BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig1753
         (1684 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB015762_1512729 Nicotiana tabacum CYP82E1 mRNA for cytochrom...   446   e-124   
pir|T04651|T04651 cytochrome P450 F10N7.250 - Arabidopsis thalia...   434   e-120   Arabidopsis thaliana [mouse-ear cress]
pir|T05942|T05942 cytochrome P450 82C1 - soybean>gb:AF022461_176...   432   e-120   Glycine max [soybeans]
pir|T07964|T07964 (S)-N-methylcoclaurine 3'-hydroxylase (EC 1.1....   416   e-115   Eschscholzia californica
pir|T04648|T04648 cytochrome P450 F10N7.220 - Arabidopsis thalia...   416   e-114   Arabidopsis thaliana [mouse-ear cress]
gb:AY532373_1612056 Ammi majus cytochrome P450 (CYP82H1) mRNA, c...   392   e-107   
sp|Q43068|C821_PEA|C821_PEA Cytochrome P450 82A1 (EC 1.14.-.-) (CYPLXXXII...   388   e-106   Pisum sativum [garden pea]
gb:AF175278_1774495 Pisum sativum wound-inducible P450 hydroxyla...   387   e-106   
sp|O49858|C823_SOYBN|C823_SOYBN Cytochrome P450 82A3 (EC 1.14.-.-) (P450 CP...   386   e-106   Glycine max [soybeans]
sp|O49859|C824_SOYBN|C824_SOYBN Cytochrome P450 82A4 (EC 1.14.-.-) (P450 CP...   385   e-105   Glycine max [soybeans]
pir|H85374|H85374 cytochrome P450-like protein [imported] - Arab...   383   e-105   Arabidopsis thaliana [mouse-ear cress]
gb:AB026647_1517200 Arabidopsis thaliana genomic DNA, chromosome...   377   e-103   
pir|T06523|T06523 cytochrome P450 monooxygenase (EC 1.13.-.-) - ...   372   e-101   Pisum sativum [garden pea]
sp|O81972|C822_SOYBN|C822_SOYBN Cytochrome P450 82A2 (EC 1.14.-.-) (P450 CP...   363   4e-99   Glycine max [soybeans]
pir|T04650|T04650 cytochrome P450 F10N7.240 - Arabidopsis thaliana    362   2e-98   Arabidopsis thaliana [mouse-ear cress]
gb:HTCYP81L_1682164 Helianthus tuberosus mRNA for cytochrome P45...   323   5e-87   
pir|T10896|T10896 cytochrome P450 (EC 1.14.-.-) 81B1c - Jerusale...   323   5e-87   Helianthus tuberosus [Jerusalem artichoke]
pir|A84645|A84645 probable cytochrome P450 [imported] - Arabidop...   317   4e-85   Arabidopsis thaliana [mouse-ear cress]
gb:AF368380_1791923 Nicotiana tabacum elicitor-inducible cytochr...   296   1e-78   
gb:AY050849_1562347 Arabidopsis thaliana putative cytochrome P45...   296   1e-78   
gb:AP005419_1851476 Oryza sativa (japonica cultivar-group) genom...   295   1e-78   
gb:AK175373_1817361 Arabidopsis thaliana mRNA for cytochrome P45...   294   3e-78   
pir|C85441|C85441 cytochrome P450-like protein [imported] - Arab...   294   3e-78   Arabidopsis thaliana [mouse-ear cress]
gb:AX031179_1457266 Sequence 20 from Patent WO9846762.                293   6e-78   
gb:CAR239051_1645168 Cicer arietinum mRNA for cytochrome P450 (c...   293   7e-78   
gb:AY278229_1594517 Medicago truncatula CYP81E8 mRNA, complete cds.   293   7e-78   
pir|B85441|B85441 cytochrome P450-like protein [imported] - Arab...   291   2e-77   Arabidopsis thaliana [mouse-ear cress]
pir|T04730|T04730 cytochrome P450 homolog F6G17.10 - Arabidopsis...   291   3e-77   Arabidopsis thaliana [mouse-ear cress]
pir|H85440|H85440 cytochrome P450-like protein [imported] - Arab...   289   1e-76   Arabidopsis thaliana [mouse-ear cress]
pir|A85441|A85441 cytochrome P450-like protein [imported] - Arab...   288   3e-76   Arabidopsis thaliana [mouse-ear cress]
gb:AY278228_1594516 Medicago truncatula isoflavone 3'-hydroxylas...   287   5e-76   
gb:AY087256_1572290 Arabidopsis thaliana clone 33365 mRNA, compl...   287   5e-76   
pir|T04731|T04731 cytochrome P450 homolog F6G17.20 - Arabidopsis...   287   5e-76   Arabidopsis thaliana [mouse-ear cress]
sp|O65790|C81F_ARATH|C81F_ARATH Cytochrome P450 81F1 (EC 1.14.-.-).>pir|T04...   287   5e-76   Arabidopsis thaliana [mouse-ear cress]
gb:AY074823_1567676 Arabidopsis thaliana AT4g37430/F6G17_80 gene...   285   2e-75   
gb:AY278227_1594515 Medicago truncatula isoflavone 2'-hydroxylas...   285   2e-75   
pir|T52175|T52175 cytochrome P450 monooxygenase [imported] - Ara...   285   3e-75   Arabidopsis thaliana [mouse-ear cress]
gb:AP005419_1851475 Oryza sativa (japonica cultivar-group) genom...   284   3e-75   
gb:AY086486_1571534 Arabidopsis thaliana clone 253698 mRNA, comp...   284   4e-75   
gb:AB025016_1516089 Lotus corniculatus var. japonicus mRNA for c...   283   8e-75   
pir|T00513|T00513 cytochrome P450 homolog At2g23190 - Arabidopsi...   281   2e-74   Arabidopsis thaliana [mouse-ear cress]
gb:AC084282_1733419 Oryza sativa chromosome 3 BAC OSJNBb0048A17 ...   281   4e-74   
gb:BT000794_1635065 Arabidopsis thaliana putative cytochrome P45...   281   4e-74   
gb:AB022732_1515265 Glycyrrhiza echinata CYP Ge-31 mRNA for cyto...   281   4e-74   
sp|P93147|C81E_GLYEC|C81E_GLYEC Cytochrome P450 81E1 (EC 1.14.-.-) (Isoflav...   281   4e-74   Glycyrrhiza echinata [hedgehog licorice]
gb:AP005570_1854232 Oryza sativa (japonica cultivar-group) genom...   280   8e-74   
pir|T04735|T04735 cytochrome P450 homolog F6G17.60 - Arabidopsis...   279   1e-73   Arabidopsis thaliana [mouse-ear cress]
pir|T00510|T00510 probable cytochrome P450 At2g23220 [imported] ...   279   1e-73   Arabidopsis thaliana [mouse-ear cress]
gb:AP005285_1849831 Oryza sativa (japonica cultivar-group) genom...   278   2e-73   
gb:D78606_1674788 Arabidopsis thaliana mRNA for cytochrome P450 ...   278   2e-73   
pir|T52174|T52174 cytochrome P450 monooxygenase [imported] - Ara...   278   2e-73   Arabidopsis thaliana [mouse-ear cress]
sp|Q9FG65|C81D_ARATH|C81D_ARATH Cytochrome P450 81D1 (EC 1.14.-.-).>gb:AB02...   276   7e-73   Arabidopsis thaliana [mouse-ear cress]
gb:CAR238439_1645167 Cicer arietinum mRNA for a cytochrome P450 ...   276   9e-73   
gb:AP005419_1851474 Oryza sativa (japonica cultivar-group) genom...   275   2e-72   
gb:AC084282_1733418 Oryza sativa chromosome 3 BAC OSJNBb0048A17 ...   275   2e-72   
gb:AB019233_1514191 Arabidopsis thaliana genomic DNA, chromosome...   275   2e-72   
gb:CAR012581_1645125 Cicer arietinum mRNA for cytochrome P450.        275   3e-72   
pir|JC7886|JC7886 cytochrome P450 92B1 - garden petunia               274   5e-72   Petunia x hybrida [garden petunia]
sp|Q9SD85|F3PH_ARATH|F3PH_ARATH Flavonoid 3'-monooxygenase (EC 1.14.13.21) ...   274   5e-72   Arabidopsis thaliana [mouse-ear cress]
gb:AF218296_1778151 Pisum sativum cytochrome P450 mRNA, complete...   273   1e-71   
gb:AY087977_1573001 Arabidopsis thaliana clone 40095 mRNA, compl...   272   1e-71   
pir|T03275|T03275 probable cytochrome P450, hypersensitivity-rel...   272   2e-71   Nicotiana tabacum [American tobacco]
pir|T03634|T03634 cytochrome P450 - common tobacco>gb:NTP450GEN_...   272   2e-71   Nicotiana tabacum [American tobacco]
gb:AX028830_1457176 Sequence 14 from Patent WO9732023.                270   7e-71   
gb:AP005285_1849829 Oryza sativa (japonica cultivar-group) genom...   270   9e-71   
gb:AY166658_1586209 Pisum sativum cytochrome P450 mRNA, complete...   270   9e-71   
gb:AB061212_1521992 Glycine max sf3'h1 mRNA for flavonoid 3'-hyd...   268   2e-70   
pir|B96691|B96691 probable cytochrome P450 F28G11.4 [imported] -...   268   2e-70   Arabidopsis thaliana [mouse-ear cress]
gb:AF466200_1802231 Sorghum bicolor putative protein kinase gene...   267   6e-70   
gb:AF313491_1785224 Matthiola incana flavonoid 3'-hydroxylase mR...   265   2e-69   
gb:AF321856_1786036 Lolium rigidum clone FHH-t putative cytochro...   265   2e-69   
pir|JC7172|JC7172 cytochrome P450 CYP703A1 - garden petunia>gb:A...   265   2e-69   Petunia x hybrida [garden petunia]
gb:AF386512_1794708 Pyrus communis cytochrome P450 mRNA, complet...   263   8e-69   
gb:AF321855_1786035 Lolium rigidum clone FHH-v putative cytochro...   263   8e-69   
gb:AC084282_1733421 Oryza sativa chromosome 3 BAC OSJNBb0048A17 ...   263   8e-69   
gb:AB159038_1528422 Lolium rigidum mRNA for P450, complete cds, ...   263   8e-69   
gb:BT005895_1638817 Arabidopsis thaliana At5g67310 gene, complet...   263   1e-68   
gb:AB007645_1510147 Arabidopsis thaliana genomic DNA, chromosome...   263   1e-68   
gb:AY072308_1567125 Arabidopsis thaliana cytochrome P450 monooxy...   262   2e-68   
gb:AF321857_1786037 Lolium rigidum clone FHH-y putative cytochro...   261   4e-68   
gb:AB159039_1528423 Lolium rigidum mRNA for P450, complete cds, ...   261   4e-68   
gb:AP005483_1852666 Oryza sativa (japonica cultivar-group) genom...   260   5e-68   
pir|A86143|A86143 probable cytochrome P450 [imported] - Arabidop...   260   7e-68   Arabidopsis thaliana [mouse-ear cress]
gb:AF315465_1785416 Pelargonium x hortorum flavonoid 3'-hydroxyl...   259   9e-68   
gb:AY072297_1567115 Zea mays cytochrome P450 monooxygenase CYP92...   259   2e-67   
sp|Q42798|C931_SOYBN|C931_SOYBN Cytochrome P450 93A1 (EC 1.14.-.-).>pir|S62...   259   2e-67   Glycine max [soybeans]
pir|T52256|T52256 cytochrome P-450LXXIA1 [similarity] - avocado>...   258   3e-67   Persea americana
gb:AP006446_1861782 Oryza sativa (japonica cultivar-group) genom...   258   3e-67   
gb:AX028832_1457177 Sequence 16 from Patent WO9732023.                258   3e-67   
gb:AF313489_1785222 Callistephus chinensis flavonoid 3',5'-hydro...   257   4e-67   
gb:AX028834_1457178 Sequence 18 from Patent WO9732023.                257   6e-67   
gb:AC084282_1733420 Oryza sativa chromosome 3 BAC OSJNBb0048A17 ...   256   1e-66   
gb:AB057672_1521704 Torenia hybrida tht mRNA for flavonoid 3'-hy...   256   1e-66   
gb:AB122079_1528034 Panax ginseng mRNA for cytochrome P450, comp...   252   2e-65   
gb:AF313488_1785221 Callistephus chinensis putative flavonoid 3'...   251   3e-65   
gb:AB159037_1528421 Lolium rigidum mRNA for P450, complete cds, ...   251   3e-65   
gb:AP004591_1842019 Oryza sativa (japonica cultivar-group) genom...   250   7e-65   
gb:AP004022_1836496 Oryza sativa (japonica cultivar-group) genom...   250   7e-65   
gb:AP005285_1849830 Oryza sativa (japonica cultivar-group) genom...   249   2e-64   
gb:AY541035_1612618 Allium cepa flavonoid 3'-hydroxylase mRNA, c...   249   2e-64   
gb:AP003711_1832299 Oryza sativa (japonica cultivar-group) genom...   248   3e-64   
gb:NRCYP71A5_1691150 Nepeta racemosa mRNA for cytochrome P450, C...   248   4e-64   
gb:AY675558_1621947 Solanum tuberosum flavonoid 3',5'-hydroxylas...   248   4e-64   
gb:OSJN00014_1693289 Oryza sativa genomic DNA, chromosome 4, BAC...   247   6e-64   
gb:AY675561_1621950 Solanum tuberosum flavonoid 3',5'-hydroxylas...   245   2e-63   
sp|P24465|CP71_PERAE|CP71_PERAE Cytochrome P450 71A1 (EC 1.14.-.-) (CYPLXXI...   245   2e-63   Persea americana
sp|P37117|C714_SOLME|C714_SOLME Cytochrome P450 71A4 (EC 1.14.-.-) (CYPLXXI...   245   2e-63   Solanum melongena [aubergine]
sp|O04773|C756_CAMME|C756_CAMME Flavonoid 3',5'-hydroxylase (EC 1.14.-.-) (...   244   5e-63   Campanula medium [Canterbury bells]
gb:AY226829_1591041 Vitis vinifera cytochrome P-450-like protein...   243   9e-63   
gb:AB045592_1520403 Perilla frutescens PFSII3 mRNA for flavone s...   243   1e-62   
gb:AX028838_1457180 Sequence 22 from Patent WO9732023.                242   1e-62   
pir|T49979|T49979 cytochrome P450-like protein - Arabidopsis tha...   242   1e-62   Arabidopsis thaliana [mouse-ear cress]
sp|Q9SBQ9|F3PH_PETHY|F3PH_PETHY Flavonoid 3'-monooxygenase (EC 1.14.13.21) ...   242   1e-62   Petunia x hybrida [garden petunia]
gb:AF135485_1771085 Glycine max cytochrome P450 monooxygenaseCYP...   242   2e-62   
gb:A29011_1448320 pCGP602 DNA from patent EP0522880.                  242   2e-62   
gb:AE016959_1021729 Oryza sativa (japonica cultivar-group) chrom...   242   2e-62   
sp|P48418|C751_PETHY|C751_PETHY Flavonoid 3',5'-hydroxylase 1 (EC 1.14.-.-)...   242   2e-62   Petunia x hybrida [garden petunia]
gb:AF156976_1773054 Gerbera hybrida flavone synthase II (CYP93B2...   241   4e-62   
gb:AF082028_1766570 Hemerocallis hybrid cultivar senescence-asso...   240   6e-62   
gb:AY463157_1607680 Ipomoea quamoclit flavonoid 3'-hydroxylase m...   240   7e-62   
sp|Q42799|C932_SOYBN|C932_SOYBN Cytochrome P450 93A2 (EC 1.14.-.-).>pir|T07...   240   7e-62   Glycine max [soybeans]
gb:AP005846_1858998 Oryza sativa (japonica cultivar-group) genom...   239   1e-61   
gb:AF313490_1785223 Lycianthes rantonnei flavonoid 3',5'-hydroxy...   239   1e-61   
gb:CRO011862_1673459 Catharanthus roseus mRNA for flavonoid 3',5...   239   2e-61   
sp|P48419|C753_PETHY|C753_PETHY Flavonoid 3',5'-hydroxylase 2 (EC 1.14.-.-)...   238   2e-61   Petunia x hybrida [garden petunia]
gb:AX028819_1457169 Sequence 3 from Patent WO9732023.                 238   3e-61   
sp|O81973|C933_SOYBN|C933_SOYBN Cytochrome P450 93A3 (EC 1.14.-.-) (P450 CP...   238   3e-61   Glycine max [soybeans]
sp|P37118|C712_SOLME|C712_SOLME Cytochrome P450 71A2 (EC 1.14.-.-) (CYPLXXI...   237   5e-61   Solanum melongena [aubergine]
gb:AB078514_1523730 Nierembergia sp. NB17 f3',5'h mRNA for flavo...   236   8e-61   
sp|P37120|C752_SOLME|C752_SOLME Flavonoid 3',5'-hydroxylase (EC 1.14.-.-) (...   236   1e-60   Solanum melongena [aubergine]
sp|O04164|C716_NEPRA|C716_NEPRA Cytochrome P450 71A6 (EC 1.14.-.-) (Fragmen...   236   1e-60   Nepeta racemosa
gb:AB113261_1527232 Ipomoea nil Magenta mRNA for flavonoid 3'-hy...   235   2e-60   
gb:AX028836_1457179 Sequence 20 from Patent WO9732023.                235   2e-60   
gb:AB113263_1527234 Ipomoea tricolor Fuchsia mRNA for flavonoid ...   234   3e-60   
gb:AY117551_1579411 Glycine max flavonoid 3', 5'-hydroxylase mRN...   234   4e-60   
pir|T49978|T49978 cytochrome P450-like protein - Arabidopsis tha...   234   4e-60   Arabidopsis thaliana [mouse-ear cress]
sp|Q9STL2|C71L_ARATH|C71L_ARATH Cytochrome P450 71A21 (EC 1.14.-.-).>pir|T0...   234   4e-60   Arabidopsis thaliana [mouse-ear cress]
gb:AF188612_1775231 Callistephus chinensis flavone synthase II (...   234   5e-60   
gb:AY532370_1612053 Ammi majus cytochrome P450 (CYP71AJ1) mRNA, ...   234   5e-60   
sp|O48922|C982_SOYBN|C982_SOYBN Cytochrome P450 98A2 (EC 1.14.-.-).>pir|T05...   234   5e-60   Glycine max [soybeans]
gb:AE016959_1021701 Oryza sativa (japonica cultivar-group) chrom...   233   7e-60   
gb:AY082612_1569191 Ocimum basilicum p-coumaroyl shikimate 3'-hy...   233   9e-60   
sp|O64718|C729_ARATH|C729_ARATH Cytochrome P450 71B9 (EC 1.14.-.-).>gb:AC00...   233   9e-60   Arabidopsis thaliana [mouse-ear cress]
sp|O65788|C722_ARATH|C722_ARATH Cytochrome P450 71B2 (EC 1.14.-.-).>pir|H86...   233   9e-60   Arabidopsis thaliana [mouse-ear cress]
gb:AB057673_1521705 Torenia hybrida ght mRNA for flavonoid 3'-hy...   233   1e-59   
sp|Q42600|C84A_ARATH|C84A_ARATH Cytochrome P450 84A1 (Ferulate-5-hydroxylas...   233   1e-59   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00041_1693755 Oryza sativa genomic DNA, chromosome 4, BAC...   232   2e-59   
gb:AY082611_1569190 Ocimum basilicum p-coumaroyl shikimate 3'-hy...   232   2e-59   
gb:AX028821_1457170 Sequence 5 from Patent WO9732023.                 232   2e-59   
gb:ATH295576_1552359 Arabidopsis thaliana fah1 gene for ferulate...   232   2e-59   
gb:AB113262_1527233 Ipomoea purpurea Pink mRNA for flavonoid 3'-...   232   2e-59   
sp|Q9LVD2|C72A_ARATH|C72A_ARATH Cytochrome P450 71B10 (EC 1.14.-.-).>gb:AB0...   232   2e-59   Arabidopsis thaliana [mouse-ear cress]
gb:AY054214_1563035 Arabidopsis thaliana AT4g37310/C7A10_50 mRNA...   231   3e-59   
gb:AJ583530_1811350 Triticum aestivum mRNA for cytochrome P450 (...   231   4e-59   
sp|O64636|C7C1_ARATH|C7C1_ARATH Cytochrome P450 76C1 (EC 1.14.-.-).>pir|T00...   231   4e-59   Arabidopsis thaliana [mouse-ear cress]
gb:AP005878_1859536 Oryza sativa (japonica cultivar-group) genom...   230   6e-59   
sp|Q9LIP3|C72Y_ARATH|C72Y_ARATH Cytochrome P450 71B37 (EC 1.14.-.-).             230   6e-59   Arabidopsis thaliana [mouse-ear cress]
gb:AY072124_1567018 Arabidopsis thaliana putative cytochrome P45...   230   8e-59   
gb:AF022460_1761995 Glycine max cytochrome P450 monooxygenase CY...   229   1e-58   
pir|T05940|T05940 cytochrome P450 83D1p - soybean (fragment)          229   1e-58   Glycine max [soybeans]
sp|Q9LIP5|C72W_ARATH|C72W_ARATH Cytochrome P450 71B35 (EC 1.14.-.-).>gb:BT0...   229   1e-58   Arabidopsis thaliana [mouse-ear cress]
gb:BT004038_1637150 Arabidopsis thaliana clone RAFL15-05-J07 (R2...   229   1e-58   
gb:ATH295580_1552363 Arabidopsis thaliana fah1 gene for ferulate...   229   1e-58   
gb:AB078781_1523781 Vinca major VFH gene for Flavonoid 3',5'-hyd...   229   1e-58   
pir|T52173|T52173 cytochrome P450 monooxygenase [imported] - Ara...   229   1e-58   Arabidopsis thaliana [mouse-ear cress]
sp|Q9LIP6|C72V_ARATH|C72V_ARATH Cytochrome P450 71B34 (EC 1.14.-.-).>gb:AP0...   229   1e-58   Arabidopsis thaliana [mouse-ear cress]
gb:AB028151_1517807 Antirrhinum majus AFNS2 mRNA for cytochrome ...   229   2e-58   
sp|Q96418|C755_EUSGR|C755_EUSGR Flavonoid 3',5'-hydroxylase (EC 1.14.-.-) (...   228   3e-58   Eustoma exaltatum subsp. russellianum [bluebells]
gb:AF122821_1769853 Capsicum annuum cytochrome P450 (PepCYP) mRN...   228   4e-58   
gb:AX146629_1462494 Sequence 5 from Patent WO0134817.                 228   4e-58   
sp|O04790|C757_EUSGR|C757_EUSGR Flavonoid 3',5'-hydroxylase (EC 1.14.-.-) (...   228   4e-58   Eustoma exaltatum subsp. russellianum [bluebells]
gb:AY532371_1612054 Ammi majus cytochrome P450 (CYP98A21) mRNA, ...   227   5e-58   
gb:AY065995_1566582 Sesamum indicum p-coumarate 3-hydroxylase mR...   227   5e-58   
gb:AB045593_1520404 Perilla frutescens SHT12 mRNA for flavonoid ...   226   8e-58   
pir|T04566|T04566 cytochrome P450 homolog T12H17.100 - Arabidops...   226   8e-58   Arabidopsis thaliana [mouse-ear cress]
sp|O48956|C981_SORBI|C981_SORBI Cytochrome P450 98A1 (EC 1.14.-.-).>pir|T14...   226   8e-58   Sorghum bicolor [broomcorn]
gb:AF214009_1777815 Brassica napus cytochrome p450-dependent mon...   226   1e-57   
gb:AY056209_1563532 Arabidopsis thaliana putative cytochrome P45...   226   1e-57   
gb:AY275430_1594368 Gossypium hirsutum flavonoid 3',5'-hydroxyla...   226   1e-57   
gb:AX146625_1462493 Sequence 1 from Patent WO0134817.                 226   1e-57   
gb:AJ583531_1811351 Triticum aestivum mRNA for cytochrome P450 (...   225   2e-57   
gb:AP005846_1858999 Oryza sativa (japonica cultivar-group) genom...   225   2e-57   
gb:AB028152_1517808 Torenia hybrida TFNS5 mRNA for cytochrome P4...   225   2e-57   
gb:AB012925_1511971 Torenia hybrida mRNA for flavonoid 3',5'-hyd...   225   2e-57   
pir|T04564|T04564 cytochrome P450 homolog T12H17.80 - Arabidopsi...   224   3e-57   Arabidopsis thaliana [mouse-ear cress]
pir|T00605|T00605 probable cytochrome P450 At2g02580 [imported] ...   224   3e-57   Arabidopsis thaliana [mouse-ear cress]
gb:AP001298_1820969 Arabidopsis thaliana genomic DNA, chromosome...   224   4e-57   
gb:AK118051_1816051 Arabidopsis thaliana At3g52970 mRNA for puta...   224   4e-57   
sp|Q9LIP4|C72X_ARATH|C72X_ARATH Cytochrome P450 71B36 (EC 1.14.-.-).>gb:AP0...   224   4e-57   Arabidopsis thaliana [mouse-ear cress]
sp|Q9STL1|C71M_ARATH|C71M_ARATH Cytochrome P450 71A22 (EC 1.14.-.-).>pir|T0...   224   5e-57   Arabidopsis thaliana [mouse-ear cress]
sp|O81970|C719_SOYBN|C719_SOYBN Cytochrome P450 71A9 (EC 1.14.-.-) (P450 CP...   224   5e-57   Glycine max [soybeans]
sp|P47195|CP80_BERST|CP80_BERST Berbamunine synthase (EC 1.14.21.3) (Cytoch...   223   7e-57   Berberis stolonifera
sp|Q96581|C754_GENTR|C754_GENTR Flavonoid 3',5'-hydroxylase (EC 1.14.-.-) (...   223   7e-57   Gentiana triflora
gb:AP002842_1823064 Oryza sativa (japonica cultivar-group) genom...   223   9e-57   
sp|O65782|C831_ARATH|C831_ARATH Cytochrome P450 83B1 (EC 1.14.-.-).>pir|T10...   223   9e-57   Arabidopsis thaliana [mouse-ear cress]
gb:AB022733_1515266 Glycyrrhiza echinata CYP Ge-51 mRNA for cyto...   223   1e-56   
gb:AB127340_1528330 Muscari armeniacum MaP450 mRNA for cytochrom...   222   2e-56   
sp|P93149|C9B1_GLYEC|C9B1_GLYEC Cytochrome P450 93B1 (EC 1.14.-.-) ((2S)-fl...   222   2e-56   Glycyrrhiza echinata [hedgehog licorice]
pir|T48140|T48140 flavonoid 3',5'-hydroxylase homolog T4C9.140 [...   221   4e-56   Arabidopsis thaliana [mouse-ear cress]
sp|O64637|C7C2_ARATH|C7C2_ARATH Cytochrome P450 76C2 (EC 1.14.-.-).>pir|T00...   221   5e-56   Arabidopsis thaliana [mouse-ear cress]
sp|Q9LTL0|C72Q_ARATH|C72Q_ARATH Cytochrome P450 71B26 (EC 1.14.-.-).>gb:AB0...   221   5e-56   Arabidopsis thaliana [mouse-ear cress]
gb:AB010697_1511191 Arabidopsis thaliana genomic DNA, chromosome...   220   6e-56   
sp|Q9STK7|C71Q_ARATH|C71Q_ARATH Cytochrome P450 71A26 (EC 1.14.-.-).>pir|T0...   220   6e-56   Arabidopsis thaliana [mouse-ear cress]
gb:AY566988_1615411 Verbena x hybrida flavonoid 3',5'-hydroxylas...   220   8e-56   
gb:AF214007_1777813 Brassica napus cytochrome p450-dependent mon...   219   1e-55   
gb:AB037245_1519120 Asparagus officinalis ASPI-2 mRNA for cytoch...   219   1e-55   
gb:AB037244_1519119 Asparagus officinalis ASPI-1 mRNA for cytoch...   219   1e-55   
sp|O22203|C983_ARATH|C983_ARATH Cytochrome P450 98A3 (EC 1.14.-.-).>pir|T00...   219   1e-55   Arabidopsis thaliana [mouse-ear cress]
pir|T00934|T00934 probable cytochrome P450 [imported] - Arabidop...   219   1e-55   Arabidopsis thaliana [mouse-ear cress]
gb:AP005285_1849832 Oryza sativa (japonica cultivar-group) genom...   219   2e-55   
gb:AF313492_1785225 Matthiola incana putative cytochrome P450 mR...   219   2e-55   
gb:AY064170_1566041 Pinus taeda p-coumarate 3-hydroxylase mRNA, ...   219   2e-55   
sp|O49342|C71D_ARATH|C71D_ARATH Cytochrome P450 71A13 (EC 1.14.-.-).>pir|E8...   219   2e-55   Arabidopsis thaliana [mouse-ear cress]
gb:AF346833_1789996 Mentha x piperita menthofuran synthase mRNA,...   218   2e-55   
gb:CBL427452_1645668 Solenostemon scutellarioides mRNA for putat...   218   2e-55   
gb:AY466856_1608088 Camptotheca acuminata hydroxylase-like cytoc...   218   2e-55   
gb:AY094484_1575777 Arabidopsis thaliana At2g30750/T11J7.14 mRNA...   218   2e-55   
gb:AB017418_1513629 Lithospermum erythrorhizon CYP98A6 mRNA for ...   218   2e-55   
sp|O49340|C71C_ARATH|C71C_ARATH Cytochrome P450 71A12 (EC 1.14.-.-).>pir|C8...   218   2e-55   Arabidopsis thaliana [mouse-ear cress]
gb:AF214008_1777814 Brassica napus cytochrome p450-dependent mon...   218   3e-55   
gb:AB028462_1517854 Petunia x hybrida imt-5 mRNA for cytochrome ...   218   3e-55   
pir|T52168|T52168 cytochrome P450 monooxygenase [imported] - Ara...   218   3e-55   Arabidopsis thaliana [mouse-ear cress]
sp|O81971|C7D9_SOYBN|C7D9_SOYBN Cytochrome P450 71D9 (EC 1.14.-.-) (P450 CP...   218   3e-55   Glycine max [soybeans]
gb:AF321860_1786040 Lolium rigidum clone Lol-20-f putative cytoc...   218   4e-55   
pir|T47554|T47554 cytochrome P450 homolog F8J2.140 [similarity] ...   218   4e-55   Arabidopsis thaliana [mouse-ear cress]
gb:BT015411_1642239 Arabidopsis thaliana At4g12320 gene, complet...   217   5e-55   
gb:AP004000_1836151 Oryza sativa (japonica cultivar-group) genom...   217   7e-55   
gb:AC112160_1738853 Oryza sativa (japonica cultivar-group) chrom...   217   7e-55   
gb:AY850933_1630830 Broussonetia papyrifera ferulate-5-hydroxyla...   217   7e-55   
gb:AY621153_1618349 Camptotheca acuminata ferulate 5-hydroxylase...   216   1e-54   
gb:AP003990_1836015 Oryza sativa (japonica cultivar-group) genom...   216   1e-54   
gb:AY596978_1617029 Centaurium erythraea coniferylalcohol 5-hydr...   216   1e-54   
pir|T48141|T48141 flavonoid 3',5'-hydroxylase homolog T4C9.150 [...   216   1e-54   Arabidopsis thaliana [mouse-ear cress]
sp|O65786|C724_ARATH|C724_ARATH Cytochrome P450 71B4 (EC 1.14.-.-).>gb:AB02...   216   1e-54   Arabidopsis thaliana [mouse-ear cress]
sp|Q9STL0|C71N_ARATH|C71N_ARATH Cytochrome P450 71A23 (EC 1.14.-.-).>pir|T0...   216   1e-54   Arabidopsis thaliana [mouse-ear cress]
