNKDIISFEQMLKMKDHALLGNIGHFDNEIDMHSLLHRD 380

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
             V R TIKPQ D F F  T   II+L+EGRL+NLG ATGHPSFVMS SF +Q IAQ+EL+
Sbjct: 381  DVTRTTIKPQVDEFTF-STGRSIIVLSEGRLLNLGNATGHPSFVMSNSFADQTIAQIELF 439

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
              +N G+YE +VY LPK LDEKV                 EQA YI + V GP+KP HYR
Sbjct: 440  --QNEGQYENEVYRLPKVLDEKVARIHVEALGGQLTELTKEQAEYIGVDVAGPFKPEHYR 497

Query: 1535 Y 1537
            Y
Sbjct: 498  Y 498



>gb:BX927150_832335 Corynebacterium glutamicum ATCC 13032, IS
            fingerprint type 4-5, complete genome; segment
            3/10.>gb:AX063937_1458882 Sequence 219 from Patent
            WO0100843.>gb:AX244105_1464643 Sequence 97 from Patent
            WO0166573.
          Length = 478

 Score =  509 bits (1310), Expect = e-142
 Identities = 266/481 (55%), Positives = 325/481 (67%), Gaps = 8/481 (1%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            ++KV D+S A+ GR ++ LAE EMPGLM  R EF   QP KGARI GS+HMT+QTAVLIE
Sbjct: 6    DFKVADLSLAEAGRHQIRLAEYEMPGLMQLRKEFADEQPLKGARIAGSIHMTVQTAVLIE 65

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXX--------XWKGETLQEYWWCTERA 454
            TLTALGAEVRW SCNIFSTQD                       WKGE+L+EYWWC  + 
Sbjct: 66   TLTALGAEVRWASCNIFSTQDEAAAAIVVGSGTVEEPAGVPVFAWKGESLEEYWWCINQI 125

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
              WG    P++I+DDGGDAT+ +  G     EY + G VP   + D+ E+   L ++R+ 
Sbjct: 126  FSWGDEL-PNMILDDGGDATMAVIRG----REYEQAGLVPPAEANDSDEYIAFLGMLREV 180

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
            L A+P K+ ++ E + GV+EETTTGV RLY   E G L FPA+NVND+VTKSKFDN YG 
Sbjct: 181  LAAEPGKWGKIAEAVKGVTEETTTGVHRLYHFAEEGVLPFPAMNVNDAVTKSKFDNKYGT 240

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            RHSL DG+ RATD+++ GK  +VCGYGDVGKGCA A    GARV VTE DPI ALQALM+
Sbjct: 241  RHSLIDGINRATDMLMGGKNVLVCGYGDVGKGCAEAFDGQGARVKVTEADPINALQALMD 300

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            G  V+T+++ + +ADI +T TGNKDII    M KMK++A++ NIGHFDNEIDMH L    
Sbjct: 301  GYSVVTVDEAIEDADIVITATGNKDIISFEQMLKMKDHALLGNIGHFDNEIDMHSLLHRD 360

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
             V R TIKPQ D F F  T   II+L+EGRL+NLG ATGHPSFVMS SF +Q IAQ+EL+
Sbjct: 361  DVTRTTIKPQVDEFTF-STGRSIIVLSEGRLLNLGNATGHPSFVMSNSFADQTIAQIELF 419

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
              +N G+YE +VY LPK LDEKV                 EQA YI + V GP+KP HYR
Sbjct: 420  --QNEGQYENEVYRLPKVLDEKVARIHVEALGGQLTELTKEQAEYIGVDVAGPFKPEHYR 477

Query: 1535 Y 1537
            Y
Sbjct: 478  Y 478



>sp|Q8NSC4|SAHH_CORGL Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:BA000036_718479 Corynebacterium
            glutamicum ATCC 13032 DNA, complete genome.
          Length = 474

 Score =  509 bits (1310), Expect = e-142
 Identities = 266/481 (55%), Positives = 325/481 (67%), Gaps = 8/481 (1%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            ++KV D+S A+ GR ++ LAE EMPGLM  R EF   QP KGARI GS+HMT+QTAVLIE
Sbjct: 2    DFKVADLSLAEAGRHQIRLAEYEMPGLMQLRKEFADEQPLKGARIAGSIHMTVQTAVLIE 61

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXX--------XWKGETLQEYWWCTERA 454
            TLTALGAEVRW SCNIFSTQD                       WKGE+L+EYWWC  + 
Sbjct: 62   TLTALGAEVRWASCNIFSTQDEAAAAIVVGSGTVEEPAGVPVFAWKGESLEEYWWCINQI 121

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
              WG    P++I+DDGGDAT+ +  G     EY + G VP   + D+ E+   L ++R+ 
Sbjct: 122  FSWGDEL-PNMILDDGGDATMAVIRG----REYEQAGLVPPAEANDSDEYIAFLGMLREV 176

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
            L A+P K+ ++ E + GV+EETTTGV RLY   E G L FPA+NVND+VTKSKFDN YG 
Sbjct: 177  LAAEPGKWGKIAEAVKGVTEETTTGVHRLYHFAEEGVLPFPAMNVNDAVTKSKFDNKYGT 236

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            RHSL DG+ RATD+++ GK  +VCGYGDVGKGCA A    GARV VTE DPI ALQALM+
Sbjct: 237  RHSLIDGINRATDMLMGGKNVLVCGYGDVGKGCAEAFDGQGARVKVTEADPINALQALMD 296

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            G  V+T+++ + +ADI +T TGNKDII    M KMK++A++ NIGHFDNEIDMH L    
Sbjct: 297  GYSVVTVDEAIEDADIVITATGNKDIISFEQMLKMKDHALLGNIGHFDNEIDMHSLLHRD 356

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
             V R TIKPQ D F F  T   II+L+EGRL+NLG ATGHPSFVMS SF +Q IAQ+EL+
Sbjct: 357  DVTRTTIKPQVDEFTF-STGRSIIVLSEGRLLNLGNATGHPSFVMSNSFADQTIAQIELF 415

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
              +N G+YE +VY LPK LDEKV                 EQA YI + V GP+KP HYR
Sbjct: 416  --QNEGQYENEVYRLPKVLDEKVARIHVEALGGQLTELTKEQAEYIGVDVAGPFKPEHYR 473

Query: 1535 Y 1537
            Y
Sbjct: 474  Y 474



>gb:BX897699_826667 Bartonella henselae strain Houston-1, complete
            genome.
          Length = 465

 Score =  508 bits (1309), Expect = e-142
 Identities = 268/476 (56%), Positives = 327/476 (68%)
 Frame = +2

Query: 110  SGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAV 289
            + ++Y VKD++ A +GR EL++AE EMPGLMACR EF  SQP +GARI+GSLHMTIQTAV
Sbjct: 2    TAQDYVVKDIALAAYGRKELDIAETEMPGLMACREEFSSSQPLRGARISGSLHMTIQTAV 61

Query: 290  LIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGP 469
            LIETL A+GA VRW S NIFSTQDH               KGETL+EYW   +    W  
Sbjct: 62   LIETLKAIGANVRWSSSNIFSTQDHAAAAIAATGTPVFAVKGETLEEYWTYIDAIFQWPD 121

Query: 470  GGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADP 649
            G   +LI+DDG DAT  I  G +AE     N  +     T+  E  +    I+  ++A P
Sbjct: 122  GNPSNLILDDGADATNYILMGSRAET----NKDILSHPKTEEEE--LFFKQIQRRMEATP 175

Query: 650  KKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLP 829
              +TR +  + G+SEETTTGV RL+Q+Q+ G L FPAIN+NDSVTKSKFDN YGCR SL 
Sbjct: 176  GFFTRQRAAIKGISEETTTGVHRLHQLQKEGLLPFPAININDSVTKSKFDNKYGCRESLV 235

Query: 830  DGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVL 1009
            DG+ RATDVMIAGK A+VCGYGDVGKG AA+L  AGARV VTEIDPICALQA M+G +V+
Sbjct: 236  DGIRRATDVMIAGKTAIVCGYGDVGKGSAASLSGAGARVKVTEIDPICALQAAMDGYEVV 295

Query: 1010 TLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRI 1189
             L+D  S ADI +TTTGNKDI+ + HM+K+K+  I+ NIGHFDNEI +  L+  P     
Sbjct: 296  NLDDAASSADIIITTTGNKDIVRLDHMRKVKDMCILGNIGHFDNEIQVAALQNLPWT--- 352

Query: 1190 TIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNT 1369
             IKPQ D   FP+ K  II+L+EGRL+NLG ATGHPSFVMS SFTNQV+AQ+EL+    +
Sbjct: 353  NIKPQVDMITFPDGKR-IILLSEGRLLNLGNATGHPSFVMSASFTNQVLAQIELF--TRS 409

Query: 1370 GKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            G Y+ +V VLPK+LDEKV                 EQAAYI +  +GPYKP HYRY
Sbjct: 410  GHYKNEVTVLPKYLDEKVARLHLDQLGIKLTTLSQEQAAYIGVTPQGPYKPDHYRY 465



>sp|O50562|SAHH_RHOSH Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:RSU76671_168375 Rhodobacter sphaeroides
            photosynthetic regulatory protein (spb) gene and
            S-adenosyl L-homocystein hydrolase gene, complete cds.
          Length = 463

 Score =  508 bits (1309), Expect = e-142
 Identities = 269/473 (56%), Positives = 330/473 (69%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            ++ VKD+S ADFGR EL++AE EMPGLMA R EFG S+P KGARI GSLHMT+QTAVLIE
Sbjct: 3    DFIVKDLSLADFGRKELDIAETEMPGLMALREEFGASKPLKGARIAGSLHMTVQTAVLIE 62

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG 478
            TL ALGA+VRW SCNIFSTQDH               KGETL++YW  T++   +  G  
Sbjct: 63   TLVALGADVRWASCNIFSTQDHAAAAIAASGVPVFAIKGETLEDYWAYTDKIFQFADGTC 122

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKY 658
             ++I+DDGGDATL I  G + E    +   +  P S +      +   IR  +   P  +
Sbjct: 123  -NMILDDGGDATLYILLGARVEA--GETDLIAVPQSDEEV---CLFNQIRKRMAETPGWF 176

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
            T+ ++ + GVSEETTTGV RLY + + G L FPAINVNDSVTKSKFDN YGC+ SL DG+
Sbjct: 177  TKQRDAIKGVSEETTTGVHRLYDLHKKGLLPFPAINVNDSVTKSKFDNKYGCKESLVDGI 236

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLE 1018
             RATDVM+AGKVAVVCGYGDVGKG AA+L+ AGARV VTE+DPICALQA M+G +V+ LE
Sbjct: 237  RRATDVMMAGKVAVVCGYGDVGKGSAASLRGAGARVKVTEVDPICALQAAMDGFEVVVLE 296

Query: 1019 DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIK 1198
            DVV +ADIF+TTTGN+D+I + HM++MK+ AIV NIGHFDNEI +  L+ +   K   IK
Sbjct: 297  DVVQDADIFITTTGNRDVIRIEHMREMKDMAIVGNIGHFDNEIQVAALKNH---KWTNIK 353

Query: 1199 PQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKY 1378
             Q D    P + + II+L+EGRL+NLG ATGHPSFVMS SFTNQV+AQ+ELW +     Y
Sbjct: 354  DQVDMIEMP-SGSRIILLSEGRLLNLGNATGHPSFVMSASFTNQVLAQIELWTK--GADY 410

Query: 1379 EKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            +  VY+LPK LDEKV                PEQA YI + VEGP+K  HYRY
Sbjct: 411  QPGVYILPKALDEKVARLHLKKIGVKLTDVRPEQADYIGVKVEGPFKAEHYRY 463



>gb:BX571965_793091 Burkholderia pseudomallei strain K96243,
            chromosome 1, complete sequence.>gb:CP000010_866967
            Burkholderia mallei ATCC 23344 chromosome 1, complete
            sequence.
          Length = 473

 Score =  507 bits (1306), Expect = e-142
 Identities = 269/476 (56%), Positives = 324/476 (68%)
 Frame = +2

Query: 110  SGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAV 289
            S ++Y V D++ A +GR EL +AE EMPGL+  R E+   QP KGARI GSLHMTIQT V
Sbjct: 10   SAQDYVVADIALAGWGRKELNIAETEMPGLVQIRDEYKAQQPLKGARIAGSLHMTIQTGV 69

Query: 290  LIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGP 469
            LIETL ALGA+VRW SCNIFSTQDH              +KGE+L EYW  + R  +W  
Sbjct: 70   LIETLKALGADVRWASCNIFSTQDHAAAAIVEAGTPVFAFKGESLDEYWEFSHRIFEWPN 129

Query: 470  GGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADP 649
            G   ++I+DDGGDATLL+  G KAE++      +  P+   N E   +   I   L+ D 
Sbjct: 130  GEFANMILDDGGDATLLLILGSKAEKD---RSVIARPT---NEEEVALFKSIERHLEIDG 183

Query: 650  KKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLP 829
              Y++    + GV+EETTTGV RLYQM++ G L FPA NVNDSVTKSKFDNLYGCR SL 
Sbjct: 184  SWYSKRLAHIKGVTEETTTGVHRLYQMEKDGRLPFPAFNVNDSVTKSKFDNLYGCRESLV 243

Query: 830  DGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVL 1009
            DG+ RATDVMIAGK+AVV GYGDVGKGCA +L+  GA V VTEIDPICALQA MEG +V+
Sbjct: 244  DGIKRATDVMIAGKIAVVAGYGDVGKGCAQSLRGLGATVWVTEIDPICALQAAMEGYRVV 303

Query: 1010 TLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRI 1189
            T+E    +ADIFVT TGN  +I   HMK M++NAIVCNIGHFD+EID+     Y   +  
Sbjct: 304  TMEYAADKADIFVTATGNYHVINHDHMKAMRHNAIVCNIGHFDSEIDVASTRQY---QWE 360

Query: 1190 TIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNT 1369
             IKPQ D  +FP+ K  +I+LAEGRL+NLGCATGHPSFVMS SFTNQ +AQ+EL+     
Sbjct: 361  NIKPQVDHIIFPDGKR-VILLAEGRLVNLGCATGHPSFVMSNSFTNQTLAQIELF--TRG 417

Query: 1370 GKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            G+Y  KVYVLPKHLDEKV                 +QAAYI +   GP+KP HYRY
Sbjct: 418  GEYANKVYVLPKHLDEKVARLHLARIGAQLSELSDDQAAYIGVSKAGPFKPDHYRY 473



>gb:CR628336_112119 Legionella pneumophila str. Paris complete genome.
          Length = 441

 Score =  507 bits (1306), Expect = e-142
 Identities = 265/481 (55%), Positives = 321/481 (66%)
 Frame = +2

Query: 95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            V+K ++ ++YKV D+S AD+GR E+ +AE EMPGLMA R EF   +P +GARI G LHMT
Sbjct: 8    VQKINTLQDYKVADISLADWGRKEIAIAETEMPGLMALREEFSARKPLQGARIAGCLHMT 67

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
            IQTAVLIETL ALGAEVRW SCNIFSTQDH              WKGET +EYWWC E+ 
Sbjct: 68   IQTAVLIETLVALGAEVRWSSCNIFSTQDHAASAIAAKGIPVFAWKGETEEEYWWCVEQT 127

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            L    G  P+L++DDGGD T ++H+                                   
Sbjct: 128  LSGPNGWTPNLLLDDGGDLTQVVHQ----------------------------------- 152

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
                  K+ ++   + GVSEETTTGV RLY+M + G L  PAINVN++VTKSKFDNLYGC
Sbjct: 153  ------KHPKLLTAIKGVSEETTTGVARLYEMAKHGQLKIPAINVNNAVTKSKFDNLYGC 206

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            R SL DGL RATDVMIAGKVA++ GYGDVGKGCA AL+  GA V+V EIDPICALQA ME
Sbjct: 207  RESLLDGLKRATDVMIAGKVALILGYGDVGKGCAQALRGQGATVLVAEIDPICALQAAME 266

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            G +V+TL+DV  + DI VT TGN  ++   HMK+M+N AI+CNIGHFD+EID+  L+ Y 
Sbjct: 267  GYRVVTLDDVAEQVDIVVTATGNYHVVTHDHMKRMRNQAILCNIGHFDSEIDIQSLKQY- 325

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
              +   IKPQ D  +FP+ K  IIILAEGRL+NLGCATGHPSFVMS SFTNQV+AQ+EL+
Sbjct: 326  --QWENIKPQVDHVIFPDGKR-IIILAEGRLVNLGCATGHPSFVMSASFTNQVLAQIELF 382

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
              +N+ +Y+ +VYVLPK LDEKV                 EQA YI +   GPYKP HYR
Sbjct: 383  --QNSSQYQNQVYVLPKVLDEKVARLHLGRIGAKLTQLSNEQADYIGVDKNGPYKPDHYR 440

Query: 1535 Y 1537
            Y
Sbjct: 441  Y 441



>gb:AY593479_630666 Collimonas fungivorans fosmid CFUFOS19, complete
            sequence.
          Length = 480

 Score =  507 bits (1305), Expect = e-142
 Identities = 266/478 (55%), Positives = 325/478 (67%)
 Frame = +2

Query: 104  TSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQT 283
            TS+  +Y V D+S + +G  E+++AE EMPGLMA R EF  +QP KGARITGS+HMTIQT
Sbjct: 15   TSTSHDYVVADISLSAWGDKEIKIAETEMPGLMAIREEFAAAQPLKGARITGSIHMTIQT 74

Query: 284  AVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDW 463
            AVLI+TL ALGA+VRW SCNI+STQDH              +KGE+L +YW  T R  +W
Sbjct: 75   AVLIQTLEALGAKVRWASCNIYSTQDHAAAAIAAAGTPVFAFKGESLDDYWDFTHRIFEW 134

Query: 464  GPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKA 643
                  ++I+DDGGDATLL+H G +AE++ +    + +P S +      +   I+  L  
Sbjct: 135  PGEQQANMILDDGGDATLLLHLGTRAEKDIS---VLNNPGSEEEI---CLFNAIKKKLAT 188

Query: 644  DPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHS 823
             P  Y+    ++ GV+EETTTGV RLYQM + G L FPAINVNDSVTKSKFDNLYGCR S
Sbjct: 189  APNWYSTRLAQIKGVTEETTTGVHRLYQMHKEGKLAFPAINVNDSVTKSKFDNLYGCRES 248

Query: 824  LPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQ 1003
            L DG+ RATDVMIAGKVAV+ GYGDVGKG A A++   A+V VTE+DPICALQA MEG +
Sbjct: 249  LVDGIKRATDVMIAGKVAVIAGYGDVGKGSAQAMRALSAQVWVTEVDPICALQAAMEGYR 308

Query: 1004 VLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVK 1183
            V+T+E      DIFVT TGN  +I  +HM+KMK+ AIVCNIGHFDNEI++  L+ Y    
Sbjct: 309  VVTMEYAAEHGDIFVTCTGNYHVITHAHMQKMKDQAIVCNIGHFDNEIEVAALKQYTWE- 367

Query: 1184 RITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK 1363
               IKPQ D  +FP+ K  II+LAEGRL+NLGC TGHPS+VMS SF NQ IAQ+EL+   
Sbjct: 368  --NIKPQVDHIIFPDGKR-IILLAEGRLVNLGCGTGHPSYVMSSSFANQTIAQIELF--V 422

Query: 1364 NTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            NT  Y   VY LPKHLDEKV                 EQAAYI +   GPYKP HYRY
Sbjct: 423  NTKAYPVGVYTLPKHLDEKVARLQLKKLNAQLSVLTEEQAAYIGVKQTGPYKPEHYRY 480



>gb:CR628337_115202 Legionella pneumophila str. Lens complete genome.
          Length = 441

 Score =  506 bits (1304), Expect = e-142
 Identities = 264/481 (54%), Positives = 321/481 (66%)
 Frame = +2

Query: 95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            V+K ++ ++YKV D+S AD+GR E+ +AE EMPGLMA R EF   +P +GARI G LHMT
Sbjct: 8    VQKINTLQDYKVADISLADWGRKEIAIAETEMPGLMALREEFSAKKPLQGARIAGCLHMT 67

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
            IQTAVLIETL ALGAEVRW SCNIFSTQDH              WKGET +EYWWC E+ 
Sbjct: 68   IQTAVLIETLVALGAEVRWSSCNIFSTQDHAASAIAAKGIPVFAWKGETEEEYWWCVEQT 127

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            L    G  P+L++DDGGD T ++H+                                   
Sbjct: 128  LSGPNGWTPNLLLDDGGDLTQIVHQ----------------------------------- 152

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
                  K+ ++   + GVSEETTTGV RLY++ + G L  PAINVN++VTKSKFDNLYGC
Sbjct: 153  ------KHPKLLTAIKGVSEETTTGVARLYEIAKHGQLKIPAINVNNAVTKSKFDNLYGC 206

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            R SL DGL RATDVMIAGKVA++ GYGDVGKGCA AL+  GA V+V EIDPICALQA ME
Sbjct: 207  RESLLDGLKRATDVMIAGKVALILGYGDVGKGCAQALRGQGATVLVAEIDPICALQAAME 266

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            G +V+TL+DV  + DI VT TGN  ++   HMK+M+N AI+CNIGHFD+EID+  L+ Y 
Sbjct: 267  GYRVVTLDDVAEQVDIVVTATGNYHVVTHDHMKRMRNQAILCNIGHFDSEIDIQSLKQY- 325

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
              +   IKPQ D  +FP+ K  IIILAEGRL+NLGCATGHPSFVMS SFTNQV+AQ+EL+
Sbjct: 326  --QWENIKPQVDHVIFPDGKR-IIILAEGRLVNLGCATGHPSFVMSASFTNQVLAQIELF 382

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
              +N+ +Y+ +VYVLPK LDEKV                 EQA YI +   GPYKP HYR
Sbjct: 383  --QNSSQYQNQVYVLPKVLDEKVARLHLGRIGAKLTQLSNEQADYIGVDKNGPYKPDHYR 440

Query: 1535 Y 1537
            Y
Sbjct: 441  Y 441



>gb:AE017354_460376 Legionella pneumophila subsp. pneumophila str.
            Philadelphia 1, complete genome.
          Length = 441

 Score =  506 bits (1303), Expect = e-142
 Identities = 264/481 (54%), Positives = 321/481 (66%)
 Frame = +2

Query: 95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            V+K ++ ++YKV ++S AD+GR E+ +AE EMPGLMA R EF   +P +GARI G LHMT
Sbjct: 8    VQKINTLQDYKVAEISLADWGRKEIAIAETEMPGLMALREEFSAKKPLQGARIAGCLHMT 67

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
            IQTAVLIETL ALGAEVRW SCNIFSTQDH              WKGET +EYWWC E+ 
Sbjct: 68   IQTAVLIETLVALGAEVRWSSCNIFSTQDHAASAIAAKGIPVFAWKGETEEEYWWCVEQT 127

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            L    G  P+L++DDGGD T ++H+                                   
Sbjct: 128  LSGPNGWTPNLLLDDGGDLTQVVHQ----------------------------------- 152

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
                  K+ ++   + GVSEETTTGV RLY+M + G L  PAINVN++VTKSKFDNLYGC
Sbjct: 153  ------KHPKLLTAIKGVSEETTTGVARLYEMAKHGQLKIPAINVNNAVTKSKFDNLYGC 206

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            R SL DGL RATDVMIAGKVA++ GYGDVGKGCA AL+  GA V+V EIDPICALQA ME
Sbjct: 207  RESLLDGLKRATDVMIAGKVALILGYGDVGKGCAQALRGQGATVLVAEIDPICALQAAME 266

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            G +V+TL+DV  + DI VT TGN  ++   HMK+M+N AI+CNIGHFD+EID+  L+ Y 
Sbjct: 267  GYRVVTLDDVAEQVDIVVTATGNYHVVTHDHMKRMRNQAILCNIGHFDSEIDIQSLKQY- 325

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
              +   IKPQ D  +FP+ K  IIILAEGRL+NLGCATGHPSFVMS SFTNQV+AQ+EL+
Sbjct: 326  --QWENIKPQVDHVIFPDGKR-IIILAEGRLVNLGCATGHPSFVMSASFTNQVLAQIELF 382

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
              +N+ +Y+ +VYVLPK LDEKV                 EQA YI +   GPYKP HYR
Sbjct: 383  --QNSSQYQNQVYVLPKVLDEKVARLHLGRIGAKLTQLSNEQADYIGVDKNGPYKPDHYR 440

Query: 1535 Y 1537
            Y
Sbjct: 441  Y 441



>gb:AY161083_1305326 Cryptosporidium parvum adenosylhomocysteinase
            gene, complete cds.
          Length = 493

 Score =  506 bits (1302), Expect = e-142
 Identities = 263/495 (53%), Positives = 330/495 (66%), Gaps = 22/495 (4%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            E ++KD+S A+FG  ++E+A+ +M GL+  + ++  S+P KGARITGSLH+TI+T+VL+E
Sbjct: 2    ESRIKDISLAEFGLQDMEIAKTDMMGLVELQRKYRDSKPLKGARITGSLHLTIETSVLVE 61

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXX-XWKGETLQEYWWCTERALDW-GPG 472
            TL  LGAE+RWCSCNI+STQDH               WK ET+++YW C   A+ W  P 
Sbjct: 62   TLYELGAEIRWCSCNIYSTQDHAAAALVKKNIATVFAWKNETIEDYWVCLNDAMTWRNPN 121

Query: 473  G-----GPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTD--------NAEFQIV 613
                  GP+LIVDDGGDATL++HEGVKAE EY K   +P+   T+        + + + +
Sbjct: 122  DKDKICGPNLIVDDGGDATLILHEGVKAEIEYEKYNKIPEYLETELDENGKQLSMDLKCM 181

Query: 614  LTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSK 793
              +++  L  +P ++  M + L GVSEETTTGV RL  M+  G LL PAINVNDSVTKSK
Sbjct: 182  YKVLKMELLKNPFRWRGMLKDLYGVSEETTTGVLRLKIMESEGKLLLPAINVNDSVTKSK 241

Query: 794  FDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPIC 973
            FDN YGCR SL  GL      M+AGK  VV GYG+VGKGCA  L   GARVIVTEIDPIC
Sbjct: 242  FDNTYGCRQSLLHGLFNGCIQMLAGKKIVVLGYGEVGKGCAQGLSGVGARVIVTEIDPIC 301

Query: 974  ALQALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDM 1153
            ALQA MEG QV  LEDVVSEADIF+T TGNKD+I V HM+KMK NA + NIGHFD+EID+
Sbjct: 302  ALQASMEGYQVSVLEDVVSEADIFITATGNKDVITVEHMRKMKENAYIANIGHFDDEIDV 361

Query: 1154 HGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQV 1333
            +GLE YPG+K I +K    +F FP+T+  +I+L +GRL+NLGCATGHP  VMS SFTNQV
Sbjct: 362  YGLENYPGIKVIEVKQNVHKFTFPDTQKSVILLCKGRLVNLGCATGHPPLVMSMSFTNQV 421

Query: 1334 IAQLELWK-------EKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYI 1492
            +AQ++LWK        KNT  + KK   L K LDE V                  QA YI
Sbjct: 422  LAQMDLWKSRELVDRSKNTRFFVKK---LSKELDEYVARLHLDVLGIKLTKLTETQAKYI 478

Query: 1493 SIPVEGPYKPPHYRY 1537
            ++ + GPYK   YRY
Sbjct: 479  NVSINGPYKSEDYRY 493



>sp|Q7UZN3|SAHH_PROMP Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:BX572094_797251 Prochlorococcus marinus
            MED4 complete genome; segment 5/5.
          Length = 472

 Score =  503 bits (1296), Expect = e-141
 Identities = 269/472 (56%), Positives = 326/472 (69%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            Y +KD+S +DFGR E+++AE EMPGLMA R +    +P  GA+I GSLHMTIQTAVLIET
Sbjct: 14   YVIKDISLSDFGRKEIKIAETEMPGLMALRDKHHSDKPLNGAKIAGSLHMTIQTAVLIET 73

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L  LGA+V+W SCNIFSTQDH               KGE+L EYW  T   LDWG    P
Sbjct: 74   LVDLGAQVKWASCNIFSTQDHAAAAIAEQGISVYAKKGESLDEYWQYTHYILDWGTDS-P 132

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGDAT L+  G KAE++ +    + +PS   N E   +   IR  L+ D   Y+
Sbjct: 133  NMILDDGGDATGLLILGSKAEKDLS---VLKNPS---NEEEIALFNSIRSKLQEDSSFYS 186

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
            R+K  ++GV+EETTTGV RLYQ+Q+   L FPAINVNDSVTKSKFDNLYGCR SL D + 
Sbjct: 187  RIKGNIIGVTEETTTGVARLYQLQKQNALPFPAINVNDSVTKSKFDNLYGCRESLVDSIK 246

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATDVMIAGKVA+V G+GDVGKG A +L+  GA V V E+DPICALQA MEG  V+TL D
Sbjct: 247  RATDVMIAGKVALVMGFGDVGKGSAQSLRGLGAIVKVAEVDPICALQAAMEGFSVVTLND 306

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
            VV + DIFVT TGN  +I   ++ KMK+ AIVCNIGHFDNEID+  L+ YP      IKP
Sbjct: 307  VVEDIDIFVTATGNYQVITNDNLIKMKDEAIVCNIGHFDNEIDVASLKDYPWE---NIKP 363

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYE 1381
            Q D    P +   II+LAEGRL+NLGCATGHPSFVMS SFTNQV+AQ+EL+ + +  +Y 
Sbjct: 364  QVDHITLP-SGNKIILLAEGRLVNLGCATGHPSFVMSNSFTNQVLAQIELFNKSD--EYS 420

Query: 1382 KKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            K+VYVLPKHLDE V                 +QA YI++ VEGPYKP  YRY
Sbjct: 421  KEVYVLPKHLDEMVARLHLDKIGAKLTKLTKDQADYINVSVEGPYKPEQYRY 472



>gb:AE008921_246378 Uncultured proteobacterium clone EBAC000-60D04
            complete sequence.
          Length = 463

 Score =  498 bits (1282), Expect = e-139
 Identities = 268/473 (56%), Positives = 328/473 (69%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            +Y VKD+S A FGR EL++AE EMPGLMA R E+G ++P KGARI GSLHMTIQTAVLIE
Sbjct: 4    DYIVKDISLAAFGRKELDIAETEMPGLMALRKEYGAAKPLKGARIVGSLHMTIQTAVLIE 63

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG 478
            TL  LGA+VRW SCNIFSTQDH               KG++L+E+W   +R+  +  G  
Sbjct: 64   TLVELGADVRWASCNIFSTQDHXAXAIAAGGTPVFAIKGQSLEEHWDYLDRSFMFPEGA- 122

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKY 658
             ++I+DDGGDATL +  G + EE       VP      + E + V   I+  +   P  +
Sbjct: 123  -NMILDDGGDATLYVLLGARVEEGETDLIAVPK-----SEEEEAVFAQIKKRMAETPGWF 176

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
            T+ +  + GVSEETTTGV RLY++ + G L FPAINVNDSVTKSKFDN YGC+ SL DG+
Sbjct: 177  TKTRAAIQGVSEETTTGVHRLYELVKQGQLPFPAINVNDSVTKSKFDNKYGCKESLVDGI 236

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLE 1018
             RATD M+AGKVAVV GYGDVGKG AA+L+ AGARV VTE+DPICALQA M+G +V+ LE
Sbjct: 237  RRATDTMMAGKVAVVLGYGDVGKGSAASLRGAGARVKVTEVDPICALQAAMDGFEVVLLE 296

Query: 1019 DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIK 1198
            DVVS ADIF+TTTGNKD+I + HM+ MK+ AIV NIGHFDNEI +  L+ +   K   IK
Sbjct: 297  DVVSSADIFITTTGNKDVIRIEHMRDMKDMAIVGNIGHFDNEIQVASLKNH---KWTNIK 353

Query: 1199 PQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKY 1378
             Q D    P     +I+L+EGRL+NLG ATGHPSFVMS SFTNQV+AQ+ELW + +   Y
Sbjct: 354  EQVDMIEMPNGNR-LILLSEGRLLNLGNATGHPSFVMSASFTNQVLAQIELWTKGD--DY 410

Query: 1379 EKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
              +VY+LPKHLDEKV                 EQAAYI +  EGP+KP HYRY
Sbjct: 411  SNEVYILPKHLDEKVARLHLDRIGVKLSKLNDEQAAYIGVSSEGPFKPEHYRY 463



>sp|Q7TTZ5|SAHH_RHOBA Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:BX294143_768505 Pirellula sp. strain 1
            complete genome; segment 11/24.
          Length = 448

 Score =  497 bits (1279), Expect = e-139
 Identities = 260/479 (54%), Positives = 314/479 (65%), Gaps = 7/479 (1%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKVKD+S AD+GR E+ELAE EMPGLMA R+++G  +P KGARI G LHMTIQTAVLIET
Sbjct: 11   YKVKDISLADYGRKEIELAENEMPGLMALRSKYGAEKPLKGARIAGCLHMTIQTAVLIET 70

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L  LGAEV W SCNIFSTQDH              WKG T +E+ WC E+ LD+  G   
Sbjct: 71   LVELGAEVTWSSCNIFSTQDHAAAAIAAAGIPVYAWKGMTEEEFDWCIEQTLDFPSGEKL 130

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGD T ++H+                                         ++ 
Sbjct: 131  NMILDDGGDLTAMVHD-----------------------------------------RFP 149

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
             + + + G+SEETT GV RL  + +SG L  P+INVNDS TKSKFDNLYGCR SL DG+ 
Sbjct: 150  ELLDNIYGISEETTAGVHRLEVLNKSGKLRVPSINVNDSATKSKFDNLYGCRESLADGVK 209

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATDVM+AGKVAVVCGYGDVGKGCA +LK  G RV+VTEIDPI ALQA MEG +V T+E+
Sbjct: 210  RATDVMLAGKVAVVCGYGDVGKGCAHSLKSYGCRVLVTEIDPINALQAAMEGFEVTTMEE 269

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT--- 1192
               E  ++VTTTGNKDII+  HMK+M N+AI+CNIGHFD EID+   E      + T   
Sbjct: 270  ACKEGRLYVTTTGNKDIILGEHMKQMPNDAILCNIGHFDTEIDIAWAEQQVADGKATVSE 329

Query: 1193 IKPQ----TDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE 1360
            IKP      DRF F +T   IIILA+GRL+NLGCATGHPSFVMS SFTNQV+AQ+EL++ 
Sbjct: 330  IKPSDIGAVDRFTFNDTGRSIIILAKGRLVNLGCATGHPSFVMSSSFTNQVLAQMELYQN 389

Query: 1361 KNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            ++  KY  +VY+LPK LDE+V                 EQA YI +PVEGPYKP HYRY
Sbjct: 390  RDNDKYGVQVYLLPKELDEEVARLHLEAIGVKLTKLTQEQADYIGVPVEGPYKPNHYRY 448



>gb:BX897700_828277 Bartonella quintana str. Toulouse, complete
            genome.
          Length = 465

 Score =  495 bits (1275), Expect = e-138
 Identities = 263/476 (55%), Positives = 321/476 (67%)
 Frame = +2

Query: 110  SGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAV 289
            + ++Y VKD++ A +GR E+++AE EMPGLMACR EF  SQP +GARI+GSLH+TIQTAV
Sbjct: 2    AAQDYVVKDIALAAYGRKEIDIAETEMPGLMACREEFSFSQPLRGARISGSLHITIQTAV 61

Query: 290  LIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGP 469
            LIETL A+GA+VRW S NIFSTQDH               KGETL+EYW   +    W  
Sbjct: 62   LIETLKAIGADVRWSSSNIFSTQDHAAAAIAATGTAVFGVKGETLEEYWAYIDAIFQWPD 121

Query: 470  GGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADP 649
            G   +LI+DDG DAT  I  G +AE     N  +     T   EF      I+  +K  P
Sbjct: 122  GNPSNLILDDGADATNYILTGSRAEV----NKDILSYPKTKEEEF--FFKQIQKRMKITP 175

Query: 650  KKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLP 829
              +TR +  + GVSEETTTGV RLYQ+Q+ G L FPAINVNDSVTKSKFDN YGC+ SL 
Sbjct: 176  GFFTRQRTAIKGVSEETTTGVLRLYQLQKEGLLPFPAINVNDSVTKSKFDNKYGCKESLV 235

Query: 830  DGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVL 1009
            DG+ R TDVMIAGK A+VCGYG+VGKG AA+L  AGARV +TEIDPICALQA M+G +V+
Sbjct: 236  DGIRRGTDVMIAGKTAIVCGYGNVGKGSAASLSGAGARVKITEIDPICALQAAMDGYEVV 295

Query: 1010 TLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRI 1189
            TL+D  S ADI +TTTGNKD++ + HM+++K+  I+ NIGHFDNEI +  L   P     
Sbjct: 296  TLDDAASSADIIITTTGNKDVVRLDHMRQVKDMCILGNIGHFDNEIQVSALRNLPWT--- 352

Query: 1190 TIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNT 1369
             IKPQ D   FP+ K  II+L+EGRL+NLG ATGHPSFVMS SFTNQV+AQ+EL+     
Sbjct: 353  NIKPQVDIVTFPDGKR-IILLSEGRLLNLGNATGHPSFVMSASFTNQVLAQIELFTRAE- 410

Query: 1370 GKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
              Y+ +V VLPK LDEKV                 EQA YI +  +GPYKP HYRY
Sbjct: 411  -HYKNEVTVLPKRLDEKVARLHLDRLGVKLSVLSEEQAVYIGVTPQGPYKPNHYRY 465



>gb:AY178804_595226 Agrobacterium tumefaciens
            S-adenosyl-L-homocysteine hydrolase (ahcY) and putative
            two-component sensor histidine kinase genes, partial cds.
          Length = 429

 Score =  490 bits (1261), Expect = e-137
 Identities = 256/441 (58%), Positives = 312/441 (70%)
 Frame = +2

Query: 215  EFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXX 394
            EFG ++P KGARITGSLHMTIQTAVLIETL ALGAEVRW SCNIFSTQDH          
Sbjct: 1    EFGETKPLKGARITGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAASGV 60

Query: 395  XXXXWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVP 574
                 KGE+L++YW  T++   W  GG  ++I+DDGGDAT+ I  G +AE   A    + 
Sbjct: 61   PVYAIKGESLEDYWIYTDKIFQWADGGFSNMILDDGGDATMYILLGARAE---AGEDVLS 117

Query: 575  DPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLF 754
            DP S +    +I+   I+  LKA P  +T+ ++ + GV+EETTTGV RLYQ+ + G L F
Sbjct: 118  DPHSEEE---EILFAQIKKRLKASPGWFTKQRDAIKGVTEETTTGVNRLYQLSQKGLLPF 174

Query: 755  PAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQA 934
            PAINVNDSVTKSKFDN YGC+ SL DG+ RATDVM+AGKVAVVCGYGDVGKG AA+L  A
Sbjct: 175  PAINVNDSVTKSKFDNKYGCKESLVDGIRRATDVMMAGKVAVVCGYGDVGKGSAASLSGA 234

Query: 935  GARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAI 1114
            GARV VTE+DPICALQA M+G +V+ LEDVVS ADIF++TTGNKD+I + HM+ MK+ AI
Sbjct: 235  GARVKVTEVDPICALQAAMDGYEVVLLEDVVSSADIFISTTGNKDVIRIDHMRAMKDMAI 294

Query: 1115 VCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGH 1294
            V NIGHFDNEI +  L     +K   +KPQ D   F +    II+L+EGRL+NLG ATGH
Sbjct: 295  VGNIGHFDNEIQVAALR---NLKWTNVKPQVDLIEFAKGNR-IILLSEGRLLNLGNATGH 350

Query: 1295 PSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXP 1474
            PSFVMS SFTNQ +AQ+EL+ +   G+Y+ +VYVLPKHLDEKV                 
Sbjct: 351  PSFVMSASFTNQTLAQIELFTK--PGQYQNQVYVLPKHLDEKVARLHLGKLGVKLTELSG 408

Query: 1475 EQAAYISIPVEGPYKPPHYRY 1537
            EQAAYI +  +GP+K  HYRY
Sbjct: 409  EQAAYIGVTPQGPFKSDHYRY 429



>sp|P61456|SAHH_CORDI Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:BX248355_761984 Corynebacterium
            diphtheriae gravis NCTC13129, complete genome; segment
            2/8.
          Length = 478

 Score =  489 bits (1258), Expect = e-136
 Identities = 258/482 (53%), Positives = 317/482 (65%), Gaps = 9/482 (1%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            +Y VKD+S A+ GR ++ LAE EMPGLM  R E+   QP  GARITGS+HMT+QTAVLIE
Sbjct: 5    DYNVKDLSLAEAGRHQIRLAEYEMPGLMQLREEYQQEQPLAGARITGSIHMTVQTAVLIE 64

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXX---------XXWKGETLQEYWWCTER 451
            TL ALGA+VRW SCNIFSTQD                        WKGETL+EYW C ++
Sbjct: 65   TLVALGAQVRWASCNIFSTQDEAAAAVVVGPHGTPEDPQGVPVFAWKGETLEEYWDCVDK 124

Query: 452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRD 631
               WG    P++I+DDGGDAT+ +  G + EE     G VP     D+ E+Q  L ++R 
Sbjct: 125  IFSWGDEL-PNMILDDGGDATMAVIRGKQFEEA----GMVPPVEEGDSDEYQAFLGMLRK 179

Query: 632  GLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG 811
             L   P K+T + E + GV+EETTTGV RLY   E G L FPA+NVND+VTKSKFDN YG
Sbjct: 180  TLAEQPGKWTAIAESVKGVTEETTTGVHRLYHFAEEGVLPFPAMNVNDAVTKSKFDNKYG 239

Query: 812  CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM 991
             RHSL DG+ RATD+++ GK  ++CGYGDVGKGCA A+   GARV VTE DPI ALQALM
Sbjct: 240  TRHSLIDGINRATDMLMGGKNVLICGYGDVGKGCAEAMAGQGARVKVTEADPINALQALM 299

Query: 992  EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY 1171
            +G  V+ ++  + +ADI +T TGN  II    M  MK++A++ NIGHFDNEIDM  L   
Sbjct: 300  DGFPVVHVDQAIGDADIVITATGNMGIISFEQMLAMKDHAVLGNIGHFDNEIDMASLLHR 359

Query: 1172 PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL 1351
              V R+TIKPQ D F  P  K+ I++L+EGRL+NLG ATGHPSFVMS SF +Q IAQ+EL
Sbjct: 360  DDVSRVTIKPQVDEFTLPNGKS-IVVLSEGRLLNLGNATGHPSFVMSTSFADQTIAQIEL 418

Query: 1352 WKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHY 1531
            +  +N G+Y  +VY LPK LDEKV                 EQA YI + V GPYKP HY
Sbjct: 419  F--QNDGRYVNEVYRLPKILDEKVARIHVEALGGTITELTKEQAEYIGVDVAGPYKPEHY 476

Query: 1532 RY 1537
            RY
Sbjct: 477  RY 478



>sp|P27604|SAHH_CAEEL Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>pir|T32918|T32918 adenosylhomocysteinase (EC
            3.3.1.1) - Caenorhabditis elegans>gb:AF043699_1235954
            Caenorhabditis elegans cosmid K02F2, complete
            sequence.>gb:CELHHG_1365962 Caenorhabditis elegans
            s-adenosylhomocysteine hydrolase gene, complete
            cds.>gb:S57284_1396642 dpy-14 region:
            S-adenosylhomocysteine hydrolase [Caenorhabditis elegans,
            Genomic, 1728 nt].
          Length = 437

