BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig1806
         (724 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:BT004742_1637776 Arabidopsis thaliana At1g21930 gene, complet...   120   3e-26   
pir|T46109|T46109 hypothetical protein T27B3.20 - Arabidopsis th...   120   3e-26   Arabidopsis thaliana [mouse-ear cress]
gb:CGU20544_1646449 Cattleya guttata var. leopoldii NADH dehydro...    35   1.8     
gb:BNU20540_1633663 Brassavola nodosa NADH dehydrogenase subunit...    33   6.8     
gb:BX571965_791060 Burkholderia pseudomallei strain K96243, chro...    32   8.8     


>gb:BT004742_1637776 Arabidopsis thaliana At1g21930 gene, complete
           cds.
          Length = 98

 Score =  120 bits (300), Expect = 3e-26
 Identities = 60/71 (84%), Positives = 65/71 (91%), Gaps = 1/71 (1%)
 Frame = +2

Query: 188 VKQLEECSVSNALGTWVFSVAGALLAIPVGIKRKSLAPLVFFGTTGTMLDIIMGISACER 367
           VK LEEC+VSNALGTWVFSV GAL+AIPVGIKRKSL PLVFFGTTGTMLDII+G+S CER
Sbjct: 7   VKHLEECTVSNALGTWVFSVLGALVAIPVGIKRKSLGPLVFFGTTGTMLDIIIGVSQCER 66

Query: 368 EHAERQ-KLLE 397
           EHAE Q KLL+
Sbjct: 67  EHAEHQMKLLQ 77



>pir|T46109|T46109 hypothetical protein T27B3.20 - Arabidopsis
           thaliana>gb:ATT27B3_1555507 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T27B3.>gb:AY086031_1571092
           Arabidopsis thaliana clone 207539 mRNA, complete
           sequence.
          Length = 100

 Score =  120 bits (300), Expect = 3e-26
 Identities = 60/71 (84%), Positives = 65/71 (91%), Gaps = 1/71 (1%)
 Frame = +2

Query: 188 VKQLEECSVSNALGTWVFSVAGALLAIPVGIKRKSLAPLVFFGTTGTMLDIIMGISACER 367
           VK LEEC+VSNALGTWVFSV GAL+AIPVGIKRKSL PLVFFGTTGTMLDII+G+S CER
Sbjct: 7   VKHLEECTVSNALGTWVFSVLGALVAIPVGIKRKSLGPLVFFGTTGTMLDIIIGVSQCER 66

Query: 368 EHAERQ-KLLE 397
           EHAE Q KLL+
Sbjct: 67  EHAEHQTKLLQ 77



>gb:CGU20544_1646449 Cattleya guttata var. leopoldii NADH
           dehydrogenase subunit (ndhF) mRNA, chloroplast gene
           encoding chloroplast protein, partial cds.
          Length = 320

 Score = 34.7 bits (78), Expect = 1.8
 Identities = 32/131 (24%), Positives = 60/131 (45%), Gaps = 15/131 (11%)
 Frame = -3

Query: 704 SKAMNITHSCIEYLPQL**PFTSRWYSTCW-FHKC-----------NDDLLD*F*QKRLT 561
           S+  N   S +E +  +  PF+ +W S  W F KC            D +   +    + 
Sbjct: 137 SRRSNRFGSLLEMVHSIDNPFSKKWNSLVWIFVKCFFFSKYSSFRTIDSISFLWIYFFIF 196

Query: 560 EKFGLNAKI*QPQNRKQ---SNKRSDLRACLSAIMIRLWLRLQYWAMHQQLRQQNFVLPK 390
           +KFGLN+ + Q ++ K      KR D++  + + + R +L   YW  H + ++    + +
Sbjct: 197 QKFGLNSFLFQKRSXKNYSGQKKRCDIQLVIESWLYRYFL---YWDFHHEYKR----VSR 249

Query: 389 ASGVLRVLFHR 357
           A+ V R + +R
Sbjct: 250 ANSVFRXIDNR 260



>gb:BNU20540_1633663 Brassavola nodosa NADH dehydrogenase subunit
           (ndhF) mRNA, chloroplast gene encoding chloroplast
           protein, partial cds.
          Length = 322

 Score = 32.7 bits (73), Expect = 6.8
 Identities = 31/126 (24%), Positives = 57/126 (45%), Gaps = 15/126 (11%)
 Frame = -3

Query: 704 SKAMNITHSCIEYLPQL**PFTSRWYSTCW-FHKC-----------NDDLLD*F*QKRLT 561
           S+  N   S +E +  +  PF+ +W S  W F KC            D +   +    + 
Sbjct: 137 SRRSNRFGSILEMVHSIDNPFSKKWNSLVWIFVKCFFFSKYSSFRSIDSISFLWIYFFIF 196

Query: 560 EKFGLNAKI*QPQNRKQ---SNKRSDLRACLSAIMIRLWLRLQYWAMHQQLRQQNFVLPK 390
           +KFGLN+ + Q ++ K      KR D++  + + + R +L   YW  H + ++    + +
Sbjct: 197 KKFGLNSFLFQKRSXKNYSGQKKRCDIQLVIESWLYRYFL---YWDFHHEYKR----VSR 249

Query: 389 ASGVLR 372
           A+ V R
Sbjct: 250 ANSVFR 255



>gb:BX571965_791060 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.
          Length = 351

 Score = 32.3 bits (72), Expect = 8.8
 Identities = 14/36 (38%), Positives = 21/36 (58%)
 Frame = -1

Query: 187 RLCILSGHHSWRISLASAGIGVDRKSNQRNWLRGEK 80
           ++CI SG H +  +L +A I  D ++    WLRG K
Sbjct: 161 KVCIRSGQHPYNTALVAAMIAHDGEAAAEQWLRGVK 196


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 749,287,310
Number of Sequences: 1806583
Number of extensions: 15483470
Number of successful extensions: 40643
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 39519
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 40627
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 43235250408
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)