gb:AJ583532_1811352 Triticum aestivum mRNA for cytochrome P450 (...   215   2e-54   
gb:AY072298_1567116 Zea mays cytochrome P450 monooxygenase CYP71...   215   2e-54   
gb:AB052131_1521171 Asparagus officinalis Asp-3 mRNA for cytochr...   215   2e-54   
gb:PAJ10324_1698705 Populus trichocarpa cv trichobel mRNA for fe...   215   3e-54   
pir|T52171|T52171 cytochrome P450 monooxygenase [imported] - Ara...   214   3e-54   Arabidopsis thaliana [mouse-ear cress]
sp|Q42716|C718_MENPI|C718_MENPI Cytochrome P450 71A8 (EC 1.14.-.-).>pir|S45...   214   3e-54   Mentha x piperita
sp|O48923|C7DA_SOYBN|C7DA_SOYBN Cytochrome P450 71D10 (EC 1.14.-.-).>pir|T0...   214   4e-54   Glycine max [soybeans]
gb:AJ585989_1811750 Triticum aestivum partial mRNA for cytochrom...   214   6e-54   
sp|P58049|C72B_ARATH|C72B_ARATH Cytochrome P450 71B11 (EC 1.14.-.-).>gb:AK1...   214   6e-54   Arabidopsis thaliana [mouse-ear cress]
gb:AF150881_1772612 Lycopersicon esculentum x Lycopersicon peruv...   213   7e-54   
gb:AY192573_1588679 Catharanthus roseus cytochrome P450 71D1 (CY...   213   7e-54   
sp|Q9STK8|C71P_ARATH|C71P_ARATH Cytochrome P450 71A25 (EC 1.14.-.-).>pir|T0...   213   7e-54   Arabidopsis thaliana [mouse-ear cress]
gb:AB016061_1512754 Petunia x hybrida IMT-6 mRNA for cytochrome ...   212   2e-53   
sp|Q9LTM0|C72N_ARATH|C72N_ARATH Cytochrome P450 71B23 (EC 1.14.-.-).>gb:AB0...   211   3e-53   Arabidopsis thaliana [mouse-ear cress]
gb:AF321863_1786043 Lolium rigidum clone Lol-3-k putative cytoch...   211   4e-53   
gb:AB036772_1519050 Triticum aestivum N-1 mRNA for cytochrome P4...   211   5e-53   
sp|Q9SAB6|C71I_ARATH|C71I_ARATH Cytochrome P450 71A18 (EC 1.14.-.-).             211   5e-53   Arabidopsis thaliana [mouse-ear cress]
gb:AF501293S2_1806527 Glycine max cultivar Williams flavonoid 3'...   210   6e-53   
gb:ATU18929_1556808 Arabidopsis thaliana cytochrome p450 depende...   210   6e-53   
pir|T14639|T14639 cytochrome P450 CYP99A1 - sorghum (fragment)        210   6e-53   Sorghum bicolor [broomcorn]
sp|O48957|CP99_SORBI|CP99_SORBI Cytochrome P450 CYP99A1 (EC 1.14.-.-) (Frag...   210   6e-53   Sorghum bicolor [broomcorn]
sp|P48421|C83A_ARATH|C83A_ARATH Cytochrome P450 83A1 (EC 1.14.-.-) (CYPLXXX...   210   6e-53   Arabidopsis thaliana [mouse-ear cress]
gb:AP004688_1843417 Oryza sativa (japonica cultivar-group) genom...   210   8e-53   
gb:OSJN00303_1698239 Oryza sativa genomic DNA, chromosome 4, BAC...   210   8e-53   
gb:AB016060_1512753 Petunia x hybrida IMT-4 mRNA for cytochrome ...   210   8e-53   
pir|A96542|A96542 probable cytochrome P450 [imported] - Arabidop...   209   1e-52   Arabidopsis thaliana [mouse-ear cress]
sp|Q9LTL2|C72P_ARATH|C72P_ARATH Cytochrome P450 71B25 (EC 1.14.-.-).>gb:AB0...   209   1e-52   Arabidopsis thaliana [mouse-ear cress]
gb:AF499735_1806171 Glycine max clone Gm-c1025-1209 cultivar Wil...   209   1e-52   
gb:AB042629_1519902 Triticum aestivum CYP71C8v2 mRNA for P450, c...   209   1e-52   
gb:AC134237_1741676 Oryza sativa (japonica cultivar-group) chrom...   208   2e-52   
gb:ZMCYP71C3_1731818 Z.mays CYP71C3 mRNA for cytochrome P-450.        208   2e-52   
pir|T03260|T03260 cytochrome P450 - maize (fragment)                  208   2e-52   Zea mays [maize]
sp|P93530|C7D6_SOLCH|C7D6_SOLCH Cytochrome P450 71D6 (EC 1.14.-.-).>pir|T10...   208   2e-52   Solanum chacoense
sp|P93703|C7C3_MAIZE|C7C3_MAIZE Cytochrome P450 71C3 (EC 1.14.-.-).>pir|T03...   208   2e-52   Zea mays [maize]
gb:AP004000_1836147 Oryza sativa (japonica cultivar-group) genom...   208   3e-52   
gb:AF426451_1799114 Citrus sinensis cytochrome P450 mRNA, partia...   208   3e-52   
sp|P58050|C72D_ARATH|C72D_ARATH Cytochrome P450 71B13 (EC 1.14.-.-).             208   3e-52   Arabidopsis thaliana [mouse-ear cress]
gb:AP004000_1836143 Oryza sativa (japonica cultivar-group) genom...   207   7e-52   
gb:STU296346_1723032 Solanum tuberosum mRNA for cytochrome P450 ...   207   7e-52   
sp|P93531|C7D7_SOLCH|C7D7_SOLCH Cytochrome P450 71D7 (EC 1.14.-.-).>pir|T10...   207   7e-52   Solanum chacoense
gb:AF123603_1769933 Triticum aestivum clone CYP71C3-TA cytochrom...   206   9e-52   
sp|Q9SAE1|C72R_ARATH|C72R_ARATH Cytochrome P450 71B27 (EC 1.14.-.-).             205   2e-51   Arabidopsis thaliana [mouse-ear cress]
gb:AP003434_1829312 Oryza sativa (japonica cultivar-group) genom...   205   3e-51   
gb:AB024024_1515696 Arabidopsis thaliana genomic DNA, chromosome...   205   3e-51   
gb:AF123602_1769932 Triticum aestivum clone CYP71C2-21TA cytochr...   204   3e-51   
sp|Q9ZU07|C72C_ARATH|C72C_ARATH Cytochrome P450 71B12 (EC 1.14.-.-).>gb:AC0...   204   3e-51   
sp|O65787|C726_ARATH|C726_ARATH Cytochrome P450 71B6 (EC 1.14.-.-).>pir|T52...   204   3e-51   
gb:AC084319_1733501 Oryza sativa chromosome 3 BAC OSJNBa0004B24 ...   204   4e-51   
pir|F96774|F96774 probable cytochrome P450 F1M20.23 [imported] -...   204   4e-51   
sp|Q9STK9|C71O_ARATH|C71O_ARATH Cytochrome P450 71A24 (EC 1.14.-.-).             204   4e-51   
gb:AY462230_1607543 Hordeum lechleri Bx5-like protein mRNA, comp...   204   6e-51   
pir|G96541|G96541 probable cytochrome P450 [imported] - Arabidop...   204   6e-51   
sp|O64635|C7C4_ARATH|C7C4_ARATH Cytochrome P450 76C4 (EC 1.14.-.-).>pir|T00...   204   6e-51   
sp|Q9SAE3|C72S_ARATH|C72S_ARATH Cytochrome P450 71B28 (EC 1.14.-.-).>pir|A8...   203   8e-51   
sp|O65785|C723_ARATH|C723_ARATH Cytochrome P450 71B3 (EC 1.14.-.-).>gb:AB02...   203   8e-51   
gb:PHPET1_1700155 P.hybrida mRNA for P450 hydroxylase.                203   1e-50   
gb:AY087432_1572463 Arabidopsis thaliana clone 35385 mRNA, compl...   203   1e-50   
pir|S32110|S32110 cytochrome P450 PET-1 - garden petunia (fragment)   203   1e-50   
sp|P58045|C71E_ARATH|C71E_ARATH Cytochrome P450 71A14 (EC 1.14.-.-).             202   1e-50   
gb:AY062672_1565328 Arabidopsis thaliana cytochrome P450 (At3g26...   202   2e-50   
pir|T52170|T52170 cytochrome P450 monooxygenase [imported] - Ara...   202   2e-50   
gb:AY834390_1630334 Manihot esculenta N-hydroxylating cytochrome...   202   2e-50   
pir|T05735|T05735 cytochrome P450 71A10 - soybean>gb:AF022157_17...   202   2e-50   
gb:AP003571_1831049 Oryza sativa (japonica cultivar-group) genom...   201   3e-50   
gb:OSJN00047_1693825 Oryza sativa genomic DNA, chromosome 4, BAC...   201   3e-50   
gb:AF140614_1771559 Manihot esculenta N-hydroxylating cytochrome...   201   4e-50   
gb:BT006472_1639359 Arabidopsis thaliana At3g20130 gene, complet...   201   4e-50   
gb:AB042628_1519901 Triticum aestivum CYP71C7v2 mRNA for P450, c...   201   4e-50   
sp|Q9T0K0|C71J_ARATH|C71J_ARATH Cytochrome P450 71A19 (EC 1.14.-.-).>pir|T0...   201   4e-50   
gb:AB017064_1513350 Arabidopsis thaliana genomic DNA, chromosome...   201   5e-50   
gb:AP003909_1835056 Oryza sativa (japonica cultivar-group) genom...   200   6e-50   
pir|E96774|E96774 probable cytochrome P450 F1M20.22 [imported] -...   200   6e-50   
sp|Q96514|C727_ARATH|C727_ARATH Cytochrome P450 71B7 (EC 1.14.-.-).>pir|T52...   200   6e-50   
sp|Q9T0K2|C71K_ARATH|C71K_ARATH Cytochrome P450 71A20 (EC 1.14.-.-).>pir|T0...   200   6e-50   
gb:ALY295586_1819129 Arabidopsis lyrata subsp. petraea partial f...   200   8e-50   
gb:AF532999_1809452 Pisum sativum isoflavone synthase (CYP93C18)...   200   8e-50   
sp|Q9LTM4|C72J_ARATH|C72J_ARATH Cytochrome P450 71B19 (EC 1.14.-.-).>gb:AB0...   200   8e-50   
sp|P58051|C72E_ARATH|C72E_ARATH Cytochrome P450 71B14 (EC 1.14.-.-).             200   8e-50   
gb:AP004346_1840586 Oryza sativa (japonica cultivar-group) genom...   199   1e-49   
gb:AP002968_1823977 Oryza sativa (japonica cultivar-group) genom...   199   1e-49   
gb:AF140613_1771558 Manihot esculenta N-hydroxylating cytochrome...   199   1e-49   
gb:AP003523_1830355 Oryza sativa (japonica cultivar-group) genom...   199   1e-49   
gb:AY086620_1571666 Arabidopsis thaliana clone 262802 mRNA, comp...   199   1e-49   
gb:AP003990_1836005 Oryza sativa (japonica cultivar-group) genom...   199   2e-49   
gb:AF321858_1786038 Lolium rigidum clone BXH putative cytochrome...   198   2e-49   
gb:AF166332_1774015 Nicotiana tabacum cytochrome P450 gene, comp...   198   2e-49   
gb:BT010585_1640531 Arabidopsis thaliana At4g37400 gene, complet...   198   2e-49   
gb:AY062168_1564987 Musa acuminata cytochrome P450-1 mRNA, compl...   198   2e-49   
gb:AB023636_1515629 Glycyrrhiza echinata CYP Ge-8 mRNA for cytoc...   198   2e-49   
gb:AX028840_1457181 Sequence 24 from Patent WO9732023.                198   2e-49   
gb:AY217351_1590137 Manihot esculenta cytochrome P450 protein CY...   197   4e-49   
gb:AY088555_1573572 Arabidopsis thaliana clone 781 mRNA, complet...   197   4e-49   
sp|P49264|C7B1_THLAR|C7B1_THLAR Cytochrome P450 71B1 (EC 1.14.-.-) (CYPLXXI...   197   4e-49   
sp|Q9LTL8|C72O_ARATH|C72O_ARATH Cytochrome P450 71B24 (EC 1.14.-.-).>gb:AB0...   197   7e-49   
sp|O22307|C7DB_LOTJA|C7DB_LOTJA Cytochrome P450 71D11 (EC 1.14.-.-) (Fragme...   196   9e-49   
gb:AF195800_1775904 Medicago sativa isoflavone synthase 1 (ifs1)...   196   1e-48   
gb:AY834391_1630335 Manihot esculenta N-hydroxylating cytochrome...   196   1e-48   
sp|Q9LTM1|C72M_ARATH|C72M_ARATH Cytochrome P450 71B22 (EC 1.14.-.-).>gb:AB0...   196   1e-48   
gb:AJ585991_1811752 Triticum aestivum partial mRNA for cytochrom...   196   2e-48   
gb:BT006102_1638996 Arabidopsis thaliana clone U51190 putative c...   196   2e-48   
gb:AB010697_1511192 Arabidopsis thaliana genomic DNA, chromosome...   196   2e-48   
sp|Q9LXM3|C72Z_ARATH|C72Z_ARATH Cytochrome P450 71B38 (EC 1.14.-.-).             196   2e-48   
gb:AX028842_1457182 Sequence 26 from Patent WO9732023.                195   2e-48   
sp|O81345|C79B_SINAL|C79B_SINAL Cytochrome P450 79B1 (EC 1.14.-.-).>gb:AF06...   195   2e-48   
gb:AP006069_1860901 Oryza sativa (japonica cultivar-group) genom...   195   3e-48   
gb:AP003434_1829313 Oryza sativa (japonica cultivar-group) genom...   195   3e-48   
gb:AF195817_1775921 Beta vulgaris isoflavone synthase 2 (ifs2) m...   195   3e-48   
pir|B84514|B84514 probable cytochrome P450 [imported] - Arabidop...   195   3e-48   
pir|T49141|T49141 cytochrome P450-like protein - Arabidopsis tha...   195   3e-48   
sp|O48958|C7E1_SORBI|C7E1_SORBI Cytochrome P450 71E1 (EC 1.14.13.68) (4-hyd...   195   3e-48   
gb:AP003909_1835063 Oryza sativa (japonica cultivar-group) genom...   194   4e-48   
gb:AJ585990_1811751 Triticum aestivum partial mRNA for cytochrom...   194   4e-48   
gb:AJ585988_1811749 Triticum aestivum partial mRNA for cytochrom...   194   4e-48   
gb:AP003990_1836009 Oryza sativa (japonica cultivar-group) genom...   194   5e-48   
gb:AB024931_1516049 Lotus corniculatus var. japonicus mRNA for c...   194   5e-48   
gb:AF195818_1775922 Glycine max isoflavone synthase 1 (ifs1) gen...   194   6e-48   
gb:AF195798_1775902 Glycine max isoflavone synthase 1 (ifs1) mRN...   194   6e-48   
gb:OSJN00136_1695482 Oryza sativa genomic DNA, chromosome 4, BAC...   194   6e-48   
pir|T48142|T48142 cytochrome P450 homolog T4C9.160 [similarity] ...   194   6e-48   
gb:AF453287_1800897 Brassica napus cytochrome P450 (CYP79B5) mRN...   193   8e-48   
sp|Q9LTM3|C72K_ARATH|C72K_ARATH Cytochrome P450 71B20 (EC 1.14.-.-).>gb:AB0...   193   8e-48   
pir|T48143|T48143 flavonoid 3',5'-hydroxylase homolog T4C9.170 [...   193   1e-47   
gb:AF462633_1801912 Pueraria montana var. lobata isoflavone synt...   192   1e-47   
gb:AC135564_1742594 Oryza sativa chromosome 3 BAC OSJNBb0056O10 ...   192   1e-47   
gb:AY596975_1617026 Centaurium erythraea clone 1 cytochrome P450...   192   1e-47   
gb:AE016959_1021110 Oryza sativa (japonica cultivar-group) chrom...   192   1e-47   
pir|G86460|G86460 probable cytochrome P450 [imported] - Arabidop...   192   1e-47   
sp|O81346|C79B_ARATH|C79B_ARATH Cytochrome P450 79B2 (EC 1.14.-.-).>pir|T06...   192   1e-47   
gb:AP003523_1830359 Oryza sativa (japonica cultivar-group) genom...   192   2e-47   
gb:AF428409_1799339 Arabidopsis thaliana AT3g26180/MTC11_8 mRNA,...   192   2e-47   
gb:AF195810_1775914 Trifolium pratense isoflavone synthase 1 (if...   192   2e-47   
gb:CAR243804_1645171 Cicer arietinum mRNA for cytochrome P450 (c...   192   2e-47   
sp|O65784|C725_ARATH|C725_ARATH Cytochrome P450 71B5 (EC 1.14.-.-).>pir|T46...   192   2e-47   
gb:AF332974_1787297 Gossypium arboreum P450 monooxygenase mRNA, ...   192   2e-47   
gb:AF195815_1775919 Trifolium repens isoflavone synthase 2 (ifs2...   192   2e-47   
gb:AF195808_1775912 Vigna radiata isoflavone synthase 3 (ifs3) m...   192   2e-47   
gb:AF195802_1775906 Medicago sativa isoflavone synthase 3 (ifs3)...   192   2e-47   
gb:HVU495774_1682727 Hordeum vulgare partial mRNA for putative c...   192   2e-47   
gb:AY462228_1607541 Hordeum lechleri Bx3-like protein mRNA, comp...   192   2e-47   
pir|F86460|F86460 probable cytochrome P450 [imported] - Arabidop...   192   2e-47   
sp|Q9SAE4|C72T_ARATH|C72T_ARATH Cytochrome P450 71B29 (EC 1.14.-.-).>pir|B8...   192   2e-47   
gb:AF195813_1775917 Lupinus albus isoflavone synthase 1 (ifs1) m...   191   3e-47   
gb:AF195807_1775911 Vigna radiata isoflavone synthase 2 (ifs2) m...   191   3e-47   
gb:AF135484_1771084 Glycine max cytochrome P450 monooxygenase CY...   191   3e-47   
gb:AC120537_1739927 Oryza sativa chromosome 3 BAC OSJNBb0042N11 ...   191   3e-47   
gb:BT002260_1635863 Arabidopsis thaliana At5g44620/K15C23_6 mRNA...   191   3e-47   
sp|O64900|C8B2_ESCCA|C8B2_ESCCA (S)-N-methylcoclaurine 3'-hydroxylase isozy...   191   3e-47   
gb:AF195816_1775920 Beta vulgaris isoflavone synthase 1 (ifs1) m...   191   4e-47   
gb:AP005308_1850270 Oryza sativa (japonica cultivar-group) genom...   191   5e-47   
gb:AF195812_1775916 Pisum sativum isoflavone synthase 1 (ifs1) m...   191   5e-47   
gb:AF195809_1775913 Vigna radiata isoflavone synthase 4 (ifs4) m...   191   5e-47   
pir|T50525|T50525 cytochrome P450 monooxygenase-like protein - A...   191   5e-47   
gb:AC120537_1739920 Oryza sativa chromosome 3 BAC OSJNBb0042N11 ...   190   7e-47   
gb:AY281025_1594663 Mentha x gracilis limonene-6-hydroxylase mRN...   190   7e-47   
gb:OSJN00145_1190851 Oryza sativa (japonica cultivar-group) chro...   190   7e-47   
gb:AE016959_1021114 Oryza sativa (japonica cultivar-group) chrom...   190   7e-47   
pir|T06713|T06713 probable cytochrome P450 T29H11.190 - Arabidop...   190   7e-47   
sp|Q9LW27|C72F_ARATH|C72F_ARATH Cytochrome P450 71B15 (EC 1.14.-.-).>gb:AB0...   190   7e-47   
gb:AF499728_1806164 Glycine max cultivar Harosoy gray pubescence...   190   9e-47   
gb:AF195814_1775918 Trifolium repens isoflavone synthase 1 (ifs1...   189   1e-46   
gb:AF195806_1775910 Vigna radiata isoflavone synthase 1 (ifs1) m...   189   1e-46   
gb:AB042630_1519903 Triticum aestivum CYP71C9v1 mRNA for P450, c...   189   1e-46   
pir|T07960|T07960 probable (S)-N-methylcoclaurine 3'-hydroxylase...   189   1e-46   
sp|O64899|C8B1_ESCCA|C8B1_ESCCA (S)-N-methylcoclaurine 3'-hydroxylase isozy...   189   1e-46   
sp|Q9FLC8|C792_ARATH|C792_ARATH Cytochrome P450 79A2 (EC 1.-.-.-).>gb:AB010...   189   1e-46   
gb:AP003434_1829310 Oryza sativa (japonica cultivar-group) genom...   189   1e-46   
gb:AC109595_1738719 Oryza sativa (japonica cultivar-group) chrom...   189   1e-46   
gb:AY192574_1588680 Catharanthus roseus cytochrome P450 71D2 (CY...   189   1e-46   
pir|C85169|C85169 cytochrome P450 like protein [imported] - Arab...   189   1e-46   
sp|O81974|C7D8_SOYBN|C7D8_SOYBN Cytochrome P450 71D8 (EC 1.14.-.-) (P450 CP...   189   1e-46   
sp|O65012|CP78_PINRA|CP78_PINRA Cytochrome P450 78A4 (EC 1.14.-.-).>pir|T08...   189   2e-46   
gb:AP000383_1819907 Arabidopsis thaliana genomic DNA, chromosome...   188   3e-46   
gb:AF195805_1775909 Lens culinaris isoflavone synthase 2 (ifs2) ...   188   3e-46   
gb:CRO238612_1673464 Catharanthus roseus mRNA for cytochrome P450.    188   3e-46   
gb:AY462227_1607540 Hordeum lechleri Bx2-like protein mRNA, comp...   188   3e-46   
sp|O23976|C76B_HELTU|C76B_HELTU Cytochrome P450 76B1 (EC 1.14.-.-) (7-ethox...   188   3e-46   
sp|Q9FH66|C71G_ARATH|C71G_ARATH Cytochrome P450 71A16 (EC 1.14.-.-).>gb:AB0...   188   3e-46   
gb:AP005114_1848113 Oryza sativa (japonica cultivar-group) genom...   188   3e-46   
gb:AK118875_1816829 Arabidopsis thaliana At2g30750 mRNA for puta...   188   3e-46   
gb:AF406732_1796912 Euphorbia lagascae cytochrome P450 (CYP726A1...   188   3e-46   
gb:AF245302_1780461 Arabidopsis thaliana cytochrome P450 CYP79A2...   188   3e-46   
gb:AF195801_1775905 Medicago sativa isoflavone synthase 2 (ifs2)...   188   3e-46   
gb:AF139532_1771438 Liquidambar styraciflua aldehyde 5-hydroxyla...   188   3e-46   
gb:CRO251269_1673471 Catharanthus roseus mRNA for geraniol 10-hy...   188   3e-46   
gb:AY167424_1586245 Medicago truncatula putative isoflavone synt...   188   3e-46   
gb:AY062167_1564986 Musa acuminata cytochrome P450-3 mRNA, parti...   188   3e-46   
pir|D84611|D84611 probable cytochrome P450 [imported] - Arabidop...   188   3e-46   
gb:AF195803_1775907 Vicia villosa isoflavone synthase 1 (ifs1) m...   187   4e-46   
sp|P37122|C762_SOLME|C762_SOLME Cytochrome P450 76A2 (EC 1.14.-.-) (CYPLXXV...   187   4e-46   
sp|P58048|C728_ARATH|C728_ARATH Cytochrome P450 71B8 (EC 1.14.-.-).              187   4e-46   
gb:AF191772_1775494 Papaver somniferum (S)-N-methylcoclaurine 3'...   187   6e-46   
gb:AB113663_1527266 Iris hollandica IhCYP-1 mRNA for cytochrome ...   187   6e-46   
gb:AB042631_1519904 Triticum aestivum CYP71C9v2 mRNA for P450, c...   187   6e-46   
pir|A71418|A71418 cytochrome P450 d13725w - Arabidopsis thaliana...   187   6e-46   
gb:AF488521_1804420 Oryza sativa Cyt-P450 monooxygenase (PM-I) m...   187   7e-46   
pir|H71417|H71417 cytochrome P450 - Arabidopsis thaliana              187   7e-46   
gb:AP003523_1830363 Oryza sativa (japonica cultivar-group) genom...   186   1e-45   
gb:AE016959_1021169 Oryza sativa (japonica cultivar-group) chrom...   186   1e-45   
pir|T04734|T04734 cytochrome P450 homolog F6G17.50 - Arabidopsis...   186   1e-45   
gb:CAR249800_1645175 Cicer arietinum partial mRNA for cytochrome...   186   1e-45   
pir|T05944|T05944 cytochrome P450 93C1p - soybean>gb:AF022462_17...   186   1e-45   
gb:AF195804_1775908 Lens culinaris isoflavone synthase 1 (ifs1) ...   186   2e-45   
gb:AP000383_1819901 Arabidopsis thaliana genomic DNA, chromosome...   185   2e-45   
gb:AY085356_1570427 Arabidopsis thaliana clone 147792 mRNA, comp...   185   2e-45   
gb:AP003522_1830333 Oryza sativa (japonica cultivar-group) genom...   185   3e-45   
gb:AF368376_1791919 Nicotiana tabacum elicitor-inducible cytochr...   185   3e-45   
gb:HTCYP76B1_1682162 H.tuberosus mRNA for 7-ethoxycoumarin O-dee...   185   3e-45   
pir|T10895|T10895 cytochrome P450 76B1, xenobiotic-inducible - J...   185   3e-45   
gb:AY622319_1618384 Mentha spicata limonene-3-hydroxylase (lim3h...   184   4e-45   
gb:AF134590_1771026 Papaver somniferum (S)-N-methylcoclaurine 3'...   184   5e-45   
gb:VVI237995_1727512 Vitis vinifera mRNA for putative ripening-r...   184   6e-45   
gb:AY090446_1574135 Arabidopsis thaliana AT3g20080/MAL21_9 mRNA,...   184   6e-45   
pir|E86249|E86249 hypothetical protein [imported] - Arabidopsis ...   184   6e-45   
gb:AF488522_1804421 Oryza sativa Cyt-P450 monooxygenase (PM-II) ...   183   8e-45   
gb:OSJN00047_1693824 Oryza sativa genomic DNA, chromosome 4, BAC...   183   8e-45   
gb:AY281027_1594665 Mentha x gracilis limonene-3-hydroxylase mRN...   183   8e-45   
gb:AF124816_1770302 Mentha x piperita cytochrome p450 isoform PM...   183   1e-44   
gb:AE016959_1022777 Oryza sativa (japonica cultivar-group) chrom...   182   1e-44   
sp|O65438|C71R_ARATH|C71R_ARATH Cytochrome P450 71A27 (EC 1.14.-.-).             182   1e-44   
gb:AP004757_1844510 Oryza sativa (japonica cultivar-group) genom...   182   2e-44   
gb:AP000383_1819904 Arabidopsis thaliana genomic DNA, chromosome...   182   2e-44   
sp|Q42797|TCMO_SOYBN|TCMO_SOYBN Trans-cinnamate 4-monooxygenase (EC 1.14.13...   182   2e-44   
sp|Q9LTM6|C72H_ARATH|C72H_ARATH Cytochrome P450 71B17 (EC 1.14.-.-).>gb:AB0...   182   2e-44   
gb:AY596979_1617030 Centaurium erythraea clone 2 cytochrome P450...   182   2e-44   
pir|S38535|S38535 cytochrome P450 76A1 - eggplant (fragment)          182   2e-44   
sp|P37121|C761_SOLME|C761_SOLME Cytochrome P450 76A1 (EC 1.14.-.-) (CYPLXXV...   182   2e-44   
gb:AJ582893_1811314 Arabidopsis halleri subsp. halleri partial f...   181   4e-44   
gb:AF124817_1770303 Mentha x piperita cytochrome p450 isoform PM...   181   4e-44   
gb:AY485941_1608515 Thinopyrum ponticum P450 mRNA, complete cds.      181   4e-44   
gb:AP003909_1835062 Oryza sativa (japonica cultivar-group) genom...   181   5e-44   
gb:AE016959_1021094 Oryza sativa (japonica cultivar-group) chrom...   181   5e-44   
gb:AJ582904_1811325 Arabidopsis lyrata subsp. petraea partial fa...   180   7e-44   
gb:AJ582907_1811328 Arabidopsis lyrata subsp. petraea partial fa...   180   9e-44   
gb:AJ582903_1811324 Arabidopsis lyrata subsp. petraea partial fa...   180   9e-44   
gb:AJ582902_1811323 Arabidopsis lyrata subsp. petraea partial fa...   180   9e-44   
gb:AJ582908_1811329 Arabidopsis lyrata subsp. petraea partial fa...   179   1e-43   
gb:AF368377_1791920 Nicotiana tabacum elicitor-inducible cytochr...   179   1e-43   
gb:AY485936_1608510 Triticum aestivum P450 gene, complete cds.        179   1e-43   
gb:AY462229_1607542 Hordeum lechleri Bx4-like protein mRNA, comp...   179   1e-43   
gb:AY485940_1608514 Triticum aestivum P450 mRNA, complete cds.        179   2e-43   
sp|Q9LTM2|C72L_ARATH|C72L_ARATH Cytochrome P450 71B21 (EC 1.14.-.-).>gb:AB0...   179   2e-43   
gb:AP001304_1821063 Arabidopsis thaliana genomic DNA, chromosome...   179   2e-43   
gb:AY485939_1608513 Triticum aestivum P450 mRNA, complete cds.        179   2e-43   
gb:AJ582909_1811330 Arabidopsis lyrata subsp. petraea partial fa...   178   3e-43   
gb:AY253284_1592984 Trifolium pratense isoflavone synthase gene,...   178   3e-43   
sp|Q9SCN2|C72U_ARATH|C72U_ARATH Cytochrome P450 71B31 (EC 1.14.-.-).>pir|T4...   178   3e-43   
gb:AJ582901_1811322 Arabidopsis lyrata subsp. petraea partial fa...   178   3e-43   
gb:AC002409_1530707 Arabidopsis thaliana chromosome 2 clone T20B...   178   3e-43   
pir|S68203|S68203 tyrosine N-monooxygenase (EC 1.14.13.41) cytoc...   178   3e-43   
sp|Q43135|C791_SORBI|C791_SORBI Cytochrome P450 79A1 (EC 1.14.13.41) (Tyros...   178   3e-43   
gb:AP001304_1821062 Arabidopsis thaliana genomic DNA, chromosome...   177   4e-43   
gb:AY281026_1594664 Mentha x gracilis cytochrome P450 mRNA, comp...   177   4e-43   
gb:AY056284_1563598 Arabidopsis thaliana putative cytochrome P45...   177   4e-43   
gb:AY056105_1563442 Arabidopsis thaliana At2g40890/T20B5.9 mRNA,...   177   4e-43   
gb:AB055507_1521485 Lithospermum erythrorhizon C4H-1 mRNA for ci...   177   4e-43   
pir|T05332|T05332 probable cytochrome P450 F1C12.160 - Arabidops...   177   4e-43   
sp|Q96423|TCMO_GLYEC|TCMO_GLYEC Trans-cinnamate 4-monooxygenase (EC 1.14.13...   177   4e-43   
gb:AP003254_1826403 Oryza sativa (japonica cultivar-group) genom...   177   6e-43   
gb:AF140610_1771557 Triglochin maritima cytochrome P450 CYP79E2 ...   177   6e-43   
gb:AY050415_1562192 Arabidopsis thaliana AT3g20100/MAL21_14 mRNA...   177   6e-43   
pir|T03259|T03259 cytochrome P450 - maize>gb:ZMCYP71C1_1731816 Z...   177   6e-43   
gb:AY504997_1609836 Triticum aestivum P450 gene, complete cds.        177   8e-43   
sp|Q43250|C7C1_MAIZE|C7C1_MAIZE Cytochrome P450 71C1 (EC 1.14.-.-).>pir|T03...   177   8e-43   
gb:AF140609_1771556 Triglochin maritima cytochrome P450 CYP79E1 ...   176   1e-42   
gb:AB042627_1519900 Triticum aestivum CYP71C6v1 mRNA for P450, c...   176   1e-42   