 Score =  484 bits (1245), Expect = e-135
 Identities = 263/473 (55%), Positives = 311/473 (65%), Gaps = 1/473 (0%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D+  ADFGR E+ LAE EMPGLMA R+++GPSQP KGARI G LHMTIQTAVLIET
Sbjct: 8    YKVADIKLADFGRKEIILAENEMPGLMAMRSKYGPSQPLKGARIAGCLHMTIQTAVLIET 67

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            LTALGAEV+W SCNIFSTQDH              WKGET +EY WC E+ + +  G   
Sbjct: 68   LTALGAEVQWSSCNIFSTQDHAAAAIAQTGVPVYAWKGETDEEYEWCIEQTIVFKDGQPL 127

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGD T L+H                                          KY 
Sbjct: 128  NMILDDGGDLTNLVHA-----------------------------------------KYP 146

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
            +    + G+SEETTTGV  L +M   G L  PAINVNDSVTKSKFDNLYG R SLPDG+ 
Sbjct: 147  QYLAGIRGLSEETTTGVHNLAKMLAKGDLKVPAINVNDSVTKSKFDNLYGIRESLPDGIK 206

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATDVM+AGKVAVV GYGDVGKG AA+LK  G+RVIVTEIDPI ALQA MEG +V TLE+
Sbjct: 207  RATDVMLAGKVAVVAGYGDVGKGSAASLKAFGSRVIVTEIDPINALQAAMEGYEVTTLEE 266

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
               +A+I VTTTG KDI+   H + + N+AIVCN+GHFD EID+  L T    K+ TIKP
Sbjct: 267  AAPKANIIVTTTGCKDIVTGKHFELLPNDAIVCNVGHFDCEIDVKWLNT-NATKKDTIKP 325

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNT-GKY 1378
            Q DR+     +  +I+LAEGRL+NLGCATGHPSFVMS SFTNQV+AQ+ELW +  T  +Y
Sbjct: 326  QVDRYTLKNGR-HVILLAEGRLVNLGCATGHPSFVMSNSFTNQVLAQVELWTKFGTPQEY 384

Query: 1379 EKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            +  +YVLPK LDE+V                 EQA+Y+ +PV GPYKP HYRY
Sbjct: 385  KLGLYVLPKTLDEEVAYLHLAQLGVKLTKLSDEQASYLGVPVAGPYKPDHYRY 437



>gb:CP000009_863091 Gluconobacter oxydans 621H, complete genome.
          Length = 438

 Score =  483 bits (1244), Expect = e-135
 Identities = 255/474 (53%), Positives = 307/474 (64%)
 Frame = +2

Query: 116  REYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLI 295
            ++YKV+D++ AD+GR E+ +AE EMPGLMA R E+  SQP KGARI G LHMTIQTAVLI
Sbjct: 11   QDYKVRDITLADWGRKEISIAEGEMPGLMALREEYKDSQPLKGARIAGCLHMTIQTAVLI 70

Query: 296  ETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGG 475
            ETL ALGA VRW SCNIFSTQDH              WKG T  E+ WC E+ +    G 
Sbjct: 71   ETLIALGATVRWSSCNIFSTQDHAAAAIAAAGIPVFAWKGLTEDEFNWCIEQTIHGPDGW 130

Query: 476  GPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKK 655
             P++I+DDGGD T+++H+                                         K
Sbjct: 131  TPNMILDDGGDLTIMMHD-----------------------------------------K 149

Query: 656  YTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDG 835
            Y  M + + G+SEETTTGV RL++M + GTL  PAINVNDSVTKSKFDNLYGCR SL D 
Sbjct: 150  YPEMLKDVRGISEETTTGVHRLWEMSKKGTLKVPAINVNDSVTKSKFDNLYGCRESLVDA 209

Query: 836  LMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTL 1015
            + R TDVM+AGKVAVV GYGDVGKG AA+L+ AG RV+VTE+DPICALQA MEG +V+T+
Sbjct: 210  IRRGTDVMMAGKVAVVAGYGDVGKGSAASLRNAGCRVLVTEVDPICALQAAMEGYEVVTM 269

Query: 1016 EDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITI 1195
            E+     DIFVT TGN DII + HM++MK+ AIVCNIGHFD+EI +  L  Y   +   I
Sbjct: 270  ENAAPRGDIFVTCTGNVDIITIDHMREMKDRAIVCNIGHFDSEIQVEALRNY---RWNNI 326

Query: 1196 KPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGK 1375
            KPQ D       +  II+L+EGRL+NLG ATGHPSFVMS SFTNQ +AQ+ELW  K  G+
Sbjct: 327  KPQVDEIELAPNRR-IILLSEGRLVNLGNATGHPSFVMSASFTNQTLAQIELWTAK-PGQ 384

Query: 1376 YEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            YE KVY LPK LDEKV                 +QA YI +PV GP+K   YRY
Sbjct: 385  YEVKVYTLPKALDEKVAALHLAKVGAELSKMSQKQADYIDVPVNGPFKHEEYRY 438



>gb:AY398307_2531837 Danio rerio clone RK113A3C03
            S-adenosylhomocysteine hydrolase (AHCY) mRNA, complete
            cds.>gb:BC044200_2548588 Danio rerio
            S-adenosylhomocysteine hydrolase, mRNA (cDNA clone
            MGC:55617 IMAGE:2644517), complete cds.
          Length = 433

 Score =  483 bits (1242), Expect = e-135
 Identities = 260/474 (54%), Positives = 311/474 (65%), Gaps = 2/474 (0%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            +KV D+S A++GR  +E+AE EMPGLM  R  +G S+P KGARI G LHMT+QTAVLIET
Sbjct: 7    FKVADISLAEWGRKAIEIAENEMPGLMKMRELYGQSKPLKGARIAGCLHMTLQTAVLIET 66

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            LTALGAEV+W SCNIFSTQDH              WKGET +EY WC E+ + +  G   
Sbjct: 67   LTALGAEVQWSSCNIFSTQDHAAAAIAKTGVPVYAWKGETDEEYVWCIEQTIYFKDGQPL 126

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGD T L+H+                                         KY 
Sbjct: 127  NMILDDGGDLTNLVHQ-----------------------------------------KYP 145

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
            ++   + G+SEETTTGV  LY+M +SG L  PAINVNDSVTKSKFDNLYGCR SL DG+ 
Sbjct: 146  KLLAGIKGISEETTTGVHNLYKMLKSGELKVPAINVNDSVTKSKFDNLYGCRESLIDGIK 205

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATDVMIAGKVAVV GYGDVGKGC  AL+  GARVIVTEIDPI ALQA MEG +V T+++
Sbjct: 206  RATDVMIAGKVAVVAGYGDVGKGCVQALRGFGARVIVTEIDPINALQAAMEGYEVTTMDE 265

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
               E +IFVTTTG +DI++  H + MK+++IVCNIGHFD EIDM  L  +   K+I IKP
Sbjct: 266  ACKEGNIFVTTTGCEDILLGRHFEHMKDDSIVCNIGHFDCEIDMKWLNEH-AAKKINIKP 324

Query: 1202 QTDRFVFPETKTG--IIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGK 1375
            Q DR+     K G  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW  KN  K
Sbjct: 325  QVDRY---RMKNGRHIIVLAEGRLVNLGCAMGHPSFVMSNSFTNQVLAQIELW--KNNSK 379

Query: 1376 YEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            Y   VY LPK LDE+V                 +QA Y+ +P EGP+KP HYRY
Sbjct: 380  YPLGVYFLPKKLDEEVAAAHLDKLGVKLTKLTEKQAKYLGLPSEGPFKPDHYRY 433



>sp|P36889|SAHH_LEIDO Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:LEISADSH_1387444 L.donovani
            S-adenosylhomocysteine hydrolase gene, complete cds.
          Length = 437

 Score =  482 bits (1241), Expect = e-134
 Identities = 258/478 (53%), Positives = 310/478 (64%), Gaps = 5/478 (1%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            +YKVKD+S A++GR  +ELAE EMPGLM  R E+GPSQP KGA+I G LHMT+QTAVLIE
Sbjct: 3    DYKVKDISLAEWGRKAIELAENEMPGLMELRREYGPSQPLKGAKIAGCLHMTVQTAVLIE 62

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG 478
            TL ALGA+VRW SCNIFSTQD+              WKGET +EY WC  + +    G G
Sbjct: 63   TLKALGADVRWSSCNIFSTQDNAAAAIAKAGVPVFAWKGETDEEYEWCIAQTVKGFSGDG 122

Query: 479  -PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKK 655
             P++I+DDGGD T L+ +                                          
Sbjct: 123  LPNMILDDGGDLTNLVID-----------------------------------------H 141

Query: 656  YTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDG 835
            +  +  ++ G+SEETTTGVK LY+    G L   AINVNDSVTKSKFDNLYGCR SL DG
Sbjct: 142  HPELVPKIFGISEETTTGVKNLYKRLSKGNLPMCAINVNDSVTKSKFDNLYGCRESLVDG 201

Query: 836  LMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTL 1015
            + RATDVMIAGK   VCGYGDVGKGCAAAL+  GARV+VTE+DPI ALQA MEG QV  +
Sbjct: 202  MKRATDVMIAGKTCCVCGYGDVGKGCAAALRAFGARVVVTEVDPINALQASMEGYQVALV 261

Query: 1016 EDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITI 1195
            EDV+++A IFVTTTGN DII   H   M+++AIVCNIGHFD EI +  LE     + + I
Sbjct: 262  EDVMADAHIFVTTTGNDDIITSEHFPHMRDDAIVCNIGHFDTEIQVGWLEA-NAKEHVEI 320

Query: 1196 KPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGK 1375
            KPQ DR+   E    II+LA+GRL+NLGCA+GHPSFVMS SFTNQV+AQ+ELW  ++ GK
Sbjct: 321  KPQVDRYTM-ENGRHIILLAKGRLVNLGCASGHPSFVMSNSFTNQVLAQIELWSNRDNGK 379

Query: 1376 YEK----KVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            Y +     V+ LPK LDEKV                P+QA YI+ PV GP+KP HYRY
Sbjct: 380  YPRGDKAGVFFLPKALDEKVAALHLAHVGAKLTKLTPKQAEYINCPVNGPFKPDHYRY 437



>gb:AY233397_1311518 Trypanosoma cruzi S-adenosylhomocysteine
            hydrolase (SAHH) gene, complete cds.
          Length = 437

 Score =  482 bits (1240), Expect = e-134
 Identities = 255/478 (53%), Positives = 313/478 (65%), Gaps = 5/478 (1%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            +YKV+D+S A++GR  +E+AE EMPGLM  R E+  S+P KGA+I G LHMT+QTAVLIE
Sbjct: 3    DYKVRDISLAEWGRKAIEIAENEMPGLMELRREYSQSKPLKGAKIAGCLHMTVQTAVLIE 62

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG 478
            TL  LGAEVRW SCNIFSTQD+              WKGET +EY WC E+ L    G G
Sbjct: 63   TLIQLGAEVRWSSCNIFSTQDNAAAAIAKRGIPVFAWKGETEEEYQWCIEQTLKGFSGDG 122

Query: 479  -PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKK 655
             P++I+DDGGD T  + +                                          
Sbjct: 123  FPNMILDDGGDLTNHVLDHCP--------------------------------------- 143

Query: 656  YTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDG 835
               + +++ G+SEETTTGVK LY+  + G L  PAINVNDSVTKSKFDNLYGCR SL DG
Sbjct: 144  --HLVDKIYGISEETTTGVKNLYKRLQRGKLPIPAINVNDSVTKSKFDNLYGCRESLVDG 201

Query: 836  LMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTL 1015
            + RATDVMIAGK A VCGYGDVGKGCAAAL+  GARV+VTE+DPI ALQA MEG QVL +
Sbjct: 202  IKRATDVMIAGKTACVCGYGDVGKGCAAALRAFGARVVVTEVDPINALQAAMEGYQVLLV 261

Query: 1016 EDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITI 1195
            ED+V +A IFVTTTGN DII   H  +M+++AIVCNIGHFD EI +  L+     +R+ +
Sbjct: 262  EDIVEQAHIFVTTTGNDDIITAEHFPRMQDDAIVCNIGHFDTEIQVSWLKA-NAKERVEV 320

Query: 1196 KPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGK 1375
            KPQ DR+     +  II+LAEGRL+NLGCA+GHPSFVMS SF+NQV+AQ+ELW ++ +GK
Sbjct: 321  KPQVDRYTMHNGR-HIILLAEGRLVNLGCASGHPSFVMSNSFSNQVLAQIELWTQRESGK 379

Query: 1376 YEK----KVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            Y +    +VY LPK LDEKV                  QA YI+ PV+GP+KP HYRY
Sbjct: 380  YPRGEKAQVYFLPKKLDEKVAALHLGKLGAKLTKLTARQADYINCPVDGPFKPDHYRY 437



>sp|Q83A77|SAHH_COXBU Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:AE016966_369208 Coxiella burnetii strain
            RSA 493, section 7 of 7 of the complete
            genome.>gb:AE016828_1009944 Coxiella burnetii strain RSA
            493, complete genome.
          Length = 429

 Score =  482 bits (1240), Expect = e-134
 Identities = 254/474 (53%), Positives = 310/474 (65%)
 Frame = +2

Query: 116  REYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLI 295
            ++Y + +++ AD+GR E+E+AE EMPGLMA R ++  ++P KGARI G +HMTIQTAVLI
Sbjct: 3    QDYHIANINLADWGRKEIEIAETEMPGLMALRKKYKNAKPLKGARIAGCIHMTIQTAVLI 62

Query: 296  ETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGG 475
            ETL  LGAEVRW SCNIFSTQDH              WKGET +EYW C    L+   G 
Sbjct: 63   ETLMLLGAEVRWSSCNIFSTQDHAAAALAQKGIPIFAWKGETEEEYWRCIASTLEGPKGW 122

Query: 476  GPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKK 655
             P+L++DDGGD T    +                                         K
Sbjct: 123  TPNLLLDDGGDLTAHTLQ-----------------------------------------K 141

Query: 656  YTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDG 835
            +  + + + GVSEETTTGV RLY+M + G+L FPAINVNDSVTKSKFDNLYGCR SL D 
Sbjct: 142  HPELCQNIRGVSEETTTGVHRLYRMLKEGSLKFPAINVNDSVTKSKFDNLYGCRESLIDS 201

Query: 836  LMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTL 1015
            + RATDVMIAGK  VVCGYGDVGKGCA +L+  GA V +TEIDPICALQA MEG +V+T+
Sbjct: 202  IKRATDVMIAGKRVVVCGYGDVGKGCAQSLRAYGATVYITEIDPICALQAAMEGYRVVTM 261

Query: 1016 EDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITI 1195
            +++   ADIFVT TGN DII   HM KMK+ AIVCNIGHFDNEID+  L+ Y   + + I
Sbjct: 262  DEMADSADIFVTATGNTDIITHEHMLKMKDQAIVCNIGHFDNEIDIASLQDY---QWMNI 318

Query: 1196 KPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGK 1375
            KPQ D+ +FP+ K  + +LA+GRL+NLGCATGHPSFVMS SFTNQV+AQ+ELW+     K
Sbjct: 319  KPQVDQVIFPDGKR-LTVLAQGRLVNLGCATGHPSFVMSNSFTNQVLAQIELWQYPE--K 375

Query: 1376 YEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            Y   VYVLPKHLDE+V                 +QA YI +  EGP+K  HYRY
Sbjct: 376  YPIGVYVLPKHLDEEVARLHLERVGGKLTTLTEKQADYIGVDPEGPFKSEHYRY 429



>pir|A45569|A45569 adenosylhomocysteinase (EC 3.3.1.1) - Leishmania
            donovani
          Length = 437

 Score =  479 bits (1234), Expect = e-134
 Identities = 258/478 (53%), Positives = 309/478 (64%), Gaps = 5/478 (1%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            +YKVKD+S A++GR  +ELAE EMPGLM  R E+GPSQP KGA+I G LHMT+QTAVLIE
Sbjct: 3    DYKVKDISLAEWGRKAIELAENEMPGLMELRREYGPSQPLKGAKIAGCLHMTVQTAVLIE 62

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG 478
            TL ALGA+VRW SCNIFSTQD+              WKGET +EY WC  + +    G G
Sbjct: 63   TLKALGADVRWSSCNIFSTQDNAAAAIAKAGVPVFAWKGETDEEYEWCIAQTVKGFSGDG 122

Query: 479  -PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKK 655
             P++I+DDGGD T L+ +                                          
Sbjct: 123  LPNMILDDGGDLTNLVID-----------------------------------------H 141

Query: 656  YTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDG 835
            +  +  ++ G+SEETTTGVK LY+    G L   AINVNDSVTKSKFDNLYGCR SL DG
Sbjct: 142  HPELVPKIFGISEETTTGVKNLYKRLSKGNLPMCAINVNDSVTKSKFDNLYGCRESLVDG 201

Query: 836  LMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTL 1015
            + RATDVMIAGK   VCGYGDVGKGCAAAL+  GARV+VTE+DPI ALQA MEG QV  +
Sbjct: 202  MKRATDVMIAGKTCCVCGYGDVGKGCAAALRAFGARVVVTEVDPINALQASMEGYQVALV 261

Query: 1016 EDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITI 1195
            EDV+++A IFVTTTGN DII   H   M+++AIVCNIGHFD EI +  LE     + + I
Sbjct: 262  EDVMADAHIFVTTTGNDDIITSEHFPHMRDDAIVCNIGHFDTEIQVGWLEA-NAKEHVEI 320

Query: 1196 KPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGK 1375
            KPQ D F   E    II+LA+GRL+NLGCA+GHPSFVMS SFTNQV+AQ+ELW  ++ GK
Sbjct: 321  KPQVD-FYTMENGRHIILLAKGRLVNLGCASGHPSFVMSNSFTNQVLAQIELWSNRDNGK 379

Query: 1376 YEK----KVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            Y +     V+ LPK LDEKV                P+QA YI+ PV GP+KP HYRY
Sbjct: 380  YPRGDKAGVFFLPKALDEKVAALHLAHVGAKLTKLTPKQAEYINCPVNGPFKPDHYRY 437



>sp|P51893|SAH1_XENLA Adenosylhomocysteinase 1 (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase 1) (ADOHCYASE
            1).>pir|JC2480|JC2480 adenosylhomocysteinase (EC 3.3.1.1)
            - African clawed frog>gb:BC060432_2552900 Xenopus laevis
            adenosylhomocysteinase, mRNA (cDNA clone MGC:68782
            IMAGE:4201976), complete cds.>gb:BC073400_2557242 Xenopus
            laevis cDNA clone MGC:80855 IMAGE:5514637, complete
            cds.>gb:XELAHH_2581742 Xenopus laevis adenine
            homocysteine hydrolase mRNA, complete cds.
          Length = 433

 Score =  478 bits (1229), Expect = e-133
 Identities = 257/472 (54%), Positives = 307/472 (65%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D+S AD+GR  +E+AE EMPGLM  R     S+P KGARI G LHMT+QTAVLIET
Sbjct: 7    YKVADISLADWGRKAIEIAENEMPGLMKMREMHSESKPLKGARIAGCLHMTLQTAVLIET 66

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            LTALGAEV+W SCNIFSTQDH              WKGET +EY WC E+ + +  G   
Sbjct: 67   LTALGAEVQWSSCNIFSTQDHAAAAIAKTGVPVYAWKGETDEEYIWCIEQTIYFKDGKPL 126

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGD T L+H                                          KY 
Sbjct: 127  NMILDDGGDLTNLVHS-----------------------------------------KYP 145

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
            ++ + + G+SEETTTGV  LY+M+ SGTL  PAINVNDSVTKSKFDNLYGCR SL DG+ 
Sbjct: 146  QLLKGIKGISEETTTGVHNLYKMKSSGTLQVPAINVNDSVTKSKFDNLYGCRESLIDGIK 205

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATDVMIAGKVAVV GYGDVGKGCA AL+  GARVI+TEIDPI ALQA MEG +V T+++
Sbjct: 206  RATDVMIAGKVAVVAGYGDVGKGCAQALRAFGARVIITEIDPINALQAAMEGYEVTTMDE 265

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
               E +IFVTTTG  DI+   H + MK+++IVCNIGHFD E+D+  L     VK++ IKP
Sbjct: 266  ASKEGNIFVTTTGCADIVEGRHFENMKDDSIVCNIGHFDIELDVKWLNE-NAVKKVNIKP 324

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYE 1381
            Q DR++    +  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW   NT KY 
Sbjct: 325  QVDRYLLKNGR-HIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELW--TNTDKYP 381

Query: 1382 KKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
              VY LPK LDE V                 +QA Y+ +  EGP+KP HYRY
Sbjct: 382  VGVYFLPKKLDEAVAAAHLDKLGVKLTKLTDKQAKYLGLDKEGPFKPDHYRY 433



>sp|O93477|SAH2_XENLA Adenosylhomocysteinase 2 (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase 2) (ADOHCYASE
            2).>gb:BC074224_2557740 Xenopus laevis cDNA clone
            MGC:83407 IMAGE:7008476, complete cds.>gb:XLA7835_2582631
            Xenopus Laevis mRNA for S-adenosyl-L-homocysteine
            hydrolase, alternate isoform.
          Length = 433

 Score =  476 bits (1225), Expect = e-133
 Identities = 255/472 (54%), Positives = 307/472 (65%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D+S AD+GR  +E+AE EMPGLM  R  +  S+P KGARI G LHMT+QTAVLIET
Sbjct: 7    YKVADISLADWGRKAIEIAENEMPGLMKMREMYSESKPLKGARIAGCLHMTLQTAVLIET 66

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            LTA+GAEV+W SCNIFSTQDH              WKGET +EY WC E+ + +  G   
Sbjct: 67   LTAIGAEVQWSSCNIFSTQDHAAAAIAKTGVPVYAWKGETDEEYIWCIEQTIYFKDGKPL 126

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGD T L+H                                          KY 
Sbjct: 127  NMILDDGGDLTNLVHT-----------------------------------------KYP 145

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
            ++ + + G+SEETTTGV  LY+M+ SGTL  PAINVNDSVTKSKFDNLYGCR SL DG+ 
Sbjct: 146  QLLKGIKGISEETTTGVHNLYKMKSSGTLQVPAINVNDSVTKSKFDNLYGCRESLIDGIK 205

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATDVMIAGKVAVV GYGDVGKGCA AL+  GARV++TEIDPI ALQA MEG +V T+++
Sbjct: 206  RATDVMIAGKVAVVAGYGDVGKGCAQALRAFGARVLITEIDPINALQAAMEGYEVTTMDE 265

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
               E +IFVTTTG  DI+   H + MK+++IVCNIGHFD E+D+  L      K+I IKP
Sbjct: 266  ASKEGNIFVTTTGCADIVEGRHFENMKDDSIVCNIGHFDVELDVKWLND-NAAKKINIKP 324

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYE 1381
            Q DR++    +  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW   NT KY 
Sbjct: 325  QVDRYLLKNGR-HIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELW--TNTDKYP 381

Query: 1382 KKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
              VY LPK LDE V                 +QA Y+ +  EGP+KP HYRY
Sbjct: 382  VGVYFLPKKLDEAVAAAHLDKLGVKLTKLTDKQAKYLGLDKEGPFKPDHYRY 433



>gb:AE014298_1125742 Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE003499_1212751 Drosophila melanogaster
            chromosome X, section 51 of 74 of the complete sequence.
          Length = 432

 Score =  469 bits (1208), Expect = e-131
 Identities = 252/472 (53%), Positives = 307/472 (65%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D+S A++GR  + +AE EMPGLMACR ++GPS+P KGARITG LHMT+QTAVLIET
Sbjct: 6    YKVADISLAEWGRKAIIIAENEMPGLMACRKKYGPSKPLKGARITGCLHMTVQTAVLIET 65

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L  LGA+V+W SCNIFSTQD+              WKGET +EY WC E+ L +  G   
Sbjct: 66   LVELGAQVQWSSCNIFSTQDNAAAAIAATGVPVYAWKGETDEEYMWCIEQTLVFPDGQPL 125

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGD T L+HE                                         K+ 
Sbjct: 126  NMILDDGGDLTNLVHE-----------------------------------------KFP 144

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
            +  + + G+SEETTTGV  LY+M + G L  PAINVNDSVTKSKFDNLYGCR SL DG+ 
Sbjct: 145  QYLKNIKGLSEETTTGVHNLYKMFKEGRLGVPAINVNDSVTKSKFDNLYGCRESLIDGIK 204

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATDVMIAGKV  V GYGDVGKGCA ALK  G RVIVTE+DPI ALQA MEG +V T+E+
Sbjct: 205  RATDVMIAGKVCCVAGYGDVGKGCAQALKGFGGRVIVTEVDPINALQAAMEGYEVTTMEE 264

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
               EA IFVTTTG +DII   H+++M ++AIVCNIGHFD EID+  L      +++ +KP
Sbjct: 265  ASKEASIFVTTTGCRDIITSVHLQQMPDDAIVCNIGHFDIEIDVDWLNA-NAKEKVNVKP 323

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYE 1381
            Q DR+     K  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW + +  KY 
Sbjct: 324  QVDRYTMQSGK-HIILLAEGRLVNLGCAHGHPSFVMSNSFTNQVLAQIELWTKSD--KYA 380

Query: 1382 KKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
              V+VLPK LDE+V                 +QA Y+ +   GP+KP HYRY
Sbjct: 381  VGVHVLPKILDEEVASLHLEKLGVKLTKLTEKQATYLGVSQTGPFKPDHYRY 432



>gb:AX063941_1458884 Sequence 223 from Patent
            WO0100843.>gb:AX244109_1464645 Sequence 101 from Patent
            WO0166573.
          Length = 432

 Score =  469 bits (1207), Expect = e-131
 Identities = 245/435 (56%), Positives = 302/435 (69%), Gaps = 8/435 (1%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            ++KV D+S A+ GR ++ LAE EMPGLM  R EF   QP KGARI GS+HMT+QTAVLIE
Sbjct: 6    DFKVADLSLAEAGRHQIRLAEYEMPGLMQLRKEFADEQPLKGARIAGSIHMTVQTAVLIE 65

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXX--------XWKGETLQEYWWCTERA 454
            TLTALGAEVRW SCNIFSTQD                       WKGE+L+EYWWC  + 
Sbjct: 66   TLTALGAEVRWASCNIFSTQDEAAAAIVVGSGTVEEPAGVPVFAWKGESLEEYWWCINQI 125

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
              WG    P++I+DDGGDAT+ +  G     EY + G VP   + D+ E+   L ++R+ 
Sbjct: 126  FSWGDEL-PNMILDDGGDATMAVIRG----REYEQAGLVPPAEANDSDEYIAFLGMLREV 180

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
            L A+P K+ ++ E + GV+EETTTGV RLY   E G L FPA+NVND+VTKSKFDN YG 
Sbjct: 181  LAAEPGKWGKIAEAVKGVTEETTTGVHRLYHFAEEGVLPFPAMNVNDAVTKSKFDNKYGT 240

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            RHSL DG+ RATD+++ GK  +VCGYGDVGKGCA A    GARV VTE DPI ALQALM+
Sbjct: 241  RHSLIDGINRATDMLMGGKNVLVCGYGDVGKGCAEAFDGQGARVKVTEADPINALQALMD 300

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            G  V+T+++ + +ADI +T TGNKDII    M KMK++A++ NIGHFDNEIDMH L    
Sbjct: 301  GYSVVTVDEAIEDADIVITATGNKDIISFEQMLKMKDHALLGNIGHFDNEIDMHSLLHRD 360

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
             V R TIKPQ D F F  T   II+L+EGRL+NLG ATGHPSFVMS SF +Q IAQ+EL+
Sbjct: 361  DVTRTTIKPQVDEFTF-STGRSIIVLSEGRLLNLGNATGHPSFVMSNSFADQTIAQIELF 419

Query: 1355 KEKNTGKYEKKVYVL 1399
              +N G+YE +VY L
Sbjct: 420  --QNEGQYENEVYRL 432



>sp|O13639|SAHH_SCHPO Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>pir|T40763|T40763 adenosylhomocysteinase -
            fission yeast (Schizosaccharomyces
            pombe)>gb:AB004537_1509125 Schizosaccharomyces pombe 37
            kb genomic DNA, clone c213.>gb:SPBC8D2_1720514 S.pombe
            chromosome II cosmid c8D2.
          Length = 433

 Score =  469 bits (1207), Expect = e-131
 Identities = 254/477 (53%), Positives = 307/477 (64%), Gaps = 3/477 (0%)
 Frame = +2

Query: 116  REYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLI 295
            + YKV D+S A FGR ELE+AE EMPGL+A R ++  SQP KGARI G LHMTIQTAVLI
Sbjct: 4    QNYKVADISLAAFGRKELEIAENEMPGLIAVREKYAKSQPLKGARIAGCLHMTIQTAVLI 63

Query: 296  ETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGG 475
            ETL ALGAEV W SCNI+STQDH              WKGET +EY WC E+ L   P G
Sbjct: 64   ETLVALGAEVTWSSCNIYSTQDHAAAAIAATGVPVFAWKGETEEEYLWCIEQQLKSFPSG 123

Query: 476  GP-DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPK 652
             P ++I+DDGGD T L+HE                                         
Sbjct: 124  KPLNMILDDGGDLTALVHE----------------------------------------- 142

Query: 653  KYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPD 832
            ++  +   + G+SEETTTGV  LY+M +   L  PAINVNDSVTKSKFDNL+GC+ SL D
Sbjct: 143  RHPELLVDIRGISEETTTGVHNLYKMFKENKLKVPAINVNDSVTKSKFDNLFGCKESLVD 202

Query: 833  GLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLT 1012
            G+ RATDVMIAGKVAVV G+GDVGKGC+ +L+  GARVIVTE+DPI ALQA M+G +V T
Sbjct: 203  GIKRATDVMIAGKVAVVAGFGDVGKGCSTSLRSQGARVIVTEVDPINALQAAMDGFEVTT 262

Query: 1013 LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT 1192
            +E+ V E  IFVTTTG +DII   H  +MK ++IVCNIGHFD EID+  L+       + 
Sbjct: 263  MEEAVKEGQIFVTTTGCRDIIRGEHFNEMKEDSIVCNIGHFDVEIDVAWLKA-NAKDVVN 321

Query: 1193 IKPQTDRFVFPETKTG--IIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKN 1366
            IKPQ DR+   E K G  II+LA+GRL+NLGCATGHPSFVMSCSFTNQV+AQ+ LW +  
Sbjct: 322  IKPQVDRY---ELKNGRHIILLADGRLVNLGCATGHPSFVMSCSFTNQVLAQIALWTDNT 378

Query: 1367 TGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            +  Y   V++LPK LDE+V                  Q+ Y+ IPV+GPYK  HYRY
Sbjct: 379  S--YPLGVHMLPKKLDEEVARLHLGKLGVKLTTLTSVQSDYLGIPVDGPYKADHYRY 433



>gb:AY278950_1315439 Branchiostoma belcheri tsingtaunese
            adenosylhomocysteinase mRNA, complete cds.
          Length = 434

 Score =  468 bits (1205), Expect = e-130
 Identities = 251/472 (53%), Positives = 303/472 (64%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D+S A+FGR E++LAE  MPGLM  RA++G  +P KGARI G LHMTIQTAVLIET
Sbjct: 9    YKVADLSLAEFGRKEIDLAEHGMPGLMMMRAKYGKDKPLKGARIAGCLHMTIQTAVLIET 68

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L  LGAEV W SCNIFSTQDH              WKGET +EY WC E+ + +  G   
Sbjct: 69   LKELGAEVTWSSCNIFSTQDHAAAAMAKAGVPVYAWKGETDEEYMWCVEQTIYFPDGKPL 128

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGD T L+H                                          KY 
Sbjct: 129  NMILDDGGDLTNLVHT-----------------------------------------KYP 147

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
            ++ E + G+SEETTTGV   Y+M   G L  PAINVNDSVTKSKFDNLYGCR SL DG+ 
Sbjct: 148  KLLEEIKGLSEETTTGVHNPYKMMAKGELKCPAINVNDSVTKSKFDNLYGCRESLVDGIK 207

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATD+M+AGKVAVV GYGDVGKG A +L+  GARV++TEIDPI ALQA MEG QV T+++
Sbjct: 208  RATDIMLAGKVAVVAGYGDVGKGSAQSLRAFGARVLITEIDPINALQAAMEGYQVTTMDE 267

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
                 +IFVT TG  DII   H ++MK +AIVCNIGHFD E+++  L      K+ TIKP
Sbjct: 268  ACKLGNIFVTATGCADIITAKHFQEMKEDAIVCNIGHFDCELEVKWLN--ENAKKDTIKP 325

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYE 1381
            Q DR+  P  +  II+LAEGRL+NLGCATGHPSFVMS SFTNQV+AQ+ELW + +  +Y+
Sbjct: 326  QVDRYTLPSGR-HIILLAEGRLVNLGCATGHPSFVMSNSFTNQVLAQIELWTKPD--QYK 382

Query: 1382 KKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
              V+VLPK LDE+V                 +QA Y+ IP EGPYKP  YRY
Sbjct: 383  IGVFVLPKKLDEEVAEAHLEQLGVKLTKLTDDQAGYLGIPKEGPYKPDFYRY 434



>gb:AE016819_1749078 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome VI, complete sequence.
          Length = 449

 Score =  467 bits (1202), Expect = e-130
 Identities = 260/487 (53%), Positives = 305/487 (62%), Gaps = 13/487 (2%)
 Frame = +2

Query: 116  REYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLI 295
            + YKV D+S A FGR E+EL+E EMPGLMA R  +G +QP KGARI G LHMTIQTAVLI
Sbjct: 6    QNYKVADLSLAAFGRKEIELSEHEMPGLMAIRKAYGDAQPLKGARIAGCLHMTIQTAVLI 65

Query: 296  ETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERAL-DWGPG 472
            ETL ALGAEV W SCNI+STQDH              WKGET +EY WC E+ L  +  G
Sbjct: 66   ETLVALGAEVTWTSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLFAFKDG 125

Query: 473  GGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPK 652
               +LI+DDGGD T L+HE                                         
Sbjct: 126  KKLNLILDDGGDLTTLVHE----------------------------------------- 144

Query: 653  KYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPD 832
            KY  M +   GVSEETTTGV  LY+M + G L  PAINVNDSVTKSKFDNLYGCR SL D
Sbjct: 145  KYPEMLDDCFGVSEETTTGVHHLYRMLKEGKLKVPAINVNDSVTKSKFDNLYGCRESLVD 204

Query: 833  GLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLT 1012
            GL RATDVM+AGKVAVV GYGDVGKGCAAAL+  GARVIVTEIDPI ALQA MEG QV T
Sbjct: 205  GLKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGARVIVTEIDPINALQAAMEGYQVTT 264

Query: 1013 LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT 1192
            ++   S   +FVTTTG +DII   H   M  +AIVCNIGHFD EID+  L+    V+ + 
Sbjct: 265  MDQCASYGQVFVTTTGCRDIIKKEHFLAMPEDAIVCNIGHFDIEIDVAWLKA-NAVEAVN 323

Query: 1193 IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE---- 1360
            IKPQ DR++    +  +I+LA+GRL+NLGCATGH SFVMSCSF+NQV+AQ+ L+K     
Sbjct: 324  IKPQVDRYLLSSGR-HVILLADGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKANDEA 382

Query: 1361 --------KNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPY 1516
                    + TG ++  V+VLPK LDE V                  Q+ Y+ IP EGP+
Sbjct: 383  FRQKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDKLGVKLTKLSSTQSEYLGIPEEGPF 442

Query: 1517 KPPHYRY 1537
            K  HYRY
Sbjct: 443  KADHYRY 449



>gb:AE017344_1755987 Cryptococcus neoformans var. neoformans JEC21
            chromosome 4, complete sequence.
          Length = 431

 Score =  467 bits (1201), Expect = e-130
 Identities = 254/473 (53%), Positives = 301/473 (63%), Gaps = 1/473 (0%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D+S A FGR E+ELAE EMPGLM  R ++  SQP KGARI G LHMTIQTAVLIET
Sbjct: 4    YKVADISLAAFGRKEIELAEHEMPGLMYLREKYAQSQPLKGARIAGCLHMTIQTAVLIET 63

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            LTALGA+V W SCNIFSTQDH              WKGET +EY WC ++ L   PGG  
Sbjct: 64   LTALGAQVTWSSCNIFSTQDHAAAAIAATGVPVFAWKGETEEEYLWCIDQTLKAFPGGQA 123

Query: 482  -DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKY 658
             ++I+DDGGD T L+HE                                         KY
Sbjct: 124  LNMILDDGGDLTSLVHE-----------------------------------------KY 142

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
              +   + GVSEETTTGV  LY+M + G L  PAINVNDSVTKSKFDN YGCR SL DG+
Sbjct: 143  PELLGDVKGVSEETTTGVHHLYKMFKDGKLKVPAINVNDSVTKSKFDNYYGCRESLVDGI 202

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLE 1018
             RATDVM+AGKVAVV G+GDVGKGCA +L+  GARVIVTEIDPI ALQA M G +V T+E
Sbjct: 203  KRATDVMLAGKVAVVAGFGDVGKGCAESLRSYGARVIVTEIDPINALQAAMAGYEVTTME 262

Query: 1019 DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIK 1198
            +     ++FVTTTG +DII  +H + M  +AIV NIGHFD EID+  L+     + + IK
Sbjct: 263  EAAPRGNVFVTTTGCRDIITGAHFEAMPEDAIVSNIGHFDVEIDVAWLKA-NAAECVNIK 321

Query: 1199 PQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKY 1378
            PQ DRF   ++   +I+LAEGRL+NLGC TGHPSFVMSCSF NQV+AQ+ LW   N   Y
Sbjct: 322  PQVDRFTM-KSGRHVILLAEGRLVNLGCGTGHPSFVMSCSFANQVLAQIALW--TNPEAY 378

Query: 1379 EKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
               V++LPK LDE+V                  QA Y+ +PV+GPYKP HYRY
Sbjct: 379  PLGVHMLPKSLDEEVARAHLAQLGIKLTTMTKVQADYLGLPVQGPYKPDHYRY 431



>gb:BC015304_2092144 Mus musculus S-adenosylhomocysteine hydrolase,
            mRNA (cDNA clone MGC:19228 IMAGE:4241917), complete
            cds.>gb:BC061841_2104700 Rattus norvegicus
            S-adenosylhomocysteine hydrolase, mRNA (cDNA clone
            MGC:72509 IMAGE:5599994), complete
            cds.>gb:BC086108_2564695 Xenopus laevis hypothetical
            LOC495745, mRNA (cDNA clone MGC:98492 IMAGE:7198568),
            complete cds.
          Length = 432

 Score =  464 bits (1195), Expect = e-129
 Identities = 253/472 (53%), Positives = 303/472 (64%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D+  A +GR  L++AE EMPGLM  R  +  S+P KGARI G LHMT++TAVLIET
Sbjct: 7    YKVADIGLAAWGRKALDIAENEMPGLMRMREMYSASKPLKGARIAGCLHMTVETAVLIET 66

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L ALGAEVRW SCNIFSTQDH              WKGET +EY WC E+ L +   G  
Sbjct: 67   LVALGAEVRWSSCNIFSTQDHAAAAIAKAGIPVFAWKGETDEEYLWCIEQTLHF-KDGPL 125

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGD T LIH                                          KY 
Sbjct: 126  NMILDDGGDLTNLIHT-----------------------------------------KYP 144

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
            ++   + G+SEETTTGV  LY+M  +G L  PAINVNDSVTKSKFDNLYGCR SL DG+ 
Sbjct: 145  QLLSGIRGISEETTTGVHNLYKMMSNGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIK 204

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATDVMIAGKVAVV GYGDVGKGCA AL+  GARVI+TEIDPI ALQA MEG +V T+++
Sbjct: 205  RATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDE 264

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
               E +IFVTTTG  DII+  H ++MK++AIVCNIGHFD EID+  L     V+++ IKP
Sbjct: 265  ACKEGNIFVTTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNE-NAVEKVNIKP 323

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYE 1381
            Q DR+     +  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW   +  KY 
Sbjct: 324  QVDRYWLKNGRR-IILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPD--KYP 380

Query: 1382 KKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
              V+ LPK LDE V                 +QA Y+ +P+ GP+KP HYRY
Sbjct: 381  VGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMPINGPFKPDHYRY 432



>gb:AY102668_1299071 Drosophila melanogaster GM02466 full insert cDNA.
          Length = 432

 Score =  464 bits (1195), Expect = e-129
 Identities = 251/472 (53%), Positives = 305/472 (64%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D+S A++GR  + +AE EMPGLMACR ++GPS+P KGARITG LHMT+QTAVLIET
Sbjct: 6    YKVADISLAEWGRKAIIIAENEMPGLMACRKKYGPSKPLKGARITGCLHMTVQTAVLIET 65

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L  LGA+V+W SCNIFSTQD+              WKGET +EY WC E+ L +  G   
Sbjct: 66   LVELGAQVQWSSCNIFSTQDNAAAAIAATGVPVYAWKGETDEEYMWCIEQTLVFPDGQPL 125

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGD T L+HE                                         K+ 
Sbjct: 126  NMILDDGGDLTNLVHE-----------------------------------------KFP 144

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
            +  + + G+SEETTTGV  LY+M + G L  PAINVNDSVTKSKFDNLYGCR SL DG+ 
Sbjct: 145  QYLKNIKGLSEETTTGVHNLYKMFKEGRLGVPAINVNDSVTKSKFDNLYGCRESLIDGIK 204

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATDVMIAGKV  V GYGDVGKGCA ALK  G RVIVTE+DPI ALQA MEG +V T+E+
Sbjct: 205  RATDVMIAGKVCCVAGYGDVGKGCAQALKGFGGRVIVTEVDPINALQAAMEGYEVTTMEE 264

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
               EA IFVTTTG +DII   H+++M ++AIVCNIGHFD EID+  L      +++ +KP
Sbjct: 265  ASKEASIFVTTTGCRDIITSVHLQQMPDDAIVCNIGHFDIEIDVDWLNA-NAKEKVNVKP 323

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYE 1381
            Q  R      K  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW + +  KY 
Sbjct: 324  QVIRHTMQSGK-HIILLAEGRLVNLGCAHGHPSFVMSNSFTNQVLAQIELWTKSD--KYA 380

Query: 1382 KKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
              V+VLPK LDE+V                 +QA Y+ +   GP+KP HYRY
Sbjct: 381  VGVHVLPKILDEEVASLHLEKLGVKLTKLTEKQATYLGVSQTGPFKPDHYRY 432



>sp|P50247|SAHH_MOUSE Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Liver
            copper binding protein) (CUBP).
          Length = 431

 Score =  464 bits (1195), Expect = e-129
 Identities = 253/472 (53%), Positives = 303/472 (64%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D+  A +GR  L++AE EMPGLM  R  +  S+P KGARI G LHMT++TAVLIET
Sbjct: 6    YKVADIGLAAWGRKALDIAENEMPGLMRMREMYSASKPLKGARIAGCLHMTVETAVLIET 65

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L ALGAEVRW SCNIFSTQDH              WKGET +EY WC E+ L +   G  
Sbjct: 66   LVALGAEVRWSSCNIFSTQDHAAAAIAKAGIPVFAWKGETDEEYLWCIEQTLHF-KDGPL 124

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGD T LIH                                          KY 
Sbjct: 125  NMILDDGGDLTNLIHT-----------------------------------------KYP 143

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
            ++   + G+SEETTTGV  LY+M  +G L  PAINVNDSVTKSKFDNLYGCR SL DG+ 
Sbjct: 144  QLLSGIRGISEETTTGVHNLYKMMSNGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIK 203

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATDVMIAGKVAVV GYGDVGKGCA AL+  GARVI+TEIDPI ALQA MEG +V T+++
Sbjct: 204  RATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDE 263

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
               E +IFVTTTG  DII+  H ++MK++AIVCNIGHFD EID+  L     V+++ IKP
Sbjct: 264  ACKEGNIFVTTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNE-NAVEKVNIKP 322

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYE 1381
            Q DR+     +  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW   +  KY 
Sbjct: 323  QVDRYWLKNGRR-IILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPD--KYP 379

Query: 1382 KKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
              V+ LPK LDE V                 +QA Y+ +P+ GP+KP HYRY
Sbjct: 380  VGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMPINGPFKPDHYRY 431



>sp|O76757|SAHH_ANOGA Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:AF080546_1239575 Anopheles gambiae
            S-adenosyl-L-homocysteine hydrolase mRNA, complete cds.
          Length = 432

 Score =  464 bits (1195), Expect = e-129
 Identities = 257/472 (54%), Positives = 304/472 (64%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D+S A+FGR E+ LAE EMPGLMACR ++GP +  +GARI G LHMTIQTAVLIET
Sbjct: 6    YKVADISLAEFGRKEIVLAENEMPGLMACRQKYGPLKILRGARIAGCLHMTIQTAVLIET 65

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L  LGAEV+W SCNIFSTQDH              WKGET +EY WC  + L +  G   
Sbjct: 66   LIELGAEVQWSSCNIFSTQDHAAAAMVKAGVPVYAWKGETDEEYMWCIRQTLIFPDGKPL 125

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGD T L+H                       AE   +L  IR           
Sbjct: 126  NMILDDGGDLTNLVH-----------------------AEHPELLKEIR----------- 151

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
                   G+SEETTTGV  LY+M   G L  PAINVNDSVTKSKFDNLYGCR SL DG+ 
Sbjct: 152  -------GLSEETTTGVHNLYKMFREGRLGMPAINVNDSVTKSKFDNLYGCRESLLDGIK 204

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATDVMIAGKV VV GYGDVGKGCA AL+ +G RV++TEIDPI ALQA MEG +V T+E+
Sbjct: 205  RATDVMIAGKVCVVAGYGDVGKGCAQALRGSGGRVLITEIDPINALQAAMEGKEVTTMEE 264

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
               EA IFVTTTG  DIIM  H   MK+++IVCNIGHFD EI++  L+    V+++ IKP
Sbjct: 265  ASKEAQIFVTTTGCTDIIMGEHFLNMKDDSIVCNIGHFDCEINVTWLQE-NAVEKVNIKP 323

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYE 1381
            Q DR+        II+LAEGRL+NLGCA GH SFVMS SFTNQV+AQ+ELW   N  +Y 
Sbjct: 324  QVDRYRL-ANGNHIILLAEGRLVNLGCAMGHSSFVMSNSFTNQVLAQIELW--TNREQYA 380

Query: 1382 KKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
              V+VLPK LD++V                  Q  Y+++PVEGPYKP HYRY
Sbjct: 381  IGVHVLPKKLDDEVAALHLDKLGVKLTKLSARQPEYLNLPVEGPYKPEHYRY 432



>gb:MUSSAHH_2129955 Mus musculus (clone C7/B9) S-adenosyl homocysteine
            hydrolase (ahcy) mRNA, complete cds.
          Length = 432

 Score =  464 bits (1194), Expect = e-129
 Identities = 253/472 (53%), Positives = 303/472 (64%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D+  A +GR  L++AE EMPGLM  R  +  S+P KGARI G LHMT++TAVLIET
Sbjct: 7    YKVADIGLAAWGRKALDIAENEMPGLMRMREMYSASKPLKGARIAGCLHMTVETAVLIET 66

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L ALGAEVRW SCNIFSTQDH              WKGET +EY WC E+ L +   G  
Sbjct: 67   LVALGAEVRWSSCNIFSTQDHAAAAIAKAGIPVFAWKGETDEEYLWCIEQTLHF-KDGPL 125

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGD T LIH                                          KY 
Sbjct: 126  NMILDDGGDLTNLIHT-----------------------------------------KYP 144

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
            ++   + G+SEETTTGV  LY+M  +G L  PAINVNDSVTKSKFDNLYGCR SL DG+ 
Sbjct: 145  QLLSGIRGISEETTTGVHNLYKMMSNGILNVPAINVNDSVTKSKFDNLYGCRESLIDGIK 204

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATDVMIAGKVAVV GYGDVGKGCA AL+  GARVI+TEIDPI ALQA MEG +V T+++
Sbjct: 205  RATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDE 264

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
               E +IFVTTTG  DII+  H ++MK++AIVCNIGHFD EID+  L     V+++ IKP
Sbjct: 265  ACKEGNIFVTTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNE-NAVEKVNIKP 323

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYE 1381
            Q DR+     +  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW   +  KY 
Sbjct: 324  QVDRYWLKNGRR-IILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPD--KYP 380

Query: 1382 KKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
              V+ LPK LDE V                 +QA Y+ +P+ GP+KP HYRY
Sbjct: 381  VGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMPINGPFKPDHYRY 432



>gb:BC086781_2109794 Mus musculus cDNA clone MGC:102079 IMAGE:6828058,
            complete cds.
          Length = 432

 Score =  464 bits (1194), Expect = e-129
 Identities = 253/472 (53%), Positives = 302/472 (63%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D+  A +GR  L++AE EMPGLM  R  +  S+P KGARI G LHMT++TAVLIET
Sbjct: 7    YKVADIGLAAWGRKALDIAENEMPGLMRMREMYSASKPLKGARIAGCLHMTVETAVLIET 66

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L ALGAEVRW SCNIFSTQDH              WKGET +EY WC E+ L +   G  
Sbjct: 67   LVALGAEVRWSSCNIFSTQDHAAAAIAKAGIPVFAWKGETDEEYLWCIEQTLHF-KDGPL 125

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGD T LIH                                          KY 
Sbjct: 126  NMILDDGGDLTNLIHT-----------------------------------------KYP 144

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
            ++   + G+SEETTTGV  LY M  +G L  PAINVNDSVTKSKFDNLYGCR SL DG+ 
Sbjct: 145  QLLSGIRGISEETTTGVHNLYNMMSNGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIK 204

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATDVMIAGKVAVV GYGDVGKGCA AL+  GARVI+TEIDPI ALQA MEG +V T+++
Sbjct: 205  RATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDE 264

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
               E +IFVTTTG  DII+  H ++MK++AIVCNIGHFD EID+  L     V+++ IKP
Sbjct: 265  ACKEGNIFVTTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNE-NAVEKVNIKP 323

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYE 1381
            Q DR+     +  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW   +  KY 
Sbjct: 324  QVDRYWLKNGRR-IILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPD--KYP 380

Query: 1382 KKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
              V+ LPK LDE V                 +QA Y+ +P+ GP+KP HYRY
Sbjct: 381  VGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMPINGPFKPDHYRY 432



>sp|Q27580|SAHH_DROME Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:DMAHCYGEN_1378034 D.melanogaster mRNA for
            S-adenosyl-L-homocysteine hydrolase.
          Length = 431

 Score =  463 bits (1192), Expect = e-129
 Identities = 251/474 (52%), Positives = 306/474 (64%), Gaps = 2/474 (0%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D+S A++GR  + +AE EMPGLMACR ++GPS+P KGARITG LHMT+QTAVLIET
Sbjct: 6    YKVADISLAEWGRKAIIIAENEMPGLMACRKKYGPSKPLKGARITGCLHMTVQTAVLIET 65

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L  LGA+V+W SCNIFSTQD+              WKGET +EY WC E+ L +  G   
Sbjct: 66   LVELGAQVQWSSCNIFSTQDNAAAAIAATGVPVYAWKGETDEEYMWCIEQTLVFPDGQPL 125

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGD T L+HE                                         K+ 
Sbjct: 126  NMILDDGGDLTNLVHE-----------------------------------------KFP 144

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
            +  + + G+SEETTTGV  LY+M + G L  PAINVNDSVTKSKFDNLYGCR SL DG+ 
Sbjct: 145  QFLKNIKGLSEETTTGVHNLYKMFKEGRLGVPAINVNDSVTKSKFDNLYGCRESLIDGIK 204

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATDVMIAGKV  V GYGDVGKGCA ALK  G RVIVTE+DPI ALQA MEG +V T+E+
Sbjct: 205  RATDVMIAGKVCCVAGYGDVGKGCAQALKGFGGRVIVTEVDPINALQAAMEGYEVTTMEE 264

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
               EA IFVTTTG +DII   H+++M ++ IVCNIGHFD EID+  L      +++ +KP
Sbjct: 265  GSKEASIFVTTTGCRDIITSVHLQQMPDDRIVCNIGHFDIEIDVDWLNA-NAKEKVNVKP 323

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW--KEKNTGK 1375
            Q DR+     K  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW   +K+ G 
Sbjct: 324  QVDRYTMKSGK-HIILLAEGRLVNLGCADGHPSFVMSNSFTNQVLAQIELWTKSDKSVG- 381

Query: 1376 YEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
                V+VLPK LDE+V                 +QA Y+ +   GP+KP HYRY
Sbjct: 382  ----VHVLPKILDEEVASLHLEKLGVKLTKLTEKQATYLGVSQTGPFKPDHYRY 431



>gb:AJ853475_1814921 Nicotiana glauca partial mRNA for putative
            adenosylhomocysteinase (ahc gene).
          Length = 264

 Score =  463 bits (1191), Expect = e-129
 Identities = 227/264 (85%), Positives = 238/264 (90%)
 Frame = +2

Query: 746  LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAL 925
            LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAAL
Sbjct: 1    LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAAL 60

Query: 926  KQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKN 1105
            KQAGARVIVTEIDPICALQA MEGLQVLTLEDVVS+ DIFVTTTGNKDIIMV HM+KMKN
Sbjct: 61   KQAGARVIVTEIDPICALQATMEGLQVLTLEDVVSDVDIFVTTTGNKDIIMVDHMRKMKN 120

Query: 1106 NAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCA 1285
            NAIVCNIGHFDNEIDM GLETYPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCA
Sbjct: 121  NAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCA 180

Query: 1286 TGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXX 1465
            TGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKV              
Sbjct: 181  TGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTK 240

Query: 1466 XXPEQAAYISIPVEGPYKPPHYRY 1537
               +QA YIS+PVEGPYKP HYRY
Sbjct: 241  LSKDQADYISVPVEGPYKPAHYRY 264



>gb:SSC427478_1445205 Sus scrofa ASIP gene for agouti signalling
            protein and AHCY gene for S-adenosylhomocysteine
            hydrolase.
          Length = 432

 Score =  463 bits (1191), Expect = e-129
 Identities = 256/474 (54%), Positives = 305/474 (64%), Gaps = 2/474 (0%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D+S A +GR  L+LAE EMPGLM  R  +  S+P KGARI G LHMT++TAVLIET
Sbjct: 7    YKVADISLAAWGRKALDLAENEMPGLMRMREMYSASKPLKGARIAGCLHMTVETAVLIET 66

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L ALGAEVRW SCNIFSTQDH              WKGET +EY WC E+ L +   G  
Sbjct: 67   LVALGAEVRWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTL-YFKDGPL 125

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGD T L+H                                          KY 
Sbjct: 126  NMILDDGGDLTNLVHT-----------------------------------------KYP 144

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
             +   + G+SEETTTGV  LY+M+ +G L  PAINVNDSVTKSKFDNLYGCR SL DG+ 
Sbjct: 145  ELLSGIRGISEETTTGVHNLYKMKANGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIK 204

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATDVMIAGKVAVV GYGDVGKGCA AL+  GARVI+TEIDPI ALQA MEG +V T+++
Sbjct: 205  RATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDE 264

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
               E +IFVTTTG  DII+  H ++MK++AIVCNIGHFD EID+  L     V+++ IKP
Sbjct: 265  ACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNE-NAVEKVNIKP 323

Query: 1202 QTDRFVFPETKTG--IIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGK 1375
            Q DR++    K G  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW   +  K
Sbjct: 324  QVDRYLL---KNGHRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVLAQIELWTHPD--K 378

Query: 1376 YEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            Y   V+ LPK LDE V                 +QA Y+ +  EGP+KP HYRY
Sbjct: 379  YPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMSREGPFKPDHYRY 432



>pir|A26583|A26583 adenosylhomocysteinase (EC 3.3.1.1) -
            rat>gb:RATAHHA_2131427 Rat S-adenosyl-L-homocysteine
            hydrolase mRNA, complete cds.>gb:RNU14937_2136895 Rattus
            norvegicus S-adenosyl-L-homocysteine hydrolase gene,
            complete cds.
          Length = 432

 Score =  463 bits (1191), Expect = e-129
 Identities = 254/474 (53%), Positives = 305/474 (64%), Gaps = 2/474 (0%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D+  A +GR  L++AE EMPGLM  R  +  S+P KGARI G LHMT++TAVLIET
Sbjct: 7    YKVADIGLAAWGRKALDIAENEMPGLMRMREMYSASKPLKGARIAGCLHMTVETAVLIET 66

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L ALGAEVRW SCNIFSTQDH              WKGET +EY WC E+ L +   G  
Sbjct: 67   LVALGAEVRWSSCNIFSTQDHAAAAIAKAGIPVFAWKGETDEEYLWCIEQTLHF-KDGPL 125

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGD T LIH                                          K+ 
Sbjct: 126  NMILDDGGDLTNLIHT-----------------------------------------KHP 144

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
            ++   + G+SEETTTGV  LY+M  +G L  PAINVNDSVTKSKFDNLYGCR SL DG+ 
Sbjct: 145  QLLSGIRGISEETTTGVHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIK 204

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATDVMIAGKVAVV GYGDVGKGCA AL+  GARVI+TEIDPI ALQA MEG +V T+++
Sbjct: 205  RATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDE 264

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
               E +IFVTTTG  DII+  H ++MK++AIVCNIGHFD EID+  L     V+++ IKP
Sbjct: 265  ACKEGNIFVTTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNE-NAVEKVNIKP 323

Query: 1202 QTDRFVFPETKTG--IIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGK 1375
            Q DR++    K G  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW   +  K
Sbjct: 324  QVDRYLL---KNGHRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPD--K 378

Query: 1376 YEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            Y   V+ LPK LDE V                 +QA Y+ +P+ GP+KP HYRY
Sbjct: 379  YPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMPINGPFKPDHYRY 432



>sp|P10760|SAHH_RAT Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase).
          Length = 431

 Score =  463 bits (1191), Expect = e-129
 Identities = 254/474 (53%), Positives = 305/474 (64%), Gaps = 2/474 (0%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D+  A +GR  L++AE EMPGLM  R  +  S+P KGARI G LHMT++TAVLIET
Sbjct: 6    YKVADIGLAAWGRKALDIAENEMPGLMRMREMYSASKPLKGARIAGCLHMTVETAVLIET 65

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L ALGAEVRW SCNIFSTQDH              WKGET +EY WC E+ L +   G  
Sbjct: 66   LVALGAEVRWSSCNIFSTQDHAAAAIAKAGIPVFAWKGETDEEYLWCIEQTLHF-KDGPL 124

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGD T LIH                                          K+ 
Sbjct: 125  NMILDDGGDLTNLIHT-----------------------------------------KHP 143

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
            ++   + G+SEETTTGV  LY+M  +G L  PAINVNDSVTKSKFDNLYGCR SL DG+ 
Sbjct: 144  QLLSGIRGISEETTTGVHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIK 203

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATDVMIAGKVAVV GYGDVGKGCA AL+  GARVI+TEIDPI ALQA MEG +V T+++
Sbjct: 204  RATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDE 263

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
               E +IFVTTTG  DII+  H ++MK++AIVCNIGHFD EID+  L     V+++ IKP
Sbjct: 264  ACKEGNIFVTTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNE-NAVEKVNIKP 322

Query: 1202 QTDRFVFPETKTG--IIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGK 1375
            Q DR++    K G  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW   +  K
Sbjct: 323  QVDRYLL---KNGHRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPD--K 377

Query: 1376 YEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            Y   V+ LPK LDE V                 +QA Y+ +P+ GP+KP HYRY
Sbjct: 378  YPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMPINGPFKPDHYRY 431



>gb:CR382121_1654313 Kluyveromyces lactis strain NRRL Y-1140
            chromosome A of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 449

 Score =  462 bits (1190), Expect = e-129
 Identities = 259/491 (52%), Positives = 306/491 (62%), Gaps = 13/491 (2%)
 Frame = +2

Query: 104  TSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQT 283
            ++    YKV D+S A FGR E+ELAE EMPGL+A R  +G  QP KGARI G LHMTIQT
Sbjct: 2    SAPAHNYKVADISLAAFGRKEIELAEHEMPGLIAIREAYGAEQPLKGARIAGCLHMTIQT 61

Query: 284  AVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERAL-D 460
            AVLIETL ALGAEV W SCNI+STQDH              WKGET +EY WC E+ L  
Sbjct: 62   AVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLFA 121

Query: 461  WGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLK 640
            +      +LI+DDGGD T L+H+                                     
Sbjct: 122  FKDDKKLNLILDDGGDLTSLVHD------------------------------------- 144

Query: 641  ADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRH 820
                KY  M     G+SEETTTGV  LY+M +   L  PAINVNDSVTKSKFDNLYGCR 
Sbjct: 145  ----KYPDMLMDCFGLSEETTTGVHHLYRMVKENKLKVPAINVNDSVTKSKFDNLYGCRE 200

Query: 821  SLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGL 1000
            SL DG+ RATDVM+AGKVAVV GYGDVGKGCAAAL+  GARVIVTEIDPI ALQA MEG 
Sbjct: 201  SLIDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGFGARVIVTEIDPINALQAAMEGY 260

Query: 1001 QVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGV 1180
            QV+ +E+ VS   +FVTTTG +DII   H  +M  +AIVCNIGHFD EID+  L+     
Sbjct: 261  QVIPMEEAVSSGQVFVTTTGCRDIITKEHFLQMPEDAIVCNIGHFDIEIDVAWLKA-NAT 319

Query: 1181 KRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE 1360
            + I IKPQ DR++ P  K  +I+LA+GRL+NLGCATGH SFVMSCSF+NQV+AQ+ L+K 
Sbjct: 320  EVINIKPQVDRYLLPSGK-HVILLADGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKA 378

Query: 1361 KN------------TGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPV 1504
            ++            TG ++  V+VLPK LDE V                  Q+ Y+ IP 
Sbjct: 379  QDKAFREKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDNLGVKLTKLSDVQSEYLGIPE 438

Query: 1505 EGPYKPPHYRY 1537
            EGPYK  HYRY
Sbjct: 439  EGPYKADHYRY 449



>sp|P39954|SAHH_YEAST Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>pir|S50546|S50546 adenosylhomocysteinase (EC
            3.3.1.1) - yeast (Saccharomyces
            cerevisiae)>gb:AY692801_1622848 Saccharomyces cerevisiae
            clone FLH112851.01X YER043C gene, complete
            cds.>gb:SCE9379_1708091 Saccharomyces cerevisiae
            chromosome V cosmids 9379, 9581, and lambda clone 4678.
          Length = 449

 Score =  460 bits (1183), Expect = e-128
 Identities = 258/491 (52%), Positives = 304/491 (61%), Gaps = 13/491 (2%)
 Frame = +2

Query: 104  TSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQT 283
            ++  + YK+ D+S A FGR E+ELAE EMPGLMA R  +G  QP KGARI G LHMTIQT
Sbjct: 2    SAPAQNYKIADISLAAFGRKEIELAEHEMPGLMAIRKAYGDVQPLKGARIAGCLHMTIQT 61

Query: 284  AVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERAL-D 460
            AVLIETL ALGAEV W SCNI+STQDH              WKGET +EY WC E+ L  
Sbjct: 62   AVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLFA 121

Query: 461  WGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLK 640
            +      +LI+DDGGD T L+HE                                     
Sbjct: 122  FKDNKKLNLILDDGGDLTTLVHE------------------------------------- 144

Query: 641  ADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRH 820
                K+  M E   G+SEETTTGV  LY+M + G L  PAINVNDSVTKSKFDNLYGCR 
Sbjct: 145  ----KHPEMLEDCFGLSEETTTGVHHLYRMVKEGKLKVPAINVNDSVTKSKFDNLYGCRE 200

Query: 821  SLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGL 1000
            SL DG+ RATDVM+AGKVAVV GYGDVGKGCAAAL+  GARV+VTEIDPI ALQA MEG 
Sbjct: 201  SLVDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGARVLVTEIDPINALQAAMEGY 260

Query: 1001 QVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGV 1180
            QV+T+ED      +FVTTTG +DII   H   M  +AIVCNIGHFD EID+  L+     
Sbjct: 261  QVVTMEDASHIGQVFVTTTGCRDIINGEHFINMPEDAIVCNIGHFDIEIDVAWLKA-NAK 319

Query: 1181 KRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE 1360
            + I IKPQ DR++    +  +I+LA GRL+NLGCATGH SFVMSCSF+NQV+AQ+ L+K 
Sbjct: 320  ECINIKPQVDRYLLSSGR-HVILLANGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKS 378

Query: 1361 ------------KNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPV 1504
                        + TG +E  V+VLPK LDE V                  Q+ Y+ IP 
Sbjct: 379  NDKSFREKHIEFQKTGPFEVGVHVLPKILDEAVAKFHLGNLGVRLTKLSKVQSEYLGIPE 438

Query: 1505 EGPYKPPHYRY 1537
            EGP+K  HYRY
Sbjct: 439  EGPFKADHYRY 449



>gb:CR380949_1649503 Candida glabrata strain CBS138 chromosome C
            complete sequence.
          Length = 449

 Score =  457 bits (1176), Expect = e-127
 Identities = 253/491 (51%), Positives = 303/491 (61%), Gaps = 13/491 (2%)
 Frame = +2

Query: 104  TSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQT 283
            ++  + YK+ D+S A FGR E+ELAE EMPGLMA R  +  +QP KGARI G LHMTIQT
Sbjct: 2    SAPAQNYKIADISLAAFGRKEIELAENEMPGLMAIRKAYAEAQPLKGARIAGCLHMTIQT 61

Query: 284  AVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERAL-D 460
            AVLIETL ALGAEV W SCNI+STQDH              WKGET +EY WC E+ L  
Sbjct: 62   AVLIETLVALGAEVTWTSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYMWCIEQQLFA 121

Query: 461  WGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLK 640
            +      +LI+DDGGD T  +HE                                     
Sbjct: 122  FKDNKKLNLILDDGGDLTSFVHE------------------------------------- 144

Query: 641  ADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRH 820
                KY  M     G+SEETTTGV  LY+M   G L  PAINVND+VTKSKFDNLYGCR 
Sbjct: 145  ----KYPEMLTDCFGLSEETTTGVHHLYRMMREGKLKVPAINVNDAVTKSKFDNLYGCRE 200

Query: 821  SLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGL 1000
            SL DG+ RATDVM+AGKVAVV G+GDVGKGCAA+L+  GARV+VTEIDPI ALQA MEG 
Sbjct: 201  SLVDGIKRATDVMLAGKVAVVAGFGDVGKGCAASLRGMGARVLVTEIDPINALQAAMEGY 260

Query: 1001 QVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGV 1180
            +V T+ED  S   +FVTTTG +DII   H +KM  +AIVCNIGHFD EID+  L+     
Sbjct: 261  EVTTMEDAASVGQVFVTTTGCRDIIKGEHFEKMPEDAIVCNIGHFDIEIDVAWLKE-NAK 319

Query: 1181 KRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE 1360
            + I IKPQ DR++    +  +I+LA GRL+NLGCATGH SFVMSCSF+NQV+AQ+ L+K 
Sbjct: 320  ECINIKPQVDRYLLSSGR-HVILLANGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKS 378

Query: 1361 ------------KNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPV 1504
                        + TG +E  V+VLPK LDE V                  Q+ Y+ IP 
Sbjct: 379  DDKAFRTKFVEFEKTGPFEVGVHVLPKILDEAVAKFHLEKLGVKLTTLSDVQSEYLGIPQ 438

Query: 1505 EGPYKPPHYRY 1537
            +GP+K  HYRY
Sbjct: 439  QGPFKADHYRY 449



>gb:BT007625_2150557 Synthetic construct Homo sapiens
            S-adenosylhomocysteine hydrolase mRNA, partial cds.
          Length = 433

 Score =  457 bits (1175), Expect = e-127
 Identities = 250/472 (52%), Positives = 301/472 (63%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D+  A +GR  L++AE EMPGLM  R  +  S+P KGARI G LHMT++TAVLIET
Sbjct: 7    YKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIET 66

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L  LGAEV+W SCNIFSTQDH              WKGET +EY WC E+ L +   G  
Sbjct: 67   LVTLGAEVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTL-YFKDGPL 125

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGD T LIH                                          KY 
Sbjct: 126  NMILDDGGDLTNLIHT-----------------------------------------KYP 144

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
            ++   + G+SEETTTGV  LY+M  +G L  PAINVNDSVTKSKFDNLYGCR SL DG+ 
Sbjct: 145  QLLPGIRGISEETTTGVHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIK 204

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATDVMIAGKVAVV GYGDVGKGCA AL+  GARVI+TEIDPI ALQA MEG +V T+++
Sbjct: 205  RATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDE 264

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
               E +IFVTTTG  DII+  H ++MK++AIVCNIGHFD EID+  L     V+++ IKP
Sbjct: 265  ACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNE-NAVEKVNIKP 323

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYE 1381
            Q DR+     +  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW   +  KY 
Sbjct: 324  QVDRYRLKNGRR-IILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPD--KYP 380

Query: 1382 KKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
              V+ LPK LDE V                 +QA Y+ +  +GP+KP HYRY
Sbjct: 381  VGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHYRY 432



>sp|P23526|SAHH_HUMAN Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>pir|A43629|A43629 adenosylhomocysteinase (EC
            3.3.1.1) - human>gb:AL356299_1924403 Human DNA sequence
            from clone CTD-3216D2 on chromosome 20 Contains the AHCY
            gene encoding S-adenosylhomocysteine hydrolase, the 5'
            end of the ITCH gene for itchy homolog E3 ubiquitin
            protein ligase (mouse), the CDC42P1 gene for cell
            division cycle 42 pseudogene 1, a pseudogene similar to
            part of laminin receptor 1 (ribosomal protein SA, 67kDa)
            (LAMR1) and two CpG islands, complete
            sequence.>gb:BC010018_1972428 Homo sapiens
            S-adenosylhomocysteine hydrolase, mRNA (cDNA clone
            MGC:19639 IMAGE:2905378), complete
            cds.>gb:BC011606_1973071 Homo sapiens
            S-adenosylhomocysteine hydrolase, mRNA (cDNA clone
            MGC:2319 IMAGE:3139231), complete
            cds.>gb:BT006697_1990135 Homo sapiens
            S-adenosylhomocysteine hydrolase mRNA, complete
            cds.>gb:HUMAHCY2_2029085 Human S-adenosylhomocysteine
            hydrolase (AHCY) mRNA, complete cds.
          Length = 432

 Score =  457 bits (1175), Expect = e-127
 Identities = 250/472 (52%), Positives = 301/472 (63%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D+  A +GR  L++AE EMPGLM  R  +  S+P KGARI G LHMT++TAVLIET
Sbjct: 7    YKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIET 66

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L  LGAEV+W SCNIFSTQDH              WKGET +EY WC E+ L +   G  
Sbjct: 67   LVTLGAEVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTL-YFKDGPL 125

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGD T LIH                                          KY 
Sbjct: 126  NMILDDGGDLTNLIHT-----------------------------------------KYP 144

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
            ++   + G+SEETTTGV  LY+M  +G L  PAINVNDSVTKSKFDNLYGCR SL DG+ 
Sbjct: 145  QLLPGIRGISEETTTGVHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIK 204

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATDVMIAGKVAVV GYGDVGKGCA AL+  GARVI+TEIDPI ALQA MEG +V T+++
Sbjct: 205  RATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDE 264

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
               E +IFVTTTG  DII+  H ++MK++AIVCNIGHFD EID+  L     V+++ IKP
Sbjct: 265  ACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNE-NAVEKVNIKP 323

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYE 1381
            Q DR+     +  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW   +  KY 
Sbjct: 324  QVDRYRLKNGRR-IILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPD--KYP 380

Query: 1382 KKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
              V+ LPK LDE V                 +QA Y+ +  +GP+KP HYRY
Sbjct: 381  VGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHYRY 432



>sp|P10819|SAHH_DICDI Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>pir|A27655|A27655 adenosylhomocysteinase (EC
            3.3.1.1) - slime mold  (Dictyostelium
            discoideum)>gb:DDIAHHA_1377016 Slime mold (D.discoideum)
            S-adenosyl-L-homocysteine hydrolase mRNA, complete cds.
          Length = 430

 Score =  457 bits (1175), Expect = e-127
 Identities = 249/472 (52%), Positives = 301/472 (63%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKVKD+S A +GR E+E+A  EMPGLM  R ++GP+Q  KGARI G LHMTIQTAVLIET
Sbjct: 6    YKVKDISLAAWGRKEIEIAANEMPGLMTLRKKYGPAQILKGARIAGCLHMTIQTAVLIET 65

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            LTALGA+V+W SCNIFSTQD               WKGET +EY WC E+ + +   G  
Sbjct: 66   LTALGAQVQWSSCNIFSTQDQAAAAIAATGVPVYAWKGETEEEYNWCVEQTIVF-QDGPL 124

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGD T L+HE                                         KY 
Sbjct: 125  NMILDDGGDLTTLVHE-----------------------------------------KYP 143

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
            +    + G+SEETT GV  LY+M + G L  PAINVNDSVTKSKFDNLYGCR SL DG+ 
Sbjct: 144  QFLAGIKGISEETTHGVHNLYKMFKEGKLKVPAINVNDSVTKSKFDNLYGCRESLIDGIK 203

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATDVMIAGKVAVV GYGDVGKGCA +L + GARV+VTEIDPI ALQA M+G Q++T+E 
Sbjct: 204  RATDVMIAGKVAVVAGYGDVGKGCAQSLSKMGARVLVTEIDPINALQACMDGYQIVTMET 263

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
                ++IFVTTTG +DI+   H   MK +AIVCNIGHFD EID+  L      K+ T+KP
Sbjct: 264  AAPLSNIFVTTTGCRDIVRGEHFAVMKEDAIVCNIGHFDCEIDVAWLNA--NAKKDTVKP 321

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYE 1381
            Q DR+        II+LAEGRL+NLGC TGHPSFVMS SF NQ +AQ+ LW +  T +Y 
Sbjct: 322  QVDRYTL-ANGVHIILLAEGRLVNLGCGTGHPSFVMSNSFCNQTLAQIALWTK--TEEYP 378

Query: 1382 KKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
              V++LPK LDE+V                 +Q+ Y+S+PV GPYK  HYRY
Sbjct: 379  LGVHLLPKILDEEVARLHLDQLGAKLTTLTEKQSEYLSVPVAGPYKVDHYRY 430



>gb:HUMAHCY_2029084 Human S-adenosylhomocysteine hydrolase (AHCY)
            mRNA, complete cds.
          Length = 432

 Score =  455 bits (1170), Expect = e-126
 Identities = 249/472 (52%), Positives = 301/472 (63%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D+  A +GR  L++AE EMPGLM  R  +  S+P KGARI G LHMT++TAVLIET
Sbjct: 7    YKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIET 66

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L  LGAEV+W SCNIFSTQ+H              WKGET +EY WC E+ L +   G  
Sbjct: 67   LVTLGAEVQWSSCNIFSTQNHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTL-YFKDGPL 125

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGD T LIH                                          KY 
Sbjct: 126  NMILDDGGDLTNLIHT-----------------------------------------KYP 144

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
            ++   + G+SEETTTGV  LY+M  +G L  PAINVNDSVTKSKFDNLYGCR SL DG+ 
Sbjct: 145  QLLPGIRGISEETTTGVHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIK 204

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATDVMIAGKVAVV GYGDVGKGCA AL+  GARVI+TEIDPI ALQA MEG +V T+++
Sbjct: 205  RATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDE 264

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
               E +IFVTTTG  DII+  H ++MK++AIVCNIGHFD EID+  L     V+++ IKP
Sbjct: 265  ACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNE-NAVEKVNIKP 323

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYE 1381
            Q DR+     +  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW   +  KY 
Sbjct: 324  QVDRYRLKNGRR-IILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPD--KYP 380

Query: 1382 KKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
              V+ LPK LDE V                 +QA Y+ +  +GP+KP HYRY
Sbjct: 381  VGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHYRY 432



>gb:CR382132_1665432 Yarrowia lipolytica chromosome F of strain CLIB99
            of Yarrowia lipolytica.
          Length = 449

 Score =  454 bits (1167), Expect = e-126
 Identities = 257/485 (52%), Positives = 296/485 (61%), Gaps = 13/485 (2%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D+  A FGR E+ELAE EMPGLM  R ++   QP KGARI G LHMTIQTAVLIET
Sbjct: 8    YKVADIGLAAFGRKEIELAENEMPGLMQTREKYAAVQPLKGARIAGCLHMTIQTAVLIET 67

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALD-WGPGGG 478
            L ALGAEV W SCNIFSTQDH              WKGET +EY WC E+ L  +  G  
Sbjct: 68   LVALGAEVTWSSCNIFSTQDHAAAAIAAAGVPVFAWKGETEEEYNWCIEQQLKAFKDGKK 127

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKY 658
             ++I+DDGGD T L+HE                                         KY
Sbjct: 128  LNMILDDGGDLTTLVHE-----------------------------------------KY 146

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
                +   G+SEETTTGV  LY+M + G L  PAINVNDSVTKSKFDNLYGCR SL DG+
Sbjct: 147  PEQLDDCFGLSEETTTGVHHLYRMMKEGKLKVPAINVNDSVTKSKFDNLYGCRESLIDGI 206

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLE 1018
             RATDVMIAGK AVV G+GDVGKGCA AL+  GARVIVTEIDPI ALQA + G QVL +E
Sbjct: 207  KRATDVMIAGKTAVVAGFGDVGKGCAQALQSFGARVIVTEIDPINALQASVSGYQVLPME 266

Query: 1019 DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIK 1198
            +      IFVTTTG +DII   H  +M N+AIVCNIGHFD EID+  L+       + IK
Sbjct: 267  EACKVGQIFVTTTGCRDIITGEHFSQMPNDAIVCNIGHFDIEIDVAWLKA-NAKNVVNIK 325

Query: 1199 PQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKN---- 1366
            PQ DRF  P  +  +I+LAEGRL+NLGCATGH SFVMSCSFTNQV+AQ+ L+  KN    
Sbjct: 326  PQVDRFEMPSGR-HVILLAEGRLVNLGCATGHSSFVMSCSFTNQVLAQIALFNAKNDEFR 384

Query: 1367 --------TGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKP 1522
                    +G +E  V+VLPK LDE+V                  QA Y+ I  EGPYK 
Sbjct: 385  KKHVEFAKSGPFEVGVHVLPKILDEEVARLHLDHLGVKLSKLSDVQAEYLGIAQEGPYKA 444

Query: 1523 PHYRY 1537
              YRY
Sbjct: 445  DIYRY 449



>gb:CR382139_1672908 Debaryomyces hansenii chromosome G of strain
            CBS767 of Debaryomyces hansenii.
          Length = 449

 Score =  453 bits (1165), Expect = e-126
 Identities = 256/485 (52%), Positives = 304/485 (62%), Gaps = 13/485 (2%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D+S A FGR ++EL+E EMPGLM  R ++G SQP KGAR+ G LHMTIQTAVLIET
Sbjct: 8    YKVADISLAAFGRKDIELSENEMPGLMDIRKKYGSSQPLKGARVAGCLHMTIQTAVLIET 67

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERAL-DWGPGGG 478
            L ALGAEV W SCNIFSTQDH              WKGET +EY WC E+ L  +  G  
Sbjct: 68   LVALGAEVTWSSCNIFSTQDHAAAAIAAAGVPVFAWKGETDEEYEWCIEQQLFAFKDGKK 127

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKY 658
             +LI+DDGGD T L+H                                         KKY
Sbjct: 128  LNLILDDGGDLTTLVH-----------------------------------------KKY 146

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
              M +   G+SEETTTGV  LY+M + GTL  PAINVNDSVTKSKFDNLYGCR SL DG+
Sbjct: 147  PEMLDDCYGLSEETTTGVHHLYKMLKEGTLKVPAINVNDSVTKSKFDNLYGCRESLIDGI 206

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLE 1018
             RATDVMIAGKVAVV G+GDVGKGCA AL+  GARVIVTEIDPI ALQA + G QV  LE
Sbjct: 207  KRATDVMIAGKVAVVAGFGDVGKGCAMALRGMGARVIVTEIDPINALQAAVSGYQVAPLE 266

Query: 1019 DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIK 1198
            +V S   IFVTTTG +DII   H ++M  +AIVCNIGHFD EID+  L+       + IK
Sbjct: 267  EVASIGQIFVTTTGCRDIITGVHFEQMPEDAIVCNIGHFDIEIDVAWLKA-NSESVVEIK 325

Query: 1199 PQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKN---- 1366
            PQ DRF+    +  +I+LAEGRL+NLGCATGH SFVMSCSF+NQV+AQ+ L+K ++    
Sbjct: 326  PQVDRFLMKNGR-HVILLAEGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKAEDKEFL 384

Query: 1367 --------TGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKP 1522
                    + K++  V++LPK LDE V                  QA Y+ IP EGP+K 
Sbjct: 385  AKFPEFGKSDKFDIGVHLLPKVLDETVAKCHLDHLGAKLTVLSDVQAEYLGIPKEGPFKA 444

Query: 1523 PHYRY 1537
              Y+Y
Sbjct: 445  DIYKY 449



>gb:AY442190_1606331 Pichia pastoris S-adenosylhomocysteine hydrolase
            (SAHH) mRNA, complete cds.
          Length = 445

 Score =  452 bits (1164), Expect = e-126
 Identities = 254/485 (52%), Positives = 304/485 (62%), Gaps = 13/485 (2%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D+S A FGR ++EL+E EMPGL+  R ++GP+QP KGARI G LHMTIQTAVLIET
Sbjct: 4    YKVADISLAAFGRKDIELSENEMPGLIYIREKYGPAQPLKGARIAGCLHMTIQTAVLIET 63

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERAL-DWGPGGG 478
            L ALGAEV W SCNIFSTQDH              WKGET +EY WC E+ L  +     
Sbjct: 64   LVALGAEVTWSSCNIFSTQDHAAAAIAATGVPVFAWKGETEEEYLWCIEQQLFAFKDNKK 123

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKY 658
             +LI+DDGGD T L+HE                                         KY
Sbjct: 124  LNLILDDGGDLTSLVHE-----------------------------------------KY 142

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
              M +   G+SEETTTGV  LY+M +  TL  PAINVNDSVTKSKFDNLYGCR SL DG+
Sbjct: 143  PEMLDDCFGLSEETTTGVHHLYKMVKDATLKVPAINVNDSVTKSKFDNLYGCRESLIDGI 202

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLE 1018
             RATDVMIAGKVAVV G+GDVGKGCA AL+  GARVI++EIDPI ALQA +EG QV  L+
Sbjct: 203  KRATDVMIAGKVAVVAGFGDVGKGCAMALRGMGARVIISEIDPINALQAAVEGYQVAPLD 262

Query: 1019 DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIK 1198
            DVVS   IFVTTTG +DII   H ++M  +AIV NIGHFD EID+  L+         IK
Sbjct: 263  DVVSIGQIFVTTTGCRDIITGKHFEQMPEDAIVSNIGHFDIEIDVAWLKA-NAQDVSNIK 321

Query: 1199 PQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE------ 1360
            PQ DR++    +  +I+LA+GRL+NLGCATGH SFVMSCSF+NQV+AQ+ L+K       
Sbjct: 322  PQVDRYLMKNGR-HVILLADGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKSNDSEFR 380

Query: 1361 ------KNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKP 1522
                  + +G ++  V+VLPK LDE V                  Q+ Y+ IPVEGP+K 
Sbjct: 381  KQFVEFEKSGPFDVGVHVLPKILDETVARCHLAHLGAKLTKLSSVQSEYLGIPVEGPFKV 440

Query: 1523 PHYRY 1537
             HYRY
Sbjct: 441  DHYRY 445



>gb:BX842649_824262 Bdellovibrio bacteriovorus complete genome, strain
            HD100; segment 4/11.
          Length = 471

 Score =  449 bits (1155), Expect = e-125
 Identities = 247/466 (53%), Positives = 293/466 (62%), Gaps = 2/466 (0%)
 Frame = +2

Query: 146  ADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEV 325
            A +GR E+++AE EMPGLMA R E+   QP KGARI G LHMTIQTAVLIETL  LGAE+
Sbjct: 52   AKWGREEIKIAETEMPGLMALRKEYKKQQPLKGARIAGCLHMTIQTAVLIETLVELGAEI 111

Query: 326  RWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERAL-DWGPGGGPDLIVDDG 502
            RW SCNIFSTQDH              WKG T QE+ WC E+ +  WG  G  ++I+DDG
Sbjct: 112  RWSSCNIFSTQDHAAAAIAAAGIPVFAWKGLTEQEFNWCIEQTIVGWGKEGF-NMILDDG 170

Query: 503  GDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLV 682
            GD T ++HE                                         ++ +  ++++
Sbjct: 171  GDLTNMMHE----------------------------------------PRFAKEMKKII 190

Query: 683  GVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMI 862
            G+SEETTTGV  L  + + G L  PAIN+NDSVTKSKFDNLYGCR SL DG+ RATDVM+
Sbjct: 191  GISEETTTGVHNLEVLVKQGKLKVPAININDSVTKSKFDNLYGCRESLADGIKRATDVMV 250

Query: 863  AGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADI 1042
            AGK+ VV GYGDVGKG A +L+  GARV+VTEIDPICALQA MEG +V T+ED     DI
Sbjct: 251  AGKICVVAGYGDVGKGSAHSLRGLGARVLVTEIDPICALQAAMEGFEVTTMEDAAPLGDI 310

Query: 1043 FVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVF 1222
            FVT TG  DII   H  KMKNNAIVCNIGHFD EIDM  L      K   +KPQ D    
Sbjct: 311  FVTATGCCDIITDKHFMKMKNNAIVCNIGHFDIEIDMAWLN--KNSKMREVKPQVDIHTL 368

Query: 1223 PETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEK-KVYVL 1399
               K  +IILA+GRL+NLGCATGHPSFVMS SFTNQV+AQ+EL+   N  KY+   VY L
Sbjct: 369  KNGKQ-VIILAKGRLVNLGCATGHPSFVMSNSFTNQVLAQMELF--NNRDKYQDIAVYRL 425

Query: 1400 PKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            PKHLDEKV                 +QA Y+ +  +GP+KP HYRY
Sbjct: 426  PKHLDEKVAALHLDKLGVKLTKLSSKQAKYLHMSPQGPFKPEHYRY 471



>sp|Q12663|SAHH_PNECA Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase)
            (Fragment).>gb:PCU57795_1699482 Pneumocystis carinii f.
            sp. ratti S-adenosylhomocysteine hydrolase (SAHH) mRNA,
            partial cds.
          Length = 440

 Score =  426 bits (1095), Expect = e-118
 Identities = 246/487 (50%), Positives = 294/487 (60%), Gaps = 23/487 (4%)
 Frame = +2

Query: 146  ADFGRLELELAEVEMPGLMACRAEFGPSQPFKGAR--ITGSLHMTIQTAVLIETLTALGA 319
            A++GR E+ELAE EMPGL++CR     +  FK  R  I G LHMTIQTAVLIETL  LGA
Sbjct: 7    AEWGRKEIELAENEMPGLISCRR----NMRFKPLRVQIAGCLHMTIQTAVLIETLVELGA 62