>gb:AB015762_1512729 Nicotiana tabacum CYP82E1 mRNA for cytochrome
            P450, complete cds.>gb:AF368381_1791924 Nicotiana tabacum
            elicitor-inducible cytochrome P450 (CYP82E1) mRNA,
            complete cds.
          Length = 519

 Score =  446 bits (1148), Expect = e-124
 Identities = 233/529 (44%), Positives = 334/529 (63%), Gaps = 17/529 (3%)
 Frame = +2

Query: 50   LSSILGIAALV----LLWFSW-RKQSK---RLPPEAGGAWPIIGHLHHFRTSVP----LV 193
            LS I  I  LV    LL+  W +KQSK    LPP+  G WP+IGHL +F  +        
Sbjct: 5    LSPIEAIVGLVTFAFLLYLLWTKKQSKILNPLPPKIPGGWPVIGHLFYFNNNGDDDRHFS 64

Query: 194  KTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYA 373
            + L + ADKYGPVFT RLG  R L VSS+EA+++CF+TND   A RP    G+YL Y+ A
Sbjct: 65   QKLGDLADKYGPVFTFRLGFRRFLAVSSYEAMKECFSTNDIHFADRPALLYGEYLCYNNA 124

Query: 374  VFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAP 553
            +   +    YW++ RKLV +E+LS  RLEK KHV  S +Q NIK+LY      N +    
Sbjct: 125  MLAVAKYGPYWKKNRKLVNQELLSVSRLEKFKHVRFSIVQKNIKQLY------NCDSPMV 178

Query: 554  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI 733
            K+N+S W   LT ++I+++V G+ Y        N   + LK  F + M    E    D +
Sbjct: 179  KINLSDWIDKLTFDIILKMVVGKTYN-------NGHGEILKAAFQKFMVQAMEIELYD-V 230

Query: 734  FPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE-----DQKFIDVMLSM 898
            F + FF+WLD  G++K MK+  KD+D I+Q W+D   K+R + +     +Q FIDV+LS 
Sbjct: 231  FHIPFFKWLDLTGNIKAMKQTFKDIDNIIQGWLDEHIKKRETKDVGGENEQDFIDVLLSK 290

Query: 899  IDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTN 1078
              ++   G  YS DT IKA V +++ DA++T A H+ W++A+++ +   +K+ Q+E+DT 
Sbjct: 291  RSNEHL-GDGYSHDTTIKATVFTLVLDATDTLALHIKWVMALMINNKNVMKKAQEEMDTI 349

Query: 1079 IGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVN 1258
            +G++RW E++D+KNL YLQ +VKE LR++P  P    H +V+DC+V+GYHIPKGT L  N
Sbjct: 350  VGRDRWVEENDIKNLVYLQAIVKEVLRLHPPAPLSVQHLSVKDCVVNGYHIPKGTALLTN 409

Query: 1259 VWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV 1438
            + +L RDP+IW DP+ F PERF+T       + + Y+ +PFG GRR+CP   Y+ Q+  +
Sbjct: 410  IMKLQRDPQIWVDPDTFDPERFLTTNAAIDYRGQHYELIPFGSGRRACPAMNYSLQVEHL 469

Query: 1439 AVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR 1585
            ++A L QGFNF+T  NEPLDM + VG+ LPK T +EVL+TPRL PTL++
Sbjct: 470  SIAHLIQGFNFATTTNEPLDMKQGVGLTLPKKTDVEVLITPRLPPTLYQ 518



>pir|T04651|T04651 cytochrome P450 F10N7.250 - Arabidopsis
            thaliana>gb:ATCHRIV76_1547115 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 76.>gb:ATF10N7_1548231
            Arabidopsis thaliana DNA chromosome 4, BAC clone F10N7
            (ESSA project).
          Length = 524

 Score =  434 bits (1115), Expect = e-120
 Identities = 223/524 (42%), Positives = 336/524 (64%), Gaps = 17/524 (3%)
 Frame = +2

Query: 62   LGIAALVLLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYG 226
            L +  LV ++ +  K+SK+      P   GAWPIIGHLH       L+ +TL + AD YG
Sbjct: 8    LFVPILVFVFIALFKKSKKPKYVKAPAPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYG 67

Query: 227  PVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYW 406
            P  +++LG +   VVSS+E  +DCF  NDK LA+RP T A K++GY++AVF F+  +++W
Sbjct: 68   PAMSLQLGSNEAFVVSSFEVAKDCFTVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFW 127

Query: 407  RRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHL 586
            R +RK+   E+LS+RRL+ LKHV VSE+   +K+LY+ +   N       V++  W   +
Sbjct: 128  REMRKIATIELLSNRRLQMLKHVRVSEITMGVKDLYS-LWFKNGGTKPVMVDLKSWLEDM 186

Query: 587  TLNLIMQIVAGRRYEYRSDGTIN----EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR 754
            TLN+I+++VAG+RY +   G+++    EEA + KK  ++  +L G F   DA   L FF 
Sbjct: 187  TLNMIVRMVAGKRY-FGGGGSVSSEDTEEAMQCKKAIAKFFHLIGIFTVSDAFPTLSFF- 244

Query: 755  WLDYEGHVKTMKRAAKDVDAILQDWVDARRKERR----SNEDQKFIDVMLSMIDDQFTQG 922
              D +GH K MK+   ++D IL+ W++  R++R+       D  FIDVM+S+ +      
Sbjct: 245  --DLQGHEKEMKQTGSELDVILERWIENHRQQRKFSGTKENDSDFIDVMMSLAEQGKLSH 302

Query: 923  YSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAE 1102
              Y  +T IK+  L+++   S+T A+ LTW +++LL + E LK+ QDEID ++G++R  E
Sbjct: 303  LQYDANTSIKSTCLALILGGSDTSASTLTWAISLLLNNKEMLKKAQDEIDIHVGRDRNVE 362

Query: 1103 DSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDP 1282
            DSD++NL YLQ ++KETLR+YP GP L P EA+EDC V GY++P GT+L VNVW++ RDP
Sbjct: 363  DSDIENLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYYVPCGTRLIVNVWKIQRDP 422

Query: 1283 KIWPDPEKFLPERFMTNLEGEA----AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVAR 1450
            K++ +P +F PERF+T   GEA     + + ++ +PFG GRRSCPG+  A Q+  + +AR
Sbjct: 423  KVYMEPNEFRPERFIT---GEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLAR 479

Query: 1451 LFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
                F+  TV + P+DM E+ G+ +PK TPLEVL++PR+   LF
Sbjct: 480  FLHSFDVKTVMDMPVDMSENPGLTIPKATPLEVLISPRIKEELF 523



>pir|T05942|T05942 cytochrome P450 82C1 - soybean>gb:AF022461_1761996
            Glycine max cytochrome P450 monooxygenase CYP82C1p
            (CYP82C1) mRNA, complete cds.
          Length = 532

 Score =  432 bits (1112), Expect = e-120
 Identities = 217/493 (44%), Positives = 312/493 (63%), Gaps = 7/493 (1%)
 Frame = +2

Query: 125  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFA 304
            P+AGGAWPIIGHLH F       KTL   A+K+GP+FTI+LG  ++LV+SSWE  ++CF 
Sbjct: 43   PQAGGAWPIIGHLHLFGGHQHTHKTLGIMAEKHGPIFTIKLGSYKVLVLSSWEMAKECFT 102

Query: 305  TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVS 484
             +DK  + RP   A K +GY+YA+F F+    YWR +RKL   ++LS+ RLE LK+   S
Sbjct: 103  VHDKAFSTRPCVAASKLMGYNYAMFGFTPYGPYWREIRKLTTIQLLSNHRLELLKNTRTS 162

Query: 485  ELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGR-RYEYRSDGTINEE 661
            E +  I+ELY   S +        V+M +WFG LT N+++++V G+  Y+  SD     E
Sbjct: 163  ESEVAIRELYKLWSREGCPKGGVLVDMKQWFGDLTHNIVLRMVRGKPYYDGASDDYAEGE 222

Query: 662  AQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR 841
            A+R KKV  + + L+G FV  DAI    F  WLD  G+ K MKR A ++D +++ W++  
Sbjct: 223  ARRYKKVMGECVSLFGVFVLSDAI---PFLGWLDINGYEKAMKRTASELDPLVEGWLEEH 279

Query: 842  RKERRSNEDQK-----FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHL 1006
            +++R  N D K     F+DVML+++ D    G  Y  DT+IKA  L+++   S+T    L
Sbjct: 280  KRKRAFNMDAKEEQDNFMDVMLNVLKDAEISG--YDSDTIIKATCLNLILAGSDTTMISL 337

Query: 1007 TWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLA 1186
            TW+L++LL H   LK+VQDE+DT IGK+R  E+SD+  L YLQ +VKET+R+YP  P + 
Sbjct: 338  TWVLSLLLNHQMELKKVQDELDTYIGKDRKVEESDITKLVYLQAIVKETMRLYPPSPLIT 397

Query: 1187 PHEAVEDCIVD-GYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQ 1363
               A+EDC    GYHIP GT+L VN W++HRD ++W DP  F P RF+T+ +    + + 
Sbjct: 398  LRAAMEDCTFSGGYHIPAGTRLMVNAWKIHRDGRVWSDPHDFKPGRFLTSHKDVDVKGQN 457

Query: 1364 YQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPL 1543
            Y+ VPFG GRR+CPG   A ++  + +ARL   FN ++  N+ +DM E +G+   K TPL
Sbjct: 458  YELVPFGSGRRACPGASLALRVVHLTMARLLHSFNVASPSNQVVDMTESIGLTNLKATPL 517

Query: 1544 EVLVTPRLSPTLF 1582
            E+L+TPRL   L+
Sbjct: 518  EILLTPRLDTKLY 530



>pir|T07964|T07964 (S)-N-methylcoclaurine 3'-hydroxylase (EC 1.1.3.-)
            - California poppy>gb:AF014802_1761357 Eschscholzia
            californica (S)-N-methylcoclaurine 3'-hydroxylase
            (CYP82B1) mRNA, complete cds.
          Length = 560

 Score =  416 bits (1069), Expect = e-115
 Identities = 226/552 (40%), Positives = 332/552 (60%), Gaps = 42/552 (7%)
 Frame = +2

Query: 53   SSILGIAALVLLWFSWRK---------QSKRLPPEAGGAWPIIGHLHHFRTS-VPLVKTL 202
            + ILG+ AL+   +   K         Q  + PPEA G+WPI+GHL     S  PL + L
Sbjct: 11   AGILGLLALICFLYYVIKVSLSTRNCNQLVKHPPEAAGSWPIVGHLPQLVGSGKPLFRVL 70

Query: 203  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT 382
             + ADK+GP+F +R G+   LVVS+WE  ++CF +NDK LA+RP + A  Y+ YD+A+F 
Sbjct: 71   GDMADKFGPIFMVRFGVYPTLVVSTWEMAKECFTSNDKFLASRPPSAASSYMTYDHAMFG 130

Query: 383  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPK-- 556
            FS    YWR +RK+    +LS RRLE LKHV  +E+   IK L+  I  D+     P   
Sbjct: 131  FSFYGPYWREIRKISTLHLLSHRRLELLKHVPHTEIHNFIKGLFG-IWKDHQKQQQPTGR 189

Query: 557  -------VNMSRWFGHLTLNLIMQIVAGRRY-EYRSDGTINE-----EAQRLKKVFSQVM 697
                   + MS+ FG+LTLN+++ +V G+R   Y +DG +++     + Q+L +  +   
Sbjct: 190  EDRDSVMLEMSQLFGYLTLNVVLSLVVGKRVCNYHADGHLDDGEEAGQGQKLHQTITDFF 249

Query: 698  YLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARR----------- 844
             L G  V+ DA+  L  F   D  G  ++MKR AK++D   + W+  ++           
Sbjct: 250  KLSGVSVASDALPLLGLF---DLGGKKESMKRVAKEMDFFAERWLQDKKLSLSLSSETNN 306

Query: 845  --KERRSNEDQKFIDVMLSMI-DDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWI 1015
               +    +   F+DV++S++ DD  +    YSRDTVIKA  LSM+  AS+T +  LTW 
Sbjct: 307  KQNDAGEGDGDDFMDVLMSILPDDDDSLFTKYSRDTVIKATSLSMVVAASDTTSVSLTWA 366

Query: 1016 LAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHE 1195
            L++LL + + L++ QDE+DT +G++R  E+ D+ NL YLQ +VKETLRMYP GP   PHE
Sbjct: 367  LSLLLNNIQVLRKAQDELDTKVGRDRHVEEKDIDNLVYLQAIVKETLRMYPAGPLSVPHE 426

Query: 1196 AVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA---QNRQY 1366
            A+EDC V GYHI  GT+L VN+W+L RDP++W +P +F PERF+ N         + + +
Sbjct: 427  AIEDCNVGGYHIKTGTRLLVNIWKLQRDPRVWSNPSEFRPERFLDNQSNGTLLDFRGQHF 486

Query: 1367 QFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLE 1546
            +++PFG GRR CPG  +AT I  + +ARL Q F+ ST  + P+DM E  G+ +PK+TPL+
Sbjct: 487  EYIPFGSGRRMCPGVNFATLILHMTLARLLQAFDLSTPSSSPVDMTEGSGLTMPKVTPLK 546

Query: 1547 VLVTPRLSPTLF 1582
            VL+TPRL   L+
Sbjct: 547  VLLTPRLPLPLY 558



>pir|T04648|T04648 cytochrome P450 F10N7.220 - Arabidopsis
            thaliana>gb:ATCHRIV76_1547118 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 76.>gb:ATF10N7_1548228
            Arabidopsis thaliana DNA chromosome 4, BAC clone F10N7
            (ESSA project).
          Length = 523

 Score =  416 bits (1068), Expect = e-114
 Identities = 214/524 (40%), Positives = 335/524 (63%), Gaps = 17/524 (3%)
 Frame = +2

Query: 62   LGIAALVLLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYG 226
            L +  LV ++ +  K+SK+      P   GAWPIIGHLH       L+ +TL + AD+YG
Sbjct: 8    LFVPILVFVFIALFKKSKKPKHVKAPAPSGAWPIIGHLHLLSGKEQLLYRTLGKMADQYG 67

Query: 227  PVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYW 406
            P  ++RLG S   VVSS+E  +DCF  NDK LA+RP T A K++GYD AVF F+  +++W
Sbjct: 68   PAMSLRLGSSETFVVSSFEVAKDCFTVNDKALASRPITAAAKHMGYDCAVFGFAPYSAFW 127

Query: 407  RRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHL 586
            R +RK+   E+LS+RRL+ LKHV VSE+   +++LY+ + +         V++  W   +
Sbjct: 128  REMRKIATLELLSNRRLQMLKHVRVSEISMVMQDLYS-LWVKKGGSEPVMVDLKSWLEDM 186

Query: 587  TLNLIMQIVAGRRYEYRSDGTIN----EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR 754
            +LN+++++VAG+RY     G+++    EEA++ +K  +   +L G F   DA FP     
Sbjct: 187  SLNMMVRMVAGKRYF--GGGSLSPEDAEEARQCRKGVANFFHLVGIFTVSDA-FPK--LG 241

Query: 755  WLDYEGHVKTMKRAAKDVDAILQDWVDARRKERR----SNEDQKFIDVMLSMIDDQFTQG 922
            W D++GH K MK+  +++D IL+ W++  R++R+     + D  F+DVMLS+ +      
Sbjct: 242  WFDFQGHEKEMKQTGRELDVILERWIENHRQQRKVSGTKHNDSDFVDVMLSLAEQGKFSH 301

Query: 923  YSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAE 1102
              +   T IK+  L+++   SET  + LTW +++LL + + LK+ QDEID ++G++R  E
Sbjct: 302  LQHDAITSIKSTCLALILGGSETSPSTLTWAISLLLNNKDMLKKAQDEIDIHVGRDRNVE 361

Query: 1103 DSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDP 1282
            DSD++NL Y+Q ++KETLR+YP GP L   EA+EDC V GY++ +GT++ VNVW++ RDP
Sbjct: 362  DSDIENLVYIQAIIKETLRLYPAGPLLGHREAIEDCTVAGYNVRRGTRMLVNVWKIQRDP 421

Query: 1283 KIWPDPEKFLPERFMTNLEGEA----AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVAR 1450
            +++ +P +F PERF+T   GEA     + + ++ +PFG GRRSCPG+  A Q+  + +AR
Sbjct: 422  RVYMEPNEFRPERFIT---GEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLAR 478

Query: 1451 LFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
              Q F+  TV + P+DM E  G+ +PK TPLE+L++PRL   L+
Sbjct: 479  FLQSFDVKTVMDMPVDMTESPGLTIPKATPLEILISPRLKEGLY 522



>gb:AY532373_1612056 Ammi majus cytochrome P450 (CYP82H1) mRNA,
            complete cds.
          Length = 530

 Score =  392 bits (1007), Expect = e-107
 Identities = 209/503 (41%), Positives = 310/503 (61%), Gaps = 8/503 (1%)
 Frame = +2

Query: 101  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW 280
            RK++   PPE  G WP+IGHLH    S  L   L + AD+YGP+F++ LGI++ +V++SW
Sbjct: 38   RKKTCSGPPEPAGRWPLIGHLHLLGGSKILHHILGDMADEYGPIFSLNLGINKTVVITSW 97

Query: 281  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE 460
            E  ++CF T D++ A RP +  G+ +GY+  V  F    +YWR +RKL + E+LS+RRL+
Sbjct: 98   EVAKECFTTQDRVFATRPKSVVGQVVGYNSRVMIFQQYGAYWREMRKLAIIELLSNRRLD 157

Query: 461  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS 640
             LKHV  SE+   IKELY   S  N N S   V M + FG LT N++++ VAG++Y    
Sbjct: 158  MLKHVRESEVNLFIKELYEQWSA-NGNGSKVVVEMMKRFGDLTTNIVVRTVAGKKYS--- 213

Query: 641  DGTI---NEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD-YEGHVKTMKRAAKDV 808
             GT    NEE+++ +K  ++ M+L G  +  DA+ PL    W+D  +G    MK+ A+++
Sbjct: 214  -GTGVHGNEESRQFQKAMAEFMHLGGLLMVSDAL-PL--LGWIDTVKGCKGKMKKTAEEI 269

Query: 809  DAILQDWVDARRKER----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQ 976
            D IL   +   +++R     ++ +  FI VMLS +D     G     DT IK   LS++ 
Sbjct: 270  DHILGSCLKEHQQKRTNISNNHSEDDFIYVMLSAMDGNQFPGID--TDTAIKGTCLSLIL 327

Query: 977  DASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETL 1156
               +T +  L W L++LL +   LK+ QDE+D  +G++R  ++SDVKNL YLQ +VKETL
Sbjct: 328  GGYDTTSATLMWALSLLLNNRHVLKKAQDEMDQYVGRDRQVKESDVKNLTYLQAIVKETL 387

Query: 1157 RMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNL 1336
            R+YP  P    H+A+ DC V G++IP GT+L VN+W++HRDPK+W DP +F PERF+   
Sbjct: 388  RLYPAAPLSVQHKAMADCTVAGFNIPAGTRLVVNLWKMHRDPKVWSDPLEFQPERFLQKH 447

Query: 1337 EGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVG 1516
                   + ++ +PFG GRRSCPG  +A Q+  + +A+L  GF   TV +  +DM E  G
Sbjct: 448  INVDIWGQNFELLPFGSGRRSCPGITFAMQVLHLTLAQLLHGFELGTVLDSSIDMTESSG 507

Query: 1517 IILPKLTPLEVLVTPRLSPTLFR 1585
            I  P+ TPLEV +TPRL P +++
Sbjct: 508  ITDPRATPLEVTLTPRLPPAVYQ 530



>sp|Q43068|C821_PEA Cytochrome P450 82A1 (EC 1.14.-.-) (CYPLXXXII)
            (Fragment).>gb:PSU29333_1702483 Pisum sativum novel
            wound-inducible cytochrome P450 monooxygenase (CYP82)
            mRNA, partial cds.
          Length = 544

 Score =  388 bits (997), Expect = e-106
 Identities = 202/531 (38%), Positives = 307/531 (57%), Gaps = 26/531 (4%)
 Frame = +2

Query: 56   SILGIAALVLLWFSWRKQSK-RLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPV 232
            + + + +L+   F + K S  + PP   G+WP++GHL   R +    KTL    DKYGP+
Sbjct: 12   AFISLISLLFFLFRFSKVSHTKEPPIISGSWPLLGHLPLMRNTQTPHKTLGALVDKYGPI 71

Query: 233  FTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRR 412
            FTI+LG +  LV+S+WE  ++CF  ND ++++RP   A + + Y+ A   ++   +YWR+
Sbjct: 72   FTIKLGATNALVLSNWELAKECFTKNDIVVSSRPKPVAVELMSYNQAFIGWAPYGAYWRQ 131

Query: 413  VRKLVVEEILSSRRLEKLKHVWVSELQTNIKELY----------------TFISMDNNNP 544
            +RK+V  EILS+RR+E L H+ VSE+QT+IKEL                 T  S  N+ P
Sbjct: 132  LRKIVTLEILSNRRIELLSHIRVSEVQTSIKELVNVWSNQISSQYGLLDDTKSSSTNDEP 191

Query: 545  SAP---KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEF 715
            S      V + +WF  LTLN+++++V G+R     D    EEA+R  +     M L G F
Sbjct: 192  STTDYVSVELKKWFAQLTLNMVLRMVVGKRCFGDVDVENKEEAKRFLENIRDFMRLIGTF 251

Query: 716  VSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQK------F 877
              GD +    F +WLD  GH K MK+ AK  D +L +W++  R+++    + K      F
Sbjct: 252  TVGDGVP---FLKWLDLGGHEKEMKKCAKKFDVMLNEWLEEHREKKGLGSEDKVVGERDF 308

Query: 878  IDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRV 1057
            +D ML ++ D+  +G+    DT+IKA  L ++   S+T A  LTW + +LLKHP  L+++
Sbjct: 309  MDAMLLVLKDKPIEGFDV--DTIIKATTLELILGGSDTTAGTLTWAMCLLLKHPHVLEKL 366

Query: 1058 QDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPK 1237
            ++E++T IGKER   +SD+  L YL  ++KETLR+YP  P+ +P E  EDC + GYHI K
Sbjct: 367  KEELNTYIGKERCVNESDINKLVYLHAIIKETLRLYPPAPFSSPREFTEDCTIGGYHIKK 426

Query: 1238 GTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLY 1417
            GT+L  N+W++HRDP +WPDP +F PERF++  +    + + ++ +PFG GRR C G   
Sbjct: 427  GTRLMPNLWKIHRDPSVWPDPLEFKPERFLSTHKDVDVRGQNFELLPFGSGRRMCAGMSL 486

Query: 1418 ATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS 1570
               +    +A     F       E +D+ E +  +  K TPLEVLV P LS
Sbjct: 487  GLHMVHYILANFLHSFEILNPSPESIDVTEVLEFVTTKATPLEVLVKPCLS 537



>gb:AF175278_1774495 Pisum sativum wound-inducible P450 hydroxylase
            (CYP82A1) gene, CYP82A1-v2 allele, complete cds.
          Length = 540

 Score =  387 bits (994), Expect = e-106
 Identities = 199/525 (37%), Positives = 308/525 (58%), Gaps = 20/525 (3%)
 Frame = +2

Query: 56   SILGIAALVLLWFSWRKQSK-RLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPV 232
            + + + +L+   F + K S  + PP   G+WP++GHL   R +    KTL    DKYGP+
Sbjct: 14   AFISLISLLFFLFRFSKVSHTKEPPIVSGSWPLLGHLPLMRNTQTPHKTLGALVDKYGPI 73

Query: 233  FTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRR 412
            FTI+LG +  LV+S+WE  ++CF  ND ++++RP   A + + Y+ A   ++   +YWR+
Sbjct: 74   FTIKLGATNALVLSNWELAKECFTKNDIVVSSRPKPVAVELMSYNQAFIGWAPYGTYWRQ 133

Query: 413  VRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFIS---------MDNNNPSAPK--- 556
            +RK+V  EILS+RR+E L H+ VSE+QT+IKEL    S         +D+   S+     
Sbjct: 134  LRKIVTLEILSNRRIELLSHIRVSEVQTSIKELVNVWSNQMSSQYGLLDDTKSSSTNDYA 193

Query: 557  -VNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI 733
             V + +WF  LTLN+++++V G+R     D    EEA++  +     M L G F  GD +
Sbjct: 194  SVELKKWFAQLTLNMVLRMVVGKRCFGDVDVENKEEAKKFLENIRDFMRLIGTFTVGDGV 253

Query: 734  FPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQK------FIDVMLS 895
                F +WLD  GH K MK+ AK  D +L +W++  R+++    + K      F+D ML 
Sbjct: 254  P---FLKWLDLGGHEKEMKKCAKKFDEMLNEWLEEHREKKGLGSEDKVVGERDFMDAMLL 310

Query: 896  MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT 1075
            ++ D+  +G+    DT+IKA  L ++   S+T A  LTW + +LLKHP  L+++++E++T
Sbjct: 311  VLKDKPIEGFDV--DTIIKATTLELILGGSDTTAGTLTWAMCLLLKHPHVLEKLKEELNT 368

Query: 1076 NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV 1255
             IGKER  ++SD+  L YL  ++KETLR+YP  P+ +P E  EDC + GYHI KGT+L  
Sbjct: 369  YIGKERCVKESDINKLVYLHAIIKETLRLYPPAPFSSPREFTEDCTIGGYHIKKGTRLMP 428

Query: 1256 NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ 1435
            N+W++HRDP +WPDP +F PERF++  +    + + ++ +PFG GRR C G      +  
Sbjct: 429  NLWKIHRDPNVWPDPLEFKPERFLSTHKDVDVRGQNFELLPFGSGRRMCAGMSLGLHMVH 488

Query: 1436 VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS 1570
              +A     F       E +D+ E +  +  K TPLEVLV P LS
Sbjct: 489  YILANFLHSFEILNPSPESIDVTEVLEFVTTKATPLEVLVKPCLS 533



>sp|O49858|C823_SOYBN Cytochrome P450 82A3 (EC 1.14.-.-) (P450
            CP6).>pir|T07748|T07748 probable cytochrome P450 -
            soybean>gb:GMP450CP6_1680549 Glycine max mRNA for
            cytochrome P450-like protein, clone CP6.
          Length = 527

 Score =  386 bits (992), Expect = e-106
 Identities = 208/529 (39%), Positives = 312/529 (58%), Gaps = 11/529 (2%)
 Frame = +2

Query: 29   MDAVPCCLS----SILGIAALVLLW-FSWRKQSK-RLPPEAGGAWPIIGHLHHFRTSVPL 190
            MD +  CL+    +I  I +L+ L  F +RK S+ +  P   GAWPI+GHL     S   
Sbjct: 1    MDLLLNCLNLNTIAIASILSLIFLCLFLYRKNSRGKDAPVVSGAWPILGHLSLLNGSQTP 60

Query: 191  VKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDY 370
             K L   ADKYGP+FTI+LG+   LV+S+WE  ++ F TND  +++RP   A + + Y+ 
Sbjct: 61   HKVLGALADKYGPLFTIKLGMKPALVLSNWEMSKELFTTNDLAVSSRPKLVAVEVMSYNQ 120

Query: 371  AVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSA 550
            A    +    YWR +RK+V  E LS+RR+E+  H+ VSE++T+IKEL+   S  N N S 
Sbjct: 121  AFVGLAPYGPYWRELRKIVTFEFLSNRRIEQRNHIRVSEVRTSIKELFDIWSNGNKNESR 180

Query: 551  -PKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGD 727
               V++ +W  +LT N+++++V G+RY         ++AQR  K   + M L G F   D
Sbjct: 181  YTLVDIKQWLAYLTFNMVVRMVVGKRYFGVMHVEGKDKAQRFMKNIREFMNLMGTFTVAD 240

Query: 728  AIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE----DQKFIDVMLS 895
             +  L   RWLD  GH K MK  AK+VD +L +W++  R+++   E    D+ F+DVM+S
Sbjct: 241  GVPCL---RWLDLGGHEKAMKANAKEVDKLLSEWLEEHRQKKLLGENVESDRDFMDVMIS 297

Query: 896  MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT 1075
             ++    Q  ++  DT+ KA  L ++   +++ A  LTW L++LL++P +L + ++EID 
Sbjct: 298  ALNG--AQIGAFDADTICKATSLELILGGTDSTAVTLTWALSLLLRNPLALGKAKEEIDM 355

Query: 1076 NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV 1255
             IGK+ +  +SD+  L YLQ +VKETLR+YP  P+ +P E  E+CI+ GYHI KGT+L  
Sbjct: 356  QIGKDEYIRESDISKLVYLQAIVKETLRLYPPAPFSSPREFTENCILGGYHIKKGTRLIH 415

Query: 1256 NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ 1435
            N+W++HRDP +W DP +F PERF+T  +    +   ++ +PFG GRR C G      +  
Sbjct: 416  NLWKIHRDPSVWSDPLEFKPERFLTTHKDVDLRGHNFELLPFGSGRRVCAGMSLGLNMVH 475

Query: 1436 VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
              +A L   F+      EP+DM E  G    K TPLE+LV PR SP  +
Sbjct: 476  FTLANLLHSFDILNPSAEPVDMTEFFGFTNTKATPLEILVKPRQSPNYY 524



>sp|O49859|C824_SOYBN Cytochrome P450 82A4 (EC 1.14.-.-) (P450
            CP9).>pir|T07749|T07749 probable cytochrome P450 -
            soybean>gb:GMP450CP9_1680550 Glycine max mRNA for
            cytochrome P450-like protein, clone CP9.
          Length = 525

 Score =  385 bits (989), Expect = e-105
 Identities = 199/496 (40%), Positives = 293/496 (59%), Gaps = 4/496 (0%)
 Frame = +2

Query: 110  SKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAV 289
            S +  P  GGAWPI GHL     S    K L   A+K+GP+FTI+LG  + LVVS WE  
Sbjct: 36   SSKEAPTVGGAWPIFGHLPLLIGSKSPHKALGALAEKHGPLFTIKLGAKKALVVSDWEMA 95

Query: 290  RDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLK 469
            R+CF TND  ++ARP     + + Y+ A+   +    YWR +RK++V EILSS R+E+L+
Sbjct: 96   RECFTTNDVAVSARPKLLVAELMCYNNAMLLVAPYGPYWRELRKIIVTEILSSSRVEQLQ 155

Query: 470  HVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGT 649
             V VSE+Q +I ELY       N      V + +WF     N+++++V G+R+   S   
Sbjct: 156  DVRVSEVQNSIVELYDVWRSQKNESDYASVELKQWFAQPIFNMVLRMVVGKRF--LSATA 213

Query: 650  INEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDW 829
             +E+A++  K   + M L G F  GDAI    + RWLD+ G+ K MK  AK++D ++ +W
Sbjct: 214  TDEKAEKCVKAVDEFMRLAGVFTVGDAIP---YLRWLDFGGYEKAMKETAKELDVMISEW 270

Query: 830  VDARRKERRSNED----QKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFA 997
            ++  R++R   E     Q F++VMLS +D +   G     DT+IK+ VL+++Q  +E   
Sbjct: 271  LEEHRQKRALGEGVDGAQDFMNVMLSSLDGKTIDGID--ADTLIKSTVLTIIQAGTEASI 328

Query: 998  THLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGP 1177
            + + W + ++LK+P  L+  + E+D  +GK+R   +SD+ NL YLQ VVKETLR+Y  GP
Sbjct: 329  STIIWAMCLILKNPLILEN-KAELDIQVGKDRCICESDISNLVYLQAVVKETLRLYAPGP 387

Query: 1178 YLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQN 1357
              +P E  EDC + GYH+ KGT+L  N+W++H DP +W DP +F P+RF+T  +    + 
Sbjct: 388  LSSPREFAEDCTLGGYHVKKGTRLITNIWKIHTDPNVWSDPFEFKPDRFLTTHKDIDVKG 447

Query: 1358 RQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLT 1537
              +Q +PFG GRR CPG  +  Q   +A+A     F       EPLDM E  G+   K T
Sbjct: 448  HHFQLLPFGSGRRVCPGISFGLQTVHLALASFLHSFEILNPSTEPLDMTEAFGVTNTKAT 507

Query: 1538 PLEVLVTPRLSPTLFR 1585
            PLEVLV P LSP+ ++
Sbjct: 508  PLEVLVKPCLSPSCYK 523



>pir|H85374|H85374 cytochrome P450-like protein [imported] -
            Arabidopsis thaliana>gb:ATCHRIV76_1547116 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            76.>gb:ATF10N7_1548230 Arabidopsis thaliana DNA
            chromosome 4, BAC clone F10N7 (ESSA
            project).>gb:AY142533_1582962 Arabidopsis thaliana
            putative cytochrome P450 (At4g31950) mRNA, complete cds.
          Length = 512

 Score =  383 bits (984), Expect = e-105
 Identities = 212/524 (40%), Positives = 316/524 (60%), Gaps = 17/524 (3%)
 Frame = +2

Query: 62   LGIAALVLLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYG 226
            L ++ LV ++ +  K+SK+      P   GAWPIIGHLH       L+ +TL + AD YG
Sbjct: 8    LFVSILVFVFIALFKKSKKPKYVKAPAPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYG 67

Query: 227  PVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYW 406
            P  ++RLG S   V SS+E  +DCF  NDK LA+   T A K++GY            +W
Sbjct: 68   PAMSLRLGSSETFVGSSFEVAKDCFTVNDKALASL-MTAAAKHMGY-----------VFW 115

Query: 407  RRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHL 586
              +RK+ + E+LS+RRL+ L +V VSE+   +K+LY+ + +         V++  W   +
Sbjct: 116  LEMRKIAMIELLSNRRLQMLNNVRVSEISMGVKDLYS-LWVKKGGSEPVMVDLKSWLEDM 174

Query: 587  TLNLIMQIVAGRRYEYRSDGTIN----EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR 754
              N+IM++VAG+RY +   G  +    EEA++ +K  ++  +L G F   DA FP     
Sbjct: 175  IANMIMRMVAGKRY-FGGGGAESSEHTEEARQWRKGIAKFFHLVGIFTVSDA-FPK--LG 230

Query: 755  WLDYEGHVKTMKRAAKDVDAILQDWVDARRKERR----SNEDQKFIDVMLSMIDDQFTQG 922
            WLD +GH K MK+  +++D IL+ W++  R++R+     + D  F+DVMLS+ +      
Sbjct: 231  WLDLQGHEKEMKQTRRELDVILERWIENHRQQRKVSGTKHNDSDFVDVMLSLAEQGKLSH 290

Query: 923  YSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAE 1102
              Y  +T IK   L+++   SET  + LTW +++LL + + LK+VQDEID ++G++R  E
Sbjct: 291  LQYDANTCIKTTCLALILGGSETSPSTLTWAISLLLNNKDMLKKVQDEIDIHVGRDRNVE 350

Query: 1103 DSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDP 1282
            DSD+KNL YLQ ++KETLR+YP  P L   EA+EDC V GY++P GT+L VNVW++ RDP
Sbjct: 351  DSDIKNLVYLQAIIKETLRLYPAAPLLGHREAMEDCTVAGYNVPCGTRLIVNVWKIQRDP 410

Query: 1283 KIWPDPEKFLPERFMTNLEGEA----AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVAR 1450
            K++ +P +F PERF+T   GEA     + + ++ +PFG GRRSCPG   A Q+  + +AR
Sbjct: 411  KVYMEPNEFRPERFIT---GEAKDFDVRGQNFELMPFGSGRRSCPGPSLAMQMLHLGLAR 467

Query: 1451 LFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
                F   TV + P+DM E  G+ + K TPLEVL+ PRL   LF
Sbjct: 468  FLHSFEVKTVLDRPVDMSESPGLTITKATPLEVLINPRLKRELF 511



>gb:AB026647_1517200 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone: MJL12.
          Length = 515

 Score =  377 bits (969), Expect = e-103
 Identities = 202/520 (38%), Positives = 303/520 (58%), Gaps = 9/520 (1%)
 Frame = +2

Query: 56   SILGIAALVLLWFSWRKQSKRLP------PEAGGAWPIIGHLHHFRTSVPLVKTLSEWAD 217
            S+  +A ++  +   RKQ  R        PE  GA P+ GHLH  R    L K L+  + 
Sbjct: 11   SLFSLALVIFGYIFLRKQLSRCEVDSSTIPEPLGALPLFGHLHLLRGKKLLCKKLAAMSQ 70

Query: 218  KYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNN 397
            K+GP+F+++LG  R++V S  + V+DCF TND   A RP    G+Y+GY+ A  T +   
Sbjct: 71   KHGPIFSLKLGFYRLVVASDPKTVKDCFTTNDLATATRPNIAFGRYVGYNNASLTLAPYG 130

Query: 398  SYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWF 577
             YWR +RK+V   + S+  +E L H+  SE+ T IK LY      N   S  K++M   F
Sbjct: 131  DYWRELRKIVTVHLFSNHSIEMLGHIRSSEVNTLIKHLYK----GNGGTSIVKIDML--F 184

Query: 578  GHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRW 757
              LT N+I++ + G+R  +   G +N +  R K+      YL    + GD I    +  W
Sbjct: 185  EFLTFNIILRKMVGKRIGF---GEVNSDEWRYKEALKHCEYLAVIPMIGDVIP---WLGW 238

Query: 758  LDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQGYS 928
            LD+  + + MKR  K++D++   W+    K+R  NE   ++  +D++L ++ +       
Sbjct: 239  LDFAKNSQ-MKRLFKELDSVNTKWLHEHLKKRSRNEKDQERTIMDLLLDILPEDIVIS-G 296

Query: 929  YSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDS 1108
            + RD ++KA +L++    S++ +  LTW +++LL +P +L+  Q+EID ++GK RW E+S
Sbjct: 297  HVRDVIVKATILALTLTGSDSTSITLTWAVSLLLNNPAALEAAQEEIDNSVGKGRWIEES 356

Query: 1109 DVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKI 1288
            D++NL YLQ +VKET R+YP  P     EA EDC V GY + KGT+L VN+W+LHRDPKI
Sbjct: 357  DIQNLKYLQAIVKETHRLYPPAPLTGIREAREDCFVGGYRVEKGTRLLVNIWKLHRDPKI 416

Query: 1289 WPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFN 1468
            WPDP+ F PERFM   +    +   ++++PFG GRRSCPG     ++    +ARL QGF 
Sbjct: 417  WPDPKTFKPERFME--DKSQCEKSNFEYIPFGSGRRSCPGVNLGLRVVHFVLARLLQGFE 474

Query: 1469 FSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFRL 1588
               V +EPLDM E  G+ LPK+ P+EV+V PRL P L+ L
Sbjct: 475  LHKVSDEPLDMAEGPGLALPKINPVEVVVMPRLDPKLYSL 514



>pir|T06523|T06523 cytochrome P450 monooxygenase (EC 1.13.-.-) -
            garden pea  (fragment)
          Length = 543

 Score =  372 bits (955), Expect = e-101
 Identities = 197/531 (37%), Positives = 303/531 (57%), Gaps = 26/531 (4%)
 Frame = +2

Query: 56   SILGIAALVLLWFSWRKQSK-RLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPV 232
            + + + +L+   F + K S  + PP   G+WP++G +   R +    KTL    DKYGP+
Sbjct: 12   AFISLISLLFFLFRFSKVSHTKEPPIISGSWPLLGSIPLMRNTQTPHKTLGALVDKYGPI 71

Query: 233  FTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRR 412
            FTI+LG +  LV+S+WE  ++CF  ND ++++RP   A + + Y+ A   ++    YWR+
Sbjct: 72   FTIKLGATNALVLSNWELAKECFTKNDIVVSSRPKPVAVELMSYNQAFIGWAPYGEYWRQ 131

Query: 413  VRKLVVEEILSSRRLEKLKHVWVSELQTNIKELY----------------TFISMDNNNP 544
            +RK+V  EILS+RR+E L H+ VSE+QT+IKEL                 T  S  N+ P
Sbjct: 132  LRKIVTLEILSNRRIELLSHIRVSEVQTSIKELVNVWSNQISSQYGLLDDTKSSSTNDEP 191

Query: 545  SAPKV---NMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEF 715
            S        + +WF  LTLN+++++V G+R     D    EEA+R  +     M L G F
Sbjct: 192  STTDYVVPELKKWFAQLTLNMVLRMVVGKRCFGDVDVENKEEAKRFLENIRDFMRLIGTF 251

Query: 716  VSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQK------F 877
              GD +    F +WLD  GH K MK+ AK  D +L +W++  R+++    + K      F
Sbjct: 252  TVGDGVP---FLKWLDLGGHEKEMKKCAKKFDVMLNEWLEEHREKKGLGSEDKVVPERDF 308

Query: 878  IDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRV 1057
            +D ML ++ D+  +G+    DT+IKA +  ++   S+T A  LTW + +LLKHP  L+++
Sbjct: 309  MDRMLLVLKDKPIEGFDV--DTIIKAHI-ELILGGSDTTAGTLTWAMCLLLKHPHVLEKL 365

Query: 1058 QDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPK 1237
            ++E++T IGKER   +SD+  L YL  ++KETLR+YP  P+ +P E  EDC + GYHI K
Sbjct: 366  KEELNTYIGKERCVNESDINKLVYLHAIIKETLRLYPPAPFSSPREFTEDCTIGGYHIKK 425

Query: 1238 GTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLY 1417
            GT+L  N+W++HRDP +WPDP +F PE F++  +    + + ++ +PFG GRR C G   
Sbjct: 426  GTRLMPNLWKIHRDPSVWPDPLEFKPESFLSTHKDVDVRGQNFELLPFGSGRRMCAGMSL 485

Query: 1418 ATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS 1570
               +    +A     F       E +D+ E +  +  K TPLEVLV P LS
Sbjct: 486  GLHMVHYILANFLHSFEILNPSPESIDVTEVLEFVTTKATPLEVLVKPCLS 536



>sp|O81972|C822_SOYBN Cytochrome P450 82A2 (EC 1.14.-.-) (P450
            CP4).>pir|T07118|T07118 probable cytochrome P450 CP4 -
            soybean>gb:GMC450CP4_1680415 G.max mRNA for putative
            cytochrome P450, clone CP4.
          Length = 522

 Score =  363 bits (933), Expect = 4e-99
 Identities = 191/515 (37%), Positives = 303/515 (58%), Gaps = 8/515 (1%)
 Frame = +2

Query: 62   LGIAALVLLWF------SWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY 223
            +G+ +L+LL +      SW K  +  PP   GAWPIIGHL     S    KTL + ADKY
Sbjct: 12   VGVVSLILLLYLFLRGGSW-KSGEEGPPTVAGAWPIIGHLPLLLGSKTPHKTLGDLADKY 70

Query: 224  GPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSY 403
            GP+F+I++G    +VVS+WE  ++C+ TND  +++ P   +   L Y+ ++   +    Y
Sbjct: 71   GPIFSIKIGAKNAVVVSNWEMAKECYTTNDIAVSSLPDLISANLLCYNRSMIVVAPYGPY 130

Query: 404  WRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSA-PKVNMSRWFG 580
            WR++RK+++ E LS  R+E+L HV VSE+Q++I EL+     + N  S    V + +WF 
Sbjct: 131  WRQLRKILMSEFLSPSRVEQLHHVRVSEVQSSITELFRDWRSNKNVQSGFATVELKQWFS 190

Query: 581  HLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWL 760
             L  N+I+++V G+RY + +  + +E+A R  K   + + L   F  GDAI    + RW 
Sbjct: 191  LLVFNMILRMVCGKRY-FSASTSDDEKANRCVKAVDEFVRLAATFTVGDAIP---YLRWF 246

Query: 761  DYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNED-QKFIDVMLSMIDDQFTQGYSYSR 937
            D+ G+   M+   K++D I+ +W+D  R++R+  E+ Q  + V+LS+++ +  +G +   
Sbjct: 247  DFGGYENDMRETGKELDEIIGEWLDEHRQKRKMGENVQDLMSVLLSLLEGKTIEGMNV-- 304

Query: 938  DTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVK 1117
            D VIK+ VL+++Q  +E   T L W  +++L +P  L++++ E+D  +GKER+  +SD+ 
Sbjct: 305  DIVIKSFVLTVIQAGTEASITTLIWATSLILNNPSVLEKLKAELDIQVGKERYICESDLS 364

Query: 1118 NLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPD 1297
             L YLQ VVKETLR+YP  P   P E  EDC + GY + KGT+L  N+ ++H D  +W +
Sbjct: 365  KLTYLQAVVKETLRLYPPAPLSRPREFEEDCTIGGYTVKKGTRLITNLSKIHTDHNVWSN 424

Query: 1298 PEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST 1477
            P +F PERF+T  +    + + +Q +PFG GRR CPG     Q  ++ +A     F    
Sbjct: 425  PLEFKPERFLTTDKDIDMKGQHFQLLPFGGGRRICPGINLGLQTVRLTLASFLHSFEILN 484

Query: 1478 VPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
               EPLDM E       K TPLE+L+ PRLSP+ +
Sbjct: 485  PSTEPLDMTEVFRATNTKATPLEILIKPRLSPSCY 519



>pir|T04650|T04650 cytochrome P450 F10N7.240 - Arabidopsis thaliana
          Length = 501

 Score =  362 bits (928), Expect = 2e-98
 Identities = 206/525 (39%), Positives = 304/525 (57%), Gaps = 18/525 (3%)
 Frame = +2

Query: 62   LGIAALVLLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYG 226
            L ++ LV ++ +  K+SK+      P   GAWPIIGHLH       L+ +TL + AD YG
Sbjct: 8    LFVSILVFVFIALFKKSKKPKYVKAPAPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYG 67

Query: 227  PVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYW 406
            P  ++RLG S   V SS+E  +DCF  NDK LA+   T A K++GY            +W
Sbjct: 68   PAMSLRLGSSETFVGSSFEVAKDCFTVNDKALASL-MTAAAKHMGY-----------VFW 115

Query: 407  RRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAP-KVNMSRWFGH 583
              +RK+ + E+LS+RR                   + F+       S P  V++  W   
Sbjct: 116  LEMRKIAMIELLSNRRFR-------------CSTTFVFLRSQWKGGSEPVMVDLKSWLED 162

Query: 584  LTLNLIMQIVAGRRYEYRSDGTIN----EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF 751
            +  N+IM++VAG+RY +   G  +    EEA++ +K  ++  +L G F   DA FP    
Sbjct: 163  MIANMIMRMVAGKRY-FGGGGAESSEHTEEARQWRKGIAKFFHLVGIFTVSDA-FPK--L 218

Query: 752  RWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERR----SNEDQKFIDVMLSMIDDQFTQ 919
             WLD +GH K MK+  +++D IL+ W++  R++R+     + D  F+DVMLS+ +     
Sbjct: 219  GWLDLQGHEKEMKQTRRELDVILERWIENHRQQRKVSGTKHNDSDFVDVMLSLAEQGKLS 278

Query: 920  GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWA 1099
               Y  +T IK   L+++   SET  + LTW +++LL + + LK+VQDEID ++G++R  
Sbjct: 279  HLQYDANTCIKTTCLALILGGSETSPSTLTWAISLLLNNKDMLKKVQDEIDIHVGRDRNV 338

Query: 1100 EDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRD 1279
            EDSD+KNL YLQ ++KETLR+YP  P L   EA+EDC V GY++P GT+L VNVW++ RD
Sbjct: 339  EDSDIKNLVYLQAIIKETLRLYPAAPLLGHREAMEDCTVAGYNVPCGTRLIVNVWKIQRD 398

Query: 1280 PKIWPDPEKFLPERFMTNLEGEA----AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA 1447
            PK++ +P +F PERF+T   GEA     + + ++ +PFG GRRSCPG   A Q+  + +A
Sbjct: 399  PKVYMEPNEFRPERFIT---GEAKDFDVRGQNFELMPFGSGRRSCPGPSLAMQMLHLGLA 455

Query: 1448 RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
            R    F   TV + P+DM E  G+ + K TPLEVL+ PRL   LF
Sbjct: 456  RFLHSFEVKTVLDRPVDMSESPGLTITKATPLEVLINPRLKRELF 500



>gb:HTCYP81L_1682164 Helianthus tuberosus mRNA for cytochrome P450,
            CYP81B1l.
          Length = 520

 Score =  323 bits (829), Expect = 5e-87
 Identities = 178/495 (35%), Positives = 279/495 (56%), Gaps = 3/495 (0%)
 Frame = +2

Query: 101  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW 280
            R++S  LPP      PIIGHL+  +   PL +TL++ + K+GP+  ++LG  R+L+VSS 
Sbjct: 38   RRRSSTLPPTIFPYLPIIGHLYLLKP--PLYRTLAKLSAKHGPILRLQLGFRRVLIVSSP 95

Query: 281  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE 460
             A  +CF  ND + A RP    GK +G +Y    +S     WR +R++   EILS  RL 
Sbjct: 96   SAAEECFTKNDIVFANRPKMLFGKIIGVNYTSLAWSPYGDNWRNLRRIASIEILSIHRLN 155

Query: 461  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS 640
            +   + V E +  I++L +       N  + +V M   F  LTLN++M++++G+RY    
Sbjct: 156  EFHDIRVEETRLLIQKLLSAC-----NSGSSQVTMKFSFYELTLNVMMRMISGKRYFGGD 210

Query: 641  DGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAIL 820
            +  + EE +R + +  +   L G    GD +  L    WL  +G  K + +  +  D   
Sbjct: 211  NPELEEEGKRFRDMLDETFVLAGASNVGDYLPVL---SWLGVKGLEKKLIKLQEKRDVFF 267

Query: 821  QDWVDARRKERRS---NEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASET 991
            Q  +D  RK + +   N+ +  I+++LS+ + +      Y  D +I++ VL +L   S+T
Sbjct: 268  QGLIDQLRKSKGTEDVNKKKTMIELLLSLQETE----PEYYTDAMIRSFVLVLLAAGSDT 323

Query: 992  FATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQ 1171
             A  + W++++LL HP+ LK+ Q+EID+ IGK    ++SD+ NLPYL+ ++ ETLR+YP 
Sbjct: 324  SAGTMEWVMSLLLNHPQVLKKAQNEIDSVIGKNCLVDESDIPNLPYLRCIINETLRLYPA 383

Query: 1172 GPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA 1351
            GP L PHEA  DC+V GY++P+GT L VN W +H DPK+W +PE F PERF    EG   
Sbjct: 384  GPLLVPHEASSDCVVGGYNVPRGTILIVNQWAIHHDPKVWDEPETFKPERF----EGLEG 439

Query: 1352 QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPK 1531
                ++ +PFG GRRSCPG   A ++  + +  + Q F++     E +DM E  G+ +PK
Sbjct: 440  TRDGFKLLPFGSGRRSCPGEGLAVRMLGMTLGSIIQCFDWERTSEELVDMTEGPGLTMPK 499

Query: 1532 LTPLEVLVTPRLSPT 1576
              PL     PR+  T
Sbjct: 500  AIPLVAKCKPRVEMT 514



>pir|T10896|T10896 cytochrome P450 (EC 1.14.-.-) 81B1c - Jerusalem
            artichoke>gb:HTCYP81C_1682163 Helianthus tuberosus mRNA
            for cytochrome P450, CYP81B1c.
          Length = 505

 Score =  323 bits (829), Expect = 5e-87
 Identities = 181/516 (35%), Positives = 288/516 (55%), Gaps = 3/516 (0%)
 Frame = +2

Query: 38   VPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWAD 217
            +P  L++ L +     L+   R++S  LPP    + PIIGHL+  +   PL +TL++ + 
Sbjct: 3    IPYLLTTTL-LLLFTTLYLLLRRRSSTLPPTIFPSLPIIGHLYLLKP--PLYRTLAKLSA 59

Query: 218  KYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNN 397
            K+G +  ++LG  R+L+VSS  A  +CF  ND + A RP    GK +G +Y    +S   
Sbjct: 60   KHGQILRLQLGFRRVLIVSSPSAAEECFTKNDIVFANRPKMLFGKIIGVNYTSLAWSPYG 119

Query: 398  SYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWF 577
              WR +R++   EILS  RL +   + V E +  I++L +       N  + +V M   F
Sbjct: 120  DNWRNLRRIASIEILSIHRLNEFHDIRVEETRLLIQKLLSAC-----NSGSSQVTMKFSF 174

Query: 578  GHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRW 757
              LTLN++M++++G+RY    +  + EE +R + +  +   L G    GD +  L    W
Sbjct: 175  YELTLNVMMRMISGKRYFGGDNPELEEEGKRFRDMLDETFVLAGASNVGDYLPVL---SW 231

Query: 758  LDYEGHVKTMKRAAKDVDAILQDWVDARRKERRS---NEDQKFIDVMLSMIDDQFTQGYS 928
            L  +G  K + +  +  D   Q  +D  RK + +   N+ +  I+++LS+ + +      
Sbjct: 232  LGVKGLEKKLIKLQEKRDVFFQGLIDQLRKSKGTEDVNKKKTMIELLLSLQETE----PE 287

Query: 929  YSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDS 1108
            Y  D +I++ VL +L   S+T A  + W++++LL HP+ LK+ Q+EID+ IGK    ++S
Sbjct: 288  YYTDAMIRSFVLVLLAAGSDTSAGTMEWVMSLLLNHPQVLKKAQNEIDSVIGKNCLVDES 347

Query: 1109 DVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKI 1288
            D+ NLPYL+ ++ ETLR+YP GP L PHEA  DC+V GY++P+GT L VN W +H DPK+
Sbjct: 348  DIPNLPYLRCIINETLRLYPAGPLLVPHEASSDCVVGGYNVPRGTILIVNQWAIHHDPKV 407

Query: 1289 WPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFN 1468
            W +PE F PERF    EG       ++ +PFG GRRSCPG   A ++  + +  + Q F+
Sbjct: 408  WDEPETFKPERF----EGLEGTRDGFKLLPFGSGRRSCPGEGLAVRMLGMTLGSIIQCFD 463

Query: 1469 FSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPT 1576
            +     E +DM E  G+ +PK  PL     PR+  T
Sbjct: 464  WERTSEELVDMTEGPGLTMPKAIPLVAKCKPRVEMT 499



>pir|A84645|A84645 probable cytochrome P450 [imported] - Arabidopsis
            thaliana>gb:BT008597_1639813 Arabidopsis thaliana clone
            RAFL17-28-J02 (R50417) putative cytochrome p450
            (At2g25160) mRNA, complete cds.>gb:BT014968_1641938
            Arabidopsis thaliana At2g25160 gene, complete cds.
          Length = 527

 Score =  317 bits (813), Expect = 4e-85
 Identities = 177/518 (34%), Positives = 280/518 (54%), Gaps = 5/518 (0%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFSWR-KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYG 226
            LS++     L+L+    R K  K   P   GAWP++GHLH F T  P   T    AD YG
Sbjct: 9    LSALFIFPVLILIKSRLRPKNKKSTAPMVPGAWPLLGHLHLFDTVNPTHVTFGAMADVYG 68

Query: 227  PVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYW 406
            PVF  +LG  ++++++S E  ++ +  +DKLL  RP   A K LGY+ +  TFS    YW
Sbjct: 69   PVFMAKLGSIKVMIINSKEVAKEIYTVHDKLLE-RPELTASKLLGYNDSFLTFSPYGLYW 127

Query: 407  RRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHL 586
            R +RK+ V E+ S+  ++        E     + LY              V+M + F  L
Sbjct: 128  REIRKIAVSELFSTSGVDMHMVSRAREADLAFRALYVRWEKRGKPKEGVLVDMKQEFIDL 187

Query: 587  TLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDY 766
            T N+ + +V+G+RY   +     +EA+R  K+  + +  +  F+  D    L F  W   
Sbjct: 188  TANISLMMVSGKRYFGENPNCEVKEARRCGKLIREFLDYFALFLLSDVAPVLGFLDWKTK 247

Query: 767  EGHVKTMKRAAKDVDAILQDWVDARRKERRSN--EDQKFIDVMLSMIDDQFTQGYSYSRD 940
             G    MKR AK +D + + W++  + +R  +   +  ++D+++ ++      G S +  
Sbjct: 248  RG----MKRTAKGLDKVAEGWIEEHKNKRSDHGRSENDYLDILIKILGQDKIPGLSDTH- 302

Query: 941  TVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKN 1120
            T IKA+ L+++   SET    L W +++LL +P  L++ Q+E+D+ IGKER  E+ D+K+
Sbjct: 303  TKIKALCLNLVLAGSETAIVVLVWAVSLLLNNPHVLRKAQEELDSKIGKERVVEELDIKD 362