Query: 320  EVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERAL-DWGPGGGPDLIVD 496
            EV W SCNIFSTQDH              WKGET +EY WC E  L  +  G   ++I+D
Sbjct: 63   EVTWSSCNIFSTQDHAAAAIAASGISVFAWKGETEEEYLWCIETQLTSFKDGKHLNMILD 122

Query: 497  DGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKER 676
            DGGD T L+H                                          KY    + 
Sbjct: 123  DGGDVTSLVH-----------------------------------------NKYPDYLKN 141

Query: 677  LVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYG--------------- 811
              G+SEETTTGV + Y+M + G L  PAINVNDSVTKSKFDNLYG               
Sbjct: 142  CKGISEETTTGVHQFYKMLKEGKLKVPAINVNDSVTKSKFDNLYGVSLVLIYKIISNIKL 201

Query: 812  -CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL 988
             CR SL DG+ RATD+MIA KVA+V G+GDVGKGCA AL+  GARVI+TEIDPI ALQA 
Sbjct: 202  RCRESLIDGIKRATDIMIAAKVAIVAGFGDVGKGCAKALRGMGARVIITEIDPIVALQAS 261

Query: 989  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLET 1168
            MEG QV  +E+V  +ADIFVT TG KDII   H + MKN+AI+CNIGHFD EID+  L  
Sbjct: 262  MEGYQVAVMEEVADQADIFVTATGCKDIICERHFEAMKNDAIICNIGHFDVEIDVAWL-- 319

Query: 1169 YPGVKRIT----IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVI 1336
               +K+ +    IKPQ DR++    +  II+LAEGRL+NLGCATGH S VMS SFTNQV+
Sbjct: 320  ---IKKCSSISNIKPQVDRYLLGNGR-NIILLAEGRLVNLGCATGHSSMVMSMSFTNQVL 375

Query: 1337 AQLELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPY 1516
            AQ+ LW  +  G+Y   V+ LPK LDE+V                PEQ+AY+ IP++GPY
Sbjct: 376  AQIALWTAQE-GQYPLGVHFLPKKLDEEV-ARLHLSKLGKLTSLTPEQSAYLDIPIDGPY 433

Query: 1517 KPPHYRY 1537
            K  HYRY
Sbjct: 434  KSEHYRY 440



>gb:BC059517_2552494 Danio rerio S-adenosylhomocysteine hydrolase-like
            2, mRNA (cDNA clone MGC:73164 IMAGE:4145939), complete
            cds.
          Length = 591

 Score =  401 bits (1031), Expect = e-110
 Identities = 212/481 (44%), Positives = 294/481 (61%), Gaps = 1/481 (0%)
 Frame = +2

Query: 98   EKTSSGR-EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            +K S G  ++ +K++ QADFGR E+E+AE EMP LMA R      +P  GA+I G  H+T
Sbjct: 157  QKNSKGSGDFCIKNIKQADFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHIT 216

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
             QTAVL+ETL+ALGA+ RW +CNI+STQ+               WKGE+  ++WWC +R 
Sbjct: 217  AQTAVLMETLSALGAQCRWAACNIYSTQNEVAAALAEGGFSVFAWKGESEDDFWWCIDRC 276

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            ++   G  P++I+DDGGD T  I+                                    
Sbjct: 277  VNV-EGWQPNMILDDGGDLTHWIY------------------------------------ 299

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
                 KKY  M +++ G+ EE+ TGV RLYQ+ ++G L  PA+NVNDSVTK KFDNLY C
Sbjct: 300  -----KKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCC 354

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            R S+ DGL R TDVM  GK  VVCGYG+VGKGC+AALK  G+ V VTEIDPICALQA M+
Sbjct: 355  RESILDGLKRTTDVMFGGKQVVVCGYGEVGKGCSAALKAMGSIVYVTEIDPICALQACMD 414

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            G +++ L +V+ + DI +T TGNK++++  +M +MKN  IVCN+GH + EID+  L T P
Sbjct: 415  GFRLVKLSEVIRQVDIVITCTGNKNVVVREYMDRMKNGCIVCNMGHSNTEIDVASLRT-P 473

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
             +    ++ Q D  ++P+ K  I++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+
Sbjct: 474  ELTWERVRSQVDHVIWPDGKR-IVLLAEGRLLNLSCST-VPTFVLSITATTQALALIELY 531

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
                 G+Y++ VY+LPK +DE V                 EQA Y+ +   GP+KP +YR
Sbjct: 532  NAPE-GRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYLGLNKNGPFKPNYYR 590

Query: 1535 Y 1537
            Y
Sbjct: 591  Y 591



>gb:CR859865_1183966 Pongo pygmaeus mRNA; cDNA DKFZp469J024 (from
            clone DKFZp469J024).
          Length = 508

 Score =  396 bits (1018), Expect = e-109
 Identities = 211/481 (43%), Positives = 291/481 (60%), Gaps = 1/481 (0%)
 Frame = +2

Query: 98   EKTSSGR-EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            +K S G  ++ VK++ QA+FGR E+E+AE EMP LMA R      +P  GA+I G  H+T
Sbjct: 74   QKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHIT 133

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
             QTAVL+ETL ALGA+ RW +CNI+ST +               WKGE+  ++WWC +R 
Sbjct: 134  AQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRC 193

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            ++   G  P++I+DDGGD T  I+                                    
Sbjct: 194  VNV-EGWQPNMILDDGGDLTHWIY------------------------------------ 216

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
                 KKY  M +++ G+ EE+ TGV RLYQ+ ++G L  PA+NVNDSVTK KFDNLY C
Sbjct: 217  -----KKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCC 271

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            R S+ DGL R TD+M  GK  VVCGYG+VGKGC AALK  G+ V VTEIDPICALQA M+
Sbjct: 272  RESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMD 331

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            G +++ L +V+ + DI +T TGNK+++   H+ +MKN+ IVCNIGH + EID+  L T P
Sbjct: 332  GFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNIGHSNTEIDVASLRT-P 390

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
             +    ++ Q D  ++P+ K  I++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+
Sbjct: 391  ELTWERVRSQVDHVIWPDGKR-IVLLAEGRLLNLSCST-VPTFVLSITATTQALALIELY 448

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
                 G+Y++ VY+LPK +DE V                 EQA Y+ +   GP+KP +YR
Sbjct: 449  NAPE-GRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYR 507

Query: 1535 Y 1537
            Y
Sbjct: 508  Y 508



>gb:AK053527_1170463 Mus musculus 0 day neonate eyeball cDNA, RIKEN
            full-length enriched library, clone:E130105J10
            product:SIMILAR TO S-ADENOSYLHOMOCYSTEINE HYDROLASE-LIKE
            1 (FRAGMENT) homolog [Homo sapiens], full insert
            sequence.
          Length = 508

 Score =  396 bits (1018), Expect = e-109
 Identities = 211/481 (43%), Positives = 291/481 (60%), Gaps = 1/481 (0%)
 Frame = +2

Query: 98   EKTSSGR-EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            +K S G  ++ VK++ QA+FGR E+E+AE EMP LMA R      +P  GA+I G  H+T
Sbjct: 74   QKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHIT 133

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
             QTAVL+ETL ALGA+ RW +CNI+ST +               WKGE+  ++WWC +R 
Sbjct: 134  AQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRC 193

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            ++   G  P++I+DDGGD T  I+                                    
Sbjct: 194  VNV-EGWQPNMILDDGGDLTHWIY------------------------------------ 216

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
                 KKY  M +++ G+ EE+ TGV RLYQ+ ++G L  PA+NVNDSVTK KFDNLY C
Sbjct: 217  -----KKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCC 271

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            R S+ DGL R TD+M  GK  VVCGYG+VGKGC AALK  G+ V VTEIDPICALQA M+
Sbjct: 272  RESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMD 331

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            G +V+ L +V+ + DI +T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L T P
Sbjct: 332  GFRVVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRT-P 390

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
             +    ++ Q D  ++P+ K  I++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+
Sbjct: 391  ELTWERVRSQVDHVIWPDGKR-IVLLAEGRLLNLSCST-VPTFVLSITATTQALALIELY 448

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
                 G+Y++ VY+LPK +DE V                 EQA Y+ +   GP+KP +YR
Sbjct: 449  NAPE-GRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYR 507

Query: 1535 Y 1537
            Y
Sbjct: 508  Y 508



>gb:BC077247_2559964 Xenopus laevis MGC79134 protein, mRNA (cDNA clone
            MGC:79134 IMAGE:5073029), complete cds.
          Length = 583

 Score =  396 bits (1017), Expect = e-109
 Identities = 211/481 (43%), Positives = 290/481 (60%), Gaps = 1/481 (0%)
 Frame = +2

Query: 98   EKTSSGR-EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            +K S G  ++ VK++ QA+FGR E+E+AE EMP LMA R      +P  GA+I G  H+T
Sbjct: 149  QKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHIT 208

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
             QTAVLIETL ALGA+ RW +CNI+ST +               WKGE+  ++WWC +R 
Sbjct: 209  AQTAVLIETLGALGAQCRWAACNIYSTLNEVAAALAESGVPVFSWKGESEDDFWWCIDRC 268

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            ++   G  P++I+DDGGD T  I+                                    
Sbjct: 269  VNV-EGWQPNMILDDGGDLTHWIY------------------------------------ 291

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
                 KKY  M +++ G+ EE+ TGV RLYQ+ ++G L  PA+NVNDSVTK KFDNLY C
Sbjct: 292  -----KKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCC 346

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            R S+ DGL R TD+M  GK  VVCGYG+VGKGC AALK  G+ V VTEIDPICALQA M+
Sbjct: 347  RESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMD 406

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            G +++ L +V+ + DI +T TGNK+++   H+ +MKN  IVCN+GH + EID+  L T P
Sbjct: 407  GFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNGCIVCNMGHSNTEIDVASLRT-P 465

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
             +    ++ Q D  ++P+ K  I++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+
Sbjct: 466  ELTWERVRSQVDHVIWPDGKR-IVLLAEGRLLNLSCST-VPTFVLSITATTQALALIELY 523

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
                 G+Y++ VY+LPK +DE V                 EQA Y+ +   GP+KP +YR
Sbjct: 524  NAPE-GRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYLGLNKNGPFKPNYYR 582

Query: 1535 Y 1537
            Y
Sbjct: 583  Y 583



>gb:AK130743_1917676 Homo sapiens cDNA FLJ27233 fis, clone SYN06481,
            highly similar to Adenosylhomocysteinase (EC 3.3.1.1).
          Length = 530

 Score =  395 bits (1016), Expect = e-108
 Identities = 210/481 (43%), Positives = 291/481 (60%), Gaps = 1/481 (0%)
 Frame = +2

Query: 98   EKTSSGR-EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            +K S G  ++ VK++ QA+FGR E+E+AE EMP LMA R      +P  GA+I G  H+T
Sbjct: 96   QKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHIT 155

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
             QTAVL+ETL ALGA+ RW +CNI+ST +               WKGE+  ++WWC +R 
Sbjct: 156  AQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRC 215

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            ++   G  P++I+DDGGD T  I+                                    
Sbjct: 216  VNV-EGWQPNMILDDGGDLTHWIY------------------------------------ 238

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
                 KKY  M +++ G+ EE+ TGV RLYQ+ ++G L  PA+NVNDSVTK KFDNLY C
Sbjct: 239  -----KKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCC 293

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            R S+ DGL R TD+M  GK  VVCGYG+VGKGC AALK  G+ V VTEIDPICALQA M+
Sbjct: 294  RESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMD 353

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            G +++ L +V+ + DI +T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L T P
Sbjct: 354  GFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRT-P 412

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
             +    ++ Q D  ++P+ K  I++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+
Sbjct: 413  ELTWERVRSQVDHVIWPDGKR-IVLLAEGRLLNLSCST-MPTFVLSITATTQALALIELY 470

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
                 G+Y++ VY+LPK +DE V                 EQA Y+ +   GP+KP +YR
Sbjct: 471  NAPE-GRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYR 529

Query: 1535 Y 1537
            Y
Sbjct: 530  Y 530



>gb:BC080079_2561511 Xenopus laevis MGC84148 protein, mRNA (cDNA clone
            MGC:84148 IMAGE:6951579), complete cds.
          Length = 588

 Score =  395 bits (1015), Expect = e-108
 Identities = 210/481 (43%), Positives = 290/481 (60%), Gaps = 1/481 (0%)
 Frame = +2

Query: 98   EKTSSGR-EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            +K S G  ++ VK++ QA+FGR E+E+AE EMP LMA R      +P  GA+I G  H+T
Sbjct: 154  QKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHIT 213

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
             QTAVLIETL ALGA+ RW +CNI+ST +               WKGE+  ++WWC +R 
Sbjct: 214  AQTAVLIETLGALGAQCRWAACNIYSTLNEVAAALAENGVAVFSWKGESEDDFWWCIDRC 273

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            ++   G  P++I+DDGGD T  I+                                    
Sbjct: 274  VNV-EGWQPNMILDDGGDLTHWIY------------------------------------ 296

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
                 KKY  M +++ G+ EE+ TGV RLYQ+ ++G L  PA+NVNDSVTK KFDNLY C
Sbjct: 297  -----KKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCC 351

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            R S+ DGL R TD+M  GK  VVCGYG+VGKGC AALK  G+ V VTEIDPICALQA M+
Sbjct: 352  RESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMD 411

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            G +++ L +V+ + DI +T TGNK+++   H+ +MKN  IVCN+GH + EID+  L T P
Sbjct: 412  GFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNGCIVCNMGHSNTEIDVASLRT-P 470

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
             +    ++ Q D  ++P+ K  +++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+
Sbjct: 471  ELTWERVRSQVDHVIWPDGKR-MVLLAEGRLLNLSCST-VPTFVLSITATTQALALIELY 528

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
                 G+Y++ VY+LPK +DE V                 EQA Y+ +   GP+KP +YR
Sbjct: 529  NAPE-GRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYLGLNKNGPFKPNYYR 587

Query: 1535 Y 1537
            Y
Sbjct: 588  Y 588



>gb:BC079660_2107648 Mus musculus RIKEN cDNA 4631427C17 gene, mRNA
            (cDNA clone MGC:90656 IMAGE:6853550), complete cds.
          Length = 613

 Score =  395 bits (1015), Expect = e-108
 Identities = 210/481 (43%), Positives = 291/481 (60%), Gaps = 1/481 (0%)
 Frame = +2

Query: 98   EKTSSGR-EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            +K S G  ++ VK++ QA+FGR E+E+AE EMP LMA R      +P  GA+I G  H+T
Sbjct: 179  QKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHIT 238

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
             QTAVL+ETL ALGA+ RW +CNI+ST +               WKGE+  ++WWC +R 
Sbjct: 239  AQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRC 298

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            ++   G  P++I+DDGGD T  I+                                    
Sbjct: 299  VNV-EGWQPNMILDDGGDLTHWIY------------------------------------ 321

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
                 KKY  M +++ G+ EE+ TGV RLYQ+ ++G L  PA+NVNDSVTK KFDNLY C
Sbjct: 322  -----KKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCC 376

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            R S+ DGL R TD+M  GK  VVCGYG+VGKGC AALK  G+ V VTEIDPICALQA M+
Sbjct: 377  RESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMD 436

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            G +++ L +V+ + DI +T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L T P
Sbjct: 437  GFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRT-P 495

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
             +    ++ Q D  ++P+ K  I++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+
Sbjct: 496  ELTWERVRSQVDHVIWPDGKR-IVLLAEGRLLNLSCST-VPTFVLSITATTQALALIELY 553

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
                 G+Y++ VY+LPK +DE V                 EQA Y+ +   GP+KP +YR
Sbjct: 554  NAPE-GRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYR 612

Query: 1535 Y 1537
            Y
Sbjct: 613  Y 613



>gb:AK122382_2069047 Mus musculus mRNA for mKIAA0828 protein.
          Length = 478

 Score =  395 bits (1015), Expect = e-108
 Identities = 210/481 (43%), Positives = 291/481 (60%), Gaps = 1/481 (0%)
 Frame = +2

Query: 98   EKTSSGR-EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            +K S G  ++ VK++ QA+FGR E+E+AE EMP LMA R      +P  GA+I G  H+T
Sbjct: 44   QKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHIT 103

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
             QTAVL+ETL ALGA+ RW +CNI+ST +               WKGE+  ++WWC +R 
Sbjct: 104  AQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRC 163

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            ++   G  P++I+DDGGD T  I+                                    
Sbjct: 164  VNV-EGWQPNMILDDGGDLTHWIY------------------------------------ 186

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
                 KKY  M +++ G+ EE+ TGV RLYQ+ ++G L  PA+NVNDSVTK KFDNLY C
Sbjct: 187  -----KKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCC 241

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            R S+ DGL R TD+M  GK  VVCGYG+VGKGC AALK  G+ V VTEIDPICALQA M+
Sbjct: 242  RESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMD 301

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            G +++ L +V+ + DI +T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L T P
Sbjct: 302  GFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRT-P 360

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
             +    ++ Q D  ++P+ K  I++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+
Sbjct: 361  ELTWERVRSQVDHVIWPDGKR-IVLLAEGRLLNLSCST-VPTFVLSITATTQALALIELY 418

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
                 G+Y++ VY+LPK +DE V                 EQA Y+ +   GP+KP +YR
Sbjct: 419  NAPE-GRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYR 477

Query: 1535 Y 1537
            Y
Sbjct: 478  Y 478



>gb:AB020635_1865233 Homo sapiens mRNA for KIAA0828 protein, partial
            cds.
          Length = 619

 Score =  395 bits (1015), Expect = e-108
 Identities = 210/481 (43%), Positives = 291/481 (60%), Gaps = 1/481 (0%)
 Frame = +2

Query: 98   EKTSSGR-EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            +K S G  ++ VK++ QA+FGR E+E+AE EMP LMA R      +P  GA+I G  H+T
Sbjct: 185  QKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHIT 244

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
             QTAVL+ETL ALGA+ RW +CNI+ST +               WKGE+  ++WWC +R 
Sbjct: 245  AQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRC 304

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            ++   G  P++I+DDGGD T  I+                                    
Sbjct: 305  VNV-EGWQPNMILDDGGDLTHWIY------------------------------------ 327

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
                 KKY  M +++ G+ EE+ TGV RLYQ+ ++G L  PA+NVNDSVTK KFDNLY C
Sbjct: 328  -----KKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCC 382

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            R S+ DGL R TD+M  GK  VVCGYG+VGKGC AALK  G+ V VTEIDPICALQA M+
Sbjct: 383  RESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMD 442

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            G +++ L +V+ + DI +T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L T P
Sbjct: 443  GFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRT-P 501

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
             +    ++ Q D  ++P+ K  I++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+
Sbjct: 502  ELTWERVRSQVDHVIWPDGKR-IVLLAEGRLLNLSCST-VPTFVLSITATTQALALIELY 559

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
                 G+Y++ VY+LPK +DE V                 EQA Y+ +   GP+KP +YR
Sbjct: 560  NAPE-GRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYR 618

Query: 1535 Y 1537
            Y
Sbjct: 619  Y 619



>sp|Q96HN2|SAH3_HUMAN Putative adenosylhomocysteinase 3 (EC 3.3.1.1)
            (S-adenosyl-L- homocysteine hydrolase)
            (AdoHcyase).>gb:BC008349_1971319 Homo sapiens KIAA0828
            protein, mRNA (cDNA clone MGC:15925 IMAGE:3536052),
            complete cds.>gb:BC024325_1978344 Homo sapiens KIAA0828
            protein, mRNA (cDNA clone MGC:21525 IMAGE:3907552),
            complete cds.
          Length = 611

 Score =  395 bits (1015), Expect = e-108
 Identities = 210/481 (43%), Positives = 291/481 (60%), Gaps = 1/481 (0%)
 Frame = +2

Query: 98   EKTSSGR-EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            +K S G  ++ VK++ QA+FGR E+E+AE EMP LMA R      +P  GA+I G  H+T
Sbjct: 177  QKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHIT 236

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
             QTAVL+ETL ALGA+ RW +CNI+ST +               WKGE+  ++WWC +R 
Sbjct: 237  AQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRC 296

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            ++   G  P++I+DDGGD T  I+                                    
Sbjct: 297  VNV-EGWQPNMILDDGGDLTHWIY------------------------------------ 319

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
                 KKY  M +++ G+ EE+ TGV RLYQ+ ++G L  PA+NVNDSVTK KFDNLY C
Sbjct: 320  -----KKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCC 374

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
            R S+ DGL R TD+M  GK  VVCGYG+VGKGC AALK  G+ V VTEIDPICALQA M+
Sbjct: 375  RESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMD 434

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            G +++ L +V+ + DI +T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L T P
Sbjct: 435  GFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRT-P 493

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
             +    ++ Q D  ++P+ K  I++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+
Sbjct: 494  ELTWERVRSQVDHVIWPDGKR-IVLLAEGRLLNLSCST-VPTFVLSITATTQALALIELY 551

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
                 G+Y++ VY+LPK +DE V                 EQA Y+ +   GP+KP +YR
Sbjct: 552  NAPE-GRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYR 610

Query: 1535 Y 1537
            Y
Sbjct: 611  Y 611



>gb:CR543861_104166 Acinetobacter sp. ADP1 complete genome.
          Length = 467

 Score =  392 bits (1007), Expect = e-107
 Identities = 220/499 (44%), Positives = 292/499 (58%), Gaps = 22/499 (4%)
 Frame = +2

Query: 107  SSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTA 286
            +S  +YKV D+S AD+GR E++LAE EMP L+  R  +   +P  GA+I G +HMTIQTA
Sbjct: 13   ASFTDYKVADISLADYGRKEIKLAEAEMPALIGLRKRYAAEKPLAGAKILGCIHMTIQTA 72

Query: 287  VLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDW- 463
            VLIETL  LGAEVRW SCNIFSTQDH              WKGET +EY WC E+ ++  
Sbjct: 73   VLIETLVELGAEVRWTSCNIFSTQDHAAAAIAASGVPVFAWKGETEEEYNWCLEQQINVN 132

Query: 464  GPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKA 643
            G     ++I+DDGGD T L+HE                                      
Sbjct: 133  GKPWDANMILDDGGDLTALVHE-------------------------------------- 154

Query: 644  DPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHS 823
               KY  + + + G++EETTTGV+RL +M + G+L  PAINVNDSVTKSK DN YGCRHS
Sbjct: 155  ---KYPTLLDHIHGITEETTTGVQRLLEMWKDGSLKVPAINVNDSVTKSKNDNKYGCRHS 211

Query: 824  LPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQ 1003
            L D + RATD++++G+ A+V GYGDVGKG A +L+Q G  V VTE+DPICA+QA M+G +
Sbjct: 212  LNDAIKRATDMLLSGRRALVIGYGDVGKGSAQSLRQEGMIVRVTEVDPICAMQACMDGYE 271

Query: 1004 VLTLE--------------DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDN 1141
            V++                D++   D+ VTTTGN  +   + +  +K  A+VCNIGHFD 
Sbjct: 272  VVSPYKNGVQTGKKEDINLDLLKNTDLIVTTTGNYHVCDSAMLDTLKAGAVVCNIGHFDT 331

Query: 1142 EIDMHGLETYPGVKRITIKPQTDRFVFPETKTG-IIILAEGRLMNLGCATGHPSFVMSCS 1318
            EID + L    G K + +KPQ  +    E +   +I+L+EGRL+NLG ATGHPS VM  S
Sbjct: 332  EIDTNYLR---GYKWVEVKPQVHQVYRSENENDYLILLSEGRLVNLGNATGHPSRVMDGS 388

Query: 1319 FTNQVIAQLELWKEK------NTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQ 1480
            F NQV+ Q+ L++EK      +    + +V VLPK LDE+V                  Q
Sbjct: 389  FANQVLGQIHLFQEKFADLPASEKAAQIRVEVLPKKLDEEVAAAMVLGFGGVLTQLTSVQ 448

Query: 1481 AAYISIPVEGPYKPPHYRY 1537
            A Y+ +PVEGP+K   Y+Y
Sbjct: 449  ADYLGVPVEGPFKSDAYKY 467



>gb:BC081269_2562161 Xenopus laevis MGC86404 protein, mRNA (cDNA clone
            MGC:86404 IMAGE:7011535), complete cds.
          Length = 520

 Score =  390 bits (1002), Expect = e-107
 Identities = 207/479 (43%), Positives = 286/479 (59%), Gaps = 1/479 (0%)
 Frame = +2

Query: 104  TSSGR-EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQ 280
            TS G  ++ VK++ QADFGR E+++AE EM  L++ R      +P  GA+I G  H+T Q
Sbjct: 87   TSKGSGDFCVKNIKQADFGRREIDIAEQEMMALISLRKRAQGEKPLLGAKIVGCTHITAQ 146

Query: 281  TAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALD 460
            T VLIETL ALGA+ RW +CNIFSTQ+               WKGE+  ++WWC +R ++
Sbjct: 147  TGVLIETLCALGAQCRWSACNIFSTQNEVAAALAESGVAIFAWKGESEDDFWWCIDRCVN 206

Query: 461  WGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLK 640
               G   ++I+DDGGD T  ++                                      
Sbjct: 207  ADSGWQANMILDDGGDLTHWVY-------------------------------------- 228

Query: 641  ADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRH 820
               KKY  +  ++ G+ EE+ TGV RLYQ+ ++G L  PA+NVNDSVTK KFDNLY CR 
Sbjct: 229  ---KKYPHVYTQIRGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRE 285

Query: 821  SLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGL 1000
            S+ DGL R+TDVM  GK  VVCGYG+VGKGC AALK  GA V VTEIDPICALQA MEG 
Sbjct: 286  SILDGLKRSTDVMFGGKQVVVCGYGEVGKGCCAALKALGAVVHVTEIDPICALQACMEGF 345

Query: 1001 QVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGV 1180
            +V+ L +++ + D+ +T TGNK+++   H+ +MKN  IVCN+GH + EID+  L T P +
Sbjct: 346  RVVKLSEIIRQVDVVITCTGNKNVVNREHLDRMKNGCIVCNMGHSNTEIDVTSLHT-PEL 404

Query: 1181 KRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE 1360
                I+ Q D  ++P+ K  I++LAEGRL+NL C+T  P+FV S + T + +A +EL+  
Sbjct: 405  TWERIRSQVDHIIWPDGKR-IVLLAEGRLLNLSCST-IPTFVHSITATTEALALIELYNA 462

Query: 1361 KNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
               G+Y++ VY+LPK +DE V                 +QA Y+ +   GP+KP +YRY
Sbjct: 463  PE-GRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTEDQAKYLGLNKNGPFKPNYYRY 520



>gb:AE014296_1134419 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003476_1211718 Drosophila melanogaster
            chromosome 3L, section 10 of 83 of the complete sequence.
          Length = 521

 Score =  388 bits (996), Expect = e-106
 Identities = 211/483 (43%), Positives = 289/483 (59%), Gaps = 2/483 (0%)
 Frame = +2

Query: 95   VEKTSSGR-EYKVKDM-SQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLH 268
            V+K S G  ++ V+++ +Q  FGR E+E+AE EMPG++A +      +P K A+I G  H
Sbjct: 85   VQKNSKGSSDFCVRNIGAQHAFGRREIEIAEQEMPGIIALKKRAAEDKPLKDAKIVGCTH 144

Query: 269  MTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTE 448
            +  QTAVLIETL  LGA VRW +CNI+STQ+               W+GET +++WWC +
Sbjct: 145  INAQTAVLIETLVELGASVRWAACNIYSTQNEVAAALAESGIPIFAWRGETEEDFWWCID 204

Query: 449  RALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIR 628
            R ++      P++I+DDGGDAT L+                                   
Sbjct: 205  RCVN-AENWQPNMILDDGGDATHLML---------------------------------- 229

Query: 629  DGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLY 808
                   KKY  M + + G+ EE+ TGV RLYQ+ ++G L  PA+NVNDSVTK+KFDNLY
Sbjct: 230  -------KKYPTMFKLVKGIVEESVTGVHRLYQLSKAGKLTVPAMNVNDSVTKTKFDNLY 282

Query: 809  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL 988
             C+ S+ D L R+TDVM  GK  VVCGYGDVGKGCA ALK  G  V +TEIDPICALQA 
Sbjct: 283  SCKESILDSLKRSTDVMFGGKQVVVCGYGDVGKGCAQALKGQGCIVYITEIDPICALQAS 342

Query: 989  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLET 1168
            M+G +V+ L +V+   DI VT TGNK++++  HM KMK+  IVCN+GH + EID++GL T
Sbjct: 343  MDGFRVVKLNEVIRNVDIVVTATGNKNVVVREHMDKMKSGCIVCNMGHSNTEIDVNGLRT 402

Query: 1169 YPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE 1348
             P +    ++ Q D  ++PE K  II+LAEGRL+NL C++  PSF +S +   Q +A +E
Sbjct: 403  -PDLTWEKVRSQVDHIIWPEGKY-IILLAEGRLVNLSCSS-IPSFAVSITSATQALALIE 459

Query: 1349 LWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPH 1528
            L+     G+Y+  VY+LPK +DE V                 EQA Y+ +   GP+KP +
Sbjct: 460  LFNAP-PGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPNY 518

Query: 1529 YRY 1537
            YRY
Sbjct: 519  YRY 521



>gb:AE017340_456250 Idiomarina loihiensis L2TR, complete genome.
          Length = 459

 Score =  387 bits (995), Expect = e-106
 Identities = 222/498 (44%), Positives = 292/498 (58%), Gaps = 22/498 (4%)
 Frame = +2

Query: 110  SGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAV 289
            + ++YKV D+S A++GR E+ +AE EMP LM  R ++  S+P  GARI G +HMTIQTAV
Sbjct: 5    NSQDYKVADISLAEWGRKEIAIAESEMPALMTIRRKYADSKPLAGARIIGCIHMTIQTAV 64

Query: 290  LIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDW-G 466
            LIETL  LGAEVRW SCNIFSTQDH              WKGET +EY WC ++     G
Sbjct: 65   LIETLLELGAEVRWSSCNIFSTQDHAAAAMAAAGVPVFAWKGETEEEYDWCLKQTCHKDG 124

Query: 467  PGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKAD 646
                 ++I+DDGGD TL+IH+                                       
Sbjct: 125  ELWDANMILDDGGDLTLMIHD--------------------------------------- 145

Query: 647  PKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSL 826
              ++ +M E++ G++EETTTGV RL  M E GTL  PAINVND+VTKSK DN YGCRHSL
Sbjct: 146  --EFPQMLEKVHGITEETTTGVHRLLDMLEKGTLKVPAINVNDAVTKSKNDNKYGCRHSL 203

Query: 827  PDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQV 1006
             D + R+TD +++GK A+V GYGDVGKG AA+L+Q G  V ++EIDPICA+QA M+G +V
Sbjct: 204  NDAIKRSTDHLLSGKKALVVGYGDVGKGSAASLRQEGMIVKISEIDPICAMQACMDGFEV 263

Query: 1007 LT--------------LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNE 1144
            ++               +D++S  D+ VTTTGN D+     +  +K  A+VCNIGHFDNE
Sbjct: 264  VSPYLEGKNNGTGDNINKDLLSNTDLIVTTTGNMDVCDRYMLAALKPTALVCNIGHFDNE 323

Query: 1145 IDMHGLETYPGVKRITIKPQTDR-FVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSF 1321
            ID   +      +   IKPQ  + +   +    +I+LAEGRL+NLG ATGHPS +M  SF
Sbjct: 324  IDTAFMR--KNWRWEEIKPQVHKIYRSDDDNDYLILLAEGRLVNLGNATGHPSRIMDGSF 381

Query: 1322 TNQVIAQLELWKEKNTGKYEK------KVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQA 1483
             NQV+AQ+ L+++K      K      +V VLPK LDE+V                 +QA
Sbjct: 382  ANQVLAQIHLFEQKFADMEIKQQEEYLRVEVLPKQLDEEVARYMVQGFGGVITKLTADQA 441

Query: 1484 AYISIPVEGPYKPPHYRY 1537
             YI + VEGP+K   YRY
Sbjct: 442  NYIHVDVEGPFKTDEYRY 459



>gb:BC054614_2551024 Danio rerio S-adenosylhomocysteine hydrolase-like
            1, mRNA (cDNA clone MGC:64088 IMAGE:6794782), complete
            cds.
          Length = 512

 Score =  387 bits (994), Expect = e-106
 Identities = 204/473 (43%), Positives = 285/473 (60%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            ++ VK++ QA+FGR E+E+AE +M  L++ R      +P  GA++ G  H+T QTAVLIE
Sbjct: 86   DFCVKNIKQAEFGRREIEIAEQDMSALISLRKRAQGEKPLAGAKVAGCTHITAQTAVLIE 145

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG 478
            TL ALGA+ RW +CNI+STQ+               WKGE+  ++WWC +R ++   G  
Sbjct: 146  TLVALGAQCRWTACNIYSTQNEVAAALAESGVSVFAWKGESEDDFWWCIDRCVNMD-GWQ 204

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKY 658
             ++I+DDGGD T  ++                                         KKY
Sbjct: 205  ANMILDDGGDLTHWVY-----------------------------------------KKY 223

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
              + +++ G+ EE+ TGV RLYQ+ ++G L  PA+NVNDSVTK KFDNLY CR S+ DGL
Sbjct: 224  PSVFKKVRGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGL 283

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLE 1018
             R TDVM  GK  VVCGYG+VGKGC +ALK  GA V VTEIDPICALQA M+G +V+ L 
Sbjct: 284  KRTTDVMFGGKQVVVCGYGEVGKGCCSALKALGAIVCVTEIDPICALQACMDGFRVVKLN 343

Query: 1019 DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIK 1198
            +VV + D+ +T TGNK+++   H+ +MKN  IVCN+GH + EID+  L T P +    ++
Sbjct: 344  EVVRQMDMVITCTGNKNVVTREHLDRMKNGCIVCNMGHSNTEIDVASLRT-PELTWERVR 402

Query: 1199 PQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKY 1378
             Q D  ++P+ K  +I+LAEGRL+NL C+T  PSFV+S + T Q +A +EL+     G+Y
Sbjct: 403  SQVDHVIWPDGKR-VILLAEGRLLNLSCST-VPSFVLSITATTQALALIELYNAPE-GRY 459

Query: 1379 EKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            ++ VY+LPK +DE V                 EQA Y+ +   GP+KP +YRY
Sbjct: 460  KQDVYLLPKKMDEYVASLHLPNFDAHLTELSDEQAKYMGLNKNGPFKPNYYRY 512



>gb:BC065254_1986785 Homo sapiens cDNA clone IMAGE:6138596, partial
            cds.
          Length = 623

 Score =  387 bits (994), Expect = e-106
 Identities = 201/470 (42%), Positives = 284/470 (60%)
 Frame = +2

Query: 128  VKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLT 307
            VK++ QA+FGR E+E+AE +M  L++ R      +P  GA+I G  H+T QTAVLIETL 
Sbjct: 200  VKNIKQAEFGRREIEIAEQDMSALISLRKRAQGEKPLAGAKIVGCTHITAQTAVLIETLC 259

Query: 308  ALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGPDL 487
            ALGA+ RW +CNI+STQ+               WKGE+  ++WWC +R ++   G   ++
Sbjct: 260  ALGAQCRWSACNIYSTQNEVAAALAEAGVAVFAWKGESEDDFWWCIDRCVNMD-GWQANM 318

Query: 488  IVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRM 667
            I+DDGGD T  ++                                         KKY  +
Sbjct: 319  ILDDGGDLTHWVY-----------------------------------------KKYPNV 337

Query: 668  KERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRA 847
             +++ G+ EE+ TGV RLYQ+ ++G L  PA+NVNDSVTK KFDNLY CR S+ DGL R 
Sbjct: 338  FKKIRGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRT 397

Query: 848  TDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVV 1027
            TDVM  GK  VVCGYG+VGKGC AALK  GA V +TEIDPICALQA M+G +V+ L +V+
Sbjct: 398  TDVMFGGKQVVVCGYGEVGKGCCAALKALGAIVYITEIDPICALQACMDGFRVVKLNEVI 457

Query: 1028 SEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQT 1207
             + D+ +T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L T P +    ++ Q 
Sbjct: 458  RQVDVVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRT-PELTWERVRSQV 516

Query: 1208 DRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKK 1387
            D  ++P+ K  +++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ 
Sbjct: 517  DHVIWPDGKR-VVLLAEGRLLNLSCST-VPTFVLSITATTQALALIELYNAPE-GRYKQD 573

Query: 1388 VYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            VY+LPK +DE V                 +QA Y+ +   GP+KP +YRY
Sbjct: 574  VYLLPKKMDEYVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY 623



>gb:AL772411_1932843 Human DNA sequence from clone RP11-180N18 on
            chromosome 1 Contains the AHCYL1 S-adenosylhomocysteine
            hydrolase-like 1 and the 5' end of gene KIAA1761
            (FLJ14743), complete sequence.
          Length = 483

 Score =  387 bits (994), Expect = e-106
 Identities = 201/470 (42%), Positives = 284/470 (60%)
 Frame = +2

Query: 128  VKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLT 307
            VK++ QA+FGR E+E+AE +M  L++ R      +P  GA+I G  H+T QTAVLIETL 
Sbjct: 60   VKNIKQAEFGRREIEIAEQDMSALISLRKRAQGEKPLAGAKIVGCTHITAQTAVLIETLC 119

Query: 308  ALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGPDL 487
            ALGA+ RW +CNI+STQ+               WKGE+  ++WWC +R ++   G   ++
Sbjct: 120  ALGAQCRWSACNIYSTQNEVAAALAEAGVAVFAWKGESEDDFWWCIDRCVNMD-GWQANM 178

Query: 488  IVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRM 667
            I+DDGGD T  ++                                         KKY  +
Sbjct: 179  ILDDGGDLTHWVY-----------------------------------------KKYPNV 197

Query: 668  KERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRA 847
             +++ G+ EE+ TGV RLYQ+ ++G L  PA+NVNDSVTK KFDNLY CR S+ DGL R 
Sbjct: 198  FKKIRGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRT 257

Query: 848  TDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVV 1027
            TDVM  GK  VVCGYG+VGKGC AALK  GA V +TEIDPICALQA M+G +V+ L +V+
Sbjct: 258  TDVMFGGKQVVVCGYGEVGKGCCAALKALGAIVYITEIDPICALQACMDGFRVVKLNEVI 317

Query: 1028 SEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQT 1207
             + D+ +T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L T P +    ++ Q 
Sbjct: 318  RQVDVVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRT-PELTWERVRSQV 376

Query: 1208 DRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKK 1387
            D  ++P+ K  +++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ 
Sbjct: 377  DHVIWPDGKR-VVLLAEGRLLNLSCST-VPTFVLSITATTQALALIELYNAPE-GRYKQD 433

Query: 1388 VYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            VY+LPK +DE V                 +QA Y+ +   GP+KP +YRY
Sbjct: 434  VYLLPKKMDEYVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY 483



>gb:AF315687_1896429 Homo sapiens S-adenosylhomocysteine
            hydrolase-like protein mRNA, complete
            cds.>gb:AL772411_1932842 Human DNA sequence from clone
            RP11-180N18 on chromosome 1 Contains the AHCYL1
            S-adenosylhomocysteine hydrolase-like 1 and the 5' end of
            gene KIAA1761 (FLJ14743), complete
            sequence.>gb:AB092504_2047971 Mus musculus Irbit mRNA for
            IP3R binding protein released with inositol
            1,4,5-trisphosphate, complete cds.>gb:BC018218_2092584
            Mus musculus S-adenosylhomocysteine hydrolase-like 1,
            mRNA (cDNA clone MGC:18748 IMAGE:4007102), complete cds.
          Length = 530

 Score =  387 bits (994), Expect = e-106
 Identities = 201/470 (42%), Positives = 284/470 (60%)
 Frame = +2

Query: 128  VKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLT 307
            VK++ QA+FGR E+E+AE +M  L++ R      +P  GA+I G  H+T QTAVLIETL 
Sbjct: 107  VKNIKQAEFGRREIEIAEQDMSALISLRKRAQGEKPLAGAKIVGCTHITAQTAVLIETLC 166

Query: 308  ALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGPDL 487
            ALGA+ RW +CNI+STQ+               WKGE+  ++WWC +R ++   G   ++
Sbjct: 167  ALGAQCRWSACNIYSTQNEVAAALAEAGVAVFAWKGESEDDFWWCIDRCVNMD-GWQANM 225

Query: 488  IVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRM 667
            I+DDGGD T  ++                                         KKY  +
Sbjct: 226  ILDDGGDLTHWVY-----------------------------------------KKYPNV 244

Query: 668  KERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRA 847
             +++ G+ EE+ TGV RLYQ+ ++G L  PA+NVNDSVTK KFDNLY CR S+ DGL R 
Sbjct: 245  FKKIRGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRT 304

Query: 848  TDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVV 1027
            TDVM  GK  VVCGYG+VGKGC AALK  GA V +TEIDPICALQA M+G +V+ L +V+
Sbjct: 305  TDVMFGGKQVVVCGYGEVGKGCCAALKALGAIVYITEIDPICALQACMDGFRVVKLNEVI 364

Query: 1028 SEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQT 1207
             + D+ +T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L T P +    ++ Q 
Sbjct: 365  RQVDVVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRT-PELTWERVRSQV 423

Query: 1208 DRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKK 1387
            D  ++P+ K  +++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ 
Sbjct: 424  DHVIWPDGKR-VVLLAEGRLLNLSCST-VPTFVLSITATTQALALIELYNAPE-GRYKQD 480

Query: 1388 VYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            VY+LPK +DE V                 +QA Y+ +   GP+KP +YRY
Sbjct: 481  VYLLPKKMDEYVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY 530



>gb:AX029176_1457188 Sequence 1 from Patent WO9814562.
          Length = 614

 Score =  387 bits (994), Expect = e-106
 Identities = 201/470 (42%), Positives = 284/470 (60%)
 Frame = +2

Query: 128  VKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLT 307
            VK++ QA+FGR E+E+AE +M  L++ R      +P  GA+I G  H+T QTAVLIETL 
Sbjct: 191  VKNIKQAEFGRREIEIAEQDMSALISLRKRAQGEKPLAGAKIVGCTHITAQTAVLIETLC 250

Query: 308  ALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGPDL 487
            ALGA+ RW +CNI+STQ+               WKGE+  ++WWC +R ++   G   ++
Sbjct: 251  ALGAQCRWSACNIYSTQNEVAAALAEAGVAVFAWKGESEDDFWWCIDRCVNMD-GWQANM 309

Query: 488  IVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRM 667
            I+DDGGD T  ++                                         KKY  +
Sbjct: 310  ILDDGGDLTHWVY-----------------------------------------KKYPNV 328

Query: 668  KERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRA 847
             +++ G+ EE+ TGV RLYQ+ ++G L  PA+NVNDSVTK KFDNLY CR S+ DGL R 
Sbjct: 329  FKKIRGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRT 388

Query: 848  TDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVV 1027
            TDVM  GK  VVCGYG+VGKGC AALK  GA V +TEIDPICALQA M+G +V+ L +V+
Sbjct: 389  TDVMFGGKQVVVCGYGEVGKGCCAALKALGAIVYITEIDPICALQACMDGFRVVKLNEVI 448

Query: 1028 SEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQT 1207
             + D+ +T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L T P +    ++ Q 
Sbjct: 449  RQVDVVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRT-PELTWERVRSQV 507

Query: 1208 DRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKK 1387
            D  ++P+ K  +++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ 
Sbjct: 508  DHVIWPDGKR-VVLLAEGRLLNLSCST-VPTFVLSITATTQALALIELYNAPE-GRYKQD 564

Query: 1388 VYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            VY+LPK +DE V                 +QA Y+ +   GP+KP +YRY
Sbjct: 565  VYLLPKKMDEYVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY 614