Query: 1121 LPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVD--GYHIPKGTQLYVNVWRLHRDPKIWP 1294
            L YLQ +VKET R+YP  P +A    VED  +     H+P GTQL V+ W++HRDP +W 
Sbjct: 363  LVYLQAIVKETFRLYPPVPLVAYRAVVEDFDIAFCKCHVPAGTQLMVSAWKIHRDPNVWS 422

Query: 1295 DPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFS 1474
            +PE+F PERF+T+        + Y+F PFGLGRRSCP      ++    + R    F+ +
Sbjct: 423  NPEQFEPERFLTSNRELDVGGQSYKFFPFGLGRRSCPAIPLGMRMVHYLLVRFLHSFDLA 482

Query: 1475 TVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFRL 1588
               ++ +DM E  G++  K TPLEV + PRL  +L+ +
Sbjct: 483  RPSSQDVDMTESNGLVNHKATPLEVNIIPRLHKSLYEV 520



>gb:AF368380_1791923 Nicotiana tabacum elicitor-inducible cytochrome
            P450 (CYP92A5) mRNA, complete cds.
          Length = 509

 Score =  296 bits (757), Expect = 1e-78
 Identities = 179/513 (34%), Positives = 280/513 (54%), Gaps = 6/513 (1%)
 Frame = +2

Query: 62   LGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTI 241
            LG   L+LL    R++   LPP     WPIIG+L+    ++P  +++ E + KYGP+  +
Sbjct: 14   LGTLFLLLLSKFLRQRKLNLPP-GPKPWPIIGNLNLIG-NLPH-RSIHELSLKYGPIMQL 70

Query: 242  RLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRK 421
            + G   ++V SS E  +    + D     RP T AGKY  Y+Y+  T+S    YWR+ R+
Sbjct: 71   QFGTFPVVVGSSVEMAKVFLKSMDINFVGRPKTAAGKYTTYNYSDITWSPYGPYWRQARR 130

Query: 422  LVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLI 601
            + + E+ S++RL+  +++   EL + +  L        N  S   + +  +   L+LN+I
Sbjct: 131  MCLMELFSTKRLDSYEYIRAEELHSLLHNL--------NKISGKPIVLKDYLTTLSLNVI 182

Query: 602  MQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVK 781
             ++V G+RY   S+ +I    +  KK+  ++  L G    GD+I  + F   +D +G+VK
Sbjct: 183  SRMVLGKRYLDESENSI-VTPEEFKKMLDELFLLNGVLNIGDSIPWIDF---MDLQGYVK 238

Query: 782  TMKRAAKDVDAILQDWVDARRKERRSNED---QKFIDVMLSMIDDQFTQGYSYSRDTVIK 952
             MK  +K  D  L+  +D     R   E+   +  +DV+L + DD  T      R  V K
Sbjct: 239  RMKFVSKKFDKFLEHVIDEHNVRRNGVENYIAKDMVDVLLQLADDP-TLEVKLERHGV-K 296

Query: 953  AIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYL 1132
            A    ML   +E+ A  + W ++ LLK PE  K+  +E+D  IG+ RW ++ D+ NLPY+
Sbjct: 297  AFTQDMLAGGTESSAVTVEWAISELLKKPEIFKKATEELDRVIGQNRWVQEKDIPNLPYI 356

Query: 1133 QGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFL 1312
            + +VKET+R++P  P L P E  EDC V GY + KGT++ V+VW + RDP +W +PE F 
Sbjct: 357  EAIVKETMRLHPVAPMLVPRECREDCKVAGYDVKKGTRVLVSVWTIGRDPTLWDEPEAFK 416

Query: 1313 PERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN-- 1486
            PERF  + +    +   ++ +PFG GRR CPG     ++ Q ++A L  GFN+S   N  
Sbjct: 417  PERF--HEKSIDVKGHDFELLPFGAGRRMCPGYNLGLKVIQASLANLIHGFNWSLPDNMT 474

Query: 1487 -EPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
             E LDM E  G+  PK  PL  ++ PRLSP L+
Sbjct: 475  PEDLDMDEIFGLSTPKKFPLATVIEPRLSPKLY 507



>gb:AY050849_1562347 Arabidopsis thaliana putative cytochrome P450
            protein (At3g28740) mRNA, complete
            cds.>gb:AY113869_1578280 Arabidopsis thaliana putative
            cytochrome P450 protein (At3g28740) mRNA, complete
            cds.>gb:AP002057_1821733 Arabidopsis thaliana genomic
            DNA, chromosome 3, BAC clone: T19N8.
          Length = 509

 Score =  296 bits (757), Expect = 1e-78
 Identities = 196/522 (37%), Positives = 287/522 (54%), Gaps = 7/522 (1%)
 Frame = +2

Query: 20   KCVMDAVPCCLSSILGIAALVL-LWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVK 196
            K +M+ +   LS       L L L F  R +   LPP     +PIIGHLH  +  +PL +
Sbjct: 5    KTIMETIYLILSLFFFFIFLSLKLLFGPRPRKLNLPPSPSRPFPIIGHLHLLK--LPLHR 62

Query: 197  ---TLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYD 367
               +LSE  +    +F++ LG   + VVSS     +CF  ND +LA RP    GK++GY+
Sbjct: 63   RFLSLSESLNN-AKIFSLSLGSRLVFVVSSHAVAEECFTKNDVVLANRPEFLVGKHIGYN 121

Query: 368  YAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPS 547
                  +     WR +R++   EI SS RL      +VS  Q  I+ L   ++  N+   
Sbjct: 122  STTMVGAAYGDSWRNLRRIGTIEIFSSLRLNS----FVSIRQDEIRRLIICLAK-NSQHG 176

Query: 548  APKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINE-EAQRLKKVFSQVMYLWGEFVSG 724
              KV M   F  LT+N I+++VAG+R+    DGT N+ EA+ ++++ ++V+   G   + 
Sbjct: 177  FVKVEMKPLFMCLTINNIIRMVAGKRFY--GDGTENDNEAKHVRQLIAEVVVSGGAGNAA 234

Query: 725  DAIFPLWFFRWL-DYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMI 901
            D  FP+   R++ +YE HVK +   A  VD  LQ  V+ +R E+        ID +LS+ 
Sbjct: 235  D-YFPI--LRYVTNYEKHVKKL---AGRVDEFLQSLVNEKRVEKVKGNTM--IDHLLSLQ 286

Query: 902  DDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNI 1081
            + Q      Y  D +IK I+L M+   ++T A  L W ++ LL HPE L++ + EID  I
Sbjct: 287  ETQ----PDYYTDVIIKGIILVMILAGTDTSAGTLEWAMSNLLNHPEVLRKAKTEIDDQI 342

Query: 1082 GKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNV 1261
            G +R  E+ D+  LPYLQ +V ETLR+YP  P L PH A EDCIVDGY +P+GT + VN 
Sbjct: 343  GVDRLVEEQDIVKLPYLQHIVSETLRLYPVAPMLLPHLASEDCIVDGYDVPRGTIILVNA 402

Query: 1262 WRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVA 1441
            W +HRDPK+W +PEKF PERF    E +       + +PFG+GRRSCPG+  A ++  +A
Sbjct: 403  WAIHRDPKLWEEPEKFKPERFEKKGEDK-------KLMPFGIGRRSCPGSGLAQRLVTLA 455

Query: 1442 VARLFQGFNFSTVPNEPLDMME-DVGIILPKLTPLEVLVTPR 1564
            +  L Q F +  V  + LDM E + G  + K T L+ +   R
Sbjct: 456  LGSLVQCFEWERVEEKYLDMRESEKGTTMRKATSLQAMCKAR 497



>gb:AP005419_1851476 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, PAC
            clone:P0046G12.>gb:AP005570_1854238 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 9, BAC
            clone:OJ1344_B01.
          Length = 522

 Score =  295 bits (756), Expect = 1e-78
 Identities = 173/508 (34%), Positives = 282/508 (55%), Gaps = 13/508 (2%)
 Frame = +2

Query: 101  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW 280
            R++   LPP     WPIIG+L+    ++P  +++ E + +YGP+  +R G   ++V SS 
Sbjct: 28   RRRKYNLPP-GPKPWPIIGNLN-LVGALPH-RSIHELSRRYGPLVYLRFGSFPVVVGSSV 84

Query: 281  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE 460
            E  R    T D     RP T AGK+  Y+Y   T+S  ++YWR+ R++V+ E+ S+RR+E
Sbjct: 85   EMARFFLKTRDAAFIDRPRTAAGKHTAYNYRDITWSPCDAYWRQARRVVLTELFSARRIE 144

Query: 461  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYE--- 631
              +H+   E+   +++L+   S         K  +S      +LN+I ++V G+RY    
Sbjct: 145  SYEHIRREEVHALLRDLHYASSSGGRRAIVIKDYLST----ASLNMITRMVMGKRYVQGE 200

Query: 632  --YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKD 805
              +   G+      + K++  ++ +L G F  GD I    +  WLD +G+VK MK+ +K 
Sbjct: 201  VVHEEPGSARTTLAQFKELLEELFFLNGVFNVGDQIP---WLEWLDLQGYVKRMKKVSKA 257

Query: 806  VDAILQDWVDARRKERRSNEDQKFI-----DVMLSMIDDQFTQGYSYSRDTVIKAIVLSM 970
            +D +L+  VD    ERR  E   F+     DV+L + DD   +    SRD+ IKA    +
Sbjct: 258  LDQLLEHVVD-EHSERRQREGNGFVAGDMVDVLLRLADDSSLE-VKLSRDS-IKAFTQDL 314

Query: 971  LQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKE 1150
            +   +E+ +  + W ++ LL+ PE   +  +E+D  +G  RW  + D+ +LPY++ +VKE
Sbjct: 315  IAGGTESSSETIEWAISELLRKPEMFAKATEELDRIVGHRRWVNEKDILDLPYIEAIVKE 374

Query: 1151 TLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMT 1330
            T+R++P GP LAP  + ED  V GY IP GT+++VNVW + RDP +W   E+F+PERF+ 
Sbjct: 375  TMRLHPIGPLLAPRLSREDTSVGGYDIPTGTRVFVNVWAIARDPTLWDASEEFMPERFLG 434

Query: 1331 NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF---STVPNEPLDM 1501
                   Q+  ++ +PFG GRR CPG     ++ Q+++A L  GF +     +  E L M
Sbjct: 435  KKIDVKGQD--FELLPFGSGRRMCPGYNLGLKVIQLSIANLLHGFTWRLPKDMVKEDLSM 492

Query: 1502 MEDVGIILPKLTPLEVLVTPRLSPTLFR 1585
             E  G+ +P+  PLEV V P+LS  L++
Sbjct: 493  EEIFGLSMPRKFPLEVAVEPKLSSHLYK 520



>gb:AK175373_1817361 Arabidopsis thaliana mRNA for cytochrome
            P450-like protein, complete cds, clone: RAFL21-81-A14.
          Length = 500

 Score =  294 bits (753), Expect = 3e-78
 Identities = 179/492 (36%), Positives = 264/492 (53%), Gaps = 5/492 (1%)
 Frame = +2

Query: 104  KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYG--PVFTIRLGISRILVVSS 277
            K+   LPP    A P+IGHL   +   PL +     ++  G  P+ ++RLG   + VVSS
Sbjct: 25   KRRPNLPPSPSWALPVIGHLRLLKP--PLHRVFLSVSESLGDAPIISLRLGNRLVFVVSS 82

Query: 278  WEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRL 457
                 +CF  ND +LA R  + A K++ Y       ++   +WR +R++   EI S+ RL
Sbjct: 83   HSLAEECFTKNDVVLANRFNSLASKHISYGCTTVVTASYGDHWRNLRRIGAVEIFSAHRL 142

Query: 458  EKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYR 637
                 +   E+   I  L       N++    KV M   F +LT N I++++AG+ Y Y 
Sbjct: 143  NSFSSIRRDEIHRLIACLSR-----NSSLEFTKVEMKSMFSNLTFNNIIRMLAGKCY-YG 196

Query: 638  SDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAI 817
                 + EA+R++++ ++ M   G F +G+    L    W+   G  K +K+ A  +D  
Sbjct: 197  DGAEDDPEAKRVRELIAEGM---GCFGAGNTADYLPILTWIT--GSEKRIKKIASRLDEF 251

Query: 818  LQDWVDARR--KERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASET 991
            LQ  VD RR  KE+R N     +D +L + + Q      Y  D +IK I+LS++   ++T
Sbjct: 252  LQGLVDERREGKEKRQNT---MVDHLLCLQETQ----PEYYTDNIIKGIMLSLILAGTDT 304

Query: 992  FATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQ 1171
             A  L W L+ LL HP+ L + +DEID  +G  R  E+SD+ +LPYLQ +V E+LR+YP 
Sbjct: 305  SAVTLEWTLSALLNHPQILSKARDEIDNKVGLNRLVEESDLSHLPYLQNIVSESLRLYPA 364

Query: 1172 GPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA 1351
             P L PH A EDC V GYH+P+GT L  N W +HRDPKIW DP  F PERF    EGEA 
Sbjct: 365  SPLLVPHVASEDCKVGGYHMPRGTMLLTNAWAIHRDPKIWDDPTSFKPERF--EKEGEA- 421

Query: 1352 QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMME-DVGIILP 1528
                 + + FGLGRR+CPG+  A ++  + +  L Q F +  +  E +DM E   G+I+P
Sbjct: 422  ----QKLLGFGLGRRACPGSGLAQRLASLTIGSLIQCFEWERIGEEEVDMTEGGGGVIMP 477

Query: 1529 KLTPLEVLVTPR 1564
            K  PL  +   R
Sbjct: 478  KAIPLVAMCKAR 489



>pir|C85441|C85441 cytochrome P450-like protein [imported] -
            Arabidopsis thaliana>gb:ATAP21_1543963 Arabidopsis
            thaliana DNA chromosome 4, ESSA I AP2 contig fragment No.
            1.>gb:ATCHRIV87_1547689 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 87.
          Length = 500

 Score =  294 bits (753), Expect = 3e-78
 Identities = 179/492 (36%), Positives = 264/492 (53%), Gaps = 5/492 (1%)
 Frame = +2

Query: 104  KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYG--PVFTIRLGISRILVVSS 277
            K+   LPP    A P+IGHL   +   PL +     ++  G  P+ ++RLG   + VVSS
Sbjct: 25   KRRPNLPPSPSWALPVIGHLRLLKP--PLHRVFLSVSESLGDAPIISLRLGNRLVFVVSS 82

Query: 278  WEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRL 457
                 +CF  ND +LA R  + A K++ Y       ++   +WR +R++   EI S+ RL
Sbjct: 83   HSLAEECFTKNDVVLANRFNSLASKHISYGCTTVVTASYGDHWRNLRRIGAVEIFSAHRL 142

Query: 458  EKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYR 637
                 +   E+   I  L       N++    KV M   F +LT N I++++AG+ Y Y 
Sbjct: 143  NSFSSIRRDEIHRLIACLSR-----NSSLEFTKVEMKSMFSNLTFNNIIRMLAGKCY-YG 196

Query: 638  SDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAI 817
                 + EA+R++++ ++ M   G F +G+    L    W+   G  K +K+ A  +D  
Sbjct: 197  DGAEDDPEAKRVRELIAEGM---GCFGAGNTADYLPILTWIT--GSEKRIKKIASRLDEF 251

Query: 818  LQDWVDARR--KERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASET 991
            LQ  VD RR  KE+R N     +D +L + + Q      Y  D +IK I+LS++   ++T
Sbjct: 252  LQGLVDERREGKEKRQNT---MVDHLLCLQETQ----PEYYTDNIIKGIMLSLILAGTDT 304

Query: 992  FATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQ 1171
             A  L W L+ LL HP+ L + +DEID  +G  R  E+SD+ +LPYLQ +V E+LR+YP 
Sbjct: 305  SAVTLEWTLSALLNHPQILSKARDEIDNKVGLNRLVEESDLSHLPYLQNIVSESLRLYPA 364

Query: 1172 GPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA 1351
             P L PH A EDC V GYH+P+GT L  N W +HRDPKIW DP  F PERF    EGEA 
Sbjct: 365  SPLLVPHVASEDCKVGGYHMPRGTMLLTNAWAIHRDPKIWDDPTSFKPERF--EKEGEA- 421

Query: 1352 QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMME-DVGIILP 1528
                 + + FGLGRR+CPG+  A ++  + +  L Q F +  +  E +DM E   G+I+P
Sbjct: 422  ----QKLLGFGLGRRACPGSGLAQRLASLTIGSLIQCFEWERIGEEEVDMTEGGGGVIMP 477

Query: 1529 KLTPLEVLVTPR 1564
            K  PL  +   R
Sbjct: 478  KAIPLVAMCKAR 489



>gb:AX031179_1457266 Sequence 20 from Patent WO9846762.
          Length = 499

 Score =  293 bits (751), Expect = 6e-78
 Identities = 168/504 (33%), Positives = 270/504 (53%), Gaps = 10/504 (1%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGP 229
            L S+     L+   F   K  + LPP    ++PI GHLH  +   P+ +TL + A KYG 
Sbjct: 10   LVSLFLFLILIKFTFLKLKTPQNLPPSPP-SFPITGHLHLLKQ--PIHRTLHQIATKYGD 66

Query: 230  VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWR 409
            +  +R G  ++LV+SS  AV++CF  ND + A RPT  AGK+L Y+     F++   +WR
Sbjct: 67   ILFLRFGTRKVLVISSLPAVQECFTINDIIFANRPTILAGKHLNYNSTTMGFASYGDHWR 126

Query: 410  RVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLT 589
             +R+L   E+ S+ R+        S  + +    +    +  N  S   V ++     LT
Sbjct: 127  HLRRLTTIELFSANRVAMF-----SGFRADESTAFYQTVVPGNRDSGKIVTLTSKLMELT 181

Query: 590  LNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYE 769
            LN IM++ AG+R+  +     +EE + L+ +  ++  L G        FP+   +W+DY+
Sbjct: 182  LNNIMRMAAGKRFYGKE--VKDEEGELLQDLMKKMEALRGNSTVKRDYFPV--LQWIDYQ 237

Query: 770  GHVKTMKRAAKDVDAILQD----------WVDARRKERRSNEDQKFIDVMLSMIDDQFTQ 919
            G  K M+   K +D  LQ+          W++  R  R        +DVML++   + TQ
Sbjct: 238  GVKKKMRNLMKKMDGFLQNLIDEHRNTTLWINQVRATRTKRGTWTLVDVMLNL---KKTQ 294

Query: 920  GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWA 1099
               Y+ D  IK ++ + L   S+T A  L W L++LL HP+ + +   EI+  +G  R  
Sbjct: 295  PDFYT-DLTIKGVIQTTLTAGSQTSAVTLEWALSLLLNHPQVMHKAYAEIEAIVGTNRLL 353

Query: 1100 EDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRD 1279
             ++D+ +L YLQ ++ ET R++P  P L PH++  DCIV G+HIP+GT L VN W ++R+
Sbjct: 354  NEADLPHLSYLQNIITETFRLFPPVPLLLPHKSSADCIVSGFHIPRGTMLLVNTWSMNRN 413

Query: 1280 PKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQ 1459
            P++W +PEKF+PERF     GE  +   Y+ +PFG GRR+CPG   A ++  + +  L Q
Sbjct: 414  PRLWKEPEKFIPERFE---GGENTEGCNYKLLPFGAGRRACPGAGVAKRMVGLTLGALIQ 470

Query: 1460 GFNFSTVPNEPLDMMEDVGIILPK 1531
             F +  +  E +D+ E  G+ +PK
Sbjct: 471  CFEWERIGEEEIDLSEGTGLTMPK 494



>gb:CAR239051_1645168 Cicer arietinum mRNA for cytochrome P450
            (cyp81E2 gene).
          Length = 499

 Score =  293 bits (750), Expect = 7e-78
 Identities = 175/491 (35%), Positives = 267/491 (54%), Gaps = 4/491 (0%)
 Frame = +2

Query: 86   LWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRIL 265
            L FS RK  K+LPP    + PIIG+LH  +   P+  T    + KYGP+FT++ G   ++
Sbjct: 21   LLFSKRK-FKKLPP-CPPSIPIIGNLHQVKQ--PIHHTFYNLSKKYGPIFTLKFGSQPVV 76

Query: 266  VVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILS 445
            VVSS   V +CF  ND + A R  +   KYLGY+      ++    WR +R++   EILS
Sbjct: 77   VVSSASLVEECFTKNDIIFANRIHSAKTKYLGYNNTNMVSTSYGDLWRNLRRISSIEILS 136

Query: 446  SRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRR 625
            + RL     +   E    I +L        ++    KV +   FG LT N IM++V G+R
Sbjct: 137  THRLNSFSEIRKDETMRLIGKL-----AKKSHKDFTKVELRSLFGELTFNTIMRMVCGKR 191

Query: 626  -YEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAK 802
             Y   SDGT  EEA++ + + +++         GD + PL  F+  D+ G  K +K+  +
Sbjct: 192  FYGEESDGTNAEEAKKFRDMMNEMQEFGLGSNLGDFV-PL--FKLFDFSGGHKKLKKVGE 248

Query: 803  DVDAILQDWVDARRKERRSNEDQKF---IDVMLSMIDDQFTQGYSYSRDTVIKAIVLSML 973
             +DA+ Q  VD    E R+N+D+     ID +LS+ + Q      Y  D +IK ++++++
Sbjct: 249  KMDALFQGLVD----EHRNNKDKNLNTMIDHLLSLQESQ----PDYYSDQIIKGLIMALI 300

Query: 974  QDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKET 1153
               +ET +  L W ++ LL HPE L++ + E+D +IG+E   E+++   L YLQ ++ ET
Sbjct: 301  VAGTETSSVTLEWAMSNLLNHPEILEKAKIELDNHIGQEHLIEEAEATKLQYLQNIISET 360

Query: 1154 LRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTN 1333
            LR++P    L PH +  DC + GY +P+ T L VN W +HRDP +W DP  F PERF   
Sbjct: 361  LRLHPPVTMLLPHLSSHDCTIGGYDVPRNTMLMVNAWAIHRDPNLWADPMSFKPERF--- 417

Query: 1334 LEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDV 1513
               E  Q     F+PFG+GRR+CPG+  A +   + +  L Q F +  +  E +DM E  
Sbjct: 418  ---ENGQGDIGGFIPFGMGRRACPGSGLALRTLGLTLGSLIQCFEWKRIGKEEVDMSEGS 474

Query: 1514 GIILPKLTPLE 1546
            G ++PK  PLE
Sbjct: 475  GTVVPKAIPLE 485



>gb:AY278229_1594517 Medicago truncatula CYP81E8 mRNA, complete cds.
          Length = 499

 Score =  293 bits (750), Expect = 7e-78
 Identities = 179/513 (34%), Positives = 277/513 (53%), Gaps = 8/513 (1%)
 Frame = +2

Query: 50   LSSILGIAALVL---LWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADK 220
            LS I+ +  L++   ++F+  ++ K LPP      PIIG+LH  +   PL  T    + K
Sbjct: 6    LSLIISLFFLIITLKVFFNTSRKFKNLPP-GPQCLPIIGNLHQLKQ--PLHHTFHTLSQK 62

Query: 221  YGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNS 400
            YG +F++  G   ++VVSS    ++CF  ND +LA RP    GKY+GY+      S    
Sbjct: 63   YGQIFSLWFGSRLVVVVSSLTIAQECFTKNDIVLANRPHFLTGKYIGYNNTTVAQSPYGD 122

Query: 401  YWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFG 580
            +WR +R+++  EILSS RL     +   E+   I++L        +     +V +   F 
Sbjct: 123  HWRNLRRILSIEILSSHRLNSFLEIRRDEIMRLIQKL-----AQKSYNGFTEVELRPMFS 177

Query: 581  HLTLNLIMQIVAGRRYEYRSDGTIN--EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR 754
             +T N IM++V+G+RY Y +D  ++  EEA+  + +  +V+ L G    GD    L F R
Sbjct: 178  EMTFNTIMRMVSGKRY-YGNDCDVSDVEEARLFRGIIKEVVSLGGANNVGDF---LGFLR 233

Query: 755  WLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYS-- 928
            W D++G  K +K+ +K  DA LQ  +D  R  +R++          +MID   TQ  S  
Sbjct: 234  WFDFDGLEKRLKKISKRTDAFLQGLIDEHRFGKRNSN---------TMIDHLLTQQQSQP 284

Query: 929  -YSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED 1105
             Y  D +IK +++ ML   ++T +  + W ++ LL HPE +K+ ++E+DT+IG +R  ++
Sbjct: 285  EYYTDQIIKGLMVVMLLAGTDTSSVTIEWAMSNLLNHPEIMKKAKNELDTHIGHDRQVDE 344

Query: 1106 SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK 1285
             D+  LPYLQ +V ETLR++   P L PH + ED  + GY+IP+ T L VN W +HRDP 
Sbjct: 345  HDISKLPYLQSIVYETLRLHAAAPLLVPHLSSEDFSLGGYNIPQNTILMVNAWVIHRDPN 404

Query: 1286 IWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF 1465
            +W DP  F PERF    EGE       + + FGLGRR+CPG   + +   + +  L Q F
Sbjct: 405  LWSDPTCFKPERF--EKEGEV-----NKLLSFGLGRRACPGENLSQRTEGLTLGLLIQCF 457

Query: 1466 NFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPR 1564
             +  +  E +DM+E  GI   K T L  +   R
Sbjct: 458  EWKRIGEEKIDMVEAKGITAGKKTSLNAMCKVR 490



>pir|B85441|B85441 cytochrome P450-like protein [imported] -
            Arabidopsis thaliana>gb:ATAP21_1543964 Arabidopsis
            thaliana DNA chromosome 4, ESSA I AP2 contig fragment No.
            1.>gb:ATCHRIV87_1547688 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 87.
          Length = 492

 Score =  291 bits (746), Expect = 2e-77
 Identities = 181/514 (35%), Positives = 270/514 (52%), Gaps = 2/514 (0%)
 Frame = +2

Query: 29   MDAVPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSE 208
            MD     + S L +  L +   +  K+   LPP    + P+IGHLH  +   PL +T   
Sbjct: 1    MDLNQILILSFLSLFTLAIFLLTRSKRKLNLPPSPAISLPVIGHLHLLKP--PLHRTFLS 58

Query: 209  WADKYG--PVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT 382
             +   G  PVF +RLG   + V+SS     +CF  ND +LA RP     K+LGY+     
Sbjct: 59   LSKSIGNAPVFHLRLGNRLVYVISSRSIAEECFTKNDVVLANRPKFTISKHLGYNATYLL 118

Query: 383  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVN 562
             ++   +WR +R++   EI S+ RL    ++   E    I+ L + +S D+ +    +V 
Sbjct: 119  SASYGDHWRNLRRIAAVEIFSTHRLNSFLYIRKDE----IRRLISHLSRDSLHGFV-EVE 173

Query: 563  MSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL 742
            M     +L  N  ++++AG+RY     G  N++A+ +K + S+ +   G   +G+ I  L
Sbjct: 174  MKTLLTNLASNTTIRMLAGKRYF----GEDNDDAKLVKNLVSEAVTSAG---AGNPIDYL 226

Query: 743  WFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQG 922
               RW+    + K +K      D  LQ  VD +R E+   E    ID +L++ D Q    
Sbjct: 227  SILRWVS--SYEKRIKNLGNRFDTFLQKLVDEKRAEKEKGETM--IDHLLALQDIQ---- 278

Query: 923  YSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAE 1102
              Y  D +IK I+L+++   ++T +  L W ++ LL HPE LK+ + EID  +G +R  +
Sbjct: 279  PDYYTDVIIKGIILTLIIAGTDTSSVTLEWAMSNLLNHPEILKKARMEIDEKVGLDRLVD 338

Query: 1103 DSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDP 1282
            +SD+ NL YLQ +V ETLRMYP  P L PH + EDC V GY IP GT +  N W +HRDP
Sbjct: 339  ESDIVNLSYLQSIVLETLRMYPAVPLLLPHLSSEDCKVGGYDIPSGTMVLTNAWAMHRDP 398

Query: 1283 KIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQG 1462
            ++W DPE F PERF    EGEA      + + FG+GRR+CPG   A ++   A+  L Q 
Sbjct: 399  EVWEDPEIFKPERF--EKEGEAE-----KLISFGMGRRACPGAGLAHRLINQALGSLVQC 451

Query: 1463 FNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPR 1564
            F +  V  + +DM ED G  LPK  PL  +   R
Sbjct: 452  FEWERVGEDFVDMTEDKGATLPKAIPLRAMCKAR 485



>pir|T04730|T04730 cytochrome P450 homolog F6G17.10 - Arabidopsis
            thaliana>gb:ATCHRIV87_1547690 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 87.>gb:ATF6G17_1550809
            Arabidopsis thaliana DNA chromosome 4, BAC clone F6G17
            (ESSA project).
          Length = 499

 Score =  291 bits (745), Expect = 3e-77
 Identities = 173/489 (35%), Positives = 263/489 (53%), Gaps = 2/489 (0%)
 Frame = +2

Query: 104  KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYG--PVFTIRLGISRILVVSS 277
            K+   LPP    A P+IGHL   +   PL +     +   G  P+ ++RLG   + VVSS
Sbjct: 25   KRKLNLPPSPAWALPVIGHLRLLKP--PLHRVFLSVSQSLGDAPIISLRLGNRLLFVVSS 82

Query: 278  WEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRL 457
                 +CF  ND +LA R TT + K++ Y  +    ++ + +WR +R++   EI S+ RL
Sbjct: 83   HSIAEECFTKNDVILANRQTTISTKHISYGNSTVVSASYSEHWRNLRRIGALEIFSAHRL 142

Query: 458  EKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYR 637
                 +   E++  I  L     + N++    KV M   F  LT N I++++AG+ Y Y 
Sbjct: 143  NSFSSIRRDEIRRLIGRL-----LRNSSYGFTKVEMKSMFSDLTFNNIIRMLAGKCY-YG 196

Query: 638  SDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAI 817
                 + EA+R++ + ++ M   G    G+A   +    W+ Y      +K+ A  +D  
Sbjct: 197  DGKEDDPEAKRVRTLIAEAMSSSGP---GNAADYIPILTWITYSE--TRIKKLAGRLDEF 251