>gb:HSM800298_1185800 Homo sapiens mRNA; cDNA DKFZp564A1523 (from
            clone DKFZp564A1523).
          Length = 484

 Score =  387 bits (994), Expect = e-106
 Identities = 201/470 (42%), Positives = 284/470 (60%)
 Frame = +2

Query: 128  VKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLT 307
            VK++ QA+FGR E+E+AE +M  L++ R      +P  GA+I G  H+T QTAVLIETL 
Sbjct: 61   VKNIKQAEFGRREIEIAEQDMSALISLRKRAQGEKPLAGAKIVGCTHITAQTAVLIETLC 120

Query: 308  ALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGPDL 487
            ALGA+ RW +CNI+STQ+               WKGE+  ++WWC +R ++   G   ++
Sbjct: 121  ALGAQCRWSACNIYSTQNEVAAALAEAGVAVFAWKGESEDDFWWCIDRCVNMD-GWQANM 179

Query: 488  IVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRM 667
            I+DDGGD T  ++                                         KKY  +
Sbjct: 180  ILDDGGDLTHWVY-----------------------------------------KKYPNV 198

Query: 668  KERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRA 847
             +++ G+ EE+ TGV RLYQ+ ++G L  PA+NVNDSVTK KFDNLY CR S+ DGL R 
Sbjct: 199  FKKIRGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRT 258

Query: 848  TDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVV 1027
            TDVM  GK  VVCGYG+VGKGC AALK  GA V +TEIDPICALQA M+G +V+ L +V+
Sbjct: 259  TDVMFGGKQVVVCGYGEVGKGCCAALKALGAIVYITEIDPICALQACMDGFRVVKLNEVI 318

Query: 1028 SEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQT 1207
             + D+ +T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L T P +    ++ Q 
Sbjct: 319  RQVDVVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRT-PELTWERVRSQV 377

Query: 1208 DRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKK 1387
            D  ++P+ K  +++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ 
Sbjct: 378  DHVIWPDGKR-VVLLAEGRLLNLSCST-VPTFVLSITATTQALALIELYNAPE-GRYKQD 434

Query: 1388 VYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            VY+LPK +DE V                 +QA Y+ +   GP+KP +YRY
Sbjct: 435  VYLLPKKMDEYVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY 484



>pir|T08681|T08681 adenosylhomocysteinase (EC 3.3.1.1) DKFZp564A1523 -
            human  (fragment)
          Length = 597

 Score =  387 bits (994), Expect = e-106
 Identities = 201/470 (42%), Positives = 284/470 (60%)
 Frame = +2

Query: 128  VKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLT 307
            VK++ QA+FGR E+E+AE +M  L++ R      +P  GA+I G  H+T QTAVLIETL 
Sbjct: 174  VKNIKQAEFGRREIEIAEQDMSALISLRKRAQGEKPLAGAKIVGCTHITAQTAVLIETLC 233

Query: 308  ALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGPDL 487
            ALGA+ RW +CNI+STQ+               WKGE+  ++WWC +R ++   G   ++
Sbjct: 234  ALGAQCRWSACNIYSTQNEVAAALAEAGVAVFAWKGESEDDFWWCIDRCVNMD-GWQANM 292

Query: 488  IVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRM 667
            I+DDGGD T  ++                                         KKY  +
Sbjct: 293  ILDDGGDLTHWVY-----------------------------------------KKYPNV 311

Query: 668  KERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRA 847
             +++ G+ EE+ TGV RLYQ+ ++G L  PA+NVNDSVTK KFDNLY CR S+ DGL R 
Sbjct: 312  FKKIRGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRT 371

Query: 848  TDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVV 1027
            TDVM  GK  VVCGYG+VGKGC AALK  GA V +TEIDPICALQA M+G +V+ L +V+
Sbjct: 372  TDVMFGGKQVVVCGYGEVGKGCCAALKALGAIVYITEIDPICALQACMDGFRVVKLNEVI 431

Query: 1028 SEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQT 1207
             + D+ +T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L T P +    ++ Q 
Sbjct: 432  RQVDVVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRT-PELTWERVRSQV 490

Query: 1208 DRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKK 1387
            D  ++P+ K  +++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ 
Sbjct: 491  DHVIWPDGKR-VVLLAEGRLLNLSCST-VPTFVLSITATTQALALIELYNAPE-GRYKQD 547

Query: 1388 VYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            VY+LPK +DE V                 +QA Y+ +   GP+KP +YRY
Sbjct: 548  VYLLPKKMDEYVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY 597



>sp|O43865|SAH2_HUMAN Putative adenosylhomocysteinase 2 (EC 3.3.1.1)
            (S-adenosyl-L- homocysteine hydrolase)
            (AdoHcyase).>gb:BC007576_1970826 Homo sapiens,
            S-adenosylhomocysteine hydrolase-like 1, clone MGC:15558
            IMAGE:3139729, mRNA, complete cds.>gb:BC010681_1972755
            Homo sapiens, S-adenosylhomocysteine hydrolase-like 1,
            clone MGC:8936 IMAGE:3853747, mRNA, complete
            cds.>gb:BC016942_1975812 Homo sapiens,
            S-adenosylhomocysteine hydrolase-like 1, clone MGC:21453
            IMAGE:3450568, mRNA, complete cds.>gb:HSU82761_2026635
            Homo sapiens S-adenosyl homocysteine hydrolase homolog
            (XPVkona) mRNA, complete cds.
          Length = 500

 Score =  387 bits (994), Expect = e-106
 Identities = 201/470 (42%), Positives = 284/470 (60%)
 Frame = +2

Query: 128  VKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLT 307
            VK++ QA+FGR E+E+AE +M  L++ R      +P  GA+I G  H+T QTAVLIETL 
Sbjct: 77   VKNIKQAEFGRREIEIAEQDMSALISLRKRAQGEKPLAGAKIVGCTHITAQTAVLIETLC 136

Query: 308  ALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGPDL 487
            ALGA+ RW +CNI+STQ+               WKGE+  ++WWC +R ++   G   ++
Sbjct: 137  ALGAQCRWSACNIYSTQNEVAAALAEAGVAVFAWKGESEDDFWWCIDRCVNMD-GWQANM 195

Query: 488  IVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRM 667
            I+DDGGD T  ++                                         KKY  +
Sbjct: 196  ILDDGGDLTHWVY-----------------------------------------KKYPNV 214

Query: 668  KERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRA 847
             +++ G+ EE+ TGV RLYQ+ ++G L  PA+NVNDSVTK KFDNLY CR S+ DGL R 
Sbjct: 215  FKKIRGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRT 274

Query: 848  TDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVV 1027
            TDVM  GK  VVCGYG+VGKGC AALK  GA V +TEIDPICALQA M+G +V+ L +V+
Sbjct: 275  TDVMFGGKQVVVCGYGEVGKGCCAALKALGAIVYITEIDPICALQACMDGFRVVKLNEVI 334

Query: 1028 SEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQT 1207
             + D+ +T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L T P +    ++ Q 
Sbjct: 335  RQVDVVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRT-PELTWERVRSQV 393

Query: 1208 DRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKK 1387
            D  ++P+ K  +++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ 
Sbjct: 394  DHVIWPDGKR-VVLLAEGRLLNLSCST-VPTFVLSITATTQALALIELYNAPE-GRYKQD 450

Query: 1388 VYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            VY+LPK +DE V                 +QA Y+ +   GP+KP +YRY
Sbjct: 451  VYLLPKKMDEYVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY 500



>gb:BT010277_1357568 Drosophila melanogaster RE06911 full insert cDNA.
          Length = 521

 Score =  386 bits (992), Expect = e-106
 Identities = 210/483 (43%), Positives = 289/483 (59%), Gaps = 2/483 (0%)
 Frame = +2

Query: 95   VEKTSSGR-EYKVKDM-SQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLH 268
            V+K S G  ++ V+++ +Q  FGR E+E+AE EMPG++A +      +P K A+I G  H
Sbjct: 85   VQKNSKGSSDFCVRNIGAQHAFGRREIEIAEQEMPGIIALKKRAAEDKPLKDAKIVGCTH 144

Query: 269  MTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTE 448
            +  QTAVLIETL  LGA VRW +CNI+STQ+               W+GET +++WWC +
Sbjct: 145  INAQTAVLIETLVELGASVRWAACNIYSTQNEVAAALAESGIPIFAWRGETEEDFWWCID 204

Query: 449  RALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIR 628
            R ++      P++I+DDGGDAT L+                                   
Sbjct: 205  RCVN-AENWQPNMILDDGGDATHLML---------------------------------- 229

Query: 629  DGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLY 808
                   KKY  M + + G+ EE+ TGV RLYQ+ ++G L  PA+NVNDSVTK+KFDNLY
Sbjct: 230  -------KKYPTMFKLVKGIVEESVTGVHRLYQLSKAGKLTVPAMNVNDSVTKTKFDNLY 282

Query: 809  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL 988
             C+ S+ D L R+TDVM  GK  VVCGYGDVGKGCA ALK  G  V +TEIDPICALQA 
Sbjct: 283  SCKESILDSLKRSTDVMFGGKQVVVCGYGDVGKGCAQALKGQGCIVYITEIDPICALQAS 342

Query: 989  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLET 1168
            M+G +V+ L +V+   DI VT TGNK++++  HM KMK+  IVCN+GH + EID++GL T
Sbjct: 343  MDGFRVVKLNEVIRNVDIVVTATGNKNVVVREHMDKMKSGCIVCNMGHSNTEIDVNGLRT 402

Query: 1169 YPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE 1348
             P +    ++ Q D  ++PE K  II+LAEGRL+NL C++  PSF +S +   Q +A +E
Sbjct: 403  -PDLTWEKVRSQVDHIIWPEGKY-IILLAEGRLVNLSCSS-IPSFAVSITSATQALALIE 459

Query: 1349 LWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPH 1528
            L+     G+Y+  VY+LPK +DE V                 E+A Y+ +   GP+KP +
Sbjct: 460  LFNAP-PGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEKAKYMGLNKAGPFKPNY 518

Query: 1529 YRY 1537
            YRY
Sbjct: 519  YRY 521



>sp|Q9I685|SAHH_PSEAE Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>pir|H83591|H83591 S-adenosyl-L-homocysteine
            hydrolase PA0432 [imported] - Pseudomonas aeruginosa
            (strain PAO1)>gb:AE004480_54667 Pseudomonas aeruginosa
            PAO1, section 41 of 529 of the complete
            genome.>gb:AE004091_968767 Pseudomonas aeruginosa PAO1,
            complete genome.
          Length = 469

 Score =  385 bits (990), Expect = e-105
 Identities = 225/502 (44%), Positives = 292/502 (58%), Gaps = 29/502 (5%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            +YKV D++ A +GR EL +AE EMP LM  R ++   QP KGA+I G +HMTIQT VLIE
Sbjct: 12   DYKVADITLAAWGRRELIIAESEMPALMGLRRKYAGQQPLKGAKILGCIHMTIQTGVLIE 71

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA-LDWGPGG 475
            TL ALGAEVRW SCNIFSTQD               WKGET +EY WC E+  L  G   
Sbjct: 72   TLVALGAEVRWSSCNIFSTQDQAAAAIAAAGIPVFAWKGETEEEYEWCIEQTILKDGQPW 131

Query: 476  GPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKK 655
              ++++DDGGD T ++H                                         KK
Sbjct: 132  DANMVLDDGGDLTEILH-----------------------------------------KK 150

Query: 656  YTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDG 835
            Y +M ER+ G++EETTTGV RL  M ++GTL  PAINVNDSVTKSK DN YGCRHSL D 
Sbjct: 151  YPQMLERIHGITEETTTGVHRLLDMLKNGTLKVPAINVNDSVTKSKNDNKYGCRHSLNDA 210

Query: 836  LMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLT- 1012
            + R TD +++GK A+V GYGDVGKG + +L+Q G  V V E+DPICA+QA M+G +V++ 
Sbjct: 211  IKRGTDHLLSGKQALVIGYGDVGKGSSQSLRQEGMIVKVAEVDPICAMQACMDGFEVVSP 270

Query: 1013 ----LED---------VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDM 1153
                + D         ++ + D+ VTTTGN ++   + +K +K  A+VCNIGHFDNEID 
Sbjct: 271  YKNGINDGTEASIDAALLGKIDLIVTTTGNVNVCDANMLKALKKRAVVCNIGHFDNEIDT 330

Query: 1154 HGLETYPGVKRITIKPQTDRFVFPETKTG--------IIILAEGRLMNLGCATGHPSFVM 1309
              +      +   +KPQ  + +    K G        +I+LAEGRL+NLG ATGHPS +M
Sbjct: 331  AFMRKNWAWEE--VKPQVHK-IHRTGKDGFDAHNDDYLILLAEGRLVNLGNATGHPSRIM 387

Query: 1310 SCSFTNQVIAQLELWKEK--NTGKYEK----KVYVLPKHLDEKVXXXXXXXXXXXXXXXX 1471
              SF NQV+AQ+ L+++K  +    EK     V VLPK LDE+V                
Sbjct: 388  DGSFANQVLAQIHLFEQKYADLPAAEKAKRLSVEVLPKKLDEEVALEMVKGFGGVVTQLT 447

Query: 1472 PEQAAYISIPVEGPYKPPHYRY 1537
            P+QA YI + VEGP+KP  YRY
Sbjct: 448  PKQAEYIGVSVEGPFKPDTYRY 469



>sp|P50245|SAH2_DROME Putative adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L- homocysteine hydrolase)
            (AdoHcyase).>gb:AE014297_1139956 Drosophila melanogaster
            chromosome 3R, complete sequence.>gb:AE003715_1221949
            Drosophila melanogaster chromosome 3R, section 53 of 118
            of the complete sequence.>gb:AY113501_1299449 Drosophila
            melanogaster RE58316 full insert cDNA.
          Length = 492

 Score =  379 bits (973), Expect = e-103
 Identities = 204/478 (42%), Positives = 280/478 (58%)
 Frame = +2

Query: 104  TSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQT 283
            ++ G ++ VK +S++ FGR E+E+AE EMPG+M  R      +P KGA I G  H+  Q+
Sbjct: 62   SAGGTDFCVKSISKSAFGRREIEIAESEMPGIMTLRKRAKDEKPLKGANIVGCTHVNAQS 121

Query: 284  AVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDW 463
            AVLIETL  LGA VRW +CNI+STQ+               W+GET +E+WWC +RA+ +
Sbjct: 122  AVLIETLVQLGATVRWAACNIYSTQNAVAAALAEAGIPIFAWRGETEEEFWWCLDRAI-Y 180

Query: 464  GPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKA 643
              G  P+LI+DDGGDAT L+                                        
Sbjct: 181  SDGWQPNLILDDGGDATHLML--------------------------------------- 201

Query: 644  DPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHS 823
              KKY    + + G+ EE+ TGV RLY + + G L  PAINVNDSVTK+KFD  Y CR S
Sbjct: 202  --KKYPDYFKAIRGIVEESVTGVHRLYMLSKGGKLTVPAINVNDSVTKNKFDTFYTCRDS 259

Query: 824  LPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQ 1003
            + D L R TD+M  GK  V+CGYGDVGKGCA +LK  G  V VTE+DPICALQA M+G +
Sbjct: 260  ILDSLKRTTDIMFGGKQVVICGYGDVGKGCAQSLKGQGCIVYVTEVDPICALQAAMDGFR 319

Query: 1004 VLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVK 1183
            V+ L +V+   D+ VT TGNK++I   HM +MKN  I+CN+GH  +EID++GL T P + 
Sbjct: 320  VVRLNEVIRTVDVVVTATGNKNVITRDHMNRMKNGCILCNMGHSCSEIDVNGLHT-PELT 378

Query: 1184 RITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK 1363
               ++ Q D   +P+ +  II+LAEGRL+NL C+T   SFV+S + + Q +A +EL+   
Sbjct: 379  WERVRSQVDHIRWPDGRM-IILLAEGRLVNLSCST-ISSFVVSVASSTQALALIELFSA- 435

Query: 1364 NTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
              G+Y+  VY+LPK +DE V                 EQ+ ++ +   GP+K  +YRY
Sbjct: 436  -PGRYKSDVYLLPKKMDEYVASLHLATFDAHLTELTDEQSKFMGLNKAGPFKANYYRY 492



>sp|Q87V73|SAHH_PSESM Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:AE016874_354407 Pseudomonas syringae pv.
            tomato str. DC3000 section 19 of 21 of the complete
            genome.>gb:AE016853_1039582 Pseudomonas syringae pv.
            tomato str. DC3000 complete genome.
          Length = 469

 Score =  378 bits (970), Expect = e-103
 Identities = 225/502 (44%), Positives = 283/502 (56%), Gaps = 29/502 (5%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            +YKV D+S A +GR E  +AE EMP LM  R ++   QP KGA+I G +HMTIQTAVLIE
Sbjct: 12   DYKVADISLAAWGRRETIIAESEMPALMGLRRKYAAEQPLKGAKILGCIHMTIQTAVLIE 71

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA-LDWGPGG 475
            TL ALGAEVRW SCNIFSTQD               WKGET +EY WC E+  L  G   
Sbjct: 72   TLVALGAEVRWSSCNIFSTQDQAAAAIAAAGIAVYAWKGETEEEYEWCIEQTILKDGQPW 131

Query: 476  GPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKK 655
              ++I+DDGGD T +IH                                         KK
Sbjct: 132  DANMILDDGGDLTEIIH-----------------------------------------KK 150

Query: 656  YTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDG 835
            Y  M +++ GV+EETTTGV RL  M   G L  PAINVNDSVTKSK DN YGCRHSL D 
Sbjct: 151  YPAMLDKIHGVTEETTTGVHRLLDMLAKGELKIPAINVNDSVTKSKNDNKYGCRHSLNDA 210

Query: 836  LMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTL 1015
            + R TD +++GK A+V GYGDVGKG A +L+Q G  V VTE+DPICA+QA M+G ++++ 
Sbjct: 211  IKRGTDHLLSGKQALVIGYGDVGKGSAQSLRQEGMIVKVTEVDPICAMQACMDGFELVSP 270

Query: 1016 --------------EDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDM 1153
                          + ++ + D+ VTTTGN ++   + +K +K  A+VCNIGHFDNEID 
Sbjct: 271  FIDGENDGTEASIDKALLGKIDLIVTTTGNVNVCDSNMLKALKKRAVVCNIGHFDNEIDT 330

Query: 1154 HGL-------ETYPGVKRITIKPQTDRFVF-PETKTGIIILAEGRLMNLGCATGHPSFVM 1309
              +       E  P V +I    +T    F  +    +I+LAEGRL+NLG ATGHPS +M
Sbjct: 331  AFMRKNWAWEEVKPQVHKI---HRTGAGAFDAQNDDYLILLAEGRLVNLGNATGHPSRIM 387

Query: 1310 SCSFTNQVIAQLELWKEKNTGKYEKK------VYVLPKHLDEKVXXXXXXXXXXXXXXXX 1471
              SF NQV+AQ+ L+ +K       K      V VLPK LDE+V                
Sbjct: 388  DGSFANQVLAQIFLFDQKYADLAPAKKAERLTVEVLPKKLDEEVALEMVRGFGGVVTKLT 447

Query: 1472 PEQAAYISIPVEGPYKPPHYRY 1537
              QA YI + VEGP+KP  YRY
Sbjct: 448  KTQADYIGVTVEGPFKPDAYRY 469



>gb:AE014297_1139957 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003715_1221950 Drosophila melanogaster
            chromosome 3R, section 53 of 118 of the complete
            sequence.>gb:DMU31961_1380629 Drosophila melanogaster
            bithorax complex (BX-C), complete sequence.
          Length = 504

 Score =  376 bits (966), Expect = e-103
 Identities = 203/477 (42%), Positives = 279/477 (58%)
 Frame = +2

Query: 104  TSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQT 283
            ++ G ++ VK +S++ FGR E+E+AE EMPG+M  R      +P KGA I G  H+  Q+
Sbjct: 62   SAGGTDFCVKSISKSAFGRREIEIAESEMPGIMTLRKRAKDEKPLKGANIVGCTHVNAQS 121

Query: 284  AVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDW 463
            AVLIETL  LGA VRW +CNI+STQ+               W+GET +E+WWC +RA+ +
Sbjct: 122  AVLIETLVQLGATVRWAACNIYSTQNAVAAALAEAGIPIFAWRGETEEEFWWCLDRAI-Y 180

Query: 464  GPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKA 643
              G  P+LI+DDGGDAT L+                                        
Sbjct: 181  SDGWQPNLILDDGGDATHLML--------------------------------------- 201

Query: 644  DPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHS 823
              KKY    + + G+ EE+ TGV RLY + + G L  PAINVNDSVTK+KFD  Y CR S
Sbjct: 202  --KKYPDYFKAIRGIVEESVTGVHRLYMLSKGGKLTVPAINVNDSVTKNKFDTFYTCRDS 259

Query: 824  LPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQ 1003
            + D L R TD+M  GK  V+CGYGDVGKGCA +LK  G  V VTE+DPICALQA M+G +
Sbjct: 260  ILDSLKRTTDIMFGGKQVVICGYGDVGKGCAQSLKGQGCIVYVTEVDPICALQAAMDGFR 319

Query: 1004 VLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVK 1183
            V+ L +V+   D+ VT TGNK++I   HM +MKN  I+CN+GH  +EID++GL T P + 
Sbjct: 320  VVRLNEVIRTVDVVVTATGNKNVITRDHMNRMKNGCILCNMGHSCSEIDVNGLHT-PELT 378

Query: 1184 RITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK 1363
               ++ Q D   +P+ +  II+LAEGRL+NL C+T   SFV+S + + Q +A +EL+   
Sbjct: 379  WERVRSQVDHIRWPDGRM-IILLAEGRLVNLSCST-ISSFVVSVASSTQALALIELFSA- 435

Query: 1364 NTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYR 1534
              G+Y+  VY+LPK +DE V                 EQ+ ++ +   GP+K  +YR
Sbjct: 436  -PGRYKSDVYLLPKKMDEYVASLHLATFDAHLTELTDEQSKFMGLNKAGPFKANYYR 491



>pir|T15035|T15035 adenosylhomocysteinase (EC 3.3.1.1) -
            parsley>gb:PUMSHHA_1702880 Parsley S-adenosylhomocysteine
            hydrolase (SHH) mRNA, complete cds.
          Length = 227

 Score =  376 bits (965), Expect = e-102
 Identities = 187/227 (82%), Positives = 197/227 (86%)
 Frame = +2

Query: 857  MIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEA 1036
            MIAGKVA++ GYGDVGKGCAAA+KQAGARVIVTEIDPICALQA MEGLQVL LEDVVSE 
Sbjct: 1    MIAGKVALIAGYGDVGKGCAAAMKQAGARVIVTEIDPICALQATMEGLQVLPLEDVVSEV 60

Query: 1037 DIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRF 1216
            DIFVTTTGNKDIIMVS M+KMKNNAIV NIGHFDNEIDM GLETYPGVKRITIKPQTDR+
Sbjct: 61   DIFVTTTGNKDIIMVSDMRKMKNNAIVDNIGHFDNEIDMLGLETYPGVKRITIKPQTDRW 120

Query: 1217 VFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYV 1396
            VFP+T  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYV
Sbjct: 121  VFPDTGRGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYV 180

Query: 1397 LPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
             PKHLDEKV                 +QA YIS+PVEGPYKP HYRY
Sbjct: 181  CPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY 227



>gb:AF439722_1799980 Zea mays S-adenosyl-L-homocysteine hydrolase
           mRNA, partial cds.
          Length = 232

 Score =  369 bits (948), Expect(2) = e-101
 Identities = 175/204 (85%), Positives = 185/204 (90%)
 Frame = +2

Query: 143 QADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAE 322
           QADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMTIQTAVLIETLTALGAE
Sbjct: 1   QADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAE 60

Query: 323 VRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGPDLIVDDG 502
           VRWCSCNIFSTQDH              WKGETLQEYWWCTERALDWGPGGGPDLIVDDG
Sbjct: 61  VRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDG 120

Query: 503 GDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLV 682
           GDATLLIHEGVKAEEE+AKNGT+PDP+STDNAEFQ+VLTII++ LK DP KYT+MKERLV
Sbjct: 121 GDATLLIHEGVKAEEEFAKNGTIPDPNSTDNAEFQLVLTIIKESLKTDPLKYTKMKERLV 180

Query: 683 GVSEETTTGVKRLYQMQESGTLLF 754
           GVSEETTTGVKRLYQMQ +GTLLF
Sbjct: 181 GVSEETTTGVKRLYQMQANGTLLF 204



 Score = 23.9 bits (50), Expect(2) = e-101
 Identities = 10/12 (83%), Positives = 10/12 (83%)
 Frame = +3

Query: 783 PRASLTTCMDAA 818
           PRAS TTC DAA
Sbjct: 214 PRASSTTCTDAA 225



>pir|S01302|S01302 adenosylhomocysteinase (EC 3.3.1.1) - fruit fly
            (Drosophila melanogaster)>gb:DMBX200_1378257 Drosophila
            pH200 gene of distal BX-C region (bithorax complex).
          Length = 527

 Score =  367 bits (943), Expect = e-100
 Identities = 200/473 (42%), Positives = 274/473 (57%)
 Frame = +2

Query: 104  TSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQT 283
            ++ G ++ VK +S++ FGR E+E+AE EMPG+M  R      +P KGA I G  H+  Q+
Sbjct: 62   SAGGTDFCVKSISKSAFGRREIEIAESEMPGIMTLRKRAKDEKPLKGANIVGCTHVNAQS 121

Query: 284  AVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDW 463
            AVLIE L  LGA VRW +CNI+STQ+               W+GET +E+WWC +RA+ +
Sbjct: 122  AVLIEALVQLGATVRWAACNIYSTQNAVAAALAEAGIPIFAWRGETEEEFWWCLDRAI-Y 180

Query: 464  GPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKA 643
              G  P+LI+DDGGDAT L+                                        
Sbjct: 181  SDGWQPNLILDDGGDATHLML--------------------------------------- 201

Query: 644  DPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHS 823
              KKY    + + G+ EE+ TGV RLY + + G L  PAINVNDSVTK+KFD  Y CR S
Sbjct: 202  --KKYPDYFKAIRGIVEESVTGVHRLYMLSKGGKLTVPAINVNDSVTKNKFDTFYTCRDS 259

Query: 824  LPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQ 1003
            + D L R TD+M  GK  V+CGYGDVGKGCA +LK  G  V VTE+DPICALQA M+G +
Sbjct: 260  ILDSLKRTTDIMFGGKQVVICGYGDVGKGCAQSLKGQGCIVYVTEVDPICALQAAMDGFR 319

Query: 1004 VLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVK 1183
            V+ L +V+   D+ VT TGNK++I   HM +MKN  I+CN+GH  +EID++GL T P + 
Sbjct: 320  VVRLNEVIRTVDVVVTATGNKNVITRDHMNRMKNGCILCNMGHSCSEIDVNGLHT-PELT 378

Query: 1184 RITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK 1363
               ++ Q D   +P+ +  II+LAEGRL+NL C+T   SFV+S + + Q +A +EL+   
Sbjct: 379  WERVRSQVDHIRWPDGRM-IILLAEGRLVNLSCST-ISSFVVSVASSTQALALIELFSA- 435

Query: 1364 NTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKP 1522
              G+Y+  VY+LPK +DE V                 EQ+ ++ +   G  KP
Sbjct: 436  -PGRYKSDVYLLPKKMDEYVASLHLATFDAHLTELTDEQSKFMGLNKAGLLKP 487



>gb:AK075629_1170915 Mus musculus 18-day embryo whole body cDNA, RIKEN
            full-length enriched library, clone:1110019K01
            product:S-adenosylhomocysteine hydrolase, full insert
            sequence.
          Length = 324

 Score =  348 bits (892), Expect = 3e-94
 Identities = 193/370 (52%), Positives = 234/370 (63%)
 Frame = +2

Query: 428  EYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQ 607
            EY WC E+ L +   G  ++I+DDGGD T LIH                           
Sbjct: 1    EYLWCIEQTLHF-KDGPLNMILDDGGDLTNLIHT-------------------------- 33

Query: 608  IVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTK 787
                           KY ++   + G+SEETTTGV  LY+M  +G L  PAINVNDSVTK
Sbjct: 34   ---------------KYPQLLSGIRGISEETTTGVHNLYKMMSNGILKVPAINVNDSVTK 78

Query: 788  SKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDP 967
            SKFDNLYGCR SL DG+ RATDVMIAGKVAVV GYGDVGKGCA AL+  GARVI+TEIDP
Sbjct: 79   SKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDP 138

Query: 968  ICALQALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEI 1147
            I ALQA MEG +V T+++   E +IFVTTTG  DII+  H ++MK++AIVCNIGHFD EI
Sbjct: 139  INALQAAMEGYEVTTMDEACKEGNIFVTTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEI 198

Query: 1148 DMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTN 1327
            D+  L     V+++ IKPQ DR+     +  II+LAEGRL+NLGCA GHPSFVMS SFTN
Sbjct: 199  DVKWLNE-NAVEKVNIKPQVDRYWLKNGRR-IILLAEGRLVNLGCAMGHPSFVMSNSFTN 256

Query: 1328 QVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVE 1507
            QV+AQ+ELW   +  KY   V+ LPK LDE V                 +QA Y+ +P+ 
Sbjct: 257  QVMAQIELWTHPD--KYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMPIN 314

Query: 1508 GPYKPPHYRY 1537
            GP+KP HYRY
Sbjct: 315  GPFKPDHYRY 324



>gb:AL356299_1924404 Human DNA sequence from clone CTD-3216D2 on
            chromosome 20 Contains the AHCY gene encoding
            S-adenosylhomocysteine hydrolase, the 5' end of the ITCH
            gene for itchy homolog E3 ubiquitin protein ligase
            (mouse), the CDC42P1 gene for cell division cycle 42
            pseudogene 1, a pseudogene similar to part of laminin
            receptor 1 (ribosomal protein SA, 67kDa) (LAMR1) and two
            CpG islands, complete sequence.
          Length = 285

 Score =  317 bits (812), Expect = 5e-85
 Identities = 173/319 (54%), Positives = 203/319 (63%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKV D+  A +GR  L++AE EMPGLM  R  +  S+P KGARI G LHMT++TAVLIET
Sbjct: 7    YKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIET 66

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L  LGAEV+W SCNIFSTQDH              WKGET +EY WC E+ L +   G  
Sbjct: 67   LVTLGAEVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTL-YFKDGPL 125

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++I+DDGGD T LIH                                          KY 
Sbjct: 126  NMILDDGGDLTNLIHT-----------------------------------------KYP 144

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
            ++   + G+SEETTTGV  LY+M  +G L  PAINVNDSVTKSKFDNLYGCR SL DG+ 
Sbjct: 145  QLLPGIRGISEETTTGVHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIK 204

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RATDVMIAGKVAVV GYGDVGKGCA AL+  GARVI+TEIDPI ALQA MEG +V T+++
Sbjct: 205  RATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDE 264

Query: 1022 VVSEADIFVTTTGNKDIIM 1078
               E +IFVTTTG  DII+
Sbjct: 265  ACQEGNIFVTTTGCIDIIL 283



>gb:AF181566_1774856 Solanum chacoense S-adenosyl-L-homocysteine
           hydrolase mRNA, partial cds.
          Length = 171

 Score =  308 bits (788), Expect = 3e-82
 Identities = 149/167 (89%), Positives = 161/167 (96%)
 Frame = +2

Query: 470 GGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADP 649
           GGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGT+PDP+STDN EFQ+VLTII++ LK DP
Sbjct: 5   GGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPTSTDNVEFQLVLTIIKESLKTDP 64

Query: 650 KKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLP 829
            +YT+MKERLVGVSEETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLP
Sbjct: 65  LRYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLP 124

Query: 830 DGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI 970
           DGLMRATDVMIAGKVA+V GYGDVGKGCAAA+KQAGARVIVT+IDPI
Sbjct: 125 DGLMRATDVMIAGKVALVAGYGDVGKGCAAAMKQAGARVIVTDIDPI 171



>sp|Q9YEF2|SAHH_AERPE Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase).
          Length = 416

 Score =  300 bits (768), Expect = 7e-80
 Identities = 174/457 (38%), Positives = 251/457 (54%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            +KV+D+S A  GR+++E AE  MP LM  R+  G  +P  G R+   LH+T +TAVL+ET
Sbjct: 5    FKVRDLSLAGEGRMQIEWAERHMPVLMRLRSSMGGDKPLSGVRVAACLHVTKETAVLVET 64

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L   GAEV     N  STQD               W+G T +EY W    AL    G  P
Sbjct: 65   LRKWGAEVYLAPSNPLSTQDEVAAALAEAGIGVFAWRGMTPEEYKW----ALSTVAGREP 120

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            D+++DDG D  +L+HE +++                                        
Sbjct: 121  DIVIDDGADLHVLLHEEMRS---------------------------------------- 140

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
             + E++ G +EETTTGV RL  ++  G LL+P I VND++TK  FDN YG   S  DG++
Sbjct: 141  -VGEKVWGGTEETTTGVIRLRALEREGRLLYPVIAVNDALTKFMFDNRYGTGQSTVDGVL 199

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RAT+++IAGK  VV GYG VG+G AA  +  GA+V+VTE+DP+ AL+A M+G  V T+++
Sbjct: 200  RATNILIAGKTVVVAGYGWVGRGIAARFRGMGAKVVVTEVDPVRALEAAMDGFTVTTMDE 259

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
              S  D+F+T TGN ++I   HM+KMK+ AI+ N GHF+ EI++  LE     KR  ++ 
Sbjct: 260  AASLGDVFITATGNINVIDARHMEKMKDGAILANAGHFNVEINVAALEEMSVSKR-RVRR 318

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYE 1381
              D +  P+ +  + ++ EGRL+NL  A GHPS VM  SF+NQ +A L++  E+  G+ E
Sbjct: 319  YLDEYRLPDGRR-LYLIGEGRLVNLVAAEGHPSEVMDMSFSNQALAVLKIAGER--GRLE 375

Query: 1382 KKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYI 1492
            K+V+ + +  DE V                 EQ  Y+
Sbjct: 376  KRVHRVERIQDEMVARLKLETMGVRIDSLTEEQKLYL 412



>pir|C90224|C90224 s-adenosyl-L-homocysteine hydrolase (ahcY)
            [imported] - Sulfolobus solfataricus>gb:SSU18930_191174
            Sulfolobus solfataricus 281 kb genomic DNA fragment,
            strain P2.>gb:AE006699_221648 Sulfolobus solfataricus P2
            section 58 of 272 of the complete
            genome.>gb:AE006641_1107496 Sulfolobus solfataricus P2,
            complete genome.
          Length = 442

 Score =  294 bits (752), Expect = 5e-78
 Identities = 180/457 (39%), Positives = 239/457 (52%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YK+KD+S A  G+ ++E AE  MP LM  R  F   +P KG  I+  LH+T +TA L++T
Sbjct: 28   YKIKDLSLASEGKKQIEWAERHMPTLMEIRKRFKAEKPLKGINISAVLHVTKETAALVKT 87

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L   GA V     N  STQD               WKGE   EY+   E  +       P
Sbjct: 88   LKIGGANVALAGSNPLSTQDDVAAALVEEGISVFAWKGENETEYYSNIESIVKIHE---P 144

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++++DDG D    IHE V ++ +                                     
Sbjct: 145  NIVMDDGADLHAYIHEKVSSKLD------------------------------------- 167

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
                 + G +EETTTGV RL  M++ G L +P + VN++ TK  FDN YG   S  DG++
Sbjct: 168  -----IYGGTEETTTGVIRLKAMEKDGVLKYPLVAVNNAYTKYLFDNRYGTGQSAIDGIL 222

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RAT+++IAGK+AVV GYG VG+G A  L+  GARVIVTE+DPI AL+A+M+G  V+ + +
Sbjct: 223  RATNILIAGKIAVVAGYGWVGRGIANRLRGMGARVIVTEVDPIRALEAVMDGFDVMPIAE 282

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
                 DIFVT TGN   I V HM  MK+ AI+ N GHF+ E+D+ GL+    VK   I+P
Sbjct: 283  ASKVGDIFVTATGNTKAIRVEHMLNMKDGAILSNAGHFNVEVDVKGLKE-TAVKVRNIRP 341

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYE 1381
              D +  P  K  + +LA+GRL+NL  A GHPS VM  SF NQ +A   L   KN GK E
Sbjct: 342  YVDEYTLPNGKR-VYLLADGRLVNLAAAEGHPSEVMDMSFANQALAVEYL--VKNRGKLE 398

Query: 1382 KKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYI 1492
            KKVY +P  LD +V                 EQ  Y+
Sbjct: 399  KKVYNMPMELDYEVARIKLKSMGIQIDELTEEQKEYL 435



>sp|P50252|SAHH_SULSO Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>pir|JC5156|S58193 adenosylhomocysteinase (EC
            3.3.1.1) [validated] - Sulfolobus
            solfataricus>gb:SSAHCYGN_190487 S.solfataricus ahcY gene
            for S-adenosylhomocysteine hydrolase.
          Length = 417

 Score =  294 bits (752), Expect = 5e-78
 Identities = 180/457 (39%), Positives = 239/457 (52%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YK+KD+S A  G+ ++E AE  MP LM  R  F   +P KG  I+  LH+T +TA L++T
Sbjct: 3    YKIKDLSLASEGKKQIEWAERHMPTLMEIRKRFKAEKPLKGINISAVLHVTKETAALVKT 62

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L   GA V     N  STQD               WKGE   EY+   E  +       P
Sbjct: 63   LKIGGANVALAGSNPLSTQDDVAAALVEEGISVFAWKGENETEYYSNIESIVKIHE---P 119

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++++DDG D    IHE V ++ +                                     
Sbjct: 120  NIVMDDGADLHAYIHEKVSSKLD------------------------------------- 142

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
                 + G +EETTTGV RL  M++ G L +P + VN++ TK  FDN YG   S  DG++
Sbjct: 143  -----IYGGTEETTTGVIRLKAMEKDGVLKYPLVAVNNAYTKYLFDNRYGTGQSAIDGIL 197

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RAT+++IAGK+AVV GYG VG+G A  L+  GARVIVTE+DPI AL+A+M+G  V+ + +
Sbjct: 198  RATNILIAGKIAVVAGYGWVGRGIANRLRGMGARVIVTEVDPIRALEAVMDGFDVMPIAE 257

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
                 DIFVT TGN   I V HM  MK+ AI+ N GHF+ E+D+ GL+    VK   I+P
Sbjct: 258  ASKVGDIFVTATGNTKAIRVEHMLNMKDGAILSNAGHFNVEVDVKGLKE-TAVKVRNIRP 316

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYE 1381
              D +  P  K  + +LA+GRL+NL  A GHPS VM  SF NQ +A   L   KN GK E
Sbjct: 317  YVDEYTLPNGKR-VYLLADGRLVNLAAAEGHPSEVMDMSFANQALAVEYL--VKNRGKLE 373

Query: 1382 KKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYI 1492
            KKVY +P  LD +V                 EQ  Y+
Sbjct: 374  KKVYNMPMELDYEVARIKLKSMGIQIDELTEEQKEYL 410



>sp|Q975T0|SAHH_SULTO Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:BA000023_690902 Sulfolobus tokodaii str.
            7 DNA, complete genome.
          Length = 415

 Score =  293 bits (749), Expect = 1e-77
 Identities = 172/435 (39%), Positives = 243/435 (55%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            +YKVKD+S A+ G+ ++E AE+ MP LM  R +F   +P +G RI+  LH+T +TAVL++
Sbjct: 2    DYKVKDLSLAEQGKKQIEWAEIHMPALMEIRKQFEKEKPLQGLRISAVLHVTKETAVLVK 61

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG 478
            TL   GA V     N  STQD               W+GET ++Y+   +  L + P   
Sbjct: 62   TLKIGGATVALAGSNPLSTQDDVAAALVEEGIRVFAWRGETEKDYYDNIKEILKYEP--- 118

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKY 658
              +I+DDGGD    +HE +                                         
Sbjct: 119  -QIIMDDGGDLHAYVHENMP---------------------------------------- 137

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
               + +L G +EETTTGV RL  M+E G L +P I VN++ TK  FDN  G   S  DG+
Sbjct: 138  ---QLKLFGGTEETTTGVIRLKAMEEQGVLRYPVIAVNNAFTKYLFDNRIGTGQSTIDGI 194

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLE 1018
            +RAT+++IAGKVAVV GYG VG+G A  L+  GARVIV E+ P+ AL+A+M+G  V+ + 
Sbjct: 195  LRATNILIAGKVAVVAGYGWVGRGIAQRLRGMGARVIVVEVSPLRALEAVMDGFDVMPMS 254

Query: 1019 DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIK 1198
                  +IF+T TGN ++I   H+ KMK+ AI+ N GHF+ EID+ GL+      R+ I+
Sbjct: 255  KAAELGEIFITATGNINVIRKEHILKMKDGAILANSGHFNVEIDVKGLKEMAKSSRL-IR 313

Query: 1199 PQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKY 1378
            P  + +  P  K  I +LAEGRL+NL  A GHPS VM  SF+NQ ++   ++  +N GK 
Sbjct: 314  PNLEEYELPNGKR-IYLLAEGRLVNLAAAEGHPSEVMDLSFSNQALSVKYIY--ENRGKL 370

Query: 1379 EKKVYVLPKHLDEKV 1423
            E KVY +P+ +DE V
Sbjct: 371  ENKVYNVPQEIDETV 385



>gb:AF105295_1768303 Alexandrium fundyense S-adenosyl-homocysteine
            hydrolase like protein mRNA, partial cds.
          Length = 195

 Score =  290 bits (742), Expect = 7e-77
 Identities = 145/195 (74%), Positives = 162/195 (83%)
 Frame = +2

Query: 767  VNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARV 946
            VND VTKSKFDN+YGCRHSLPD +MRATDVMI GK A++CGYGDVGKGCA A++ AGARV
Sbjct: 1    VNDCVTKSKFDNVYGCRHSLPD-IMRATDVMIGGKRALICGYGDVGKGCALAMRGAGARV 59

Query: 947  IVTEIDPICALQALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNI 1126
            ++TEIDPICALQA MEG QV+TLE VV E DIF TTTGN  II + HMKKMKNNAIV NI
Sbjct: 60   LITEIDPICALQACMEGFQVVTLESVVGEVDIFTTTTGNFKIITLEHMKKMKNNAIVGNI 119

Query: 1127 GHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFV 1306
            GHFDNEI+M  LE  PG+K   IK Q DRF+FP+   GII+LA GRL+NLGCATGHPSFV
Sbjct: 120  GHFDNEIEMAELEGMPGIKVENIKAQVDRFIFPDGH-GIIVLASGRLLNLGCATGHPSFV 178

Query: 1307 MSCSFTNQVIAQLEL 1351
            MSCSFTNQV+  L L
Sbjct: 179  MSCSFTNQVLDNLTL 193



>pir|B72649|B72649 probable adenosylhomocysteinase APE0624 - Aeropyrum
            pernix  (strain K1)>gb:BA000002_651338 Aeropyrum pernix
            K1 DNA, complete genome.
          Length = 399

 Score =  286 bits (733), Expect = 8e-76
 Identities = 167/444 (37%), Positives = 241/444 (54%)
 Frame = +2

Query: 161  LELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSC 340
            +++E AE  MP LM  R+  G  +P  G R+   LH+T +TAVL+ETL   GAEV     
Sbjct: 1    MQIEWAERHMPVLMRLRSSMGGDKPLSGVRVAACLHVTKETAVLVETLRKWGAEVYLAPS 60

Query: 341  NIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLL 520
            N  STQD               W+G T +EY W    AL    G  PD+++DDG D  +L
Sbjct: 61   NPLSTQDEVAAALAEAGIGVFAWRGMTPEEYKW----ALSTVAGREPDIVIDDGADLHVL 116

Query: 521  IHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEET 700
            +HE +++                                         + E++ G +EET
Sbjct: 117  LHEEMRS-----------------------------------------VGEKVWGGTEET 135

Query: 701  TTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAV 880
            TTGV RL  ++  G LL+P I VND++TK  FDN YG   S  DG++RAT+++IAGK  V
Sbjct: 136  TTGVIRLRALEREGRLLYPVIAVNDALTKFMFDNRYGTGQSTVDGVLRATNILIAGKTVV 195

Query: 881  VCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIFVTTTG 1060
            V GYG VG+G AA  +  GA+V+VTE+DP+ AL+A M+G  V T+++  S  D+F+T TG
Sbjct: 196  VAGYGWVGRGIAARFRGMGAKVVVTEVDPVRALEAAMDGFTVTTMDEAASLGDVFITATG 255

Query: 1061 NKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTG 1240
            N ++I   HM+KMK+ AI+ N GHF+ EI++  LE     KR  ++   D +  P+ +  
Sbjct: 256  NINVIDARHMEKMKDGAILANAGHFNVEINVAALEEMSVSKR-RVRRYLDEYRLPDGRR- 313

Query: 1241 IIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEK 1420
            + ++ EGRL+NL  A GHPS VM  SF+NQ +A L++  E+  G+ EK+V+ + +  DE 
Sbjct: 314  LYLIGEGRLVNLVAAEGHPSEVMDMSFSNQALAVLKIAGER--GRLEKRVHRVERIQDEM 371

Query: 1421 VXXXXXXXXXXXXXXXXPEQAAYI 1492
            V                 EQ  Y+
Sbjct: 372  VARLKLETMGVRIDSLTEEQKLYL 395



>gb:BX957221_844173 Methanococcus maripaludis S2 complete genome;
            segment 3/5.
          Length = 415

 Score =  285 bits (728), Expect = 3e-75
 Identities = 177/464 (38%), Positives = 237/464 (51%), Gaps = 3/464 (0%)
 Frame = +2

Query: 128  VKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLT 307
            VKDMS A  G L++E A+  MP L     EF   +PF+G  I  +LH+  +TA+L ETL 
Sbjct: 4    VKDMSLAPSGHLKMEWAKRHMPVLCRIAEEFKNDKPFEGLTIGMALHLEAKTAILAETLL 63

Query: 308  ALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGPDL 487
              GA++    CN  STQD               W+GET +EY+    + LD      PD+
Sbjct: 64   EGGAKIVITGCNPLSTQDDVAAACVEKGMEVYAWRGETNEEYYENLNKVLD----SNPDI 119

Query: 488  IVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRM 667
            I+DDG D   LIH                                          + T +
Sbjct: 120  IIDDGADLIFLIHT-----------------------------------------ERTEL 138

Query: 668  KERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRA 847
              +++G  EETTTG+ RL  M E G L FP +NVND+ TK  FDN YG   S  DG++R 
Sbjct: 139  IGKIMGGCEETTTGIIRLKSMAEEGALKFPVVNVNDAYTKHLFDNRYGTGQSAMDGIIRT 198

Query: 848  TDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVV 1027
            T+++IAGK  VV GYG  G+G A+     GA VI+TE++PI AL+A M+G  VL +E+  
Sbjct: 199  TNLLIAGKNVVVGGYGWCGRGVASRAAGHGANVIITEVNPIRALEAKMDGFTVLKMEEAA 258

Query: 1028 SEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQT 1207
               DIFVTTTG KDI+ + H   MK+ A++ N GHFDNEI+ + L      K ++   + 
Sbjct: 259  KIGDIFVTTTGCKDILRMEHFLLMKDGAVLSNAGHFDNEINKNDL------KELSKSVKE 312

Query: 1208 DRFVFPETKTG---IIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKY 1378
             RF   E   G   I +L EGRL+NL CA GHP  VM  SF NQ ++   +  ++N GK 
Sbjct: 313  ARFNIEEYDLGNKKIYLLGEGRLVNLACADGHPCEVMDMSFANQALSAKFI--KENKGKL 370

Query: 1379 EKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEG 1510
            E +VY +P   D K+                PEQ  Y+S   EG
Sbjct: 371  ENEVYEIPYEQDFKIALLKLHSMGADIDELSPEQRKYLSDWKEG 414



>sp|P58855|SAHH_METKA Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:AE010334_262000 Methanopyrus kandleri
            AV19 section 33 of 157 of the complete
            genome.>gb:AE009439_902781 Methanopyrus kandleri AV19,
            complete genome.
          Length = 424

 Score =  277 bits (709), Expect = 5e-73
 Identities = 170/464 (36%), Positives = 233/464 (50%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            EY ++D S A  GR  +E A   MP L A R  F   +P +G  +  +LH+  +TAVL+E
Sbjct: 8    EYAIRDPSLAPKGRDMIEWARDHMPVLGAIRERFEEERPLEGITVGMTLHLEAKTAVLVE 67

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG 478
            TL A GAEV    CN  ST+D               W+GET +EY+   +R L   P   
Sbjct: 68   TLMAGGAEVAITGCNPLSTKDEVAAALVEEGVHVYAWRGETEEEYYQNIDRVLSHEP--- 124

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKY 658
             D+IVDDG D    +H                                          ++
Sbjct: 125  -DIIVDDGADCIARVHT-----------------------------------------EF 142

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
              + ER++G +EETTTGV RL+ M   G L FP I VND+ TK   DN YG   S  DGL
Sbjct: 143  PDLAERVIGATEETTTGVNRLHAMHREGVLKFPVIAVNDAKTKYLMDNRYGTGQSALDGL 202

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLE 1018
            MRAT++++AGK  VV GYG  G+G A   +  GA VIV E+DPI A++A+ +G +V+ ++
Sbjct: 203  MRATNILLAGKTVVVVGYGWCGRGIARRARGLGANVIVVEVDPIKAMEAIFDGFRVMPMD 262

Query: 1019 DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIK 1198
                E DIF+T TGN+D+I   H++KMK+  I+ N GHFD EID   LE +   K     
Sbjct: 263  RAAEEGDIFITATGNRDVIRGEHIEKMKDGVILANAGHFDVEIDKEYLEEHCEEKIDRRG 322

Query: 1199 PQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKY 1378
                 +  P+ K  + ++AEGRL+NL    GHP  +M  SF  Q ++   L KE    + 
Sbjct: 323  GLVTEYRMPDGKR-VYLIAEGRLVNLAAGEGHPIEIMDISFALQALSVEVLAKEGK--EM 379

Query: 1379 EKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEG 1510
            E  VY +PK +D++V                PEQ  Y+    EG
Sbjct: 380  EPGVYKVPKDVDKRVAELKLESMGIELEELTPEQREYMKSWEEG 423



>gb:AK131563_1918085 Homo sapiens cDNA FLJ16815 fis, clone
            THYMU3044175, highly similar to Adenosylhomocysteinase
            (EC 3.3.1.1).
          Length = 317

 Score =  276 bits (706), Expect = 1e-72
 Identities = 142/329 (43%), Positives = 198/329 (60%)
 Frame = +2

Query: 281  TAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALD 460
            T VLIETL ALGA+ RW +CNI+STQ+               WKGE+  ++WWC +R ++
Sbjct: 22   TQVLIETLCALGAQCRWSACNIYSTQNEVAAALAEAGVAVFAWKGESEDDFWWCIDRCVN 81

Query: 461  WGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLK 640
               G   ++I+DDGGD T  ++                                      
Sbjct: 82   MD-GWQANMILDDGGDLTHWVY-------------------------------------- 102

Query: 641  ADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRH 820
               KKY  + +++ G+ EE+ TGV RLYQ+ ++G L  PA+NVNDSVTK KFDNLY CR 
Sbjct: 103  ---KKYPNVFKKIRGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRE 159

Query: 821  SLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGL 1000
            S+ DGL R TDVM  GK  VVCGYG+VGKGC AALK  GA V +TEIDPICALQA M+G 
Sbjct: 160  SILDGLKRTTDVMFGGKQVVVCGYGEVGKGCCAALKALGAIVYITEIDPICALQACMDGF 219

Query: 1001 QVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGV 1180
            +V+ L +V+ + D+ +T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L T P +
Sbjct: 220  RVVKLNEVIRQVDVVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRT-PEL 278

Query: 1181 KRITIKPQTDRFVFPETKTGIIILAEGRL 1267
                ++ Q D  ++P+ K  +++LAE ++
Sbjct: 279  TWERVRSQVDHVIWPDGKR-VVLLAETQM 306



>sp|Q58783|SAHH_METJA Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>pir|C64473|C64473 adenosylhomocysteinase (EC
            3.3.1.1) - Methanococcus jannaschii>gb:U67578_207502
            Methanocaldococcus jannaschii DSM 2661 section 120 of 150
            of the complete genome.>gb:L77117_1100260
            Methanocaldococcus jannaschii DSM 2661, complete genome.
          Length = 415

 Score =  273 bits (699), Expect = 7e-72
 Identities = 172/467 (36%), Positives = 234/467 (50%), Gaps = 4/467 (0%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            Y+V+D++    G  +++ A+  MP L   R  F   +PFKG  I  +LH+  +TAVL ET
Sbjct: 2    YEVRDINLWKEGERKIQWAKQHMPVLNLIRERFKEEKPFKGITIGMALHLEAKTAVLAET 61

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L   GAE+    CN  STQD               W+GET++EY+    + LD  P    
Sbjct: 62   LMEGGAEIAITGCNPLSTQDDVAAACAKKGMHVYAWRGETVEEYYENLNKVLDHKP---- 117

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            D+++DDG D   L+H                                          K T
Sbjct: 118  DIVIDDGCDLIFLLHT-----------------------------------------KRT 136

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
             + + ++G  EETTTG+ RL  M++ G L FP ++VND+ TK  FDN YG   S  DG++
Sbjct: 137  ELLDNIMGGCEETTTGIIRLKAMEKEGALKFPVMDVNDAYTKHLFDNRYGTGQSALDGIL 196

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RAT+++IAGK  VV GYG  G+G A   K  GA V+VTE++PI AL+A M+G +V+ +E 
Sbjct: 197  RATNLLIAGKTVVVAGYGWCGRGVAMRAKGLGAEVVVTEVNPIRALEARMDGFRVMKMEK 256

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY-PGVKRITIK 1198
                 DIF+TTTG KD+I   H+ KM+N AI+ N GHFDNEI+   LE     +K +   
Sbjct: 257  AAEIGDIFITTTGCKDVIRKEHILKMRNGAILANAGHFDNEINKKHLEELAKSIKEV--- 313

Query: 1199 PQTDRFVFPETKTG---IIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNT 1369
                R    E   G   I +L EGRL+NL CA GHP  VM  SF NQ +A   +   KN 
Sbjct: 314  ----RNCVTEYDLGNKKIYLLGEGRLVNLACADGHPCEVMDMSFANQALAAEYIL--KNH 367

Query: 1370 GKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEG 1510
             K E +VY +P   D  +                 EQ  Y+    EG
Sbjct: 368  EKLEPRVYNIPYEQDLMIASLKLKAMGIEIDELTKEQKKYLEDWREG 414



>sp|Q8ZTQ7|SAHH_PYRAE Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:AE009913_257327 Pyrobaculum aerophilum
            strain IM2 section 168 of 201 of the complete
            genome.>gb:AE009441_899953 Pyrobaculum aerophilum strain
            IM2 complete genome.
          Length = 437

 Score =  271 bits (694), Expect = 3e-71
 Identities = 176/460 (38%), Positives = 236/460 (51%), Gaps = 1/460 (0%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            E +VKD S AD GR +L  AE+ MP L+  R  F   +P  G  I   LH+T +T VL+ 
Sbjct: 3    ESRVKDSSLADRGREQLYWAELNMPVLLEIRRRFEKEKPLSGHVIAACLHVTKETGVLVR 62

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG 478
            TL A GAEV     N  STQD               W+G + +EY+     A+ +     
Sbjct: 63   TLAAGGAEVVLIPSNPLSTQDDVAAALAQEGIHVYAWRGMSEREYY----NAIGFALSFN 118

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKY 658
            P + +DDG D T  IH+      +      +    S D A                    
Sbjct: 119  PTITMDDGADLTATIHKIGHGVRDQTIEYVLETAGSLDAA-------------------- 158

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
              +  R+ G +EETTTGV RL  +++SG LL+P I VN+S TK  FDN YG   S  DG+
Sbjct: 159  -GLFSRIRGGTEETTTGVIRLKALKKSGKLLYPIIAVNESYTKYLFDNRYGTGQSTWDGV 217

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGA-RVIVTEIDPICALQALMEGLQVLTL 1015
            MRAT+++IAGK  V+ GYG VG+G A   +  GA RVIV E+DPI AL+A+ +G +V+ +
Sbjct: 218  MRATNLLIAGKNVVIAGYGWVGRGIAIRARGLGARRVIVVEVDPIRALEAVFDGYEVMPM 277

Query: 1016 EDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITI 1195
            +      DIF+T TGN   I + H+ KMK+ A++ N GHF+ EID+ GLE     KR  I
Sbjct: 278  DKAAEVGDIFITATGNIRAISLGHIFKMKDGAVLANAGHFNVEIDVAGLERVAVAKR-RI 336

Query: 1196 KPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGK 1375
            +P  + +  P  K  + ++ EGRL+NL  A GHPS VM  SF NQ +A   L K     K
Sbjct: 337  RPYLEEYTLPNGKR-VYLIGEGRLVNLVAAEGHPSEVMDLSFANQALAAEFLAK----NK 391

Query: 1376 YEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYIS 1495
                VY LP  +D +V                 EQ  YIS
Sbjct: 392  LSVDVYKLPDEIDREVARLKLKTMGIEIEELTEEQRRYIS 431



>gb:AP008231_580601 Synechococcus elongatus PCC 6301 DNA, complete
            genome.
          Length = 426

 Score =  268 bits (685), Expect = 3e-70
 Identities = 170/459 (37%), Positives = 234/459 (50%), Gaps = 1/459 (0%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            Y+VKD+S A  G+  +E A  EMP +   R  F   +P  G R+    H+T +TA L   
Sbjct: 11   YEVKDLSLAPLGKQRIEWAAREMPVIRLIRDRFAAEKPLAGIRLVACCHVTTETANLAIA 70

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXX-XXXWKGETLQEYWWCTERALDWGPGGG 478
            L A GA+    + N  STQD                 KGE  + Y    + ALD  P   
Sbjct: 71   LKAGGADAILIASNPLSTQDDVAAGLVADYGIPLFAIKGEDNETYHRHVQIALDHKP--- 127

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKY 658
              +I+DDG D                                 +V T++++  +  P   
Sbjct: 128  -QVIIDDGCD---------------------------------VVATLVQERPQQLPD-- 151

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
                  ++G +EETTTG+ RL  M   G L FPA+NVND+ TK  FDN YG   S  DG+
Sbjct: 152  ------VIGTTEETTTGIVRLRAMLRDGVLTFPAMNVNDAETKHFFDNRYGTGQSTLDGI 205

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLE 1018
            +RAT++++AGK  VV GYG  GKG A      GA VIVTEIDP+ A++A+M+G +VL + 
Sbjct: 206  IRATNILLAGKTIVVAGYGWCGKGTAMRAAGMGANVIVTEIDPVKAIEAVMDGFRVLPMA 265

Query: 1019 DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIK 1198
            +     D+FVT TGNK +I   H   MK+ AIVCN GHFD EID+ GL+T     R T++
Sbjct: 266  EAAPLGDLFVTVTGNKHVIRTEHFAAMKDGAIVCNSGHFDIEIDIAGLKTLSSEVR-TVR 324

Query: 1199 PQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKY 1378
            P T+ +     K+ +I+L EGRL+NL  A GHPS VM  SF NQ +A   L    N G+ 
Sbjct: 325  PFTEEYRLASGKS-VIVLGEGRLVNLAAAEGHPSAVMDMSFANQALAVEHL--VTNRGRL 381

Query: 1379 EKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYIS 1495
            E  ++ +P+ LD ++                 +Q AYI+
Sbjct: 382  EPGIHSIPEDLDRQIATLKLQAMGIVIDSLTEDQTAYIN 420



>sp|Q7NGI6|SAHH_GLOVI Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:BA000045_743258 Gloeobacter violaceus PCC
            7421 DNA, complete genome.
          Length = 428

 Score =  265 bits (676), Expect = 3e-69
 Identities = 173/474 (36%), Positives = 237/474 (50%), Gaps = 1/474 (0%)
 Frame = +2

Query: 92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM 271
            T  KT     Y+V+++  A  GR  +E A  EMP L   R  F   +P  G RI+   H+
Sbjct: 2    TAVKTPIQVRYEVRNLELAAEGRQRIEWAAREMPVLKQLRQRFSQERPLAGIRISACCHV 61

Query: 272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXX-XXXWKGETLQEYWWCTE 448
            T +TA L   L A GA+    + N  STQD                 KGE    Y     
Sbjct: 62   TTETANLAVALKAAGADALLIASNPLSTQDDVAASLVVDHGIPVFALKGEDTATYLRHVR 121

Query: 449  RALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIR 628
             ALD  P     +I+DDG D                                 +V T+I+
Sbjct: 122  VALDHRP----QIIIDDGSD---------------------------------VVATMIK 144

Query: 629  DGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLY 808
            D  + D      +   ++G +EETTTG+ RL  M  +G L FPA+ VND+ TK  FDN Y
Sbjct: 145  D--RPD------LIAGVIGTTEETTTGIVRLKAMLAAGVLTFPAMAVNDAETKHFFDNRY 196

Query: 809  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL 988
            G   S  DG++RAT++++AGK  VV GYG  GKG A   +  GA V+VTEI+P+ A++A 
Sbjct: 197  GTGQSTLDGIIRATNILLAGKTIVVAGYGWCGKGVALRARGMGANVVVTEINPVRAIEAA 256

Query: 989  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLET 1168
            M+GLQV+ + +     D+F+T TGNK +I   H   MK+ AIVCN GHFD EID+  L  
Sbjct: 257  MDGLQVMPMAEAACLGDLFITVTGNKHVIRREHFAMMKDGAIVCNSGHFDIEIDLVALGE 316

Query: 1169 YPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE 1348
                +R+ ++P T+ +     K+ +I+L EGRL+NL  A GHP+ VM  SF NQ +A   
Sbjct: 317  LSSERRM-VRPFTEEYTLEGGKS-VIVLGEGRLINLAAAEGHPASVMDMSFANQALAVEY 374

Query: 1349 LWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEG 1510
            L   KN GK    +Y +P+ LD ++                P+Q  YIS   EG
Sbjct: 375  L--IKNQGKLSPGIYNIPEELDRQIAALKLAAMGIAIDTLTPDQLHYISSWDEG 426



>sp|P74008|SAHH_SYNY3 Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>pir|S75518|S75518 adenosylhomocysteinase (EC
            3.3.1.1) - Synechocystis sp.  (strain PCC
            6803)>gb:BA000022_688858 Synechocystis sp. PCC 6803 DNA,
            complete genome.
          Length = 425

 Score =  264 bits (674), Expect = 5e-69
 Identities = 169/462 (36%), Positives = 236/462 (51%), Gaps = 2/462 (0%)
 Frame = +2

Query: 116  REYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLI 295
            ++Y +KD+S A  GR  +E A  EMP L   R  F   +PF G R+    H+T +TA L 
Sbjct: 8    QKYDIKDISLAPQGRQRIEWAAREMPVLKQIRERFAQEKPFAGIRLVACCHVTTETANLA 67

Query: 296  ETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXX-XXXWKGETLQEYWWCTERALDWGPG 472
              L A GA+    + N  STQD                 KGE  + Y    + ALD  P 
Sbjct: 68   IALHAGGADSLLIASNPLSTQDDVAACLVADYGIPVYAIKGEDNETYHRHVQIALDHRP- 126

Query: 473  GGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPK 652
               ++I+DDG D                                 +V T++++       
Sbjct: 127  ---NIIIDDGSD---------------------------------VVATLVQER------ 144

Query: 653  KYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPD 832
                    ++G +EETTTG+ RL  M   G L FPA+NVND+ TK  +DN YG   S  D
Sbjct: 145  --QHQLSDIIGTTEETTTGIVRLRAMFNDGVLTFPAMNVNDADTKHFYDNRYGTGQSTLD 202

Query: 833  GLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLT 1012
            G++RAT++++AGK  VV GYG  GKG A   K  GA VIVTEI P+ A++A M+G +V+ 
Sbjct: 203  GIIRATNILLAGKTIVVAGYGWCGKGVAMRAKGMGADVIVTEISPVPAIEAAMDGFRVMP 262

Query: 1013 LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGL-ETYPGVKRI 1189
            + +   + DIF+T TGNK +I   H   MK+ AIVCN GHFD EID+  L E    VK  
Sbjct: 263  MAEAAHQGDIFITVTGNKHVIRPEHFAVMKDGAIVCNSGHFDIEIDLKSLKEQAKEVKE- 321

Query: 1190 TIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNT 1369
             ++  T++++ P  K+ II++ EGRL+NL  A GHPS VM  SF NQ +A   L   KN 
Sbjct: 322  -VRNFTEQYILPNGKS-IIVIGEGRLVNLAAAEGHPSAVMDMSFANQALACEHL--VKNK 377

Query: 1370 GKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYIS 1495
            G+ E  ++ +P  +D+++                PEQ  YI+
Sbjct: 378  GQLEPGMHSIPVEVDQEIARLKLQAMGIAIDSLTPEQVEYIN 419



>gb:CP000027_79518 Dehalococcoides ethenogenes 195, complete genome.
          Length = 418

 Score =  262 bits (670), Expect = 2e-68
 Identities = 169/463 (36%), Positives = 228/463 (49%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            + VKDMS A  G+  ++ A  EM  L   +  F   +PFKG RI   LH+T +TA L   
Sbjct: 4    FDVKDMSLAALGKKRIDWAGREMKTLSLIKERFEQEKPFKGIRIAACLHITTETANLGLV 63

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L A GA++  C+ N  STQD                 GE  + Y+     ALD      P
Sbjct: 64   LKAGGADLTLCASNPLSTQDETAAALVEHGINTFAIHGEDNESYYRHIAAALD----AKP 119

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
             L VDDG D    +H                                          + T
Sbjct: 120  QLTVDDGADLVATLHS-----------------------------------------QRT 138

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
             +   ++G +EETTTGV RL  + ESG L +P I VND+ TK  FDN YG   S  DG+ 
Sbjct: 139  ELLSGILGGTEETTTGVIRLRALAESGKLCYPIIAVNDAKTKYMFDNRYGTGQSTLDGIT 198

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
            RAT+ + A K  VV GYG  G G A   K  GA +IVTE+DP+ AL+A+M+G  V+ + +
Sbjct: 199  RATNFLWASKTVVVVGYGWCGHGVAMRAKGLGAHIIVTEVDPVKALEAVMDGFSVMPMAE 258

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKP 1201
                 DIF+T TG+K +I  +H K MK+ A + N GHF++EI++  LET    K  TI+P
Sbjct: 259  AAKAGDIFITVTGDKHVIDANHFKLMKDGATLANSGHFNSEINIPALETLACGKE-TIRP 317

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYE 1381
              + +   + +  I +L EGRL+NL  A GHP+ VM  SF NQ ++ LE +  KN  K E
Sbjct: 318  SVEEYKMKDGRR-IYLLGEGRLINLAAAEGHPAAVMDMSFANQALS-LE-YLVKNHTKLE 374

Query: 1382 KKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEG 1510
            KKVY +P+ +D  V                 EQ  Y+S   EG
Sbjct: 375  KKVYAVPEEIDRAVAATKLSSLNVSIDTLTEEQIKYLSSWQEG 417



>sp|Q8YX05|SAHH_ANASP Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>pir|AC1983|AC1983 adenosylhomocysteinase
            [imported] - Nostoc sp. (strain PCC
            7120)>gb:BA000019_682405 Nostoc sp. PCC 7120 DNA,
            complete genome.
          Length = 425

 Score =  260 bits (664), Expect = 8e-68
 Identities = 169/466 (36%), Positives = 236/466 (50%), Gaps = 2/466 (0%)
 Frame = +2

Query: 104  TSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQT 283
            TS   +++VKD++ A  GR  +E A  EMP L   R  F   +PF G R+    H+T +T
Sbjct: 4    TSPRLKHEVKDLALAPLGRQRIEWAGREMPVLRQIRDRFAQEKPFAGLRLVACAHITTET 63

Query: 284  AVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXX-XXXWKGETLQEYWWCTERALD 460
            A L   L A GA+    + N  STQD                 KGE    Y    + ALD
Sbjct: 64   AHLAIALKAGGADAVLIASNPLSTQDDVAASLVLDHEIPVFAQKGEDNATYNRHVQIALD 123

Query: 461  WGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLK 640
              P    ++I+DDG D                                 +V T++++   
Sbjct: 124  HRP----NIIIDDGSD---------------------------------VVATLVQER-- 144

Query: 641  ADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRH 820
                        L+G +EETTTG+ RL  M + G L FPA+NVND+ TK  FDN YG   
Sbjct: 145  ------QHQIADLIGTTEETTTGIVRLRAMFKDGVLTFPAVNVNDADTKHFFDNRYGTGQ 198

Query: 821  SLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGL 1000
            S  DG++RAT++++AGK  VV GYG  GKG A   +  GA VIVTEIDPI A++A+M+G 
Sbjct: 199  STLDGIIRATNILLAGKNVVVVGYGWCGKGTALRARGMGANVIVTEIDPIKAIEAVMDGF 258

Query: 1001 QVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGV 1180
            +VL + +   + DIF+T TGNK ++   H   MK+ AIVCN GHFD E+D+  L      
Sbjct: 259  RVLPMAEAAPQGDIFITVTGNKHVVRGEHFDVMKDGAIVCNSGHFDLELDLKYLAA--NA 316

Query: 1181 KRI-TIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWK 1357
            K I  ++P T+ +     K+ +++L +GRL+NL  A GHPS VM  SF NQ +A   L  
Sbjct: 317  KEIKEVRPFTEEYKLTNGKS-VVVLGQGRLINLAAAEGHPSAVMDMSFANQALACEYL-- 373

Query: 1358 EKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYIS 1495
             KN GK    ++ +P  +D+++                PEQ  YI+
Sbjct: 374  VKNKGKLAPGLHSIPVEVDQEIARLKLQAMGIYIDSLTPEQIEYIN 419



>sp|O67240|SAHH_AQUAE Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>pir|E70401|E70401 S-adenosylhomocysteine
            hydrolase - Aquifex aeolicus>gb:AE000727_26592 Aquifex
            aeolicus VF5 section 59 of 109 of the complete
            genome.>gb:AE000657_977123 Aquifex aeolicus VF5 complete
            genome.
          Length = 418

 Score =  259 bits (663), Expect = 1e-67
 Identities = 168/460 (36%), Positives = 232/460 (50%), Gaps = 1/460 (0%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            E+ VKD+S A+ G   +E AE++MP L   R  F   +P KG +I+  LH+T +TA L+ 
Sbjct: 2    EFDVKDLSLAEEGLKRIEWAEMDMPVLRQIRERFSKEKPLKGKKISACLHVTTETANLMR 61

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXX-XXXWKGETLQEYWWCTERALDWGPGG 475
            TL   GAEV   + N  STQD                 +GE  + Y+      ++     
Sbjct: 62   TLKEGGAEVYLTASNPLSTQDDVAAALVKYFEIPVFAIRGEDRETYYKHLRAVIE----K 117

Query: 476  GPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKK 655
             PD+++DDG D    +H                                         K+
Sbjct: 118  EPDVVIDDGADLISTLH-----------------------------------------KE 136

Query: 656  YTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDG 835
            Y  + E+++G  EETTTGV RL  M E G L FP I VND+ TK  FDN YG   S  DG
Sbjct: 137  YPGLAEKVLGGMEETTTGVIRLRAMAEQGVLKFPIIAVNDAYTKHMFDNRYGTGQSTIDG 196

Query: 836  LMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTL 1015
            ++RAT+ ++AG   VV GYG  GKG A   +  GA VIVTE+DPI AL+A M+G  V+ +
Sbjct: 197  ILRATNRLLAGSYFVVAGYGWCGKGVAQRARGMGAIVIVTEVDPIKALEARMDGFLVMPM 256

Query: 1016 EDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITI 1195
            E+     D FVT TGN  +I   H + MK+ AIV N GHF+ EID+  LE    V++  I
Sbjct: 257  EEAAKLGDFFVTVTGNIHVIRREHFEVMKDGAIVANSGHFNVEIDIPALEEM-AVEKREI 315

Query: 1196 KPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGK 1375
            + +   +   + +  I +LAEGRL+NL  A GHP+ VM  SF+NQ ++   + K     +
Sbjct: 316  RKEVTEYKLKDGRR-IYLLAEGRLVNLAAAEGHPASVMDMSFSNQALSAEYIVKHHK--E 372

Query: 1376 YEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYIS 1495
             EKKVY +P+ +DE V                 EQ  Y+S
Sbjct: 373  LEKKVYRVPREIDEAVARLKLNALGIKIDELTEEQKKYLS 412



>sp|Q8DGC8|SAHH_SYNEL Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:BA000039_728174 Thermosynechococcus
            elongatus BP-1 DNA, complete genome.
          Length = 429

 Score =  259 bits (662), Expect = 1e-67
 Identities = 167/466 (35%), Positives = 233/466 (50%), Gaps = 1/466 (0%)
 Frame = +2

Query: 101  KTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQ 280
            K+ +   + VKD+S A  G+  +E A  EMP L   R  F   +PF G R+    H+T +
Sbjct: 7    KSEAPVRHDVKDLSLAPLGQQRIEWASREMPVLRQIRDRFEKEKPFAGIRLAACCHVTTE 66

Query: 281  TAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXX-XXXWKGETLQEYWWCTERAL 457
            TA L   L A GA+    + N  STQD                 KGE    Y      AL
Sbjct: 67   TANLAIALKAGGADAVLIASNPLSTQDDVAASLVVNYGIPVFAQKGEDTATYMRHVNIAL 126

Query: 458  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGL 637
            D  P    ++I+DDG D                                 +V T++    
Sbjct: 127  DHRP----NIIIDDGCD---------------------------------VVATLV---- 145

Query: 638  KADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCR 817
                K+       ++G +EETTTG+ RL  M   G L FPAINVND+ TK  FDN YG  
Sbjct: 146  ----KERQHQISDIIGTTEETTTGIVRLKAMFRDGVLTFPAINVNDADTKHFFDNRYGTG 201

Query: 818  HSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEG 997
             S  DG++RAT++++AGK  VV GYG  GKG A   +  GA VIVTEIDP+ A++A+M+G
Sbjct: 202  QSTLDGIIRATNILLAGKTVVVAGYGWCGKGTALRARGMGANVIVTEIDPVRAIEAVMDG 261

Query: 998  LQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPG 1177
             +V+ + D     DIF+T TGNK +I   H   MK+ A+V N GHFD EID+  L+T   
Sbjct: 262  FRVMPMLDAAPLGDIFITVTGNKHVIRAEHFAVMKDGAMVANSGHFDIEIDLATLKTLAK 321

Query: 1178 VKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWK 1357
              R+ ++  T+ ++ P  K+ II+L EGRL+NL  A GHP+ VM  SF NQ +    L  
Sbjct: 322  QVRV-VRNFTEEYILPSGKS-IIVLGEGRLINLAAAEGHPASVMDMSFANQALGCEYL-- 377

Query: 1358 EKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYIS 1495
             KN G+    ++ +P  +D+++                PEQ  Y++
Sbjct: 378  VKNKGQLAAGIHPIPAAVDQEIARLKLQAMGIAIDTLTPEQVEYMN 423



>sp|O28279|SAHH_ARCFU Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>pir|G69499|G69499 adenosylhomocysteinase (EC
            3.3.1.1) homolog ahcY-2 - Archaeoglobus
            fulgidus>gb:AE000964_29905 Archaeoglobus fulgidus DSM
            4304 section 143 of 172 of the complete
            genome.>gb:AE000782_975876 Archaeoglobus fulgidus DSM
            4304 complete genome.
          Length = 405

 Score =  259 bits (661), Expect = 2e-67
 Identities = 165/447 (36%), Positives = 225/447 (50%)
 Frame = +2

Query: 155  GRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWC 334
            G  ++E AE  M  L   R +F   +P +G  +  +LH+  +TAVL+ TL   GAEV   
Sbjct: 3    GFRKIEWAERYMKVLGKIREQFRKERPLEGFTVGMALHVEAKTAVLVRTLVDAGAEVAIT 62

Query: 335  SCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDAT 514
             CN  STQD                +G  ++EY+      +       PD+++DDG D  
Sbjct: 63   GCNPMSTQDDVADALRESGIACYAKRGMDVEEYYEALRNVIR----AEPDIVIDDGADLI 118

Query: 515  LLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSE 694
             L+H  +   E YA                                      E++ G SE
Sbjct: 119  FLLHGEM---ESYA--------------------------------------EKVKGASE 137

Query: 695  ETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV 874
            ETTTGV RL  M+  G L FP I VND+ TK  FDN YG   S  DG++RAT++++AGK+
Sbjct: 138  ETTTGVIRLRAMEREGVLKFPVIAVNDAYTKYLFDNRYGTGQSAIDGVIRATNLLMAGKI 197

Query: 875  AVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIFVTT 1054
             VV GYG  G+G A   +  GA V+VTE+D I AL+A+M+G +V+ +ED     DIF+T 
Sbjct: 198  VVVAGYGWCGRGIAMRARGMGASVVVTEVDEIRALEAVMDGFRVMRMEDAAKIGDIFITA 257

Query: 1055 TGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETK 1234
            TGN+DII   H++ MK+ AI+ N GHF+ EID+  LE     KR   K  T+   +    
Sbjct: 258  TGNRDIIREEHIRLMKDGAILANAGHFNVEIDIPALERMAKAKREARKYVTE---YDLGD 314

Query: 1235 TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLD 1414
              + +LAEGRL+NL  A GHP  VM  SF NQ +A   +   +N  K E+KVY LP+ LD
Sbjct: 315  KRVYLLAEGRLVNLVAADGHPVEVMDMSFANQALAAKYI--AENWQKLERKVYRLPEELD 372

Query: 1415 EKVXXXXXXXXXXXXXXXXPEQAAYIS 1495
              V                 EQ  Y+S
Sbjct: 373  RMVARMKLESMGVEIDQLTEEQVRYLS 399



>pir|H71167|H71167 probable S-adenosyl-L-homocysteine hydrolase -
            Pyrococcus horikoshii>gb:BA000001_649191 Pyrococcus
            horikoshii OT3 DNA, complete genome.
          Length = 425

 Score =  256 bits (655), Expect = 9e-67
 Identities = 168/466 (36%), Positives = 232/466 (49%)
 Frame = +2

Query: 95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT 274
            V     GR+Y VKD+S AD G  +++     MP L   R EF   +PFKG RI  +LH+ 
Sbjct: 2    VNSMDCGRDYCVKDLSLADEGWKKIDWVSRFMPVLQHIRREFEEKKPFKGVRIAATLHLE 61

Query: 275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERA 454
            ++TA L+ TL A GAEV   + N  STQD                +GE+ ++Y+    +A
Sbjct: 62   MKTAFLLLTLKAGGAEVSAAASNPLSTQDDVVAALAKAGVKVYAIRGESKEQYYEFMHKA 121

Query: 455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDG 634
            LD  P    ++I+DDG D   L+H                                    
Sbjct: 122  LDIRP----NIIIDDGADMISLVH------------------------------------ 141

Query: 635  LKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGC 814
                 K+   + + + G SEETTTGV RL  M+  G L F  I VNDS  K  FDN YG 
Sbjct: 142  -----KERQELLDEIWGGSEETTTGVIRLRAMERDGVLRFSVIAVNDSYMKYLFDNRYGT 196

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALME 994
              S  DG+MRAT+++IAGK  VV GYG  G+G A   +  GA VIV E+DPI AL+A M+
Sbjct: 197  GQSTWDGVMRATNLLIAGKNVVVVGYGWCGRGIAMRARGLGATVIVVEVDPIKALEARMD 256

Query: 995  GLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYP 1174
            G  V+ +++     DIF+T TG+   I   H + MK+ AI+ N GHFD EI    LE   
Sbjct: 257  GFLVMNMKEAAKIGDIFITATGDIKCIRREHFELMKDGAIMANAGHFDVEIWKPDLEEL- 315

Query: 1175 GVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW 1354
             V+    +P    +   + +  + +LA+GRL+NL  A GHP+ +M  SF  Q  A+   +
Sbjct: 316  AVEISNPRPNVTEYKLKDGRR-LYLLADGRLVNLVAADGHPAEIMDMSFALQ--AKAAEY 372

Query: 1355 KEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYI 1492
             + N GK E +VY+LP+ +DE V                 EQ  Y+
Sbjct: 373  IKDNHGKLEPRVYILPREIDEMVARIKLASMGIEIEELTEEQKKYL 418



>sp|O58275|SAHH_PYRHO Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase).
          Length = 421

 Score =  256 bits (653), Expect = 1e-66
 Identities = 167/460 (36%), Positives = 231/460 (50%)
 Frame = +2

Query: 113  GREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVL 292
            GR+Y VKD+S AD G  +++     MP L   R EF   +PFKG RI  +LH+ ++TA L
Sbjct: 4    GRDYCVKDLSLADEGWKKIDWVSRFMPVLQHIRREFEEKKPFKGVRIAATLHLEMKTAFL 63

Query: 293  IETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPG 472
            + TL A GAEV   + N  STQD                +GE+ ++Y+    +ALD  P 
Sbjct: 64   LLTLKAGGAEVSAAASNPLSTQDDVVAALAKAGVKVYAIRGESKEQYYEFMHKALDIRP- 122

Query: 473  GGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPK 652
               ++I+DDG D   L+H                                         K
Sbjct: 123  ---NIIIDDGADMISLVH-----------------------------------------K 138

Query: 653  KYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPD 832
            +   + + + G SEETTTGV RL  M+  G L F  I VNDS  K  FDN YG   S  D
Sbjct: 139  ERQELLDEIWGGSEETTTGVIRLRAMERDGVLRFSVIAVNDSYMKYLFDNRYGTGQSTWD 198

Query: 833  GLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLT 1012
            G+MRAT+++IAGK  VV GYG  G+G A   +  GA VIV E+DPI AL+A M+G  V+ 
Sbjct: 199  GVMRATNLLIAGKNVVVVGYGWCGRGIAMRARGLGATVIVVEVDPIKALEARMDGFLVMN 258

Query: 1013 LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT 1192
            +++     DIF+T TG+   I   H + MK+ AI+ N GHFD EI    LE    V+   
Sbjct: 259  MKEAAKIGDIFITATGDIKCIRREHFELMKDGAIMANAGHFDVEIWKPDLEEL-AVEISN 317

Query: 1193 IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG 1372
             +P    +   + +  + +LA+GRL+NL  A GHP+ +M  SF  Q  A+   + + N G
Sbjct: 318  PRPNVTEYKLKDGRR-LYLLADGRLVNLVAADGHPAEIMDMSFALQ--AKAAEYIKDNHG 374

Query: 1373 KYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYI 1492
            K E +VY+LP+ +DE V                 EQ  Y+
Sbjct: 375  KLEPRVYILPREIDEMVARIKLASMGIEIEELTEEQKKYL 414



>sp|P50251|SAHH_PYRFU Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:AE010158_259910 Pyrococcus furiosus DSM
            3638, section 33 of 173 of the complete
            genome.>gb:AE009950_900691 Pyrococcus furiosus DSM 3638,
            complete genome.
          Length = 421

 Score =  255 bits (651), Expect = 3e-66
 Identities = 167/460 (36%), Positives = 233/460 (50%)
 Frame = +2

Query: 113  GREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVL 292
            G++Y VKD+S A+ G  +++     MP L   + EF   +PFKG RI  +LH+ ++TA L
Sbjct: 4    GKDYCVKDLSLAEEGWKKIDWVSRFMPVLQYIKREFEEKKPFKGVRIAATLHLEMKTAFL 63

Query: 293  IETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPG 472
            + TL A GAEV   + N  STQD                +GE+ ++Y+    +ALD  P 
Sbjct: 64   LLTLKAGGAEVSAAASNPLSTQDDVVAALAKAGVKVYAIRGESREQYYEFMHKALDIRP- 122

Query: 473  GGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPK 652
               ++I+DDG D   L+H                                         K
Sbjct: 123  ---NIIIDDGADMISLVH-----------------------------------------K 138

Query: 653  KYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPD 832
            +   M + + G SEETTTGV RL  M+++G L FP I VNDS  K  FDN YG   S  D
Sbjct: 139  ERQEMLDEIWGGSEETTTGVIRLRAMEKAGILKFPVIAVNDSYMKYLFDNRYGTGQSTWD 198

Query: 833  GLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLT 1012
            G+MRAT+++IAGK  VV GYG  G+G A   +  GA VIV E+DPI AL+A M+G  V+ 
Sbjct: 199  GIMRATNLLIAGKNVVVVGYGWCGRGIAMRARGLGATVIVVEVDPIKALEARMDGFLVMD 258

Query: 1013 LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT 1192
            +++     DIFVT TGN   I   H + MK+ AI+ N GHFD EI    LE    V+   
Sbjct: 259  MKEAAKIGDIFVTATGNIKCIRREHFELMKDGAIMANAGHFDVEIWKPDLEKL-AVEINN 317

Query: 1193 IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG 1372
             +P    +   + +  + +LA+GRL+NL  A GHP+ +M  SF  Q  A+   + + N  
Sbjct: 318  PRPNVTEYKLKDGRR-LYLLADGRLVNLVAADGHPAEIMDMSFALQ--AKAAEYIKDNHE 374

Query: 1373 KYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYI 1492
            + E KVY+LP+ +DE V                 EQ  Y+
Sbjct: 375  RLEPKVYILPREIDEMVARIKLESMGIKIEELTEEQKKYL 414



>gb:AP006878_575180 Thermococcus kodakaraensis strain KOD1 DNA,
            complete genome.
          Length = 421

 Score =  254 bits (650), Expect = 3e-66
 Identities = 164/459 (35%), Positives = 234/459 (50%)
 Frame = +2

Query: 116  REYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLI 295
            ++Y VKD+S A  G  +++     MP L   R +F   +PFKG RI  +LH+ ++TA L+
Sbjct: 5    KDYCVKDISLAPSGEKKIDWVSRFMPVLQHIRKDFEERKPFKGVRIAATLHLEMKTAFLL 64

Query: 296  ETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGG 475
             TL A GAEV   + N  STQD                +GE  ++Y+    +ALD  P  
Sbjct: 65   LTLKAAGAEVSAAASNPLSTQDDVVAALAKAGVKVYAIRGEDREQYYEFMHKALDVKP-- 122

Query: 476  GPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKK 655
              ++I+DDG D                                 +V T++++  +  P+ 
Sbjct: 123  --NIIIDDGAD---------------------------------MVSTVLKERQELIPEI 147

Query: 656  YTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDG 835
            +        G SEETTTGV RL  M++ G L FP I VNDS TK  FDN YG   S  DG
Sbjct: 148  W--------GASEETTTGVIRLRAMEKDGVLKFPIIAVNDSYTKYLFDNRYGTGQSTWDG 199

Query: 836  LMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTL 1015
            ++R T++++AGK  VV GYG  G+G A   +  GA VIV E+DPI AL+A M+G  V+ +
Sbjct: 200  IIRTTNLLVAGKNVVVVGYGWCGRGIAMRARGLGATVIVVEVDPIRALEARMDGFLVMDM 259