Query: 818  LQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFA 997
            LQ  VD +R E +  ++   +D +L + + Q      Y  D +IK  +LS++   ++T A
Sbjct: 252  LQGLVDEKR-EGKEKKENTMVDHLLCLQETQ----PEYYMDRIIKGTMLSLIAGGTDTTA 306

Query: 998  THLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGP 1177
              L W L+ LL +PE L + +DEID  IG +R  E+SD+ NLPYLQ +V ETLR+YP  P
Sbjct: 307  VTLEWALSSLLNNPEVLNKARDEIDRMIGVDRLLEESDIPNLPYLQNIVSETLRLYPAAP 366

Query: 1178 YLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQN 1357
             L PH A +DC V GY +P+GT L  N W +HRDP +W DP  F PERF    EGEA   
Sbjct: 367  MLLPHVASKDCKVGGYDMPRGTMLLTNAWAIHRDPLLWDDPTSFKPERF--EKEGEAK-- 422

Query: 1358 RQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLT 1537
               + +PFGLGRR+CPG+  A ++  +++  L Q F +  +  E +DM E  G+ +PK  
Sbjct: 423  ---KLMPFGLGRRACPGSGLAQRLVTLSLGSLIQCFEWERIGEEEVDMTEGPGLTMPKAR 479

Query: 1538 PLEVLVTPR 1564
            PLE +   R
Sbjct: 480  PLEAMCRAR 488



>pir|H85440|H85440 cytochrome P450-like protein [imported] -
            Arabidopsis thaliana>gb:ATAP21_1543966 Arabidopsis
            thaliana DNA chromosome 4, ESSA I AP2 contig fragment No.
            1.>gb:ATCHRIV87_1547686 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 87.
          Length = 518

 Score =  289 bits (739), Expect = 1e-76
 Identities = 172/519 (33%), Positives = 287/519 (55%), Gaps = 7/519 (1%)
 Frame = +2

Query: 29   MDAVPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSE 208
            MD +   L++++ I  +V +     K +K LPP     +PIIGHLH  +  + L +TLS 
Sbjct: 1    MDCILLILTTLVAIF-IVKIVLLVTKPNKNLPPSPNICFPIIGHLHLLKKPL-LHRTLSH 58

Query: 209  WADKYGPVFTIRLGISRILVVSSWEAVRDCFAT-NDKLLAARPTTCAGKYLGYDYAVFTF 385
             +   GPVF++RLG    +++SS  A  +CF T ND +LA RP    GKY+ YDY     
Sbjct: 59   LSHSLGPVFSLRLGSRLAVIISSPTAAEECFLTKNDIVLANRPRFIMGKYVAYDYTSMVT 118

Query: 386  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM 565
            +    +WR +R++   E+ S+ RL     +   E++  +++L+     D +     KV +
Sbjct: 119  APYGDHWRNLRRITALEVFSTNRLNASAEIRHDEVKMLLQKLH-----DLSVERPAKVEL 173

Query: 566  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW 745
             +    LTLN+IM+++ G+R+    DG     +   +++ ++++ L       D +  L 
Sbjct: 174  RQLLTGLTLNVIMRMMTGKRFFEEDDGGKAGISLEFRELVAEILELSAADNPADFLPAL- 232

Query: 746  FFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQ-KFIDVMLS-MIDDQFTQ 919
              RW DY+G VK  KR  + +D++LQ ++D    E R+N+D+ +F + M++ ++D Q  +
Sbjct: 233  --RWFDYKGLVKRAKRIGERMDSLLQGFLD----EHRANKDRLEFKNTMIAHLLDSQEKE 286

Query: 920  GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNI---GKE 1090
             ++YS D  IK ++L M+   ++T A  + W ++ LL HP+ L+  +  IDT +      
Sbjct: 287  PHNYS-DQTIKGLILMMVVGGTDTSALTVEWAMSNLLNHPQILETTRQNIDTQMETSSSR 345

Query: 1091 RWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRL 1270
            R  ++ D+ N+ YL+ VV ETLR+YP  P + PH    DC++ G+++P+ T + VN+W +
Sbjct: 346  RLLKEEDLVNMNYLKNVVSETLRLYPVAPLMVPHVPSSDCVIGGFNVPRDTIVLVNLWAI 405

Query: 1271 HRDPKIWPDPEKFLPERFMTNLEG-EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA 1447
            HRDP +W DP  F PERF    EG +   +   + +PFGLGRR+CPG   A ++  + + 
Sbjct: 406  HRDPSVWDDPTSFKPERF----EGSDQFGHYNGKMMPFGLGRRACPGLSLANRVVGLLLG 461

Query: 1448 RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPR 1564
             + Q F + +     +DM E  G+ LPK  PL V    R
Sbjct: 462  SMIQCFEWESGSGGQVDMTEGPGLSLPKAEPLVVTCRTR 500



>pir|A85441|A85441 cytochrome P450-like protein [imported] -
            Arabidopsis thaliana>gb:ATAP21_1543965 Arabidopsis
            thaliana DNA chromosome 4, ESSA I AP2 contig fragment No.
            1.>gb:ATCHRIV87_1547687 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 87.>gb:BT002874_1636465
            Arabidopsis thaliana clone RAFL15-01-B10 (R20394)
            putative cytochrome p450 family protein (At4g37320) mRNA,
            complete cds.>gb:BT004449_1637521 Arabidopsis thaliana
            clone U20394 putative cytochrome p450 family protein
            (At4g37320) mRNA, complete cds.
          Length = 495

 Score =  288 bits (736), Expect = 3e-76
 Identities = 176/515 (34%), Positives = 274/515 (53%), Gaps = 3/515 (0%)
 Frame = +2

Query: 29   MDAVPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSE 208
            MD     L S L +   + L  +   +   LPP      P+IGHLH  +   P+ +T   
Sbjct: 1    MDLTQILLLSFLFLTISIKLLLTKSNRKPNLPPSPAYPLPVIGHLHLLKQ--PVHRTFHS 58

Query: 209  WADKYG--PVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT 382
             +   G  P+F +RLG   + V+SS     +CF  ND +LA RP     K++GY++    
Sbjct: 59   ISKSLGNAPIFHLRLGNRLVYVISSHSIAEECFTKNDVVLANRPDIIMAKHVGYNFTNMI 118

Query: 383  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVN 562
             ++   +WR +R++   EI SS R+     +   E    I+ L T +S D+ +    +V 
Sbjct: 119  AASYGDHWRNLRRIAAVEIFSSHRISTFSSIRKDE----IRRLITHLSRDSLHGFV-EVE 173

Query: 563  MSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL 742
            +     +L  N I+ +VAG+RY Y +    N+EA+ ++++ +++M   G   SG+    L
Sbjct: 174  LKSLLTNLAFNNIIMMVAGKRY-YGTGTEDNDEAKLVRELIAEIMAGAG---SGNLADYL 229

Query: 743  WFFRWL-DYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQ 919
                W+ ++E   K +      +D +LQ  VD +R E+     Q  ID +LS  + +   
Sbjct: 230  PSINWVTNFENQTKIL---GNRLDRVLQKLVDEKRAEKEKG--QTLIDHLLSFQETE--- 281

Query: 920  GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWA 1099
               Y  D +IK I+L+++   ++T +  L W ++ LL HPE L++ + EID  IG +R  
Sbjct: 282  -PEYYTDVIIKGIILALVLAGTDTSSVTLEWAMSNLLNHPEILEKARAEIDDKIGSDRLV 340

Query: 1100 EDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRD 1279
            E+SD+ NL YLQ +V ETLR+YP  P L PH + ++C V GY +P+ T L  NVW +HRD
Sbjct: 341  EESDIVNLHYLQNIVSETLRLYPAVPLLLPHFSSDECKVAGYDMPRRTLLLTNVWAMHRD 400

Query: 1280 PKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQ 1459
            P +W +PE+F PERF    EGEA      + +PFG+GRR+CPG     ++  +A+  L Q
Sbjct: 401  PGLWEEPERFKPERF--EKEGEAR-----KLMPFGMGRRACPGAELGKRLVSLALGCLIQ 453

Query: 1460 GFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPR 1564
             F +  V  E +DM E  GI +PK TPL  +   R
Sbjct: 454  SFEWERVGAELVDMTEGEGITMPKATPLRAMCKAR 488



>gb:AY278228_1594516 Medicago truncatula isoflavone 3'-hydroxylase
            mRNA, partial cds.
          Length = 501

 Score =  287 bits (734), Expect = 5e-76
 Identities = 170/503 (33%), Positives = 271/503 (53%), Gaps = 4/503 (0%)
 Frame = +2

Query: 56   SILGIAALVLLWFSWRKQSKRLP--PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGP 229
            S+L ++ ++ +    +  S+RL   P      PIIG+LHH +   PL +T +  +  YG 
Sbjct: 6    SLLSLSFIITIKILLKITSRRLKNLPPGPPTIPIIGNLHHLKH--PLHRTFTTLSQTYGD 63

Query: 230  VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWR 409
            +F++  G   ++VVSS     +CF  ND +LA RP    GKY+ Y+Y     ++   +WR
Sbjct: 64   IFSLWFGSRLVVVVSSPSLAHECFTKNDIILANRPRFLTGKYIFYNYTTLGSASYGDHWR 123

Query: 410  RVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLT 589
             +R++   ++LS+ RL     V   E    I++L   +  +    +  KV +      +T
Sbjct: 124  NLRRITTIDVLSNNRLNSFLGVRRDETNRLIQKLLKDVVSEGFGFT--KVELRPRLTEMT 181

Query: 590  LNLIMQIVAGRRYEYRSDGTIN--EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD 763
             N +M++++G+RY Y  DG ++  EEA++ +++ S++M L G    GD + PL   R +D
Sbjct: 182  FNAMMRMISGKRY-YGDDGDVSDVEEAKQFREIISEMMSLLGANNKGDFL-PL--LRVVD 237

Query: 764  YEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDT 943
             +   K  KR AK  +A L+  ++  R+    ++    ID +L + + Q      Y  D 
Sbjct: 238  LDNLEKRCKRIAKRSNAFLEGLIEEHRRGNIHSDGGTMIDHLLKLSESQ----PEYYSDH 293

Query: 944  VIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNL 1123
            +IK ++  ML   ++T A  + W+++ LL HPE LK+ ++E+DT IGK +  ++ D+  L
Sbjct: 294  LIKGLIQGMLLAGTDTSAVTIEWVMSELLNHPEVLKKAKEELDTQIGKNKLVDEQDLSKL 353

Query: 1124 PYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPE 1303
            PYLQ ++ ETLR++P  P L PH + EDC +  +++PK T +  NVW +HRDPK W D  
Sbjct: 354  PYLQNIISETLRLHPPAPLLLPHYSSEDCTIGEFNVPKDTIILTNVWGIHRDPKHWNDAL 413

Query: 1304 KFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVP 1483
             F PERF    E E   N+    + FGLGRR+CPG   A +     V  L Q F +    
Sbjct: 414  SFKPERF----EKEEEVNK---VMAFGLGRRACPGLSLAQRTVGFTVGLLIQCFEWERES 466

Query: 1484 NEPLDMMEDVGIILPKLTPLEVL 1552
             E LDMME  GI +P   PL  +
Sbjct: 467  EEKLDMMEGKGITMPMKIPLRAM 489



>gb:AY087256_1572290 Arabidopsis thaliana clone 33365 mRNA, complete
            sequence.
          Length = 500

 Score =  287 bits (734), Expect = 5e-76
 Identities = 164/504 (32%), Positives = 270/504 (53%), Gaps = 2/504 (0%)
 Frame = +2

Query: 59   ILGIAALVLLW-FSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVF 235
            +L +  LV+ + F + K  +   P    + P +GHLH  +   P+ + L  ++++YGP+F
Sbjct: 6    LLPLLFLVISYKFLYSKTQRFNLPPGPPSRPFVGHLHLMKP--PIHRLLQRYSNQYGPIF 63

Query: 236  TIRLGISRILVVSSWEAVRDCFA-TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRR 412
            ++R G  R++V++S    ++ F   ND +L++RP     KY+ Y++     +    +WR 
Sbjct: 64   SLRFGSRRVVVITSPSLAQESFTGQNDIVLSSRPLQLTSKYVAYNHTTVGTAPYGDHWRN 123

Query: 413  VRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTL 592
            +R++  +EILSS RL   +H+   E+   +  L  +    N +     + +      LT 
Sbjct: 124  LRRICSQEILSSHRLINFQHIRKDEILRMLTRLSRYTQTSNESNDFTHIELEPLLSDLTF 183

Query: 593  NLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEG 772
            N I+++V G+RY Y  D    EEA+  KK+   +    G   S D +  L  F       
Sbjct: 184  NNIVRMVTGKRY-YGDDVNNKEEAELFKKLVYDIAMYSGANHSADYLPILKLFG----NK 238

Query: 773  HVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIK 952
              K +K   K +D ILQ  +D  R+++  N     ++ ++S+   Q      Y  D +IK
Sbjct: 239  FEKEVKAIGKSMDDILQRLLDECRRDKEGNT---MVNHLISLQQQQ----PEYYTDVIIK 291

Query: 953  AIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYL 1132
             +++SM+   +ET A  L W +A LL++PE L++ + EID  IGK+R  ++SD+  LPYL
Sbjct: 292  GLMMSMMLAGTETSAVTLEWAMANLLRNPEVLEKARSEIDEKIGKDRLIDESDIAVLPYL 351

Query: 1133 QGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFL 1312
            Q VV ET R++P  P+L P    +D  + GY +P+ T + VN W +HRDP+IW +PEKF 
Sbjct: 352  QNVVSETFRLFPVAPFLIPRSPTDDMKIGGYDVPRDTIVMVNAWAIHRDPEIWEEPEKFN 411

Query: 1313 PERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEP 1492
            P+R+    +G  +    Y+ +PFG GRR+CPG     +I  +A+  L Q F +  V  E 
Sbjct: 412  PDRYN---DGCGSDYYVYKLMPFGNGRRTCPGAGLGQRIVTLALGSLIQCFEWENVKGEE 468

Query: 1493 LDMMEDVGIILPKLTPLEVLVTPR 1564
            +DM E  G+ + K+ PL  +  PR
Sbjct: 469  MDMSESTGLGMRKMDPLRAMCRPR 492



>pir|T04731|T04731 cytochrome P450 homolog F6G17.20 - Arabidopsis
            thaliana>gb:ATCHRIV87_1547691 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 87.>gb:ATF6G17_1550810
            Arabidopsis thaliana DNA chromosome 4, BAC clone F6G17
            (ESSA project).>gb:AY065192_1566346 Arabidopsis thaliana
            cytochrome P450-like protein (F6G17.20) mRNA, complete
            cds.>gb:BT000090_1634368 Arabidopsis thaliana cytochrome
            P450-like protein (At4g37370) mRNA, complete cds.
          Length = 497

 Score =  287 bits (734), Expect = 5e-76
 Identities = 181/512 (35%), Positives = 275/512 (53%), Gaps = 7/512 (1%)
 Frame = +2

Query: 56   SILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHF-----RTSVPLVKTLSEWADK 220
            SIL +   ++      K+   LPP    + P+IGHL        RT + L ++L+     
Sbjct: 9    SILFVVLSLIYLIGKLKRKPNLPPSPAWSLPVIGHLRLLKPPIHRTFLSLSQSLNN---- 64

Query: 221  YGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNS 400
              P+F++RLG   + V SS     +CF  ND +LA RP     K++ YDY     ++   
Sbjct: 65   -APIFSLRLGNRLVFVNSSHSIAEECFTKNDVVLANRPNFILAKHVAYDYTTMIAASYGD 123

Query: 401  YWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFG 580
            +WR +R++   EI S+ RL     +   E++  +  L    S +       KV+M     
Sbjct: 124  HWRNLRRIGSVEIFSNHRLNSFLSIRKDEIRRLVFRLSRNFSQE-----FVKVDMKSMLS 178

Query: 581  HLTLNLIMQIVAGRRYEYRSDGTINE-EAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRW 757
             LT N I+++VAG+RY    DG  ++ EA+R++++ + V+   G   +G+A+  L   R 
Sbjct: 179  DLTFNNILRMVAGKRYY--GDGVEDDPEAKRVRQLIADVVACAG---AGNAVDYLPVLRL 233

Query: 758  L-DYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYS 934
            + DYE  VK +   A  +D  LQ  VD +R+ +        ID +L++ + Q      Y 
Sbjct: 234  VSDYETRVKKL---AGRLDEFLQGLVDEKREAKEKGNTM--IDHLLTLQESQ----PDYF 284

Query: 935  RDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDV 1114
             D +IK  +L+++   ++T A  L W L+ +L HP+ L + +DEID  IG +R  ++SD+
Sbjct: 285  TDRIIKGNMLALILAGTDTSAVTLEWALSNVLNHPDVLNKARDEIDRKIGLDRLMDESDI 344

Query: 1115 KNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWP 1294
             NLPYLQ +V ETLR+YP  P L PH A EDC V GY +P+GT L  NVW +HRDP++W 
Sbjct: 345  SNLPYLQNIVSETLRLYPAAPMLLPHVASEDCKVAGYDMPRGTILLTNVWAIHRDPQLWD 404

Query: 1295 DPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFS 1474
            DP  F PERF    EGEA      + +PFGLGRR+CPG+  A ++  + +  L Q   + 
Sbjct: 405  DPMSFKPERF--EKEGEA-----QKLMPFGLGRRACPGSGLAHRLINLTLGSLIQCLEWE 457

Query: 1475 TVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS 1570
             +  E +DM E  G+ +PK  PLE +   R S
Sbjct: 458  KI-GEEVDMSEGKGVTMPKAKPLEAMCRARPS 488



>sp|O65790|C81F_ARATH Cytochrome P450 81F1 (EC
            1.14.-.-).>pir|T04737|T04737 cytochrome P450 homolog
            F6G17.80 - Arabidopsis thaliana>gb:ATCHRIV87_1547697
            Arabidopsis thaliana DNA chromosome 4, contig fragment
            No. 87.>gb:ATF6G17_1550816 Arabidopsis thaliana DNA
            chromosome 4, BAC clone F6G17 (ESSA
            project).>gb:AY039844_1560358 Arabidopsis thaliana
            AT4g37430/F6G17_80 mRNA, complete cds.
          Length = 500

 Score =  287 bits (734), Expect = 5e-76
 Identities = 164/504 (32%), Positives = 270/504 (53%), Gaps = 2/504 (0%)
 Frame = +2

Query: 59   ILGIAALVLLW-FSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVF 235
            +L +  LV+ + F + K  +   P    + P +GHLH  +   P+ + L  ++++YGP+F
Sbjct: 6    LLPLLFLVISYKFLYSKTQRFNLPPGPPSRPFVGHLHLMKP--PIHRLLQRYSNQYGPIF 63

Query: 236  TIRLGISRILVVSSWEAVRDCFA-TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRR 412
            ++R G  R++V++S    ++ F   ND +L++RP     KY+ Y++     +    +WR 
Sbjct: 64   SLRFGSRRVVVITSPSLAQESFTGQNDIVLSSRPLQLTAKYVAYNHTTVGTAPYGDHWRN 123

Query: 413  VRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTL 592
            +R++  +EILSS RL   +H+   E+   +  L  +    N +     + +      LT 
Sbjct: 124  LRRICSQEILSSHRLINFQHIRKDEILRMLTRLSRYTQTSNESNDFTHIELEPLLSDLTF 183

Query: 593  NLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEG 772
            N I+++V G+RY Y  D    EEA+  KK+   +    G   S D +  L  F       
Sbjct: 184  NNIVRMVTGKRY-YGDDVNNKEEAELFKKLVYDIAMYSGANHSADYLPILKLFG----NK 238

Query: 773  HVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIK 952
              K +K   K +D ILQ  +D  R+++  N     ++ ++S+   Q      Y  D +IK
Sbjct: 239  FEKEVKAIGKSMDDILQRLLDECRRDKEGNT---MVNHLISLQQQQ----PEYYTDVIIK 291

Query: 953  AIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYL 1132
             +++SM+   +ET A  L W +A LL++PE L++ + EID  IGK+R  ++SD+  LPYL
Sbjct: 292  GLMMSMMLAGTETSAVTLEWAMANLLRNPEVLEKARSEIDEKIGKDRLIDESDIAVLPYL 351

Query: 1133 QGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFL 1312
            Q VV ET R++P  P+L P    +D  + GY +P+ T + VN W +HRDP+IW +PEKF 
Sbjct: 352  QNVVSETFRLFPVAPFLIPRSPTDDMKIGGYDVPRDTIVMVNAWAIHRDPEIWEEPEKFN 411

Query: 1313 PERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEP 1492
            P+R+    +G  +    Y+ +PFG GRR+CPG     +I  +A+  L Q F +  V  E 
Sbjct: 412  PDRYN---DGCGSDYYVYKLMPFGNGRRTCPGAGLGQRIVTLALGSLIQCFEWENVKGEE 468

Query: 1493 LDMMEDVGIILPKLTPLEVLVTPR 1564
            +DM E  G+ + K+ PL  +  PR
Sbjct: 469  MDMSESTGLGMRKMDPLRAMCRPR 492



>gb:AY074823_1567676 Arabidopsis thaliana AT4g37430/F6G17_80 gene,
            complete cds.
          Length = 500

 Score =  285 bits (730), Expect = 2e-75
 Identities = 163/504 (32%), Positives = 268/504 (53%), Gaps = 2/504 (0%)
 Frame = +2

Query: 59   ILGIAALVLLW-FSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVF 235
            +L +  LV+ + F + K  +   P    + P +GHLH  +   P+ + L  ++++YGP+F
Sbjct: 6    LLPLLFLVISYKFLYSKTQRFNLPPGPPSRPFVGHLHLMKP--PIHRLLQRYSNQYGPIF 63

Query: 236  TIRLGISRILVVSSWEAVRDCFA-TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRR 412
            ++R G  R++V++S    ++ F   ND +L++RP     KY+ Y++     +    +WR 
Sbjct: 64   SLRFGSRRVVVITSPSLAQESFTGQNDIVLSSRPLQLTAKYVAYNHTTVGTAPYGDHWRN 123

Query: 413  VRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTL 592
            +R++  +EILSS RL   +H+   E+   +  L  +    N +     + +      LT 
Sbjct: 124  LRRICSQEILSSHRLINFQHIRKDEILRMLTRLSRYTQTSNESNDFTHIELEPLLSDLTF 183

Query: 593  NLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEG 772
            N I+++V G+RY Y  D    EEA+  KK+   +    G   S D +  L  F       
Sbjct: 184  NNIVRMVTGKRY-YGDDVNNKEEAELFKKLVYDIAMYSGANHSADYLPILKLFG----NK 238

Query: 773  HVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIK 952
              K +K   K +D ILQ  +D  R+++  +        M++ +     Q   Y  D +IK
Sbjct: 239  FEKEVKAIGKSMDDILQRLLDECRRDKEGS-------TMVNHLFSVQQQQREYYTDVIIK 291

Query: 953  AIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYL 1132
             +++SM+   +ET A  L W +A LL++PE L++ + EID  IGK+R  ++SD+  LPYL
Sbjct: 292  GLMMSMMLAGTETSAVTLEWAMANLLRNPEVLEKARSEIDEKIGKDRLIDESDIAVLPYL 351

Query: 1133 QGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFL 1312
            Q VV ET R++P  P+L P    +D  + GY +P+ T + VN W +HRDP+IW +PEKF 
Sbjct: 352  QNVVSETFRLFPVAPFLIPRSPTDDMKIGGYDVPRDTIVMVNAWAIHRDPEIWEEPEKFN 411

Query: 1313 PERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEP 1492
            P+R+    +G  +    Y+ +PFG GRR+CPG     +I  +A+  L Q F +  V  E 
Sbjct: 412  PDRYN---DGCGSDYYVYKLMPFGNGRRTCPGAGLGQRIVTLALGSLIQCFEWENVKGEE 468

Query: 1493 LDMMEDVGIILPKLTPLEVLVTPR 1564
            +DM E  G+ + K+ PL  +  PR
Sbjct: 469  MDMSESTGLGMRKMDPLRAMCRPR 492



>gb:AY278227_1594515 Medicago truncatula isoflavone 2'-hydroxylase
            mRNA, complete cds.
          Length = 498

 Score =  285 bits (729), Expect = 2e-75
 Identities = 172/504 (34%), Positives = 281/504 (55%), Gaps = 3/504 (0%)
 Frame = +2

Query: 62   LGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTI 241
            L I  ++ L F  RK  K LPP    + PIIG+LHH +   PL +T     +KYG V ++
Sbjct: 14   LSIFFIIRLLFQSRK-FKNLPP-GPTSLPIIGNLHHLKR--PLNRTFKALTEKYGNVISL 69

Query: 242  RLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRK 421
              G   ++VVSS    ++CF  ND +LA RP   +GKY+ Y+Y     ++   +WR +R+
Sbjct: 70   WFGSRLVVVVSSLSEFQECFTKNDVVLANRPRFLSGKYIFYNYTTLGSTSYGEHWRNLRR 129

Query: 422  LVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLI 601
            +   ++LS+ R+     +   E Q  IK+L      ++++    +V ++  F  +T N I
Sbjct: 130  ITSLDVLSNHRINNFAPIRRDETQRLIKKL-----AEDSSTKFAEVELTFRFFDMTFNNI 184

Query: 602  MQIVAGRRYEYRSDGTINE--EAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGH 775
            M++++G+RY Y  D  I+E  EA + + + S+++ L G     D   PL   ++LD+E  
Sbjct: 185  MRMISGKRY-YGDDCDISEVQEASQFRDMVSELLQLSGANNKTD-FMPL--LKFLDFENL 240

Query: 776  VKTMKRAAKDVDAILQDWVDARR-KERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIK 952
             K +KR  +  D  L   +  +R K+ R+N     ID +L+M + Q      Y  DT+IK
Sbjct: 241  EKRVKRIGEKNDVFLSGLLQEQRSKKERTNT---MIDHLLNMQESQ----PEYYTDTIIK 293

Query: 953  AIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYL 1132
             + L+ML   +++ A  L W ++ +L +PE LK+V+DE+DT++G++R  ++SD+  L YL
Sbjct: 294  GLCLAMLLAGTDSSAVTLEWTMSNILNYPEVLKKVRDEVDTHVGQDRLVDESDLPKLTYL 353

Query: 1133 QGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFL 1312
            + V+ ETLR+Y   P L PH   ++CI+ GY +P+ T + +N W +HRDP+ W +   F 
Sbjct: 354  RNVIYETLRLYTPAPLLLPHSTADECIMGGYKVPRDTIVLINAWAIHRDPETWSEATTFK 413

Query: 1313 PERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEP 1492
            PERF    E E       + + FG+GRR+CPG   A +   + +A L Q F++  + +E 
Sbjct: 414  PERFDKKGELE-------KMIAFGMGRRACPGEGLALRAISMTLALLVQCFDWKRINDEK 466

Query: 1493 LDMMEDVGIILPKLTPLEVLVTPR 1564
            +DM E  G  + KL PL+ +   R
Sbjct: 467  IDMSERDGFTMTKLLPLKAMCKTR 490



>pir|T52175|T52175 cytochrome P450 monooxygenase [imported] -
            Arabidopsis thaliana>gb:D78607_1674789 Arabidopsis
            thaliana mRNA for cytochrome P450 monooxygenase, complete
            cds, clone P450-66-8.
          Length = 500

 Score =  285 bits (728), Expect = 3e-75
 Identities = 164/504 (32%), Positives = 270/504 (53%), Gaps = 2/504 (0%)
 Frame = +2

Query: 59   ILGIAALVLLW-FSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVF 235
            +L +  LV+ + F + K  +   P    + P +GHLH  +   P+ + L  ++++YGP+F
Sbjct: 6    LLPLLFLVISYKFLYSKTQRFNLPPGPPSRPFVGHLHLMKP--PIHRLLQRYSNQYGPIF 63

Query: 236  TIRLGISRILVVSSWEAVRDCFA-TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRR 412
            ++R G  R++V++S    ++ F   ND +L++RP     KY+ Y++     +    +WR 
Sbjct: 64   SLRFGSRRVVVITSPSLAQESFTGQNDIVLSSRPLQLTAKYVVYNHTTVGTAPYGDHWRN 123

Query: 413  VRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTL 592
            +R++  +EILSS RL   +H+   E+   +  L  +    N +     + +      LT 
Sbjct: 124  LRRMCSQEILSSHRLIIFQHIRKDEILRMLTRLSRYTQTSNESNDFTHIELEPLLSDLTF 183

Query: 593  NLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEG 772
            N I+++V G+RY Y  D    EEA+  KK+   +    G   S D +  L  F       
Sbjct: 184  NNIVRMVTGKRY-YGDDVNNKEEAELFKKLVYDIAMYSGANHSADYLPILKLFG----NK 238

Query: 773  HVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIK 952
              K +K   K +D ILQ  +D  R+++  N     ++ ++S+   Q      Y  D +IK
Sbjct: 239  FEKEVKAIGKSMDDILQRLLDECRRDKEGNT---MVNHLISLQQQQ----PEYYTDVIIK 291

Query: 953  AIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYL 1132
             +++SM+   +ET A  L W +A LL++PE L++ + EID  IGK+R  ++SD+  LPYL
Sbjct: 292  GLMMSMMLAGTETSAVTLEWAMANLLRNPEVLEKARSEIDEKIGKDRLIDESDIAVLPYL 351

Query: 1133 QGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFL 1312
            Q VV ET R++P  P+L P    +D  + GY +P+ T + VN W +HRDP+IW +PEKF 
Sbjct: 352  QNVVSETFRLFPVAPFLIPRSPTDDMKIGGYDVPRDTIVMVNAWAIHRDPEIWEEPEKFN 411

Query: 1313 PERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEP 1492
            P+R+    +G  +    Y+ +PFG GRR+CPG     +I  +A+  L Q F +  V  E 
Sbjct: 412  PDRYN---DGCGSDYYVYKLMPFGNGRRTCPGAGLGQRIVTLALGTLIQCFEWENVKGEE 468

Query: 1493 LDMMEDVGIILPKLTPLEVLVTPR 1564
            +DM E  G+ + K+ PL  +  PR
Sbjct: 469  MDMSESTGLGMRKMDPLRAMCRPR 492



>gb:AP005419_1851475 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, PAC
            clone:P0046G12.>gb:AP005570_1854237 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 9, BAC
            clone:OJ1344_B01.
          Length = 518

 Score =  284 bits (727), Expect = 3e-75
 Identities = 165/497 (33%), Positives = 278/497 (55%), Gaps = 11/497 (2%)
 Frame = +2

Query: 125  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFA 304
            P     WPIIG+L+    S+P  +++   + KYGP+  +R G   ++V SS E  +    
Sbjct: 36   PPGPKPWPIIGNLN-LMGSLPH-RSIHSLSKKYGPLMHLRFGSFPVVVGSSVEMAKFFLK 93

Query: 305  TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVS 484
            T+D + A RP T AGK+  Y+Y+  T+S   +YWR+ RK+ + E+ S++R+E  +H+   
Sbjct: 94   THDVVFADRPKTAAGKHTTYNYSDMTWSPYGAYWRQARKVCLAELFSAKRIESYEHIRRE 153

Query: 485  ELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS---DGTIN 655
            E++  +++L+          S   V +  +    +LN+I ++V G++Y  R    +G + 
Sbjct: 154  EVRALLRDLHA--------ASGRVVALKDYLSAASLNVISRMVLGKKYLEREVVHEGEVV 205

Query: 656  EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVD 835
               +R + +  ++  L G    GD+I    +  WLD +G+++ MK+ +K  D  L+  +D
Sbjct: 206  TTPERFRWMIDELFLLNGVLDIGDSIP---WLGWLDLQGYIRRMKKLSKMFDQFLEYVLD 262

Query: 836  ARRKERRSNEDQKFI-----DVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFAT 1000
               + R   E + F+     DV+L++  D   +   +SRD+V KA    ++   +E+ + 
Sbjct: 263  -EHENRMCREGESFVAKDMVDVLLNVASDPSLE-VKFSRDSV-KAFTQDLIAGGTESSSA 319

Query: 1001 HLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPY 1180
             + W +A LL+ PE   +V +E+D  +G+ RW  + D+ +LPY+  ++KET+RM+P  P 
Sbjct: 320  TVDWAIAELLRKPEVFAKVTEELDRVVGRGRWVTEKDIPSLPYIDAIMKETMRMHPVAPM 379

Query: 1181 LAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNR 1360
            LAP  + ED  VDGY IP GT++ V VW + RDPK+W  PE+F+PERF+ +      Q+ 
Sbjct: 380  LAPRLSREDTSVDGYDIPAGTRVLVGVWSIGRDPKLWDAPEEFMPERFIGSKIDVKGQD- 438

Query: 1361 QYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF---STVPNEPLDMMEDVGIILPK 1531
             ++ +PFG GRR CPG     ++ QV++A L  GF +     +  E L M E  G+  P+
Sbjct: 439  -FELLPFGSGRRMCPGYSLGLRVIQVSLANLLHGFAWRLPDGMTKEQLSMEEIFGLSTPR 497

Query: 1532 LTPLEVLVTPRLSPTLF 1582
              PLEV+V P+L   L+
Sbjct: 498  KFPLEVVVEPKLPADLY 514



>gb:AY086486_1571534 Arabidopsis thaliana clone 253698 mRNA, complete
            sequence.
          Length = 494

 Score =  284 bits (726), Expect = 4e-75
 Identities = 181/512 (35%), Positives = 273/512 (53%), Gaps = 7/512 (1%)
 Frame = +2

Query: 56   SILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHF-----RTSVPLVKTLSEWADK 220
            SIL +   ++      K+   LPP    + P+IGHL        RT + L ++L+     
Sbjct: 9    SILVVVLSLIYLIGKLKRKPNLPPSPAWSLPVIGHLRLLKPPIHRTFLSLSQSLNN---- 64

Query: 221  YGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNS 400
              P+F++RLG   + V SS     +CF  ND +LA RP     K++ YDY     ++   
Sbjct: 65   -APIFSLRLGNRLVFVNSSHSIAEECFTKNDVVLANRPNFILAKHVAYDYTTMIAASYGD 123

Query: 401  YWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFG 580
            +WR +R++   EI S+ RL     +   E++  +  L    S +       KV+M     
Sbjct: 124  HWRNLRRIGSVEIFSNHRLNSFLSIRKDEIRRLVFRLSRNFSQE-----FVKVDMKSMLS 178

Query: 581  HLTLNLIMQIVAGRRYEYRSDGTINE-EAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRW 757
             LT N I+++VAG+RY    DG  ++ EA+R++++ + V+   G   +G+A+  L   R 
Sbjct: 179  DLTFNNIIRMVAGKRYY--GDGVEDDPEAKRVRQLIADVVACAG---AGNAVDYLPVLRL 233

Query: 758  L-DYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYS 934
            + DYE  VK +   A  +D  LQ  VD +R  +        ID +L++ + Q      Y 
Sbjct: 234  VSDYETRVKKL---AGRLDEFLQGLVDEKRDAKEKGNTM--IDHLLTLQESQ----PDYF 284

Query: 935  RDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDV 1114
             D +IK  +L+++   ++T A  L W L+ +L H E L + +DEID  IG +R  ++SD+
Sbjct: 285  TDRIIKGNMLALILAGTDTSAVTLEWALSNVLNHSEVLNKARDEIDRKIGLDRLMDESDI 344

Query: 1115 KNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWP 1294
             NLPYLQ +V ETLR+YP  P L PH A EDC V GY +P+GT L  NVW +HRDP++W 
Sbjct: 345  SNLPYLQNIVSETLRLYPAAPMLLPHVASEDCKVAGYDMPRGTILLTNVWAIHRDPQLWD 404

Query: 1295 DPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFS 1474
            DP  F PERF    EGEA      + +PFGLGRR+CPG+  A ++  + +  L Q   + 
Sbjct: 405  DPMSFKPERF--EKEGEA-----QKLMPFGLGRRACPGSGLAHRLINLTLGSLIQCLEWE 457

Query: 1475 TVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS 1570
             +  E +DM E  G+ +PK  PLE +   R S
Sbjct: 458  KI-GEEVDMSEGKGVTMPKAKPLEAMCRARPS 488



>gb:AB025016_1516089 Lotus corniculatus var. japonicus mRNA for
            cytochrome P450, complete cds.
          Length = 499

 Score =  283 bits (724), Expect = 8e-75
 Identities = 168/516 (32%), Positives = 285/516 (55%), Gaps = 4/516 (0%)
 Frame = +2

Query: 29   MDAVPCCLSSILGIA--ALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTL 202
            MD +     S+  +A  A++ L+   RK  K LPP    + PIIG+LHH +   PL +T 
Sbjct: 1    MDIISFLYYSLFYVALFAIIKLFLGSRK-FKNLPP-GPTSLPIIGNLHHLKR--PLHRTF 56

Query: 203  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT 382
               ++KYG VF++  G   ++VVSS+  V++CF  ND +LA RP   +GKY+ Y+Y    
Sbjct: 57   RALSEKYGDVFSLWFGNRLVVVVSSFADVQECFTKNDVVLANRPRFLSGKYIFYNYTTLG 116

Query: 383  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVN 562
             ++   +WR +R++   ++LS+ R+     +   E    I++L      +++  +  +V 
Sbjct: 117  STSYGEHWRNLRRITSLDVLSNHRINSFSPIRRDETTRLIRKL-----AEDSAKNFSEVE 171

Query: 563  MSRWFGHLTLNLIMQIVAGRRYEYRSDGTINE--EAQRLKKVFSQVMYLWGEFVSGDAIF 736
            ++  F  +T N IM++++G+RY Y  D  + E  EA   + + ++++ L G     D   
Sbjct: 172  LTSRFFDMTFNNIMRMISGKRY-YGEDCDMTELQEASEFRDMVTELLQLSGANNKAD-FM 229

Query: 737  PLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFT 916
            P+   R +D+EG  K +K  +   D  L+  +   R +++       ID +L++ + Q  
Sbjct: 230  PI--LRLVDFEGLEKRVKGISSKTDRFLRGLLQEHR-DKKQRTANTMIDHLLTLQESQ-- 284

Query: 917  QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW 1096
                Y  D +IK + L+ML   +++ A  L W +  +L +PE L++++ E+DT++G++R 
Sbjct: 285  --PEYYTDQIIKGLALAMLLAGTDSSAVTLEWSMCNVLNYPEVLEKIKAELDTHVGQDRL 342

Query: 1097 AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR 1276
             ++SD+  L YL+ V+ ETLR+Y   P L PH A +DC + GY +P+ T + +N W LHR
Sbjct: 343  VDESDIPKLTYLKNVINETLRLYTPAPLLLPHSASDDCTIGGYKVPRDTIVLINAWALHR 402

Query: 1277 DPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLF 1456
            DP++W +   F PERF    E E       + +PFGLGRR+CPG L A +   + +A L 
Sbjct: 403  DPQLWTEATTFKPERFDKKGELE-------KLIPFGLGRRACPGELLAIRAISMTLALLI 455

Query: 1457 QGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPR 1564
            Q F++  V +E +DM E  G +L K  P++ +   R
Sbjct: 456  QCFDWKRVSDEEIDMGERDGFVLMKSIPVKAMCKSR 491



>pir|T00513|T00513 cytochrome P450 homolog At2g23190 - Arabidopsis
            thaliana>gb:AC002391_1530639 Arabidopsis thaliana
            chromosome 2 clone T20D16 map CIC06C07, complete
            sequence.
          Length = 543

 Score =  281 bits (720), Expect = 2e-74
 Identities = 174/497 (35%), Positives = 268/497 (53%), Gaps = 4/497 (0%)
 Frame = +2

Query: 86   LWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYG--PVFTIRLGISR 259
            L F  R     LPP      P IGHLH  +   PL +T   ++   G  P+F++RLG   
Sbjct: 64   LLFGKRHSKFNLPPSPARPLPFIGHLHLLKQ--PLHRTFLSFSQSLGDAPIFSLRLGNHL 121

Query: 260  ILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEI 439
             +VVSS+    +CF  ND +LA RP    GK++ Y++   T +    +WR +R++   EI
Sbjct: 122  TVVVSSYSIAEECFTKNDIVLANRPKFILGKHIEYNFTTMTSAPYGDHWRNLRRIGTLEI 181

Query: 440  LSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAG 619
             SS +L      ++S  +  I+ L   +S ++ +  A KV M + F  LT+N I+++VAG
Sbjct: 182  FSSHKLNG----FLSVRKDEIRHLLLRLSKNSQHGFA-KVEMRQLFYDLTINNILRMVAG 236

Query: 620  RRYEYRSDGTINEE-AQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWL-DYEGHVKTMKR 793
            +R+    +GT  +E A+R+ ++  +++Y  G    G+A   +   RW+ D+E   K +K 
Sbjct: 237  KRFY--GEGTEQDEVARRVTQLIDEIVYRAGV---GNAADYIPILRWITDFE---KGVKE 288

Query: 794  AAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSML 973
             A  VD  LQ  VD RR  ++       +D +LS+ + Q      Y  D  +K I++ M+
Sbjct: 289  LASRVDEFLQSLVDERRVHKQKGNTM--MDHLLSLQETQ----PDYYTDVTLKGIIIVMI 342

Query: 974  QDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKET 1153
               +ET A  L W +  LL HPE L++ + EIDT +G +R  +++D KNLPYLQ +V ET
Sbjct: 343  LAGTETLAGTLEWAMLNLLNHPEVLEKARTEIDTEVGFDRLMDEADTKNLPYLQWIVLET 402

Query: 1154 LRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTN 1333
            LR+YP  P   PH   +DCI+ GY +P+G+ L VNVW +HRDP IW  PE F PERF   
Sbjct: 403  LRLYPVAPTNIPHMTSDDCILAGYDVPRGSMLLVNVWSMHRDPSIWEAPEMFKPERFKN- 461

Query: 1334 LEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDV 1513
                  +    + + FG GRR+CPG   A ++  +A+  + Q F +  +  E +D  E+ 
Sbjct: 462  ------EKLNQKLLSFGFGRRACPGVGLAHRLMSLALGSMVQCFEWQRIGEEYVDTREEP 515

Query: 1514 GIILPKLTPLEVLVTPR 1564
              ++   TPL  +   R
Sbjct: 516  MAMMRPATPLLAMCKAR 532



>gb:AC084282_1733419 Oryza sativa chromosome 3 BAC OSJNBb0048A17
            genomic sequence, complete sequence.
          Length = 732

 Score =  281 bits (718), Expect = 4e-74
 Identities = 168/510 (32%), Positives = 278/510 (54%), Gaps = 7/510 (1%)
 Frame = +2

Query: 56   SILGIAALVLLWFSWRKQSK----RLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY 223
            +IL +A L LL +    +      RLPP    A PI+GHLH  +   P+  T+S  A++Y
Sbjct: 227  AILSVAILFLLHYYLLGRGNGGAARLPP-GPPAVPILGHLHLVKK--PMHATMSRLAERY 283

Query: 224  GPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSY 403
            GPVF++RLG  R +VVSS    R+CF  +D   A RP   +   + ++ A    ++  ++
Sbjct: 284  GPVFSLRLGSRRAVVVSSPGCARECFTEHDVTFANRPRFESQLLVSFNGAALATASYGAH 343

Query: 404  WRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGH 583
            WR +R++V  ++LS+ R+  +  +   E++  ++ +Y   +   +   A ++ + R    
Sbjct: 344  WRNLRRIVAVQLLSAHRVGLMSGLIAGEVRAMVRRMYRAAAA--SPAGAARIQLKRRLFE 401

Query: 584  LTLNLIMQIVA---GRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR 754
            ++L+++M+ +A     R E   D  ++ EAQ  K+V  +++   G     D +  L   R
Sbjct: 402  VSLSVLMETIAHTKATRPETDPDTDMSVEAQEFKQVVDEIIPHIGAANLWDYLPAL---R 458

Query: 755  WLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYS 934
            W D  G  + +  A    DA L+  +DA R+     ++ +   ++  ++  Q T+   Y+
Sbjct: 459  WFDVFGVRRKILAAVSRRDAFLRRLIDAERRRLDDGDEGEKKSMIAVLLTLQKTEPEVYT 518

Query: 935  RDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDV 1114
             D +I A+  ++    +ET +T   W +++LL HP++LK+ Q EID ++G  R     DV
Sbjct: 519  -DNMITALTANLFGAGTETTSTTSEWAMSLLLNHPDTLKKAQAEIDASVGNSRLITADDV 577

Query: 1115 KNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWP 1294
              L YLQ +V+ETLR+YP  P L PHE+  DC V GY+IP+G+ L +N + +HRDP +W 
Sbjct: 578  TRLGYLQCIVRETLRLYPAAPMLLPHESSADCKVGGYNIPRGSMLLINAYAIHRDPAVWE 637

Query: 1295 DPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFS 1474
            +PEKF+PERF    +G    N     +PFG+GRR CPG   A +   + +  L Q F++ 
Sbjct: 638  EPEKFMPERFE---DGGCDGN---LLMPFGMGRRRCPGETLALRTVGLVLGTLIQCFDWE 691

Query: 1475 TVPNEPLDMMEDVGIILPKLTPLEVLVTPR 1564
             V    +DM E  G+ +PK+ PLE +  PR
Sbjct: 692  RVDGVEVDMTEGGGLTIPKVVPLEAMCRPR 721



>gb:BT000794_1635065 Arabidopsis thaliana putative cytochrome P450
            monooxygenase (CYP91A2) (At4g37430) mRNA, partial cds.
          Length = 484

 Score =  281 bits (718), Expect = 4e-74
 Identities = 161/496 (32%), Positives = 266/496 (53%), Gaps = 2/496 (0%)
 Frame = +2

Query: 59   ILGIAALVLLW-FSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVF 235
            +L +  LV+ + F + K  +   P    + P +GHLH  +   P+ + L  ++++YGP+F
Sbjct: 6    LLPLLFLVISYKFLYSKTQRFNLPPGPPSRPFVGHLHLMKP--PIHRLLQRYSNQYGPIF 63

Query: 236  TIRLGISRILVVSSWEAVRDCFA-TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRR 412
            ++R G  R++V++S    ++ F   ND +L++RP     KY+ Y++     +    +WR 
Sbjct: 64   SLRFGSRRVVVITSPSLAQESFTGQNDIVLSSRPLQLTAKYVAYNHTTVGTAPYGDHWRN 123

Query: 413  VRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTL 592
            +R++  +EILSS RL   +H+   E+   +  L  +    N +     + +      LT 
Sbjct: 124  LRRICSQEILSSHRLINFQHIRKDEILRMLTRLSRYTQTSNESNDFTHIELEPLLSDLTF 183

Query: 593  NLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEG 772
            N I+++V G+RY Y  D    EEA+  KK+   +    G   S D +  L  F       
Sbjct: 184  NNIVRMVTGKRY-YGDDVNNKEEAELFKKLVYDIAMYSGANHSADYLPILKLFG----NK 238

Query: 773  HVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIK 952
              K +K   K +D ILQ  +D  R+++  N     ++ ++S+   Q      Y  D +IK
Sbjct: 239  FEKEVKAIGKSMDDILQRLLDECRRDKEGNT---MVNHLISLQQQQ----PEYYTDVIIK 291

Query: 953  AIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYL 1132
             +++SM+   +ET A  L W +A LL++PE L++ + EID  IGK+R  ++SD+  LPYL
Sbjct: 292  GLMMSMMLAGTETSAVTLEWAMANLLRNPEVLEKARSEIDEKIGKDRLIDESDIAVLPYL 351

Query: 1133 QGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFL 1312
            Q VV ET R++P  P+L P    +D  + GY +P+ T + VN W +HRDP+IW +PEKF 
Sbjct: 352  QNVVSETFRLFPVAPFLIPRSPTDDMKIGGYDVPRDTIVMVNAWAIHRDPEIWEEPEKFN 411

Query: 1313 PERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEP 1492
            P+R+    +G  +    Y+ +PFG GRR+CPG     +I  +A+  L Q F +  V  E 
Sbjct: 412  PDRYN---DGCGSDYYVYKLMPFGNGRRTCPGAGLGQRIVTLALGSLIQCFEWENVKGEE 468

Query: 1493 LDMMEDVGIILPKLTP 1540
            +DM E  G+ + K+ P
Sbjct: 469  MDMSESTGLGMRKMDP 484



>gb:AB022732_1515265 Glycyrrhiza echinata CYP Ge-31 mRNA for
            cytochrome P450, complete cds.
          Length = 499

 Score =  281 bits (718), Expect = 4e-74
 Identities = 165/490 (33%), Positives = 272/490 (55%), Gaps = 3/490 (0%)
 Frame = +2

Query: 104  KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWE 283
            ++ K LPP    + PIIG+LHH +   PL +T    ++KYG V ++  G   ++VVSS  
Sbjct: 27   RKFKNLPP-GPPSLPIIGNLHHLKR--PLHRTFKGLSEKYGHVISLWFGSRLVVVVSSAS 83

Query: 284  AVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEK 463
              + CF  ND +LA RP   +GKY+ Y+Y     ++   +WR +R++   ++LS+ R+  
Sbjct: 84   EFQQCFTKNDVVLANRPRFLSGKYIFYNYTTLGSTSYGEHWRNLRRITALDVLSNHRINS 143

Query: 464  LKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSD 643
               +   E Q  I  L      D+++ +  ++ +S  F  +T N IM++++G+RY Y  D
Sbjct: 144  FSGIRRDETQRLITRL-----ADDSSTNFAEIELSYRFYDMTFNNIMRMISGKRY-YGED 197

Query: 644  GTIN--EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAI 817
              ++  +EA + + + S+++ L G     D   PL   R+LD+E   K +K  +   DA 
Sbjct: 198  CDMSDLQEASQFRDMVSELLQLSGANNKTD-FMPL--LRFLDFENLEKRLKDISGKTDAF 254

Query: 818  LQDWV-DARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETF 994
            L+  + + R K+ R+N     ID +L++ D Q      Y  D +IK + L+ML   +++ 
Sbjct: 255  LRGLIQEHRAKKERAN---TMIDHLLNLQDSQ----PEYYTDQIIKGLALAMLLAGTDSS 307

Query: 995  ATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQG 1174
            A  L W ++ LL HPE LK+V+DE+DT++G++R  ++SD+  L YL+ V+ ETLR+Y   
Sbjct: 308  AVTLEWSMSNLLNHPEVLKKVKDELDTHVGQDRLVDESDLPKLSYLKNVINETLRLYTPA 367

Query: 1175 PYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ 1354
            P L PH   ++C + GY +P+ T + +N W +HRDP++W +   F PERF    E E   
Sbjct: 368  PLLLPHSTSDECNIGGYKVPQDTIVLINAWAIHRDPELWTEATTFKPERFEKKGELE--- 424

Query: 1355 NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKL 1534
                + + FG+GRR+CPG   A +   + +A L Q F++     + +DM E  G  L KL
Sbjct: 425  ----KLIAFGMGRRACPGEGLAIRAISMTLALLIQCFDWKLTNGDKIDMAERDGFTLTKL 480

Query: 1535 TPLEVLVTPR 1564
             PL+ +   R
Sbjct: 481  VPLKAMCKSR 490



>sp|P93147|C81E_GLYEC Cytochrome P450 81E1 (EC 1.14.-.-) (Isoflavone
            2'-hydroxylase) (P450 91A4) (CYP
            GE-3).>gb:AB001379_1508464 Glycyrrhiza echinata CYP81E1
            mRNA for cytochrome P450, complete cds, clone:CYP Ge-3.
          Length = 499

 Score =  281 bits (718), Expect = 4e-74
 Identities = 163/489 (33%), Positives = 271/489 (55%), Gaps = 2/489 (0%)
 Frame = +2

Query: 104  KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWE 283
            ++ K LPP    + PIIG+LHH +   PL +T    ++KYG VF++  G   ++VVSS  
Sbjct: 27   RKFKNLPP-GPPSLPIIGNLHHLKR--PLHRTFKGLSEKYGHVFSLWFGSRLVVVVSSAS 83

Query: 284  AVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEK 463
              + CF  ND +LA RP   +GKY+ Y+Y     ++   +WR +R++   ++LS+ R+  
Sbjct: 84   EFQQCFTKNDVVLANRPRFLSGKYIFYNYTTLGSTSYGEHWRNLRRITALDVLSNHRINS 143

Query: 464  LKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSD 643
               +   E Q  I  L      D+++ +  ++ +S     +T N IM++++G+RY     
Sbjct: 144  FSGIRRDETQRLITRL-----ADDSSTNFAEMELSSRLYDMTFNNIMRMISGKRYYGEDC 198

Query: 644  GTIN-EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAIL 820
             T + +EA + + + S+++ L G     D   PL   R+LD+E   K +K  +   DA L
Sbjct: 199  DTSDLQEASQFRDMVSELLQLSGANNKTD-FMPL--LRFLDFENLEKRLKDISGKTDAFL 255

Query: 821  QDWVDARR-KERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFA 997
            +  ++  R K+ R+N     ID +L++ D Q      Y  D +IK + L+ML   +++ A
Sbjct: 256  RGLIEEHRTKKERANT---MIDHLLNLQDSQ----PEYYTDQIIKGLALAMLLAGTDSSA 308

Query: 998  THLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGP 1177
              L W ++ LL HPE LK+V+DE+DT++G++R  ++SD+  L YL+ V+ ETLR+Y   P
Sbjct: 309  VTLEWSMSNLLNHPEVLKKVKDELDTHVGQDRLVDESDLPKLTYLKNVINETLRLYTPAP 368

Query: 1178 YLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQN 1357
             L PH   ++C + GY +P+ T + +N W +HRDP++W +   F PERF    E E    
Sbjct: 369  LLLPHSTSDECNIGGYKVPQDTIVLINAWAIHRDPELWTEATTFKPERFEKKGELE---- 424

Query: 1358 RQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLT 1537
               + + FG+GRR+CPG   A +   + +A L Q F++  +  + +D+ E  G  L KL 
Sbjct: 425  ---KLIAFGMGRRACPGEGLAIRAISMTLALLIQCFDWKLINGDKIDLAERDGFTLTKLV 481

Query: 1538 PLEVLVTPR 1564
            PL+ +   R
Sbjct: 482  PLKAMCKSR 490



>gb:AP005570_1854232 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC clone:OJ1344_B01.
          Length = 525

 Score =  280 bits (715), Expect = 8e-74
 Identities = 176/532 (33%), Positives = 286/532 (53%), Gaps = 24/532 (4%)
 Frame = +2

Query: 59   ILGIAALVLLWFSWRKQSKR---LPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGP 229
            ++ +AA+V L  +  +  +R   LPP     WPIIG+L+    ++P  +++ E + +YGP
Sbjct: 13   VIVLAAVVFLLATILRHGRRAYRLPP-GPNPWPIIGNLNLIG-ALPH-RSIHELSKRYGP 69

Query: 230  VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWR 409
            +  +R G   ++V SS E  R    ++D +   RP T AGK+  Y+Y    +S   +YWR
Sbjct: 70   LMQLRFGSFPVVVGSSAEMARFFLKSHDIVFTDRPRTAAGKHTTYNYTDILWSPYGAYWR 129

Query: 410  RVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLT 589
            + RK+ V E+ S+RRLE  +H+   E++  +++L+          +A  V +  +    T
Sbjct: 130  QARKMCVTELFSARRLESFEHIRGEEVRALLRDLHG---------AAAPVLLRDYLSTAT 180

Query: 590  LNLIMQIVAGRRY--------------EYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGD 727
            L +I ++V G++Y              E  S     EE    K +  ++  L G    GD
Sbjct: 181  LGVISRMVLGKKYVGVEGASAGNGGGGEGTSPAATPEE---FKMMMDELFLLSGVLNIGD 237

Query: 728  AIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQ----KFIDVMLS 895
              F  W   WLD +G+++ MKR  K +D  ++  +D   K RR   D+      +DV+L 
Sbjct: 238  --FIPWL-DWLDLQGYIRRMKRVGKKLDRFMEHVLDEHDKVRRQQGDRFAARDLVDVLLQ 294

Query: 896  MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT 1075
            + DD   +     RD V KA+   ++   ++T A  + W ++ LL+ PE L +  +E+D 
Sbjct: 295  LADDPNLE-VQLRRDNV-KALTQDLIAGGTDTSAITVEWAISELLRKPEILAKATEELDR 352

Query: 1076 NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV 1255
             +G+ R   ++D+ +LPY++ +VKET+R++P  P LAPH A ED  V GY IP GT++ V
Sbjct: 353  VVGRGRLVTETDMTSLPYVEAIVKETMRVHPVAPLLAPHVAREDASVGGYDIPAGTRVLV 412

Query: 1256 NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ 1435
            NVW + RDP +W  PE+F+PERF+ +      Q+  +Q +PFG GRR CPG+    ++ Q
Sbjct: 413  NVWTIARDPALWDSPEEFMPERFIGSKIDVKGQD--FQLLPFGSGRRLCPGHSLGLKVIQ 470

Query: 1436 VAVARLFQGFNF---STVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
            +++A L  GF +     V    L M E  G+  P+  PLEV+V P+L   L+
Sbjct: 471  LSLASLLHGFEWRLPDGVSAGELSMEEVFGLSTPRKVPLEVVVKPKLPAHLY 522



>pir|T04735|T04735 cytochrome P450 homolog F6G17.60 - Arabidopsis
            thaliana>gb:ATCHRIV87_1547695 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 87.>gb:ATF6G17_1550814
            Arabidopsis thaliana DNA chromosome 4, BAC clone F6G17
            (ESSA project).>gb:AY084273_1569365 Arabidopsis thaliana
            clone 102007 mRNA, complete sequence.
          Length = 501

 Score =  279 bits (714), Expect = 1e-73
 Identities = 177/517 (34%), Positives = 276/517 (53%), Gaps = 4/517 (0%)
 Frame = +2

Query: 59   ILGIAALVLLW---FSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGP 229
            IL +A  +L +   F+ +KQ   LPP    + PI+GH  H     P+ +     ++ +GP
Sbjct: 7    ILPLALFLLAYKFFFTSKKQRYYLPPSPSYSLPILGH--HLLIKPPVHRLFHRLSNIHGP 64

Query: 230  VFTIRLGISRILVVSSWEAVRDCFA-TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYW 406
            +F +RLG  R +V+SS    R+CF   ND +++ RP     KY+ Y+Y     ++   +W
Sbjct: 65   IFYLRLGSRRAVVISSSSLARECFTGQNDVIVSNRPRFLTSKYIAYNYTTIATTSYGDHW 124

Query: 407  RRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHL 586
            R +R++   EI+SS+RL    H+   E+Q     + T +S D       +V +      L
Sbjct: 125  RNLRRICSLEIVSSKRLANFLHIRKEEIQ----RMLTRLSRDAR--VGKEVELESILYDL 178

Query: 587  TLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDY 766
            T N I+++V G+ Y Y  D +  EEA+  KK+F+ +    G    G+ + P        +
Sbjct: 179  TFNNIVRMVTGKIY-YGDDVSDKEEAELFKKLFTFITTNSGARHPGEYL-PFMKIFGGSF 236

Query: 767  EGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTV 946
            E   K +K AAK +D +LQ  +D  + ++  N     ++ +LS+  D       Y  D +
Sbjct: 237  E---KEVKAAAKVIDEMLQRLLDECKSDKDGNT---MVNHLLSLQQDD----PEYYTDII 286

Query: 947  IKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLP 1126
            IK ++L ++  +SET A  + W +A LL HP+ L +V+ EID  IG++R  E+SD+ NLP
Sbjct: 287  IKGLMLGIMVASSETSALTIEWAMASLLNHPKVLDKVKLEIDEIIGQDRLIEESDIANLP 346

Query: 1127 YLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEK 1306
            YLQ VV ETLR++P  P L P    ED  + GY +P+ T + VN W +HRDP +W +PE+
Sbjct: 347  YLQNVVSETLRLHPAAPVLVPRSTAEDIKIGGYDVPRDTMVMVNAWAIHRDPDLWTEPER 406

Query: 1307 FLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN 1486
            F PERF     GE  ++     + FG GRR CPG   A +I  +A+  L Q F++  V  
Sbjct: 407  FNPERFN---GGEGEKDDVRMLIAFGSGRRICPGVGLAHKIVTLALGSLIQCFDWKKVNE 463