Query: 1016 EDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITI 1195
             +     DIF+T TG+ + I   H + MK+ AI+ N GHFD EI    LE    V+    
Sbjct: 260  MEAAKVGDIFITATGDINCIRKEHFELMKDGAILANAGHFDVEISKPDLEAL-AVEISEP 318

Query: 1196 KPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGK 1375
            +P    +   + +  + +LAEGRL+NL  A GHP+ +M  SF  Q  A+   + ++N G+
Sbjct: 319  RPNITEYKMADGRR-LYLLAEGRLVNLAAADGHPAEIMDMSFALQ--AKAAEYIKENRGR 375

Query: 1376 YEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYI 1492
             E KVYVLP+ +DE V                 EQ  Y+
Sbjct: 376  LEPKVYVLPREIDEMVARIKLASMGIKIEELTEEQKKYL 414



>gb:AY142857_592040 Heliobacillus mobilis Adenosylhomocysteinase gene,
            partial cds.
          Length = 425

 Score =  252 bits (644), Expect = 2e-65
 Identities = 158/444 (35%), Positives = 229/444 (51%), Gaps = 3/444 (0%)
 Frame = +2

Query: 101  KTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQ 280
            K +S  E  ++D+S A  G+L+++     MP L   + +F   +P  G R+   LH+  +
Sbjct: 6    KEASSVESMIRDISLAPKGQLKIDWVAQHMPILNQLKKDFEKRKPLAGKRVIICLHLEAK 65

Query: 281  TAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALD 460
            TA L  T+ A GAEV  C  N  STQD               W G T +EY     +ALD
Sbjct: 66   TAYLALTVKAAGAEVAVCGSNPLSTQDDVVAALVQNGVTAYAWYGATDEEYKMHLNKALD 125

Query: 461  WGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLK 640
            + P    D+++DDGGD    +H       E AK                           
Sbjct: 126  FQP----DILIDDGGDLVATLHA---ERPEQAK--------------------------- 151

Query: 641  ADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRH 820
                       +++G +EETTTG+ RL  + + G L FP + VND+  K  FDN YG   
Sbjct: 152  -----------KIIGGAEETTTGILRLKALAKEGHLSFPMMAVNDAQMKYLFDNRYGTGQ 200

Query: 821  SLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGL 1000
            S+ D +MR T++++ GKV VV GYG  GKG AA  +   AR++VTEIDP+ A +ALM+G 
Sbjct: 201  SVWDAIMRTTNLVVCGKVVVVGGYGWCGKGVAARARGLNARIVVTEIDPVKANEALMDGF 260

Query: 1001 QVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEI---DMHGLETY 1171
            +V+ + +     D+FVT TGN+DI+   H++ +K+ AI+CN GHFD E+   D+  L T 
Sbjct: 261  EVMPMVEAAKIGDVFVTVTGNRDIVRREHLEVIKDKAILCNAGHFDVEVNKEDLRALSTS 320

Query: 1172 PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL 1351
              + R  I+  T R         + +L EGRL+NL C  GHP+ VM  +F  Q ++ LE 
Sbjct: 321  VRIARNNIEEYTFR-----DGRKVYLLGEGRLVNLACGDGHPAEVMDLTFALQAMS-LE- 373

Query: 1352 WKEKNTGKYEKKVYVLPKHLDEKV 1423
            +   N  + E KVY +P+ +D KV
Sbjct: 374  YVFTNREQLEPKVYPVPEEIDRKV 397



>sp|O27673|SAHH_METTH Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>pir|F69085|F69085 adenosylhomocysteinase (EC
            3.3.1.1) - Methanobacterium thermoautotrophicum (strain
            Delta H)>gb:AE000922_29305 Methanobacterium
            thermoautotrophicum from bases 1493200 to 1503470
            (section 128 of 148) of the complete
            genome.>gb:AE000666_926387 Methanobacterium
            thermoautotrophicum str. Delta H complete genome.
          Length = 417

 Score =  252 bits (643), Expect = 2e-65
 Identities = 162/467 (34%), Positives = 226/467 (48%), Gaps = 4/467 (0%)
 Frame = +2

Query: 122  YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            YKVKD+S A  G  ++   +  MP L   +++F   +PFKG  I   LH+  +T  L  T
Sbjct: 3    YKVKDISLAPQGEKKIRWVQEHMPVLERIKSDFSEEKPFKGVTIGSCLHLEPKTINLGLT 62

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGP 481
            L A GAEV    CN  STQD               W+GET +EY+    R LD  P    
Sbjct: 63   LQAGGAEVAMTGCNPLSTQDDATAAGAKMGLNMYGWRGETNEEYYENIHRVLDHEP---- 118

Query: 482  DLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYT 661
            ++++DDG D   L+H                                         ++  
Sbjct: 119  EILIDDGADMIFLVH-----------------------------------------RERP 137

Query: 662  RMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLM 841
             + + ++G  EETTTG+ RL  M   G L FP + VND+ TK  FDN YG   S  D +M
Sbjct: 138  ELLDGIIGACEETTTGINRLRAMAADGALKFPVMAVNDAYTKYLFDNRYGTGQSTFDSIM 197

Query: 842  RATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLED 1021
              T+++IAGK  VVCGYG  G+G A   +  GA VIVTE+DPI AL+A M+G +V+ + D
Sbjct: 198  GTTNMLIAGKTVVVCGYGWCGRGIAMRAEGLGASVIVTEVDPIRALEARMDGFRVMKVSD 257

Query: 1022 VVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT--I 1195
             V EADI +T TGN D++  S    MK+  ++ N GHF+ EI+   LE    + R T  +
Sbjct: 258  AVKEADILITATGNTDVVSESEFMNMKDGCVMANSGHFNVEINREALEE---LSRETGKV 314

Query: 1196 KPQTDRFVFPETKTGIIILAEGRLMNLGC--ATGHPSFVMSCSFTNQVIAQLELWKEKNT 1369
            K   + F+ P+ +  I +LAEGRL+NL      GHP+ +M  SF  Q ++   L +EK  
Sbjct: 315  KEDIEVFIMPDGRK-IYLLAEGRLVNLASERGQGHPAEIMDMSFAMQALSARHLLQEKP- 372

Query: 1370 GKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEG 1510
               +  VY  P  +D  V                 +Q  Y+    EG
Sbjct: 373  ---DPGVYRAPDEIDLMVARMKLDAMGIEIDELTEKQRLYLENWEEG 416



>sp|Q9UYK5|SAHH_PYRAB Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>pir|B75064|B75064 adenosylhomocysteinase
            (ahcy) PAB1372 - Pyrococcus abyssi  (strain
            Orsay)>gb:CNSPAX05_850265 Pyrococcus abyssi complete
            genome; segment 5/6.
          Length = 422

 Score =  248 bits (633), Expect = 3e-64
 Identities = 165/458 (36%), Positives = 230/458 (50%)
 Frame = +2

Query: 119  EYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIE 298
            +Y VKD+S A  G  +++     MP L   R EF   +PFKG RI  +LH+ ++TA L+ 
Sbjct: 7    DYCVKDISLAPEGMKKIDWVSRFMPVLQHIRREFEEKKPFKGVRIAATLHLEMKTAFLLL 66

Query: 299  TLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGG 478
            TL A GA+V   + N  STQD                +GE+ +EY+    +ALD  P   
Sbjct: 67   TLKAGGAKVSAAASNPLSTQDDVVAALAKEGVKVYAIRGESKEEYYEFMNKALDIRP--- 123

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKY 658
             ++I+DDG D   L+H                    T+  E                   
Sbjct: 124  -NIIIDDGADMVSLVH--------------------TERKE------------------- 143

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
              + + + G SEETTTGV RL  M+    L FP I VNDS  K  FDN YG   S  DG+
Sbjct: 144  --LLDEIWGASEETTTGVIRLRAMERDKVLRFPVIAVNDSYMKYLFDNRYGTGQSTWDGI 201

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLE 1018
            MRAT++++AGK  VV GYG  G+G A   +  GA VIV E+DPI AL+A M+G  V++++
Sbjct: 202  MRATNLLVAGKNVVVVGYGWCGRGIAMRARGLGATVIVVEVDPIKALEARMDGFLVMSMK 261

Query: 1019 DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIK 1198
            +     DIFVT TGN   I   H + MK+ AI+ N GHFD EI    LE    V+    +
Sbjct: 262  EAAKIGDIFVTATGNIKCIRREHFELMKDGAIMANAGHFDVEIWKPDLEEL-AVEISNPR 320

Query: 1199 PQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKY 1378
            P    +   + +  + +LA+GRL+NL  A GHP+ +M  SF  Q  A+   + ++N  + 
Sbjct: 321  PNVTEYKLKDGRR-LYLLADGRLVNLVAADGHPAEIMDMSFALQ--AKAAEYIKENHERL 377

Query: 1379 EKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYI 1492
            E +VYVLP+ +DE V                 EQ  Y+
Sbjct: 378  EPRVYVLPREIDEMVARIKLQSMGINIEELTEEQKKYL 415



>gb:AP006840_568886 Symbiobacterium thermophilum DNA, complete genome.
          Length = 421

 Score =  243 bits (619), Expect = 1e-62
 Identities = 153/455 (33%), Positives = 218/455 (47%)
 Frame = +2

Query: 128  VKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLT 307
            ++D   A  G  +++  +  MP L     E    +P  G R+  S+H+  +TA +     
Sbjct: 10   LRDPGLAPSGHQKIDWVKAHMPILNQLERELSAHRPLAGQRVAMSIHLEAKTAYMALVFA 69

Query: 308  ALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGPDL 487
            A GAEV     N  STQD               W G T +EY     R L+      P L
Sbjct: 70   AAGAEVFLTGSNPLSTQDDVAAAAAERGVTVHAWHGATPEEYTAHLTRTLE---AARPTL 126

Query: 488  IVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRM 667
            ++DDGGD T L+H G                                   +AD      +
Sbjct: 127  LLDDGGDLTHLLHTG-----------------------------------RAD------L 145

Query: 668  KERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRA 847
               L+G SEET+TGV+RL  M+  G L FP + VN++  K  FDN YG   S  + +MR 
Sbjct: 146  AANLIGGSEETSTGVQRLRAMEAEGVLRFPMVAVNNARMKHLFDNRYGTGQSTLESVMRN 205

Query: 848  TDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVV 1027
            T++ IAGK  VV GYG  GKG A   K  GARVIV E+DP+ A +ALM+G +V+ +    
Sbjct: 206  TNLSIAGKRVVVAGYGWCGKGVAMRAKGLGARVIVCEVDPVLANEALMDGFEVMPMARAA 265

Query: 1028 SEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQT 1207
            +  DIF+T TG + +I   H + M++ AI+ N GHFD EI    LE + G + + ++P  
Sbjct: 266  ALGDIFITVTGCEKVIRREHFEVMRDGAILANAGHFDVEIWKPDLEAFGG-QPVRVRPHV 324

Query: 1208 DRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKK 1387
            D +  P+ +  + ++ EGRL NL    GHP+ VM  SF  Q++    LW  +N G+ E +
Sbjct: 325  DAYTAPDGRR-LYLIGEGRLANLAAGDGHPAEVMDLSFGVQLLT--HLWLVENRGRLENR 381

Query: 1388 VYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYI 1492
            V  +P  +D +V                PEQ  YI
Sbjct: 382  VIEVPPEIDTRVAETRLRALGVEIDRLTPEQERYI 416



>gb:AF178115_485818 Mycobacterium bovis S-adenosyl-L-homocysteine
            hydrolase gene, partial cds.
          Length = 181

 Score =  239 bits (611), Expect = 1e-61
 Identities = 117/181 (64%), Positives = 142/181 (78%)
 Frame = +2

Query: 620  IIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFD 799
            ++R   + D  K+T++ E + GV+EETTTGV RLYQ   +G L FPAINVNDSVTKSKFD
Sbjct: 1    LVRTRFETDKDKWTKIAESVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFD 60

Query: 800  NLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICAL 979
            N YG RHSL DG+ R TD +I GK  ++CGYGDVGKGCA A+K  GARV VTEIDPI AL
Sbjct: 61   NKYGTRHSLIDGINRGTDALIGGKKVLICGYGDVGKGCAEAMKGQGARVSVTEIDPINAL 120

Query: 980  QALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHG 1159
            QA+MEG  V+T+E+ + +ADI VT TGNKDIIM+ H+K MK++AI+ NIGHFDNEIDM G
Sbjct: 121  QAMMEGFDVVTVEEAIGDADIVVTATGNKDIIMLEHIKAMKDHAILGNIGHFDNEIDMAG 180

Query: 1160 L 1162
            L
Sbjct: 181  L 181



>sp|Q9HKX4|SAHH_THEAC Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:TACID2_196241 Thermoplasma acidophilum
            complete genome; segment 2/5.
          Length = 410

 Score =  239 bits (609), Expect = 2e-61
 Identities = 161/456 (35%), Positives = 220/456 (48%), Gaps = 4/456 (0%)
 Frame = +2

Query: 155  GRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWC 334
            G L L  A   MP +   R  F   +PFKG ++  +LH+  +T +    L   GAEV+  
Sbjct: 6    GFLRLAWARDHMPVIAEIRKRFQAEKPFKGIKVAMALHVEAKTGIFALLLKEGGAEVKMA 65

Query: 335  SCNIFSTQDHXXXXXXXXXXX-XXXWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA 511
            SCN  S+ D                 KGET +EY+    R LD  P    D+I+DDGGD 
Sbjct: 66   SCNPLSSDDSVVQSLKEDYGMPVFARKGETSEEYYEYLHRTLDVQP----DIIIDDGGDL 121

Query: 512  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS 691
            T ++H   K   + AKN                                      ++G +
Sbjct: 122  TKIVHTERK---DLAKN--------------------------------------ILGGN 140

Query: 692  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK 871
            EETTTGV+RL  M+ SG LLFP  +VND+  K  FDN YG   S  DG+M AT+++IAG+
Sbjct: 141  EETTTGVQRLRAMERSGVLLFPMFDVNDANMKHLFDNRYGTGQSTLDGIMNATNLLIAGR 200

Query: 872  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIFVT 1051
              VV GYG  G+G A  LK  GA VIVTEIDPI A +A+M+G QV  + + + +AD+ +T
Sbjct: 201  TVVVAGYGYCGRGIAMRLKGMGANVIVTEIDPIKANEAIMDGFQVRRMNNAIRDADMVIT 260

Query: 1052 TTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFP-- 1225
             TG KD++        K N ++ N GHF+NE+ +  +E     KR     +   FV    
Sbjct: 261  ATGMKDVVKYEDALVAKKNIVLANAGHFNNEVAVSEIE-----KRSLEVNEVREFVKRYR 315

Query: 1226 -ETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLP 1402
             E    + I+A+GRL+NL    GHP  +M  SF  Q +    L   KN  K E+KVY +P
Sbjct: 316  LENGNTVDIIADGRLVNLAAGQGHPVEIMDLSFALQALTAEYL--VKNHDKLERKVYPVP 373

Query: 1403 KHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEG 1510
              +D  V                 EQ  Y++   EG
Sbjct: 374  ADIDRYVAEIRLKQFGGELDQLNEEQIKYLNSWDEG 409



>sp|Q979Z4|SAHH_THEVO Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:BA000011_665458 Thermoplasma volcanium
            GSS1 DNA, complete genome.
          Length = 410

 Score =  238 bits (608), Expect = 2e-61
 Identities = 159/453 (35%), Positives = 220/453 (48%), Gaps = 1/453 (0%)
 Frame = +2

Query: 155  GRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWC 334
            G L LE A   MP +   R  F   +PFKG  I  +LH+  +T +    L   GA VR  
Sbjct: 6    GFLRLEWARDHMPVIAEIRKRFLDEKPFKGINIAMALHVEAKTGIFSLLLKEGGANVRMA 65

Query: 335  SCNIFSTQDHXXXXXXXXXXX-XXXWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA 511
            SCN  S+ D                 KGET +EY+   +R L+      PD+I+DDGGD 
Sbjct: 66   SCNPLSSDDSVVESLKTDYGMPVFARKGETQEEYYENLQRTLE----KPPDIIIDDGGDL 121

Query: 512  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS 691
            T L+H   K   + +KN                                      ++G +
Sbjct: 122  TKLVHTERK---DLSKN--------------------------------------IMGGN 140

Query: 692  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK 871
            EETTTGV RL  M+++G LLFP  +VND+  K  FDN YG   S  DG+M +T+++IAG+
Sbjct: 141  EETTTGVVRLKAMEKAGVLLFPMFDVNDANMKHLFDNRYGTGQSTLDGIMNSTNLLIAGR 200

Query: 872  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIFVT 1051
              VV GYG  G+G A  LK  GA VIVTEIDPI A +A+M+G QV  + D +  AD+ +T
Sbjct: 201  NVVVAGYGYCGRGIAMRLKGMGANVIVTEIDPIKANEAIMDGFQVRRMNDAIRYADMVIT 260

Query: 1052 TTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPET 1231
             TG KD++        K N ++ N GHFDNE+ +  +E +   KR  ++    R+     
Sbjct: 261  ATGMKDVVKYEDALVAKKNIVLANAGHFDNEVAVKEIEKHSLEKR-EVREFVKRYRLENG 319

Query: 1232 KTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHL 1411
             T + ++A+GRL+NL    GHP  +M  SF  Q +    L   KN    EKKVY +P  +
Sbjct: 320  NT-VDVIADGRLVNLAAGQGHPVEIMDLSFALQALTAEYL--VKNHQNLEKKVYPVPPEI 376

Query: 1412 DEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEG 1510
            D  V                 +Q  Y++   EG
Sbjct: 377  DRYVAEIRLKQFGGELDTLTEDQIKYLNSWDEG 409



>sp|Q8PUQ4|SAHH_METMA Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:AE013469_292608 Methanosarcina mazei
            strain Goe1, section 251 of 379 of the complete
            genome.>gb:AE008384_966717 Methanosarcina mazei strain
            Goe1, complete genome.
          Length = 411

 Score =  237 bits (604), Expect = 7e-61
 Identities = 155/448 (34%), Positives = 218/448 (48%), Gaps = 1/448 (0%)
 Frame = +2

Query: 155  GRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWC 334
            G +++E A   MP L   R +F   +P KG ++  +LH+  +TAVL+ETL A GA+V   
Sbjct: 10   GNMKMEWARNHMPVLAIIREKFEKEKPLKGLKVGMALHVEAKTAVLVETLAAGGAQVAIS 69

Query: 335  SCNIFSTQDHXXXXXXXXXXXXXXWK-GETLQEYWWCTERALDWGPGGGPDLIVDDGGDA 511
             CN  STQD                K G    EY+   +R LD  P    D+ +DDG D 
Sbjct: 70   GCNPLSTQDDVAAALDTRENINCFAKYGCCTGEYYEAIDRVLDIEP----DITIDDGADL 125

Query: 512  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS 691
               +H                                         K+   M  +++G  
Sbjct: 126  IFKLH-----------------------------------------KERQEMLAKILGGC 144

Query: 692  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK 871
            EETTTGV RL+ M++ G L  P I VND++TK  FDN YG   S  DG+ R T++++AGK
Sbjct: 145  EETTTGVHRLHAMEKDGALKMPVIAVNDAMTKYLFDNRYGTGQSAWDGINRTTNLLVAGK 204

Query: 872  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIFVT 1051
              VV GYG  G+G A      GA VIVTEIDPI AL+A M+G +V+ + +     D+FVT
Sbjct: 205  NVVVAGYGWCGRGVAMRATGLGASVIVTEIDPIRALEARMDGHRVMKMSEAAKIGDLFVT 264

Query: 1052 TTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPET 1231
             TGN+DI+   + K MK+ AI+ N GHF+ EIDM  L++     R T++     +     
Sbjct: 265  ATGNRDILTADNFKVMKDGAILANSGHFNVEIDMEALDSLAKSTR-TVRHNIKEYDIGNR 323

Query: 1232 KTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHL 1411
            +  I ++AEGRL+NL    GHP+ VM  SF NQ +    + +     K    V+ +P+ L
Sbjct: 324  R--INVIAEGRLVNLAAGDGHPAEVMDMSFANQALCVRYIAE----NKLSSGVHGVPREL 377

Query: 1412 DEKVXXXXXXXXXXXXXXXXPEQAAYIS 1495
            D  V                 +Q  Y+S
Sbjct: 378  DTYVAKLKLESMGIATDELTSKQECYMS 405



>gb:AE017261_420287 Picrophilus torridus DSM 9790, complete genome.
          Length = 408

 Score =  233 bits (593), Expect = 1e-59
 Identities = 159/458 (34%), Positives = 227/458 (49%), Gaps = 3/458 (0%)
 Frame = +2

Query: 146  ADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEV 325
            A+ G L L+ A   M      R  F   +PFKG RI  +LH+  +T V    L   GA++
Sbjct: 2    ANTGYLRLKWAREHMDITSNIRQRFIEEKPFKGIRIAMALHVEAKTGVFAILLKEGGADI 61

Query: 326  RWCSCNIFSTQDHXXXXXXXXXXX-XXXWKGETLQEYWWCTERALDWGPGGGPDLIVDDG 502
            +  SCN  S+ D+                KGET +EY+    + +D      PD+I+DDG
Sbjct: 62   KMASCNPLSSDDYVVESLKNDYNIPVFARKGETQEEYYDYLNKIID----PEPDIIIDDG 117

Query: 503  GDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLV 682
            GD T L    V ++E+  KN                                      ++
Sbjct: 118  GDLTNL----VSSDEKLYKN--------------------------------------IM 135

Query: 683  GVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMI 862
            G +EETTTGV RL  M++S  L FP  +VND+  K  FDN YG   S  DG M AT+++I
Sbjct: 136  GGNEETTTGVVRLKAMEKSNALKFPMFDVNDAKMKHLFDNRYGTGQSALDGFMNATNILI 195

Query: 863  AGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADI 1042
            AGK   V GYG VG+G A  LK  GA V ++E+DP+ A++ALM+G  V T+E+ V  +DI
Sbjct: 196  AGKRICVIGYGWVGRGIAMRLKGLGAIVTISEVDPVKAVEALMDGFSVDTVENAVKYSDI 255

Query: 1043 FVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVF 1222
              T TG K+++  S + K KN  I+ N GHF+NEIDM  +E+    K I+ +   D    
Sbjct: 256  VFTATGMKNVVPYSALLKAKNGIILGNAGHFNNEIDMESIES----KNISKERVRDYITE 311

Query: 1223 PETKTG--IIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYV 1396
               + G  I I+++GRL+NL    GHP  +M  SF+ Q +    +   KN  + EK+VY 
Sbjct: 312  YRLENGNRINIISDGRLLNLAAGQGHPIEIMDLSFSIQALTAEYI--VKNHDRLEKRVYP 369

Query: 1397 LPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEG 1510
            +P+ +D+ V                 EQ  Y++   EG
Sbjct: 370  VPEDIDKNVAEIKLNALGIKIDKLTDEQIMYMNSFKEG 407



>sp|Q8TRA5|SAHH_METAC Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>gb:AE010796_266630 Methanosarcina
            acetivorans str. C2A, section 141 of 534 of the complete
            genome.>gb:AE010299_907189 Methanosarcina acetivorans
            str. C2A, complete genome.
          Length = 411

 Score =  231 bits (588), Expect = 5e-59
 Identities = 144/396 (36%), Positives = 204/396 (51%), Gaps = 2/396 (0%)
 Frame = +2

Query: 155  GRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWC 334
            G +++E A   MP +   R +F   +P KG ++  +LH+  +TAVL+ETL A GA+V   
Sbjct: 10   GNMKMEWARNHMPVIAIIREKFEKEKPLKGLKVGMALHVEAKTAVLVETLAAGGAQVAIS 69

Query: 335  SCNIFSTQDHXXXXXXXXXXXXXXWK-GETLQEYWWCTERALDWGPGGGPDLIVDDGGDA 511
             CN  STQD                + G    EY+   ++ LD  P    D+ +DDG D 
Sbjct: 70   GCNPLSTQDDVARALDTRKNISCFARYGCCTSEYYEAIDKVLDIEP----DITIDDGADL 125

Query: 512  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS 691
               +H                                         K+ T +  +++G  
Sbjct: 126  IFKLH-----------------------------------------KERTDLLPKILGGC 144

Query: 692  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK 871
            EETTTGV RL+ M++ G L  P I VND++TK  FDN YG   S  DG+ R T++++AGK
Sbjct: 145  EETTTGVHRLHAMEKEGALKMPVIAVNDAMTKYLFDNRYGTGQSAWDGINRTTNLLVAGK 204

Query: 872  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIFVT 1051
              VV GYG  G+G A      GA VIVTE+DPI AL+A M+G +V+ + D     +IFVT
Sbjct: 205  NVVVGGYGWCGRGVAMRAAGLGANVIVTEVDPIRALEARMDGYRVMRMADAARLGEIFVT 264

Query: 1052 TTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY-PGVKRITIKPQTDRFVFPE 1228
            TTGN+DI+   H K M + A++ N GHF+ EIDM  L +    VK  T++     +   +
Sbjct: 265  TTGNRDILTAEHFKVMPDGAVLANSGHFNVEIDMEALTSLAKSVK--TVRHNIKEYDIGD 322

Query: 1229 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVI 1336
             +  I ++AEGRL+NL    GHP+ VM  SF NQ +
Sbjct: 323  RR--INVIAEGRLVNLAAGDGHPAEVMDMSFANQAL 356



>sp|O51933|SAHH_THEMA Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>pir|B72409|B72409 adenosylhomocysteinase -
            Thermotoga maritima (strain MSB8)>gb:AE001702_38093
            Thermotoga maritima MSB8 section 14 of 136 of the
            complete genome.>gb:AE000512_1112566 Thermotoga maritima
            MSB8, complete genome.
          Length = 404

 Score =  224 bits (572), Expect = 4e-57
 Identities = 147/423 (34%), Positives = 209/423 (49%)
 Frame = +2

Query: 155  GRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWC 334
            G +++      MP L     E+   +P  G  +  S+H+  +TA L  TL+ LGA+V   
Sbjct: 4    GEMKINWVSRYMPLLNKIAEEYSREKPLSGFTVGMSIHLEAKTAYLAITLSKLGAKVVIT 63

Query: 335  SCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDAT 514
              N  STQD                +      Y     + LD      PD I+DDGGD T
Sbjct: 64   GSNPLSTQDDVAEALRSKGITVYARRTHDESIYRENLMKVLD----ERPDFIIDDGGDLT 119

Query: 515  LLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSE 694
            ++ H                    T+  E                     + E L GVSE
Sbjct: 120  VISH--------------------TEREE---------------------VLENLKGVSE 138

Query: 695  ETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV 874
            ETTTGV+RL  ++E+G L  P I VNDS  K  FDN YG   S  D +MR T++++AGK 
Sbjct: 139  ETTTGVRRLKALEETGKLRVPVIAVNDSKMKYLFDNRYGTGQSTWDAIMRNTNLLVAGKN 198

Query: 875  AVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIFVTT 1054
             VV GYG  G+G A      GARVIVTE+DP+ A++A+M+G  V+ +++ V  AD  +T 
Sbjct: 199  VVVAGYGWCGRGIALRAAGLGARVIVTEVDPVKAVEAIMDGFTVMPMKEAVKIADFVITA 258

Query: 1055 TGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETK 1234
            +GN D++    +  +K+ A++ N GHF+ EI +  LE    V++   +P    +     K
Sbjct: 259  SGNTDVLSKEDILSLKDGAVLANAGHFNVEIPVRVLEEI-AVEKFEARPNVTGYTLENGK 317

Query: 1235 TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLD 1414
            T + +LAEGRL+NL    GHP  +M  SF  Q+ A L L   +N  K   KVY+LP  +D
Sbjct: 318  T-VFLLAEGRLVNLAAGDGHPVEIMDLSFALQIFAVLYLL--ENHRKMSPKVYMLPDEID 374

Query: 1415 EKV 1423
            E+V
Sbjct: 375  ERV 377



>gb:AF013268_468780 Thermotoga maritima S adenosylhomocysteine
            hydrolase and reverse gyrase (TmTopR) genes, complete
            cds; and inorganic pyrophosphatase gene, partial cds.
          Length = 404

 Score =  224 bits (571), Expect = 5e-57
 Identities = 147/423 (34%), Positives = 209/423 (49%)
 Frame = +2

Query: 155  GRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWC 334
            G +++      MP L     E+   +P  G  +  S+H+  +TA L  TL+ LGA+V   
Sbjct: 4    GEMKINWVSRYMPLLNKIAEEYSREKPLSGFTVGMSIHLERKTAYLAVTLSKLGAKVVIT 63

Query: 335  SCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDAT 514
              N  STQD                +      Y     + LD      PD I+DDGGD T
Sbjct: 64   GSNPLSTQDDVAEALRSKGITVYARRTHDESIYRENLMKVLD----ERPDFIIDDGGDLT 119

Query: 515  LLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSE 694
            ++ H                    T+  E                     + E L GVSE
Sbjct: 120  VISH--------------------TEREE---------------------VLENLKGVSE 138

Query: 695  ETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKV 874
            ETTTGV+RL  ++E+G L  P I VNDS  K  FDN YG   S  D +MR T++++AGK 
Sbjct: 139  ETTTGVRRLKALEETGKLRVPVIAVNDSKMKYLFDNRYGTGQSTWDAIMRNTNLLVAGKN 198

Query: 875  AVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIFVTT 1054
             VV GYG  G+G A      GARVIVTE+DP+ A++A+M+G  V+ +++ V  AD  +T 
Sbjct: 199  VVVAGYGWCGRGIALRAAGLGARVIVTEVDPVKAVEAIMDGFTVMPMKEAVKIADFVITA 258

Query: 1055 TGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETK 1234
            +GN D++    +  +K+ A++ N GHF+ EI +  LE    V++   +P    +     K
Sbjct: 259  SGNTDVLSKEDILSLKDGAVLANAGHFNVEIPVRVLEEI-AVEKFEARPNVTGYTLENGK 317

Query: 1235 TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLD 1414
            T + +LAEGRL+NL    GHP  +M  SF  Q+ A L L   +N  K   KVY+LP  +D
Sbjct: 318  T-VFLLAEGRLVNLAAGDGHPVEIMDLSFALQIFAVLYLL--ENHRKMSPKVYMLPDEID 374

Query: 1415 EKV 1423
            E+V
Sbjct: 375  ERV 377



>gb:AY596297_634056 Haloarcula marismortui ATCC 43049 chromosome I,
            complete sequence.
          Length = 425

 Score =  214 bits (545), Expect = 5e-54
 Identities = 152/465 (32%), Positives = 212/465 (45%), Gaps = 9/465 (1%)
 Frame = +2

Query: 125  KVKDMSQA-DFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
            ++ D+ +A D GR +++ A   MP   A R +F   QPF G RI  ++H+  +TAVL E 
Sbjct: 8    RLDDLDEARDSGRRKMDWAIQHMPICGALREQFEADQPFAGERIGMAMHVEAKTAVLAEI 67

Query: 302  LTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXX-XWKGETLQEYWWCTERALDWGPGGG 478
            L   GAEV    CN  ST D                 +G   +EY+   E  +    G  
Sbjct: 68   LAVGGAEVAITGCNPLSTHDDVSAALDAVDGITSYAERGVDDEEYYEAIEAVI----GHK 123

Query: 479  PDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKY 658
            P + VDDG D    IHE                                          Y
Sbjct: 124  PTITVDDGMDLVAAIHED-----------------------------------------Y 142

Query: 659  TRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGL 838
              + + ++G +EETTTGV RL  M + G L +P   VND+  K  FDN++G   S    +
Sbjct: 143  PELIDTIIGGAEETTTGVHRLRAMDDDGELDYPVFAVNDTPMKRLFDNVHGTGESSLASI 202

Query: 839  MRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLE 1018
               T++  AGK  VV GYGD GKG A       A VIVTE++P  AL+A MEG  V  + 
Sbjct: 203  AMTTNLSWAGKTVVVSGYGDCGKGVAKKASGQNADVIVTEVEPRRALEAHMEGYDVKPMA 262

Query: 1019 DVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGL-----ETYPGVK 1183
            +  +E D+F+TTTGN+D+I+  H + M++  ++ N GHFD E+D+  L     +TY    
Sbjct: 263  EAAAEGDVFITTTGNRDVIVEEHFEAMQDGVLLANAGHFDVEVDLDALSDLAVDTYEARN 322

Query: 1184 RITIKPQTDRFVFPETKTGIIILAEGRLMNLG--CATGHPSFVMSCSFTNQVIAQLELWK 1357
             +      D          + +LAEGRL+NL    A GHP  VM  SF  Q +   EL  
Sbjct: 323  GVQTYEMAD-------GRRLNVLAEGRLVNLATPIALGHPVEVMDQSFGVQAVCVREL-- 373

Query: 1358 EKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYI 1492
             +N   YE  V+ +P  LD++V                  QA Y+
Sbjct: 374  VENGDDYEAGVHAVPDRLDKEVAEIKLDAEGVDFDSLTDTQAEYM 418



>gb:AF129871_1770694 Gossypium hirsutum S-adenosyl-L-homocysteine
            hydrolase mRNA, partial cds.
          Length = 102

 Score =  198 bits (503), Expect = 4e-49
 Identities = 98/102 (96%), Positives = 101/102 (99%)
 Frame = +2

Query: 812  CRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALM 991
            CRHSLPDGLMRATDVMIAGKVAVVCGYGD GKGCAAALKQAGARVIVTEIDPICALQALM
Sbjct: 1    CRHSLPDGLMRATDVMIAGKVAVVCGYGDAGKGCAAALKQAGARVIVTEIDPICALQALM 60

Query: 992  EGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIV 1117
            EGLQVLTLEDVVSEADIFVTTTGNKDIIMV+HM+KMKNNA+V
Sbjct: 61   EGLQVLTLEDVVSEADIFVTTTGNKDIIMVNHMRKMKNNAVV 102



>gb:AF035319_1877930 Homo sapiens clone 23931 mRNA, partial cds.
          Length = 218

 Score =  197 bits (501), Expect = 6e-49
 Identities = 97/219 (44%), Positives = 144/219 (65%)
 Frame = +2

Query: 881  VCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIFVTTTG 1060
            +CGYG+VGKGC AALK  GA V +TEIDPICALQA M+G +V+ L +V+ + D+ +T TG
Sbjct: 4    MCGYGEVGKGCCAALKALGAIVYITEIDPICALQACMDGFRVVKLNEVIRQVDVVITCTG 63

Query: 1061 NKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTG 1240
            NK+++   H+ +MKN+ IVCN+GH + EID+  L T P +    ++ Q D  ++P+ K  
Sbjct: 64   NKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRT-PELTWERVRSQVDHVIWPDGKR- 121

Query: 1241 IIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEK 1420
            +++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ VY+LPK +DE 
Sbjct: 122  VVLLAEGRLLNLSCST-VPTFVLSITATTQALALIELYNAPE-GRYKQDVYLLPKKMDEY 179

Query: 1421 VXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            V                 +QA Y+ +   GP+KP +YRY
Sbjct: 180  VASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY 218



>sp|Q9HN50|SAHH_HALN1 Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase)
            (AdoHcyase).>pir|G84375|G84375 adenosylhomocysteinase
            [imported] - Halobacterium sp. NRC-1>gb:AE005110_63531
            Halobacterium sp. NRC-1 section 141 of 170 of the
            complete genome.>gb:AE004437_888450 Halobacterium sp.
            NRC-1 complete genome.
          Length = 427

 Score =  195 bits (495), Expect = 3e-48
 Identities = 137/454 (30%), Positives = 204/454 (44%), Gaps = 3/454 (0%)
 Frame = +2

Query: 140  SQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGA 319
            S  + GR +++ A   MP L A R EF  +QP  G  I  ++H+  +TA L+ET+   GA
Sbjct: 16   SARETGRAKIDWAFEHMPILSALREEFDANQPLAGETIGMAMHVEAKTAALVETMADAGA 75

Query: 320  EVRWCSCNIFSTQDHXXXXXXXXXXXXX-XWKGETLQEYWWCTERALDWGPGGGPDLIVD 496
            E+    CN  ST D                 +G   + Y+     A+D      P + VD
Sbjct: 76   EIAITGCNPLSTHDGVSAALDAHESITSYAERGAEGEAYY----DAIDAVLAHEPTVTVD 131

Query: 497  DGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKER 676
            DGGD    +HE                                          +  + + 
Sbjct: 132  DGGDLVFRVHED-----------------------------------------HPELIDT 150

Query: 677  LVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDV 856
            ++G +EETTTGV RL  M +   L +P   VND+  K  FDN++G   S    +   T++
Sbjct: 151  IIGGTEETTTGVHRLRAMDDDDALEYPVFAVNDTPMKRLFDNVHGTGESALANIAMTTNL 210

Query: 857  MIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEA 1036
              AGK  VV GYGD G+G A       A VIVTE++P  AL+A MEG  V+ + +     
Sbjct: 211  SWAGKDVVVAGYGDCGRGVAKKAAGQNANVIVTEVEPRRALEAHMEGYDVMPMAEAAEVG 270

Query: 1037 DIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRF 1216
            D+F+TTTGNK++I  +H ++M +  ++ N GHFD E+++  L     V     +     +
Sbjct: 271  DVFLTTTGNKNVITRAHFERMDDGVVLANAGHFDVEVNLDHLSEL-AVSEREAREGVREY 329

Query: 1217 VFPETKTGIIILAEGRLMNLG--CATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKV 1390
               + +  + +LAEGRL+NL      GHP  VM  SF  Q +   EL    N  +Y   V
Sbjct: 330  ELADGRR-LNVLAEGRLVNLASPIGLGHPVGVMDQSFGVQAVCVREL--VANREEYAAGV 386

Query: 1391 YVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYI 1492
            + +P  LD ++                 +QA Y+
Sbjct: 387  HNVPDELDIEIAEIKLAAEGVEYDALTDDQAEYM 420



>gb:AF252255_1781009 Lupinus luteus S-adenosyl-L-homocysteinase II
           mRNA, partial cds.
          Length = 90

 Score =  170 bits (431), Expect = 8e-41
 Identities = 84/90 (93%), Positives = 87/90 (96%)
 Frame = +2

Query: 692 EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK 871
           EETTTGVKRLYQMQ +GTLLFPAINVNDSVTK +FDNLYGCRHSLPDGLMRATDVMIAGK
Sbjct: 1   EETTTGVKRLYQMQANGTLLFPAINVNDSVTKRQFDNLYGCRHSLPDGLMRATDVMIAGK 60

Query: 872 VAVVCGYGDVGKGCAAALKQAGARVIVTEI 961
           VAVV GYGDVGKGCA+ALKQAGARVIVTEI
Sbjct: 61  VAVVAGYGDVGKGCASALKQAGARVIVTEI 90



>gb:PPI300723_1701349 Pinus pinaster partial mRNA for putative
           S-adenosyl-L-homocysteine hydrolase (shh gene).
          Length = 94

 Score =  169 bits (429), Expect = 1e-40
 Identities = 77/94 (81%), Positives = 84/94 (89%)
 Frame = +2

Query: 428 EYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQ 607
           EYWWCTERALDWGPGGGPDLIVDDGGD TLLIHEGVKAEEE+AK G VPDPSST N EFQ
Sbjct: 1   EYWWCTERALDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEEFAKTGKVPDPSSTTNVEFQ 60

Query: 608 IVLTIIRDGLKADPKKYTRMKERLVGVSEETTTG 709
           IVL +I++ LK DP +Y RMK+R+VGVSEETTTG
Sbjct: 61  IVLELIKESLKVDPLRYHRMKDRIVGVSEETTTG 94



>gb:BC003631_1968941 Homo sapiens S-adenosylhomocysteine
            hydrolase-like 1, mRNA (cDNA clone IMAGE:3010755),
            partial cds.
          Length = 199

 Score =  168 bits (425), Expect = 4e-40
 Identities = 84/201 (41%), Positives = 129/201 (64%)
 Frame = +2

Query: 935  GARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAI 1114
            GA V +TEIDPICALQA M+G +V+ L +V+ + D+ +T TGNK+++   H+ +MKN+ I
Sbjct: 3    GAIVYITEIDPICALQACMDGFRVVKLNEVIRQVDVVITCTGNKNVVTREHLDRMKNSCI 62

Query: 1115 VCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGH 1294
            VCN+GH + EID+  L T P +    ++ Q D  ++P+ K  +++LAEGRL+NL C+T  
Sbjct: 63   VCNMGHSNTEIDVTSLRT-PELTWERVRSQVDHVIWPDGKR-VVLLAEGRLLNLSCST-V 119

Query: 1295 PSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXP 1474
            P+FV+S + T Q +A +EL+     G+Y++ VY+LPK +DE V                 
Sbjct: 120  PTFVLSITATTQALALIELYNAPE-GRYKQDVYLLPKKMDEYVASLHLPSFDAHLTELTD 178

Query: 1475 EQAAYISIPVEGPYKPPHYRY 1537
            +QA Y+ +   GP+KP +YRY
Sbjct: 179  DQAKYLGLNKNGPFKPNYYRY 199



>gb:AF178114_485817 Mycobacterium bovis S-adenosyl-L-homocysteine
           hydrolase gene, partial cds.
          Length = 140

 Score =  154 bits (388), Expect = 8e-36
 Identities = 75/127 (59%), Positives = 87/127 (68%), Gaps = 9/127 (7%)
 Frame = +2

Query: 110 SGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAV 289
           +G ++K+ D+S ADFGR EL +AE EMPGLM+ R E+   QP KGARI+GSLHMT+QTAV
Sbjct: 3   NGIDFKIADLSLADFGRKELRIAEHEMPGLMSLRREYAEVQPLKGARISGSLHMTVQTAV 62

Query: 290 LIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXX---------XXWKGETLQEYWWC 442
           LIETLTALGAEVRW SCNIFSTQDH                       WKGETL+EYWW 
Sbjct: 63  LIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPDEPKGVPVFAWKGETLEEYWWA 122

Query: 443 TERALDW 463
            E+ L W
Sbjct: 123 AEQMLTW 129



>gb:BC051504_2100775 Mus musculus mRNA similar to KIAA0828 protein
            (cDNA clone IMAGE:1348339).
          Length = 188

 Score =  147 bits (370), Expect = 1e-33
 Identities = 75/187 (40%), Positives = 117/187 (62%)
 Frame = +2

Query: 977  LQALMEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMH 1156
            LQA M+G +++ L +V+ + DI +T TGNK+++   H+ +MKN+ IVCN+GH + EID+ 
Sbjct: 6    LQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVA 65

Query: 1157 GLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVI 1336
             L T P +    ++ Q D  ++P+ K  I++LAEGRL+NL C+T  P+FV+S + T Q +
Sbjct: 66   SLRT-PELTWERVRSQVDHVIWPDGKR-IVLLAEGRLLNLSCST-VPTFVLSITATTQAL 122

Query: 1337 AQLELWKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPY 1516
            A +EL+     G+Y++ VY+LPK +DE V                 EQA Y+ +   GP+
Sbjct: 123  ALIELYNAPE-GRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPF 181

Query: 1517 KPPHYRY 1537
            KP +YRY
Sbjct: 182  KPNYYRY 188



>gb:DDAHCH_1376851 D. discoideum mRNA fragment for
            S-adenosyl-L-homocysteine hydrolase (EC 3.3.1.1).
          Length = 176

 Score =  144 bits (362), Expect = 8e-33
 Identities = 81/166 (48%), Positives = 101/166 (60%)
 Frame = +2

Query: 1040 IFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRFV 1219
            IFVTTTG +DI+   H   MK +AIVCNIGHFD EID+  L      K+ T+KPQ  R+ 
Sbjct: 17   IFVTTTGCRDIVRGEHFAVMKEDAIVCNIGHFDCEIDVAWLN--GNAKKDTVKPQVSRYT 74

Query: 1220 FPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVL 1399
                   II+LAEGRL+NLGC TGHPSFVMS S   + +AQ+ LW +  T +Y   V+ L
Sbjct: 75   L-ANGVHIILLAEGRLVNLGCGTGHPSFVMSNSSVTK-LAQIALWTK--TEEYPLGVHFL 130

Query: 1400 PKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
            PK LDE+V                 +Q+ Y+S+PV GPYK  HYRY
Sbjct: 131  PKILDEEVARLHLDQLGAKLTTLTEKQSEYLSVPVAGPYKVDHYRY 176



>gb:AE014295_311497 Bifidobacterium longum NCC2705, complete genome.
          Length = 500

 Score =  141 bits (355), Expect = 5e-32
 Identities = 118/416 (28%), Positives = 182/416 (43%), Gaps = 2/416 (0%)
 Frame = +2

Query: 128  VKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLT 307
            + DM +A  G   +E AE  MP L            F G RI   L +  +TA+L+  L 
Sbjct: 83   ITDMRKAS-GLEAMEYAEQHMPVLRDTMDSLTTRVDFSGIRIAVCLILEPKTAILLRKLK 141

Query: 308  ALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGPDL 487
            A GA V    C   ST                  +  T ++     E AL       PD+
Sbjct: 142  AAGAIVG-VYCGPDSTDPRVAEQLRREGITVESSRDWTAEQ---AHEAALHLLDEIQPDI 197

Query: 488  IVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRM 667
            I+DDG                +A+  ++  P  T N                        
Sbjct: 198  IIDDGAS--------------FARLASLERPELTAN------------------------ 219

Query: 668  KERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRA 847
               L+GV+EETT+GV+   QMQE+G L +P + VNDSV K+ FDN +G   +    + R 
Sbjct: 220  ---LIGVAEETTSGVRAFQQMQEAGALTYPVVAVNDSVLKTGFDNAHGTGETCVTTMQRI 276

Query: 848  T-DVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDV 1024
              +    GK   V GYG VG+G A  ++  GA V + +IDP+ +L+A+ +G     +++ 
Sbjct: 277  LGEHAFDGKNVTVIGYGPVGQGFARRIRALGAEVTICDIDPVASLKAVFDGFAAQDIDEA 336

Query: 1025 VSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETY-PGVKRITIKP 1201
            +  AD+ V+ TG +  + + HM+ M   A +  IG   NEI +  +  + P V R T++ 
Sbjct: 337  LPCADMVVSATGVRHTVTLEHMRAMHEGAALAVIGGIANEIALDEVSDFTPQVNRDTVQL 396

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNT 1369
                   P+  T + ++A+G  +N     G+P  +M  SF  Q  A   L + + T
Sbjct: 397  NV-----PDGPT-LTLIADGDGVNYTVGGGNPIEIMDLSFAVQASAVAYLLEHRGT 446



>gb:AL356299_1924405 Human DNA sequence from clone CTD-3216D2 on
           chromosome 20 Contains the AHCY gene encoding
           S-adenosylhomocysteine hydrolase, the 5' end of the ITCH
           gene for itchy homolog E3 ubiquitin protein ligase
           (mouse), the CDC42P1 gene for cell division cycle 42
           pseudogene 1, a pseudogene similar to part of laminin
           receptor 1 (ribosomal protein SA, 67kDa) (LAMR1) and two
           CpG islands, complete sequence.
          Length = 143

 Score =  140 bits (352), Expect = 1e-31
 Identities = 79/185 (42%), Positives = 96/185 (51%)
 Frame = +2

Query: 188 MPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHX 367
           MPGLM  R  +  S+P KGARI G LHMT++TAVLIETL  LGAEV+W SCNIFSTQDH 
Sbjct: 1   MPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIETLVTLGAEVQWSSCNIFSTQDHA 60

Query: 368 XXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 547
                        WKGET +EY WC E+ L +   G  ++I+DDGGD T LIH       
Sbjct: 61  AAAIAKAGIPVYAWKGETDEEYLWCIEQTL-YFKDGPLNMILDDGGDLTNLIH------- 112

Query: 548 EYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSEETTTGVKRLYQ 727
                                              KY ++   + G+SEETTTGV  LY+
Sbjct: 113 ----------------------------------TKYPQLLPGIRGISEETTTGVHNLYK 138

Query: 728 MQESG 742
           M  +G
Sbjct: 139 MMANG 143



>pir|S22958|S22958 adenosylhomocysteinase (EC 3.3.1.1) - Streptomyces
            fradiae  (fragment)
          Length = 120

 Score =  124 bits (311), Expect = 7e-27
 Identities = 64/122 (52%), Positives = 79/122 (64%)
 Frame = +2

Query: 1172 PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL 1351
            PG+ +  +KPQ   + F + K  II+L+EGRL+NLG ATGHPSFVMS SF +Q +AQ+EL
Sbjct: 2    PGIVKDEVKPQVHTWTFADGKK-IIVLSEGRLLNLGNATGHPSFVMSNSFADQTLAQIEL 60

Query: 1352 WKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHY 1531
            + +    +Y   VYVLPKHLDEKV                PEQA YI + VEGPYKP HY
Sbjct: 61   YTKPE--QYPTDVYVLPKHLDEKVARLHLDALGVKLTTLRPEQAEYIGVEVEGPYKPDHY 118

Query: 1532 RY 1537
            RY
Sbjct: 119  RY 120



>sp|P26799|SAHH_STRFR Adenosylhomocysteinase (EC 3.3.1.1)
            (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase)
            (Fragment).
          Length = 120

 Score =  124 bits (311), Expect = 7e-27
 Identities = 64/122 (52%), Positives = 79/122 (64%)
 Frame = +2

Query: 1172 PGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL 1351
            PG+ +  +KPQ   + F + K  II+L+EGRL+NLG ATGHPSFVMS SF +Q +AQ+EL
Sbjct: 2    PGIVKDEVKPQVHTWTFADGKK-IIVLSEGRLLNLGNATGHPSFVMSNSFADQTLAQIEL 60

Query: 1352 WKEKNTGKYEKKVYVLPKHLDEKVXXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHY 1531
            + +    +Y   VYVLPKHLDEKV                PEQA YI + VEGPYKP HY
Sbjct: 61   YTKPE--QYPTDVYVLPKHLDEKVARLHLDALGVKLTTLRPEQAEYIGVEVEGPYKPDHY 118

Query: 1532 RY 1537
            RY
Sbjct: 119  RY 120



>gb:AF206620_1776744 Cucumis melo adenosyl-homocysteinase mRNA,
            partial cds.
          Length = 85

 Score =  114 bits (286), Expect = 5e-24
 Identities = 65/86 (75%), Positives = 69/86 (80%)
 Frame = +2

Query: 833  GLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLT 1012
            GLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEID    LQALMEGLQVLT
Sbjct: 1    GLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDQ-SVLQALMEGLQVLT 59

Query: 1013 LEDVVSEADIFVTTTGNKDIIMVSHM 1090
             +  +    +    T NKDIIMV H+
Sbjct: 60   WK--MLSRRLISRHTRNKDIIMVDHI 83



>gb:AF410884_508053 Mycobacterium avium subsp. paratuberculosis
            S-adenosyl-L-homocysteine hydrolase (sahH) gene, partial
            cds; and thimidylate kinase (tmk), MtrA (mtrA), MtrB
            (mtrB), and LpqB (lpqB) genes, complete cds.
          Length = 96

 Score =  113 bits (282), Expect = 2e-23
 Identities = 56/98 (57%), Positives = 68/98 (69%)
 Frame = +2

Query: 1244 IILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKV 1423
            I+L+EGRL+NLG ATGHPSFVMS SF+NQVIAQ+ELW + +  +Y+ +VY LPKHLDEKV
Sbjct: 1    IVLSEGRLLNLGNATGHPSFVMSNSFSNQVIAQIELWTKND--EYDNEVYRLPKHLDEKV 58

Query: 1424 XXXXXXXXXXXXXXXXPEQAAYISIPVEGPYKPPHYRY 1537
                             EQA YI + V+GPYK  HYRY
Sbjct: 59   ARIHVEALGGELTKLTKEQAEYIGVDVDGPYKADHYRY 96



>gb:AX886059_1481512 Sequence 1922 from Patent EP1033401.
          Length = 81

 Score = 97.4 bits (241), Expect = 9e-19
 Identities = 47/75 (62%), Positives = 56/75 (74%)
 Frame = +2

Query: 122 YKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIET 301
           YKV D+  A +GR  L++AE EMPGLM  R  +  S+P KGARI G LHMT++TAVLIET
Sbjct: 7   YKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIET 66

Query: 302 LTALGAEVRWCSCNI 346
           L  LGAEV+W SCNI
Sbjct: 67  LVTLGAEVQWSSCNI 81



>gb:PFAOR_157813 P.furiosus aor, cmo and ado-hcy genes.
          Length = 169

 Score = 92.8 bits (229), Expect = 2e-17
 Identities = 65/210 (30%), Positives = 96/210 (45%)
 Frame = +2

Query: 113 GREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVL 292
           G++Y VKD+S A+ G  +++     MP L   + EF   +PFKG RI  +LH+ ++TA L
Sbjct: 4   GKDYCVKDLSLAEEGWKKIDWVSRFMPVLQYIKREFEEKKPFKGVRIAATLHLEMKTAFL 63

Query: 293 IETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTERALDWGPG 472
           + TL A GAEV   + N  STQD                +GE+ ++Y+    +ALD    
Sbjct: 64  LLTLKAGGAEVSAAASNPLSTQDDVVAALAKAGVKVYAIRGESREQYYEFMHKALDI--- 120

Query: 473 GGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPK 652
             P++I+DDG D   L+H                                         K
Sbjct: 121 -RPNIIIDDGADMISLVH-----------------------------------------K 138

Query: 653 KYTRMKERLVGVSEETTTGVKRLYQMQESG 742
           +   M + + G SEETTTGV RL  M+++G
Sbjct: 139 ERQEMLDEIWGGSEETTTGVIRLRAMEKAG 168



>pir|F69360|F69360 adenosylhomocysteinase (EC 3.3.1.1) homolog ahcY-1
            - Archaeoglobus fulgidus>gb:AE001043_31025 Archaeoglobus
            fulgidus DSM 4304 section 64 of 172 of the complete
            genome.>gb:AE000782_974775 Archaeoglobus fulgidus DSM
            4304 complete genome.
          Length = 326

 Score = 86.7 bits (213), Expect = 2e-15
 Identities = 74/254 (29%), Positives = 124/254 (48%), Gaps = 2/254 (0%)
 Frame = +2

Query: 668  KERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRA 847
            KERL  V E T TG + L +M     +   AI+++ S  K   +N +G    L D L+R 
Sbjct: 92   KERLK-VVELTKTGEEYLRKMD----VRMKAISLDSSTLKGTGENTHGTAFGLLDALLRL 146

Query: 848  TDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVV 1027
             +V + GK A++ G+G VG+GCA  LK  G  V V + D    ++AL EG +V    +  
Sbjct: 147  -NVFLPGKKALILGFGRVGRGCARLLKSVGCDVAVWDNDETRQIEALYEGFRV----EKD 201

Query: 1028 SEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHG--LETYPGVKRITIKP 1201
              A++ VT TG K ++    ++++ + +I+ N+G  + EI+  G  ++ Y  VK   I  
Sbjct: 202  FTAEVVVTCTGVKGVLGKEELEEISDGSIILNMG-AEMEIEPAGELIKDYGLVKEYEIAG 260

Query: 1202 QTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYE 1381
            +              ++A+G   NL   +G P  VM  +F+  ++A   L +    G   
Sbjct: 261  KR-----------YFLVADGYAANLALGSGTPIEVMDRTFSAAILALNHLSRSDFDG--- 306

Query: 1382 KKVYVLPKHLDEKV 1423
              +  LP H++  +
Sbjct: 307  --IIPLPHHIESTI 318



>gb:SSU18930_191175 Sulfolobus solfataricus 281 kb genomic DNA
            fragment, strain P2.
          Length = 138

 Score = 75.5 bits (184), Expect = 4e-12
 Identities = 52/117 (44%), Positives = 61/117 (52%)
 Frame = -2

Query: 1089 MWLTMMMSLLPVVVTKISASETTSSRVRTWRPSMRAWRAQIGSISVTITRAPACFKAAAQ 910
            M  T++  + PV VT +S +   S+   T +PS+ A RA IGS SVT+T AP      A 
Sbjct: 3    MCSTLIAFVFPVAVTNMSPTFEASAIGITSKPSITASRALIGSTSVTMTLAPIPLNLLAM 62

Query: 909  PLPTSP*PHTTATFPAIITSVALIKPSGREWRHPYKLSNLLLVTESLTLMAGKRRVP 739
            PLPT P P TTA FPAI   VAL  PS      PY LS   LV    T   G  R P
Sbjct: 63   PLPTHPYPATTAIFPAIRMFVALSIPSMALCPVPYLLSKRYLVYALFTATRGYLRTP 119



>gb:AY389748_1178355 Hyacinthus orientalis adenosylhomocysteinase
           mRNA, partial cds.
          Length = 190

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 29/42 (69%), Positives = 34/42 (80%)
 Frame = +2

Query: 569 VPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVSE 694
           +PDP STDNAEFQI+LTII DGLK DP KY +MK ++V  SE
Sbjct: 55  MPDPDSTDNAEFQIILTIIHDGLKLDPTKYWKMKYQIVDASE 96



>gb:AE017354_460524 Legionella pneumophila subsp. pneumophila str.
            Philadelphia 1, complete genome.
          Length = 367

 Score = 54.3 bits (129), Expect = 8e-06
 Identities = 44/167 (26%), Positives = 80/167 (47%), Gaps = 6/167 (3%)
 Frame = +2

Query: 656  YTRMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDG 835
            + R+   L G  E T +G +    ++   TL FP I+++ ++TK + + ++GC  S    
Sbjct: 111  HQRLGRPLTGAIELTGSGDQYYRSLK---TLDFPVISIDHTMTK-QLETVFGCAESSHQA 166

Query: 836  LMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVL-- 1009
            + + T V    K  ++ G+G +G+G A    +    V V +        A   G++ +  
Sbjct: 167  IQKLTGVDPTNKNWLIFGFGKIGRGLAYFCLEHQVPVTVVDSSVHQCDLAFNLGIEAIRP 226

Query: 1010 ----TLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFD 1138
                 LE  V++ADI +T TG K+ IM  + +   +  I+ N+G  D
Sbjct: 227  EEHDKLEKAVAKADIILTATGGKN-IMSEYPRAWFDGKILGNLGLHD 272



>gb:CR628336_112226 Legionella pneumophila str. Paris complete genome.
          Length = 367

 Score = 51.6 bits (122), Expect = 5e-05
 Identities = 38/138 (27%), Positives = 68/138 (49%), Gaps = 6/138 (4%)
 Frame = +2

Query: 743  TLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA 922
            TL FP I+++ ++TK + + ++GC  S    + + T V    K  ++ G+G +G+G A  
Sbjct: 137  TLDFPVISIDHTMTK-QLETVFGCAESSHQAIQKLTGVDPTNKNWLIFGFGKIGRGLAYF 195

Query: 923  LKQAGARVIVTEIDPICALQALMEGLQVL------TLEDVVSEADIFVTTTGNKDIIMVS 1084
              +    V V +        A   G++ +       LE  V++ADI +T TG K+ IM  
Sbjct: 196  CLEHQVPVTVVDSSVHQCDLASNLGIEAIRPEEHDKLEKAVAKADIILTATGGKN-IMSK 254

Query: 1085 HMKKMKNNAIVCNIGHFD 1138
            + +   +  I+ N+G  D
Sbjct: 255  YPRSWFDGKILGNLGLHD 272



>gb:BX640419_807254 Bordetella pertussis strain Tohama I, complete
            genome; segment 9/12.
          Length = 249

 Score = 46.2 bits (108), Expect = 0.002
 Identities = 23/49 (46%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = +2

Query: 860  IAGKVAVVCGYGD-VGKGCAAALKQAGARVIVTEIDPICALQALMEGLQ 1003
            +AGK+AVV G G  +G+   AAL++ GARV+ T++DP    QA+ E  Q
Sbjct: 6    LAGKIAVVTGAGGGIGRAIVAALREQGARVVATDLDPQALAQAMRESGQ 54



>gb:AE010604_264862 Fusobacterium nucleatum subsp. nucleatum ATCC
            25586, section 146 of 197 of the complete
            genome.>gb:AE009951_912030 Fusobacterium nucleatum subsp.
            nucleatum ATCC 25586, complete genome.
          Length = 321

 Score = 45.8 bits (107), Expect = 0.003
 Identities = 32/103 (31%), Positives = 53/103 (51%), Gaps = 6/103 (5%)
 Frame = +2

Query: 866  GKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIF 1045
            GKV  + G+G++GK   +  K  G  V++ +I        L    +   L++V+ + DIF
Sbjct: 150  GKVLGILGHGNIGKKVESYAKSFGMEVMIAKIPGREYTDNLENRFE---LDEVLEKCDIF 206

Query: 1046 VT----TTGNKDIIMVSHMKKMKNNAIVCNIGH--FDNEIDMH 1156
                  T   +D+I +  MKKMK +AI+ N+G     NE D++
Sbjct: 207  SIHAPLTDLTRDLINLDRMKKMKKSAIILNLGRGPIINEEDLY 249



>pir|D97262|D97262 probable phosphoglycerate dehydrogenase [imported]
            - Clostridium acetobutylicum>gb:AE007791_230248
            Clostridium acetobutylicum ATCC 824 section 279 of 356 of
            the complete genome.>gb:AE001437_1093203 Clostridium
            acetobutylicum ATCC 824, complete genome.
          Length = 324

 Score = 45.4 bits (106), Expect = 0.004
 Identities = 31/107 (28%), Positives = 53/107 (49%), Gaps = 6/107 (5%)
 Frame = +2

Query: 854  VMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSE 1033
            + ++GK   + GYG +GK    A +  G +V V    P    +   E ++ ++L+ +  E
Sbjct: 148  IELSGKTIGLVGYGSIGKAMQKAAEALGMKVFVYTPHPDKKYE--NESMKFVSLDTLFKE 205

Query: 1034 ADIF----VTTTGNKDIIMVSHMKKMKNNAIVCNI--GHFDNEIDMH 1156
            AD+          NK++I  + +KKMKN  I+ N   G   NE D++
Sbjct: 206  ADVISLHCPLKDDNKEMINKASIKKMKNGVIIINTARGGLINERDLY 252



>gb:NCB20D17_1689641 Neurospora crassa DNA linkage group V BAC clone
            B20D17.
          Length = 288

 Score = 42.7 bits (99), Expect = 0.025
 Identities = 31/93 (33%), Positives = 46/93 (49%), Gaps = 5/93 (5%)
 Frame = +2

Query: 860  IAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEAD 1039
            I GK   + GYG +G   +   +  G  VI  ++     L A+    QV TLED+++EAD
Sbjct: 16   IRGKTLGIVGYGHIGSQLSVLAEAMGMTVIYYDV---VTLMAIGTARQVPTLEDLLAEAD 72

Query: 1040 IFVT-----TTGNKDIIMVSHMKKMKNNAIVCN 1123
             FVT     T   K++I     +KMK  + + N
Sbjct: 73   -FVTLHVPETPETKNMISNDQFEKMKTGSYLIN 104



>gb:AE016765_327392 Escherichia coli CFT073 section 11 of 18 of the
            complete genome.>gb:AE014075_957976 Escherichia coli
            CFT073 complete genome.
          Length = 318

 Score = 42.4 bits (98), Expect = 0.033
 Identities = 30/145 (20%), Positives = 69/145 (47%), Gaps = 13/145 (8%)
 Frame = +2

Query: 731  QESGTLLFPAINVNDSVTK--------SKFDNLYGCRHSLPDGLM-RATDVMIAGKVAVV 883
            Q+SG ++  A+ +N +           +   N+ G  H++ +G    +    + GK   +
Sbjct: 93   QQSGIVVNNAVGINSNAVAEFIIGLIFASMRNIPGSYHAMQNGYWGESHGCELQGKRIGL 152

Query: 884  CGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADIFVT---- 1051
             GYG++GK  A  L      ++  +  P   + A   G+Q +++ED+  ++ + +     
Sbjct: 153  VGYGNIGKTLAKRLSGFDVELLAFDKQPDYQV-ADKAGVQFVSIEDIFMQSHVIIVLLPF 211

Query: 1052 TTGNKDIIMVSHMKKMKNNAIVCNI 1126
            ++G ++ I   ++  M+N A++ N+
Sbjct: 212  SSGLENFISHKYLSMMRNGALLINV 236



>gb:REU80928_163175 Rhizobium etli strain CFN42 symbiotic plasmid
            p42d, complete sequence.
          Length = 280

 Score = 42.4 bits (98), Expect = 0.033
 Identities = 35/106 (33%), Positives = 49/106 (46%), Gaps = 12/106 (11%)
 Frame = +2

Query: 866  GKVAVVCGYG-DVGKGCAAALKQAGARVIVTEIDP----ICALQALMEGLQVLT----LE 1018
            GKVAVV G G  +GK CA A+ + G RV+V +ID      C  Q   E  Q L     + 
Sbjct: 6    GKVAVVTGAGAGIGKACALAIAREGGRVVVADIDGPAAIACTAQIAAEAGQALAVAMDIA 65

Query: 1019 DVVSEADIFVTTT---GNKDIIMVSHMKKMKNNAIVCNIGHFDNEI 1147
            D  + A++F T     G  D+++        NNA   ++   D  I
Sbjct: 66   DAQAVAELFKTAKRRFGGVDVLV--------NNASAMHLTPHDRAI 103



>sp|Q59516|DHGY_METEX Glycerate dehydrogenase (EC 1.1.1.29)
            (NADH-dependent hydroxypyruvate reductase) (HPR) (GDH)
            (Hydroxypyruvate dehydrogenase) (Glyoxylate reductase)
            (HPR-A).
          Length = 313

 Score = 42.4 bits (98), Expect = 0.033
 Identities = 27/92 (29%), Positives = 47/92 (51%), Gaps = 4/92 (4%)
 Frame = +2

Query: 860  IAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEAD 1039
            IAG    + GYG +GK  A   +  G +V+  ++ P        +GL  + LE +++++D
Sbjct: 144  IAGSTLGIIGYGALGKSIAKRAEALGMKVLAFDVFP-------QDGL--VDLETILTQSD 194

Query: 1040 IFV----TTTGNKDIIMVSHMKKMKNNAIVCN 1123
            +       T   K++I    +KKMK +AI+ N
Sbjct: 195  VITLHVPLTPDTKNMIGAEQLKKMKRSAILIN 226



>gb:BX572099_798674 Prochlorococcus marinus MIT9313 complete genome;
            segment 5/7.
          Length = 359

 Score = 41.6 bits (96), Expect = 0.057
 Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 4/59 (6%)
 Frame = +2

Query: 878  VVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVL----TLEDVVSEADI 1042
            +VCGYG +GK  A+ L+     V+V EIDP     A  +GL VL    TL++ + EA +
Sbjct: 128  IVCGYGRIGKEIASKLQLEQVPVLVVEIDPANKQTAEEQGLNVLQADATLDETLLEAGL 186



>gb:MDI421476_143251 Methylobacterium dichloromethanicum gene for sgaA
            gene, hprA gene, mtdA gene and ORF DNA (partial) , strain
            DM4 (DSM6343).
          Length = 314

 Score = 41.2 bits (95), Expect = 0.074
 Identities = 26/92 (28%), Positives = 47/92 (51%), Gaps = 4/92 (4%)
 Frame = +2

Query: 860  IAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEAD 1039
            IAG    + GYG +GK  A   +  G +V+  ++ P        +GL  + L+ +++++D
Sbjct: 145  IAGSTLGIIGYGALGKSIAKRAEALGMKVLAFDVFP-------QDGL--VDLDTILTQSD 195

Query: 1040 IFV----TTTGNKDIIMVSHMKKMKNNAIVCN 1123
            +       T   K++I    +KKMK +AI+ N
Sbjct: 196  VITLHVPLTPDTKNMIGAEQLKKMKRSAILIN 227



>gb:AE017282_428987 Methylococcus capsulatus str. Bath, complete
            genome.
          Length = 338

 Score = 40.8 bits (94), Expect = 0.097
 Identities = 28/91 (30%), Positives = 43/91 (47%), Gaps = 1/91 (1%)
 Frame = +2

Query: 857  MIAGKVAVVCGYGDVGKGCAAALKQAGARVIV-TEIDPICALQALMEGLQVLTLEDVVSE 1033
            +I GK   + GYG  G   A  LK +G +V+V        A +A   GL V ++ED V +
Sbjct: 13   IIQGKKVAIIGYGSQGHAHANNLKDSGVQVVVGLRPGSASAKKAENAGLAVASVEDAVKQ 72

Query: 1034 ADIFVTTTGNKDIIMVSHMKKMKNNAIVCNI 1126
            AD+ +    ++      H  ++ N  I  NI
Sbjct: 73   ADVIMILAPDE------HQARLYNEQIAPNI 97



>gb:BA000012_670963 Mesorhizobium loti MAFF303099 DNA, complete
            genome.
          Length = 374

 Score = 40.4 bits (93), Expect = 0.13
 Identities = 29/79 (36%), Positives = 38/79 (48%), Gaps = 5/79 (6%)
 Frame = +2

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYG-DVGKGCAAALKQAGARVIVTEID----PICAL 979
            RH+  D   R       GKVAVV G G  +GK CA A+ + G RV+V +ID      C  
Sbjct: 84   RHAAKD--QRNPGGRFEGKVAVVTGAGAGIGKACALAIAREGGRVVVADIDGSAAVACTA 141

Query: 980  QALMEGLQVLTLEDVVSEA 1036
            Q   E    L L   +++A
Sbjct: 142  QIAAEAGHALALAMDIADA 160



>gb:AE017261_419389 Picrophilus torridus DSM 9790, complete genome.
          Length = 299

 Score = 40.4 bits (93), Expect = 0.13
 Identities = 27/109 (24%), Positives = 51/109 (46%), Gaps = 4/109 (3%)
 Frame = +2

Query: 809  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL 988
            G  ++  +   +   + ++GK   + GYG +G+  A A      R I  +  P+      
Sbjct: 119  GVENTRKNDFTKLKGIELSGKTLGIIGYGRIGRAIANAFSVFNVRSIAYDAYPVD----- 173

Query: 989  MEGLQVLTLEDVVSEADIF-VTTTGNKD---IIMVSHMKKMKNNAIVCN 1123
              G + +TLED++  +DI  +  T  KD   ++    +  +++NAIV N
Sbjct: 174  FTGAEQVTLEDLLRNSDIISINITLRKDSPPVLNEKELSMLRDNAIVIN 222



>gb:MLO672112_148428 Mesorhizobium loti R7A symbiosis island; segment
            1/4.
          Length = 380

 Score = 40.4 bits (93), Expect = 0.13
 Identities = 29/79 (36%), Positives = 38/79 (48%), Gaps = 5/79 (6%)
 Frame = +2

Query: 815  RHSLPDGLMRATDVMIAGKVAVVCGYG-DVGKGCAAALKQAGARVIVTEID----PICAL 979
            RH+  D   R       GKVAVV G G  +GK CA A+ + G RV+V +ID      C  
Sbjct: 90   RHAAKD--QRNPGGRFEGKVAVVTGAGAGIGKACALAIAREGGRVVVADIDGSAAVACTA 147

Query: 980  QALMEGLQVLTLEDVVSEA 1036
            Q   E    L L   +++A
Sbjct: 148  QIAAEAGHALALAMDIADA 166



>pir|I40211|I40211 probable sterol dehydrogenase (EC 1.1.1.-) -
            Bradyrhizobium japonicum>gb:BJU12678_748888
            Bradyrhizobium japonicum USDA 110 cytochrome P-450 BJ-2
            (CYP115P) pseudogene, cytochrome P-450 BJ-1 (CYP112)
            gene, cytochrome P-450 BJ-3 (CYP114) gene, putative
            ferredoxin gene, putative sterol dehydrogenase-like
            enzyme gene, cytochrome P-450 BJ-4 (CYP117) gene, and
            putative dimethylallyltranstransferase gene, complete
            cds.
          Length = 275

 Score = 40.0 bits (92), Expect = 0.17
 Identities = 25/62 (40%), Positives = 33/62 (53%), Gaps = 5/62 (8%)
 Frame = +2

Query: 866  GKVAVVCGYG-DVGKGCAAALKQAGARVIVTEIDP----ICALQALMEGLQVLTLEDVVS 1030
            GKVAVV G G  +GK CA A+ + G RV+V +ID      C  Q   E    L L   ++
Sbjct: 6    GKVAVVTGAGAGIGKACALAIAREGGRVVVADIDGSAAIACTAQIAAEAGHALALAIDIA 65

Query: 1031 EA 1036
            +A
Sbjct: 66   DA 67



>sp|Q45219|YL46_BRAJA Probable short-chain type
            dehydrogenase/reductase blr2146 (EC
            1.-.-.-).>gb:BA000040_730406 Bradyrhizobium japonicum
            USDA 110 DNA, complete genome.
          Length = 281

 Score = 40.0 bits (92), Expect = 0.17
 Identities = 25/62 (40%), Positives = 33/62 (53%), Gaps = 5/62 (8%)
 Frame = +2

Query: 866  GKVAVVCGYG-DVGKGCAAALKQAGARVIVTEIDP----ICALQALMEGLQVLTLEDVVS 1030
            GKVAVV G G  +GK CA A+ + G RV+V +ID      C  Q   E    L L   ++
Sbjct: 6    GKVAVVTGAGAGIGKACALAIAREGGRVVVADIDGSAAIACTAQIAAEAGHALALAIDIA 65

Query: 1031 EA 1036
            +A
Sbjct: 66   DA 67



>gb:BA000040_732174 Bradyrhizobium japonicum USDA 110 DNA, complete
            genome.
          Length = 269

 Score = 39.7 bits (91), Expect = 0.22
 Identities = 41/194 (21%), Positives = 76/194 (39%), Gaps = 27/194 (13%)
 Frame = +2

Query: 860  IAGKVAVV-CGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEA 1036
            + GK AV+      +G+ CA A  + GA VI T+I+         EG+      DV + A
Sbjct: 31   LKGKRAVITAAAAGIGRACAIAFAREGATVIATDINESGIAGLAKEGIAETAKLDVRNTA 90

Query: 1037 DI--FVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRI------- 1189
            D+  F    G  DI++ +         + C+   FD   D++    +  ++         
Sbjct: 91   DVNAFAKRVGKIDILLNAAGFVHHGTILECSEEDFDFSFDLNVKSMHRTIRAFLPDMLAG 150

Query: 1190 ------------TIKPQTDRFVFPETKTGIIILAEGRLMN-----LGCATGHPSFVMSCS 1318
                         ++P  +R+V+  +K  + +L     ++     + C +  P  V + S
Sbjct: 151  GGGSIVNISSCAALRPPANRYVYSASKAAVSLLTRAVALDFITKGIRCNSICPGTVETPS 210

Query: 1319 FTNQVIAQLELWKE 1360
              ++  AQ    KE
Sbjct: 211  MLDRAAAQGPQGKE 224



>gb:AY820162_646722 Leuconostoc mesenteroides putative lactate
            dehydrogenase (ldh) gene, complete cds.
          Length = 331

 Score = 39.7 bits (91), Expect = 0.22
 Identities = 30/85 (35%), Positives = 45/85 (52%), Gaps = 4/85 (4%)
 Frame = +2

Query: 881  VCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEAD-IFVTTT 1057
            V G G +G+     LK  GA+VI  +  P   LQA  EGL V TL+++ ++AD I +   
Sbjct: 150  VIGTGHIGRVAINILKGFGAKVIAYDKYPNAELQA--EGLYVDTLDELYAQADAISLYVP 207

Query: 1058 G---NKDIIMVSHMKKMKNNAIVCN 1123
            G   N  +I    + KMK+  ++ N
Sbjct: 208  GVPENHHLINADAIAKMKDGVVIMN 232



>pir|G75284|G75284 probable potassium channel - Deinococcus
            radiodurans (strain R1)>gb:AE002065_42581 Deinococcus
            radiodurans R1 section 202 of 229 of the complete
            chromosome 1.>gb:AE000513_883476 Deinococcus radiodurans
            R1 complete chromosome 1.
          Length = 320

 Score = 39.7 bits (91), Expect = 0.22
 Identities = 29/78 (37%), Positives = 38/78 (48%), Gaps = 6/78 (7%)
 Frame = +2

Query: 827  PDGLMRATD--VMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGL 1000
            PD   R  +  V+   +  +VCGYG VG+  A AL+ AG  V+V +  P     A   GL
Sbjct: 90   PDAQRRRKEKKVLSLREHTIVCGYGQVGEAVATALRGAGRTVVVIDQRPAHLEWAEAHGL 149

Query: 1001 QVL----TLEDVVSEADI 1042
              L    T EDV+  A I
Sbjct: 150  YTLVGDATDEDVLRRAGI 167



>sp|P51011|LDHD_LEUMC D-lactate dehydrogenase (EC 1.1.1.28) (D-LDH)
            (D-specific D-2- hydroxyacid
            dehydrogenase).>gb:LEUDLDH_140352 Leuconostoc
            mesenteroides (clone pGIV102) D-lactate dehydrogenase
            (D-ldh) gene, complete cds.
          Length = 331

 Score = 39.7 bits (91), Expect = 0.22
 Identities = 30/85 (35%), Positives = 45/85 (52%), Gaps = 4/85 (4%)
 Frame = +2

Query: 881  VCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEAD-IFVTTT 1057
            V G G +G+     LK  GA+VI  +  P   LQA  EGL V TL+++ ++AD I +   
Sbjct: 150  VIGTGHIGRVAINILKGFGAKVIAYDKYPNAELQA--EGLYVDTLDELYAQADAISLYVP 207

Query: 1058 G---NKDIIMVSHMKKMKNNAIVCN 1123
            G   N  +I    + KMK+  ++ N
Sbjct: 208  GVPENHHLINADAIAKMKDGVVIMN 232



>gb:AF285781_1783144 Ophiostoma floccosum hydroxynaphthalene reductase
            gene, complete cds.
          Length = 269

 Score = 39.3 bits (90), Expect = 0.28
 Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 1/62 (1%)
 Frame = +2

Query: 860  IAGKVAVVCGYG-DVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEA 1036
            +AGKVA++ G G  +G+G A  L + GA VIV       A + ++  L+ L  + V  +A
Sbjct: 13   LAGKVAIITGAGRGIGRGIATELGRRGANVIVNYGSSSAAAEEVVADLKALGTDAVAMQA 72

Query: 1037 DI 1042
            DI
Sbjct: 73   DI 74



>gb:BA000035_717047 Corynebacterium efficiens YS-314 DNA, complete
            genome.
          Length = 290

 Score = 39.3 bits (90), Expect = 0.28
 Identities = 33/97 (34%), Positives = 43/97 (44%), Gaps = 9/97 (9%)
 Frame = +2

Query: 866  GKVAVVCGYGDVGKGCAAALKQAGARVIVTEID--PICALQALMEGLQVLTLEDVVSEAD 1039
            GK   + G G +G      LK  G R+I       P+       E L +   + V SEAD
Sbjct: 125  GKTIAIMGAGGIGVRLIELLKPFGVRIIAVNNSGRPVPGAD---ETLPMSAADHVWSEAD 181

Query: 1040 IFV-------TTTGNKDIIMVSHMKKMKNNAIVCNIG 1129
             FV       TTTG   I+    + KMK NA+V N+G
Sbjct: 182  YFVLLMPLTETTTG---IVNRDTLAKMKPNAVVVNVG 215



>pir|AD1285|AD1285 glycerate dehydrogenases homolog lmo1684 [imported]
            - Listeria monocytogenes (strain
            EGD-e)>gb:AL591980_536175 Listeria monocytogenes strain
            EGD, complete genome, segment 8/12.
          Length = 313

 Score = 39.3 bits (90), Expect = 0.28
 Identities = 32/106 (30%), Positives = 49/106 (46%), Gaps = 4/106 (3%)
 Frame = +2

Query: 860  IAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEAD 1039
            +AGK  VV G G +G   A   +     +I        A +   E   +  +E V   AD
Sbjct: 133  LAGKTLVVAGTGAIGAKVAEFAQAFDMEIIGVNTTGHPA-KPFSETYAMTNIEKVAPLAD 191

Query: 1040 IFVTTTGNKD----IIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLE 1165
             FV+   + D    I  +S  +KMKNNA+  NIG   + ++++ LE
Sbjct: 192  FFVSVLPHTDETMGIYSLSFFEKMKNNAVFINIGR-GSAVELNVLE 236



>gb:AB120870_1527988 Alternaria brassicae Brn1 gene for
            1,3,8-naphthalenetriol reductase, partial cds,
            strain:AB-1.
          Length = 265

 Score = 38.9 bits (89), Expect = 0.37
 Identities = 42/154 (27%), Positives = 71/154 (46%), Gaps = 10/154 (6%)
 Frame = +2

Query: 860  IAGKVAVVCGYG-DVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEA 1036
            +AGKVAVV G G  +GK  A  L + GA+V V   + +   +A+++ ++ L      S+A
Sbjct: 9    LAGKVAVVTGSGRGIGKAMAIELAKRGAKVAVNYANAVEGAEAVVKEIKAL---GNGSDA 65

Query: 1037 DIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRF 1216
              F    GN     V   +K+ ++ +V + G  D      G+ ++   K +T  P+    
Sbjct: 66   AAFKANVGN-----VEESEKLMDD-VVKHFGKLDICCSNSGVVSFGHFKDVT--PEEFDR 117

Query: 1217 VFPETKTGIIILAE---------GRLMNLGCATG 1291
            VF     G   +A+         GR++ +G  TG
Sbjct: 118  VFTINTRGQFFVAKAAYKRMEMGGRIILMGSITG 151



>pir|E86731|E86731 hypothetical protein folD [imported] - Lactococcus
            lactis subsp. lactis (strain IL1403)>gb:AE006319_217755
            Lactococcus lactis subsp. lactis IL1403 section 81 of 218
            of the complete genome.>gb:AE005176_1094828 Lactococcus
            lactis subsp. lactis IL1403, complete genome.
          Length = 294

 Score = 38.9 bits (89), Expect = 0.37
 Identities = 40/128 (31%), Positives = 59/128 (46%), Gaps = 5/128 (3%)
 Frame = +2

Query: 821  SLPDGLM---RATDVMIAGKVAVVCGYGD-VGKGCAAALKQAGARVIVTEIDPICALQAL 988
            S P G+M   R  DV ++GK AVV G  + VGK  A  L  A A V +          + 
Sbjct: 148  STPAGIMEMFREYDVELSGKRAVVIGRSNIVGKPMAQLLMMADATVTIA--------HSK 199

Query: 989  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIG-HFDNEIDMHGLE 1165
             E L+ LT      EAD+ V   G   +I     + +K  A+V ++G + D +  +HG  
Sbjct: 200  TENLRELT-----KEADVLVVAIGRDRMIKA---EDVKEGAVVIDVGMNRDEDGKLHGDV 251

Query: 1166 TYPGVKRI 1189
             +  VK +
Sbjct: 252  DFDEVKDV 259



>gb:AB120866_1527984 Alternaria brassicae Brn1 gene for
            1,3,8-naphthalenetriol reductase, partial cds,
            strain:AB-1.
          Length = 265

 Score = 38.5 bits (88), Expect = 0.48
 Identities = 42/154 (27%), Positives = 70/154 (45%), Gaps = 10/154 (6%)
 Frame = +2

Query: 860  IAGKVAVVCGYG-DVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEA 1036
            +AGKVAVV G G  +GK  A  L + GA+V V   + I   + +++ ++ L      S+A
Sbjct: 9    LAGKVAVVTGSGRGIGKAMAIELAKRGAKVAVNYANAIEGAEQVVKEIKAL---GNGSDA 65

Query: 1037 DIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRF 1216
              F    GN     V   +K+ ++ +V + G  D      G+ ++   K +T  P+    
Sbjct: 66   KAFKANVGN-----VEESEKLMDD-VVAHFGKLDICCSNSGVVSFGHFKDVT--PEEFDR 117

Query: 1217 VFPETKTGIIILAE---------GRLMNLGCATG 1291
            VF     G   +A+         GR++ +G  TG
Sbjct: 118  VFNINTRGQFFVAKAAYQRMEMGGRIILMGSITG 151



>gb:BA000045_743851 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 310

 Score = 38.5 bits (88), Expect = 0.48
 Identities = 30/102 (29%), Positives = 45/102 (44%), Gaps = 4/102 (3%)
 Frame = +2

Query: 833  GLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLT 1012
            G  +   V +AGK   + G+GD+GK  A  L  A  RVI    DP    +A  E ++   
Sbjct: 134  GWPKPCGVSLAGKTVALVGFGDIGKATARRLVAAEMRVIA--YDPRYVPEAGSEAVEPAL 191

Query: 1013 LEDVVSEADIFVTTTG----NKDIIMVSHMKKMKNNAIVCNI 1126
              + + EAD  V T      N+ ++ V+     K    V N+
Sbjct: 192  WPERLGEADFIVFTCALTPENRHMLGVAAFGLTKPGVRVVNV 233



>gb:BA000030_699253 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 267

 Score = 38.5 bits (88), Expect = 0.48
 Identities = 19/37 (51%), Positives = 27/37 (72%), Gaps = 1/37 (2%)
 Frame = +2

Query: 860 IAGKVAVVCG-YGDVGKGCAAALKQAGARVIVTEIDP 967
           + GKVA+V G  G +G+  A AL +AGARV+V ++DP
Sbjct: 20  LQGKVAIVTGGAGGLGRATALALGKAGARVVVADLDP 56



>gb:AE017333_448789 Bacillus licheniformis DSM 13, complete
            genome.>gb:CP000002_858590 Bacillus licheniformis ATCC
            14580, complete genome.
          Length = 342

 Score = 38.5 bits (88), Expect = 0.48
 Identities = 23/62 (37%), Positives = 32/62 (51%)
 Frame = +2

Query: 857  MIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEA 1036
            ++AGK   V GYG  G   A  LK++G  VIV         +A  +G QV T+ +   +A
Sbjct: 14   VLAGKKVAVIGYGSQGHAHALNLKESGVDVIVGVRKGKSFAKAEEDGHQVFTVREAAEQA 73

Query: 1037 DI 1042
            DI
Sbjct: 74   DI 75



>sp|P55541|Y4LA_RHISN Putative short-chain type
           dehydrogenase/reductase Y4LA (EC
           1.-.-.-).>pir|T10877|T10877 y4lA protein - Rhizobium sp.
           (strain NGR234) plasmid pNGR234a>gb:AE000082_19767
           Rhizobium sp. NGR234 plasmid pNGR234a, section 19 of 46
           of the complete plasmid sequence.
          Length = 278

 Score = 38.5 bits (88), Expect = 0.48
 Identities = 19/39 (48%), Positives = 26/39 (66%), Gaps = 1/39 (2%)
 Frame = +2

Query: 866 GKVAVVCGYG-DVGKGCAAALKQAGARVIVTEIDPICAL 979
           GKVAVV G G  +GK CA A+ + G RV+V ++D   A+
Sbjct: 6   GKVAVVTGAGAGIGKACALAIAREGGRVVVADLDGSAAI 44


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,893,763,686
Number of Sequences: 1806583
Number of extensions: 40975690
Number of successful extensions: 146491
Number of sequences better than 10.0: 371
Number of HSP's better than 10.0 without gapping: 128468
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 145194
length of database: 581,917,975
effective HSP length: 131
effective length of database: 345,255,602
effective search space used: 168829989378
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)