Query: 1487 EPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFRL*AY 1597
            + +DM E  G+ +  + PL  L   R  P + +L AY
Sbjct: 464  KEIDMSEGPGMAMRMMVPLRALCKTR--PIMNKLPAY 498



>pir|T00510|T00510 probable cytochrome P450 At2g23220 [imported] -
            Arabidopsis thaliana>gb:AC002391_1530636 Arabidopsis
            thaliana chromosome 2 clone T20D16 map CIC06C07, complete
            sequence.
          Length = 515

 Score =  279 bits (714), Expect = 1e-73
 Identities = 170/499 (34%), Positives = 266/499 (53%), Gaps = 4/499 (0%)
 Frame = +2

Query: 80   VLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYG--PVFTIRLGI 253
            V L F  R     LPP      P+IGHLH  +  +PL +T   ++   G  P+F +RLG 
Sbjct: 33   VKLLFGKRLSKFNLPPSPARPLPLIGHLHLLK--LPLHRTFLSFSQSLGGAPIFCLRLGN 90

Query: 254  SRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVE 433
               +VVSS+    +CF  ND + A RP    GK++ Y+    T +    +WR +R++   
Sbjct: 91   RLTVVVSSYSIAEECFTKNDIVFANRPELILGKHIEYNSTTMTSAPYGDHWRNLRRIATL 150

Query: 434  EILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIV 613
            EI +S +L      ++S  +  I++L   +S ++ +  A KV M      LT+N + ++V
Sbjct: 151  EIFASHKLNG----FLSVRKDEIRQLLLRLSKNSRHGFA-KVEMRHLLFELTINNVFRMV 205

Query: 614  AGRRYEYRSDGTINEE-AQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMK 790
            AG+R+    +GT  +E AQ+++ +  +++   G   +G+A   L   RW  +    K +K
Sbjct: 206  AGKRFY--GEGTEQDEVAQQVRHLMDEIVTSAG---AGNAADYLPIMRW--FTNFEKRVK 258

Query: 791  RAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSM 970
              A  +D  LQ  VD +R ++        ID +LS+ + Q      Y  D  +K I++ M
Sbjct: 259  NLAIRIDKFLQSLVDEKRADKEKGTTM--IDHLLSLQESQ----PDYYTDVTLKGIIIVM 312

Query: 971  LQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKE 1150
            +   SET A  L W +  +L HPE LK+ + EIDT IG +R  +++D KNLPYLQ +V E
Sbjct: 313  IIAGSETIAWTLEWAMLNVLNHPEVLKKARTEIDTKIGFDRLMDEADTKNLPYLQWIVLE 372

Query: 1151 TLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMT 1330
            TLR++P  P   PH   EDC++ GY +P+G+ L VN+W +HRDP IW DPE F PERF  
Sbjct: 373  TLRLHPAAPTNVPHSTSEDCMLAGYDVPRGSMLLVNIWSMHRDPSIWEDPEMFKPERFKN 432

Query: 1331 NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED 1510
                   +    + + FG+GRR+CPG   A ++  + +  + Q F +  +  E +D  ED
Sbjct: 433  -------EKLNQKLLSFGMGRRACPGYGLAHRVVSLTLGSMVQCFEWQRIGQEYVDNSED 485

Query: 1511 VGIILPK-LTPLEVLVTPR 1564
              ++L +  TPL  +   R
Sbjct: 486  KTVVLMRPTTPLLAMCKAR 504



>gb:AP005285_1849831 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1003_F04.
          Length = 524

 Score =  278 bits (712), Expect = 2e-73
 Identities = 169/533 (31%), Positives = 276/533 (51%), Gaps = 15/533 (2%)
 Frame = +2

Query: 17   IKCVMDAVPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVK 196
            +  +  +V   L +++  AA +  W   R++    P     A P++GHLH FR   PL +
Sbjct: 3    VDAMFGSVAVALLAVVVAAAALRRWRRRRRRGGGRPLPGPVALPVVGHLHLFRR--PLHR 60

Query: 197  TLSEWADKYGP-VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYA 373
            TL+  A ++G  V  +R G  R+ VVSS  A  +C   +D   A RP   +G+ L Y+++
Sbjct: 61   TLARLAARHGAAVMGLRFGSRRVAVVSSAPAAEECLGPHDLAFANRPRLPSGEILAYEWS 120

Query: 374  VFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAP 553
                ++   YWR +R++ V E+LS+ R++    V V E++   + LY   +      +  
Sbjct: 121  TMGTASYGPYWRHIRRIAVTELLSAHRVQHFADVNVREVRALARRLYRRAAAAAAAGART 180

Query: 554  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI 733
            +V +      L +N +M ++  R +    D  ++EEA+  + V  + M L G        
Sbjct: 181  RVELKSRLFELLMNTMMSMICERTFYGADDDEVSEEARWFRSVVKETMELSGAST----- 235

Query: 734  FPLWFF-----RWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNED-------QKF 877
              +W F     RWLD     + M+  +      LQ  +D +RK+  ++ D       +  
Sbjct: 236  --VWDFLPAPARWLDAGRMTRRMRELSDSRTRFLQRLIDDQRKDMDADSDDHAPAKRRTM 293

Query: 878  IDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRV 1057
            I V+LS+      +      D +I+++ +  LQ  ++T A  + W +++LL +P ++ R 
Sbjct: 294  IGVLLSLQ----RKDPDSCPDQLIRSLCIGSLQAGTDTSAATVEWAMSLLLNNPGAMARA 349

Query: 1058 QDEIDTNIGKE--RWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHI 1231
            + EID  +G+   R  E +D+  L YL+ VV ETLR+YP  P LAPHE+  DC+V G+H+
Sbjct: 350  RGEIDACVGQPAARLLEAADLPKLHYLRCVVMETLRLYPPVPLLAPHESSADCVVAGFHV 409

Query: 1232 PKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGN 1411
            P+GT L VN + +HRDP++W +PE F+P+RF         +N     +PFG+GRR CPG 
Sbjct: 410  PQGTMLLVNTFAIHRDPQVWDEPEAFIPDRFAD------GKNEGKMVIPFGMGRRRCPGE 463

Query: 1412 LYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS 1570
                Q+  +A+  L Q F++  V  E +DM E  G+ +PK  PLE L  PR S
Sbjct: 464  NLGMQMVGLALGTLIQCFDWERVGEELVDMRECSGLTMPKELPLEALYQPRAS 516



>gb:D78606_1674788 Arabidopsis thaliana mRNA for cytochrome P450
            monooxygenase, complete cds, clone P450-65.
          Length = 500

 Score =  278 bits (711), Expect = 2e-73
 Identities = 176/512 (34%), Positives = 267/512 (52%), Gaps = 7/512 (1%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY-- 223
            L SI  +  L++ +   + + + LPP   G  PIIGHL   +   P+ +TL  +++    
Sbjct: 8    LYSIFSLIFLIISFKFLKPKKQNLPPSPPGWLPIIGHLRLLKP--PIHRTLRSFSETLDH 65

Query: 224  ---GPVFTIRLGISRILVVSSWE-AVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFST 391
               G V ++RLG   + VVSS + A  +CF  ND +LA RP    GK++GY+ A    + 
Sbjct: 66   NDGGGVMSLRLGSRLVYVVSSHKVAAEECFGKNDVVLANRPQVIIGKHVGYNNANMIAAP 125

Query: 392  NNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSR 571
               +WR +R+L   EI S+ RL    +V   E++  I  L               V +  
Sbjct: 126  YGDHWRNLRRLCTIEIFSTHRLNCFLYVRTDEVRRLISRLSRLAGTKKT-----VVELKP 180

Query: 572  WFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF 751
                LT N IM+++ G+RY Y  + T  EEA+R++K+ + V        SG+A+  +   
Sbjct: 181  MLMDLTFNNIMRMMTGKRY-YGEETTDEEEAKRVRKLVADV---GANTSSGNAVDYVPIL 236

Query: 752  R-WLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYS 928
            R +  YE  VK +    ++ D  LQ  +D +R ++ +      ID +L +          
Sbjct: 237  RLFSSYENRVKKL---GEETDKFLQGLIDDKRGQQETGTTM--IDHLLVLQKSDI----E 287

Query: 929  YSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDS 1108
            Y  D +IK I+L M+   + T A  L W L+ LL HP+ + + +DEID  +G +R  E++
Sbjct: 288  YYTDQIIKGIILIMVIAGTNTSAVTLEWALSNLLNHPDVISKARDEIDNRVGLDRLIEEA 347

Query: 1109 DVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKI 1288
            D+  LPYL+ +V ETLR++P  P L PH A EDC +  Y +P+GT L VN W +HRDP  
Sbjct: 348  DLSELPYLKNIVLETLRLHPATPLLVPHMASEDCKIGSYDMPRGTTLLVNAWAIHRDPNT 407

Query: 1289 WPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFN 1468
            W DP+ F PERF    E +       + + FGLGRR+CPG+  A +I  +A+  L Q F 
Sbjct: 408  WDDPDSFKPERFEKEEEAQ-------KLLAFGLGRRACPGSGLAQRIVGLALGSLIQCFE 460

Query: 1469 FSTVPNEPLDMMEDVGIILPKLTPLEVLVTPR 1564
            +  V N  +DM E VG  +PK  PL+ +   R
Sbjct: 461  WERVGNVEVDMKEGVGNTVPKAIPLKAICKAR 492



>pir|T52174|T52174 cytochrome P450 monooxygenase [imported] -
            Arabidopsis thaliana (fragment)
          Length = 500

 Score =  278 bits (711), Expect = 2e-73
 Identities = 176/512 (34%), Positives = 267/512 (52%), Gaps = 7/512 (1%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY-- 223
            L SI  +  L++ +   + + + LPP   G  PIIGHL   +   P+ +TL  +++    
Sbjct: 8    LYSIFSLIFLIISFKFLKPKKQNLPPSPPGWLPIIGHLRLLKP--PIHRTLRSFSETLDH 65

Query: 224  ---GPVFTIRLGISRILVVSSWE-AVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFST 391
               G V ++RLG   + VVSS + A  +CF  ND +LA RP    GK++GY+ A    + 
Sbjct: 66   NDGGGVMSLRLGSRLVYVVSSHKVAAEECFGKNDVVLANRPQVIIGKHVGYNNANMIAAP 125

Query: 392  NNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSR 571
               +WR +R+L   EI S+ RL    +V   E++  I  L               V +  
Sbjct: 126  YGDHWRNLRRLCTIEIFSTHRLNCFLYVRTDEVRRLISRLSRLAGTKKT-----VVELKP 180

Query: 572  WFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF 751
                LT N IM+++ G+RY Y  + T  EEA+R++K+ + V        SG+A+  +   
Sbjct: 181  MLMDLTFNNIMRMMTGKRY-YGEETTDEEEAKRVRKLVADV---GANTSSGNAVDYVPIL 236

Query: 752  R-WLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYS 928
            R +  YE  VK +    ++ D  LQ  +D +R ++ +      ID +L +          
Sbjct: 237  RLFSSYENRVKKL---GEETDKFLQGLIDDKRGQQETGTTM--IDHLLVLQKSDI----E 287

Query: 929  YSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDS 1108
            Y  D +IK I+L M+   + T A  L W L+ LL HP+ + + +DEID  +G +R  E++
Sbjct: 288  YYTDQIIKGIILIMVIAGTNTSAVTLEWALSNLLNHPDVISKARDEIDNRVGLDRLIEEA 347

Query: 1109 DVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKI 1288
            D+  LPYL+ +V ETLR++P  P L PH A EDC +  Y +P+GT L VN W +HRDP  
Sbjct: 348  DLSELPYLKNIVLETLRLHPATPLLVPHMASEDCKIGSYDMPRGTTLLVNAWAIHRDPNT 407

Query: 1289 WPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFN 1468
            W DP+ F PERF    E +       + + FGLGRR+CPG+  A +I  +A+  L Q F 
Sbjct: 408  WDDPDSFKPERFEKEEEAQ-------KLLAFGLGRRACPGSGLAQRIVGLALGSLIQCFE 460

Query: 1469 FSTVPNEPLDMMEDVGIILPKLTPLEVLVTPR 1564
            +  V N  +DM E VG  +PK  PL+ +   R
Sbjct: 461  WERVGNVEVDMKEGVGNTVPKAIPLKAICKAR 492



>sp|Q9FG65|C81D_ARATH Cytochrome P450 81D1 (EC
            1.14.-.-).>gb:AB026661_1517385 Arabidopsis thaliana
            genomic DNA, chromosome 5, BAC
            clone:T30G6.>gb:AY093766_1575424 Arabidopsis thaliana
            AT5g36220/T30G6_3 mRNA, complete cds.>gb:BT001045_1635300
            Arabidopsis thaliana At5g36220/T30G6_3 mRNA, complete
            cds.
          Length = 502

 Score =  276 bits (707), Expect = 7e-73
 Identities = 175/512 (34%), Positives = 266/512 (51%), Gaps = 7/512 (1%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY-- 223
            L SI  +  L++ +   + + + LPP   G  PIIGHL   +   P+ +TL  +++    
Sbjct: 10   LYSIFSLIFLIISFKFLKPKKQNLPPSPPGWLPIIGHLRLLKP--PIHRTLRSFSETLDH 67

Query: 224  ---GPVFTIRLGISRILVVSSWE-AVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFST 391
               G V ++RLG   + VVSS + A  +CF  ND +LA RP    GK++GY+      + 
Sbjct: 68   NDGGGVMSLRLGSRLVYVVSSHKVAAEECFGKNDVVLANRPQVIIGKHVGYNNTNMIAAP 127

Query: 392  NNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSR 571
               +WR +R+L   EI S+ RL    +V   E++  I  L               V +  
Sbjct: 128  YGDHWRNLRRLCTIEIFSTHRLNCFLYVRTDEVRRLISRLSRLAGTKKT-----VVELKP 182

Query: 572  WFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF 751
                LT N IM+++ G+RY Y  + T  EEA+R++K+ + V        SG+A+  +   
Sbjct: 183  MLMDLTFNNIMRMMTGKRY-YGEETTDEEEAKRVRKLVADV---GANTSSGNAVDYVPIL 238

Query: 752  R-WLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYS 928
            R +  YE  VK +    ++ D  LQ  +D +R ++ +      ID +L +          
Sbjct: 239  RLFSSYENRVKKL---GEETDKFLQGLIDDKRGQQETGTTM--IDHLLVLQKSDI----E 289

Query: 929  YSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDS 1108
            Y  D +IK I+L M+   + T A  L W L+ LL HP+ + + +DEID  +G +R  E++
Sbjct: 290  YYTDQIIKGIILIMVIAGTNTSAVTLEWALSNLLNHPDVISKARDEIDNRVGLDRLIEEA 349

Query: 1109 DVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKI 1288
            D+  LPYL+ +V ETLR++P  P L PH A EDC +  Y +P+GT L VN W +HRDP  
Sbjct: 350  DLSELPYLKNIVLETLRLHPATPLLVPHMASEDCKIGSYDMPRGTTLLVNAWAIHRDPNT 409

Query: 1289 WPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFN 1468
            W DP+ F PERF    E +       + + FGLGRR+CPG+  A +I  +A+  L Q F 
Sbjct: 410  WDDPDSFKPERFEKEEEAQ-------KLLAFGLGRRACPGSGLAQRIVGLALGSLIQCFE 462

Query: 1469 FSTVPNEPLDMMEDVGIILPKLTPLEVLVTPR 1564
            +  V N  +DM E VG  +PK  PL+ +   R
Sbjct: 463  WERVGNVEVDMKEGVGNTVPKAIPLKAICKAR 494



>gb:CAR238439_1645167 Cicer arietinum mRNA for a cytochrome P450
            monooxygenase.
          Length = 498

 Score =  276 bits (706), Expect = 9e-73
 Identities = 170/504 (33%), Positives = 275/504 (54%), Gaps = 3/504 (0%)
 Frame = +2

Query: 62   LGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTI 241
            L I  +  L F  RK  K LPP    + PIIG+ HH +   PL +T    +  YG + ++
Sbjct: 14   LSIFFIFRLLFQSRK-FKNLPP-GPPSLPIIGNFHHLKR--PLHRTFKGLSKTYGDIISL 69

Query: 242  RLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRK 421
              G   ++VVSS    + CF  ND +LA RP   +GKY+ Y+Y     ++ + +WR +R+
Sbjct: 70   WFGSRLVVVVSSLSEFQQCFTKNDVVLANRPRFLSGKYIFYNYTTLGSTSYSEHWRNLRR 129

Query: 422  LVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLI 601
            +   ++LS+ R+     V   E Q  I +L      ++++ S  +V +S  F  +T N I
Sbjct: 130  ITSLDVLSNHRINNFSGVRRDETQRLITKL-----AEDSSTSFAEVELSFRFYDMTFNNI 184

Query: 602  MQIVAGRRYEYRSDGTINE--EAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGH 775
            M++++G+RY Y  D  +++  EA + + + ++++ L G     D +  L FF   D+E  
Sbjct: 185  MRMISGKRY-YGEDCDMSDLQEASQFRDMVTELLQLSGANNKTDFMPLLKFF---DFENL 240

Query: 776  VKTMKRAAKDVDAILQDWV-DARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIK 952
             K +K  A   DA L+  + + R K+ R+N     ID +L++ + Q      Y  D +IK
Sbjct: 241  EKRVKNIADKTDAFLRGLLQEQRNKKERTNT---MIDHLLNLQESQ----PEYYTDQIIK 293

Query: 953  AIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYL 1132
             + L+ML   +++ A  L W ++ LL HPE LK+V+DE+DT++G++R  ++SD+  L YL
Sbjct: 294  GLALAMLLAGTDSSAVTLEWSMSNLLNHPEVLKKVRDELDTHVGQDRLVDESDLPKLTYL 353

Query: 1133 QGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFL 1312
            + V+ ETLR+    P L PH   +DCI+ GY +P+ T + +N W +HRDPK W +   F 
Sbjct: 354  KNVIYETLRLCTPAPLLLPHSTSDDCIIGGYKVPRDTIVLINAWAIHRDPKSWSEATTFK 413

Query: 1313 PERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEP 1492
            PERF    E E       + + FG+GRR CPG   A +   + +A L Q F++    ++ 
Sbjct: 414  PERFDKKGEIE-------KVIAFGMGRRVCPGEALALRTISMTLALLIQCFDWKRTSDDM 466

Query: 1493 LDMMEDVGIILPKLTPLEVLVTPR 1564
            +DM E  G +L KL PL+ +   R
Sbjct: 467  IDMAERDGFVLTKLVPLKAMCKTR 490



>gb:AP005419_1851474 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, PAC
            clone:P0046G12.>gb:AP005570_1854236 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 9, BAC
            clone:OJ1344_B01.
          Length = 514

 Score =  275 bits (704), Expect = 2e-72
 Identities = 171/522 (32%), Positives = 281/522 (53%), Gaps = 12/522 (2%)
 Frame = +2

Query: 53   SSILGIA-ALVLLWFSWRKQSKR---LPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADK 220
            +S +G+  A VL   +   +S+R   LPP     WP+IG+L+   T     +++   + K
Sbjct: 9    ASFVGVVLATVLFLKAVLGRSRRVYNLPP-GPKPWPVIGNLNLVGTLPH--RSIHNLSKK 65

Query: 221  YGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNS 400
            YGP+  +R G   ++V SS E  +    T+D +   RP T AGK+  Y+Y+  T+S   +
Sbjct: 66   YGPLMYLRFGSFPVVVGSSVEMAKFFLKTHDVVFTDRPKTAAGKHTTYNYSDITWSPYGA 125

Query: 401  YWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFG 580
            YWR+ RK+ + E+ S++RLE  +++   E++  +++L+          +   V +  +  
Sbjct: 126  YWRQARKMCLTELFSAKRLESYEYIRGEEVRALLRDLH--------GAAGGVVVLKDYLS 177

Query: 581  HLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWL 760
             ++LN+I ++V G++Y  +  G      +  K +  ++  L G    GD+I    +  WL
Sbjct: 178  TVSLNVITRMVLGKKYLDKDAGGSVTTPEEFKWMLDELFLLNGVLNIGDSIP---WLDWL 234

Query: 761  DYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFI-----DVMLSMIDDQFTQGY 925
            D +G++K MK+  K  D  L+  VD    ERR  E + F+     DV+L   D+   +  
Sbjct: 235  DLQGYIKRMKKLGKMFDRFLEHVVD-EHNERRRREGESFVAKDMVDVLLQFADNPNLE-V 292

Query: 926  SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED 1105
               R+ V KA    ++   +E+ A  + W L+ LLK PE   +  +E+D  +G+ RW  +
Sbjct: 293  KLKREGV-KAFTQDLIAGGTESSAVTVEWALSELLKKPEVFAKATEELDRVVGRGRWVTE 351

Query: 1106 SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK 1285
             DV +L Y+  +VKET+R++P  P L P  + ED  VDGY IP GT++ V+VW + RDPK
Sbjct: 352  KDVPSLTYVDAIVKETMRLHPVAPMLVPRLSREDTSVDGYDIPAGTRVLVSVWTIGRDPK 411

Query: 1286 IWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF 1465
            +W  PE+F+PERF+ N      Q+  ++ +PFG GRR CPG     ++ Q+++A L  GF
Sbjct: 412  LWDAPEEFMPERFIGNKIDVKGQD--FELLPFGSGRRMCPGYSLGLKVIQLSLANLLHGF 469

Query: 1466 NF---STVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
             +     V  E L M E  G+  P+  PLE +V P+L   L+
Sbjct: 470  AWRLPDGVTREQLSMEEIFGLSTPRKFPLEAVVEPKLPAHLY 511



>gb:AC084282_1733418 Oryza sativa chromosome 3 BAC OSJNBb0048A17
            genomic sequence, complete sequence.
          Length = 512

 Score =  275 bits (703), Expect = 2e-72
 Identities = 169/492 (34%), Positives = 262/492 (53%), Gaps = 4/492 (0%)
 Frame = +2

Query: 101  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW 280
            + +  RLPP    A PIIGHLH  +   P+  TLS  A ++GPVF++RLG  R +VVSS 
Sbjct: 33   KNKGMRLPPGLP-AVPIIGHLHLVKK--PMHATLSRLAARHGPVFSLRLGSRRAVVVSSP 89

Query: 281  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE 460
               R+CF  +D   A RP   +   + +D      ++   +WR +R++   ++LS+RR+ 
Sbjct: 90   GCARECFTEHDVAFANRPRFESQLLMSFDGTALAMASYGPHWRNLRRVAAVQLLSARRVG 149

Query: 461  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAG----RRY 628
             +  +   E++  ++      S+     +A  V + R    L+L+++M+ +A     R  
Sbjct: 150  LMSGLIAGEVRAMVR------SLCRRPAAAAPVQLKRRLFELSLSVLMETIAQSKATRPE 203

Query: 629  EYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDV 808
               +D  ++ EAQ  K+V  +++   G   +G+    L   RW D  G    +  A    
Sbjct: 204  TTDTDTDMSMEAQEYKQVVEEILERIG---TGNLCDYLPALRWFDVFGVRNRILAAVSRR 260

Query: 809  DAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASE 988
            DA L+  + A R      E +  I V+L++   Q TQ   Y+ D +I A+  ++L   +E
Sbjct: 261  DAFLRRLIYAARWRMDDGEKKSMIAVLLTL---QKTQPEVYT-DNMITALCSNLLGAGTE 316

Query: 989  TFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYP 1168
            T +T + W +++LL HPE+LK+ Q EID ++G  R     DV  + YLQ +V+ETLR+YP
Sbjct: 317  TTSTTIEWAMSLLLNHPETLKKAQAEIDASVGNSRLITADDVPRITYLQCIVRETLRLYP 376

Query: 1169 QGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEA 1348
              P L PHE+  DC V GY +P+GT L VN + +HRDP  W +PE+F+PERF    EG  
Sbjct: 377  AAPMLIPHESSADCEVGGYSVPRGTMLLVNAYAIHRDPAAWEEPERFVPERF----EGGG 432

Query: 1349 AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILP 1528
                    +PFG+GRR CPG   A     + +  L Q F++  V    +DM E  G+ +P
Sbjct: 433  CDGN--LSMPFGMGRRRCPGETLALHTVGLVLGTLIQCFDWERVDGVEVDMAEGGGLTMP 490

Query: 1529 KLTPLEVLVTPR 1564
            K+ PLE +  PR
Sbjct: 491  KVVPLEAVCRPR 502



>gb:AB019233_1514191 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MJB24.>gb:AY065209_1566362 Arabidopsis thaliana
            putative cytochrome P450 protein (At5g57220) mRNA,
            complete cds.>gb:AY096511_1576053 Arabidopsis thaliana
            putative cytochrome P450 protein (At5g57220) mRNA,
            complete cds.
          Length = 491

 Score =  275 bits (703), Expect = 2e-72
 Identities = 182/513 (35%), Positives = 266/513 (51%), Gaps = 1/513 (0%)
 Frame = +2

Query: 29   MDAVPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSE 208
            MD V   L   L + A   L FS + Q   LPP     +PI+GHLH  +   P+ +    
Sbjct: 1    MDYVLIVLPLALFLIAYKFL-FSSKTQGFNLPP-GPTPFPIVGHLHLVKP--PVHRLFRR 56

Query: 209  WADKYGPVFTIRLGISRILVVSSWEAVRDCFA-TNDKLLAARPTTCAGKYLGYDYAVFTF 385
            +A+KYG +F++R G  +++V+SS   VR+ F   ND +L  RP     KY+ YDY     
Sbjct: 57   FAEKYGDIFSLRYGSRQVVVISSLPLVRESFTGQNDVILTNRPHFLTAKYVAYDYTTIGT 116

Query: 386  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM 565
            +    +WR +R++   EILSS RL      ++S  +  I+ L T +S + +      V +
Sbjct: 117  AAYGDHWRNLRRICSLEILSSNRLTG----FLSVRKDEIRRLLTKLSREYDGRV---VEL 169

Query: 566  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW 745
                  LT N I+++V GRRY Y       EEA   KK+ + +    G    GD +  L 
Sbjct: 170  EPLLADLTFNNIVRMVTGRRY-YGDQVHNKEEANLFKKLVTDINDNSGASHPGDYLPILK 228

Query: 746  FFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGY 925
             F      G+ K +K   + +DA LQ  +D  R    SN     +  +LS+  DQ     
Sbjct: 229  VFG----HGYEKKVKALGEAMDAFLQRLLDECRINGESNT---MVSHLLSLQLDQ----P 277

Query: 926  SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED 1105
             Y  D +IK ++LSM+   ++T A  L W +A LLK PE LK+ + EID  IG+ER  ++
Sbjct: 278  KYYSDVIIKGLMLSMMLAGTDTAAVTLEWAMANLLKKPEVLKKAKAEIDEKIGEERLVDE 337

Query: 1106 SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK 1285
             D+ NLPYLQ +V ET R+ P  P L P    ED  + GY IP+GT + VN W +HRDP+
Sbjct: 338  PDIANLPYLQNIVSETFRLCPAAPLLVPRSPSEDLKIGGYDIPRGTIVLVNAWAIHRDPR 397

Query: 1286 IWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF 1465
            +W +PEKF+PERF         Q    + + FG GRR+CPG     ++  +A+  L Q F
Sbjct: 398  LWDEPEKFMPERF-------EDQEASKKLMVFGNGRRTCPGATLGQRMVLLALGSLIQCF 450

Query: 1466 NFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPR 1564
            ++  V  E +DM E+ G+ + KL  L  +   R
Sbjct: 451  DWEKVNGEDVDMTENPGMAMRKLVQLRAVCHKR 483



>gb:CAR012581_1645125 Cicer arietinum mRNA for cytochrome P450.
          Length = 498

 Score =  275 bits (702), Expect = 3e-72
 Identities = 168/499 (33%), Positives = 273/499 (54%), Gaps = 3/499 (0%)
 Frame = +2

Query: 77   LVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGIS 256
            ++ L F  RK  K LPP    + PIIG+LHH +   PL +T    +  YG + ++  G  
Sbjct: 19   IIRLLFQSRK-FKNLPP-GPPSLPIIGNLHHLKR--PLHRTFKGLSKTYGDIISLWFGSR 74

Query: 257  RILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEE 436
             ++VVSS    + CF  ND +LA RP   +GKY+ Y+Y     ++ + +WR +R++   +
Sbjct: 75   LVVVVSSLSEFQQCFTKNDVVLANRPRFLSGKYIFYNYTTLGSTSYSEHWRNLRRITSLD 134

Query: 437  ILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVA 616
            +LS+ R+     V   E Q  I +L      ++++ S  +V +S  F  +T N IM+++ 
Sbjct: 135  VLSNHRINNFSGVRRDETQRLITKL-----AEDSSTSFAEVELSFRFYDMTFNNIMRMIP 189

Query: 617  GRRYEYRSDGTINE--EAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMK 790
            G+RY Y  D  +++  EA + + + ++++ L G     D +  L FF   D+E   K +K
Sbjct: 190  GKRY-YGEDCDMSDLQEASQFRDMVTELLQLSGANNKTDFMPLLKFF---DFENLEKRVK 245

Query: 791  RAAKDVDAILQDWV-DARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLS 967
              A   DA L+  + + R K+ R+N     ID +L++ + Q      Y  D +IK + L+
Sbjct: 246  NIADKTDAFLRGLLQEQRNKKERTNT---MIDHLLNLQESQ----PEYYTDQIIKGLALA 298

Query: 968  MLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVK 1147
            ML   +++ A  L W ++ LL HPE LK+V+DE+D ++G++R  ++SD+  L YL+ V+ 
Sbjct: 299  MLLAGTDSSAVTLEWSMSNLLNHPEILKKVKDELDIHVGQDRLVDESDLPKLTYLKNVIY 358

Query: 1148 ETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFM 1327
            ETLR+    P L PH   +DCI+ GY +P+ T + +N W +HRDPK W +   F PERF 
Sbjct: 359  ETLRLCTPAPLLLPHSTSDDCIIGGYKVPRDTIVLINAWAIHRDPKSWSEATSFKPERFD 418

Query: 1328 TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMME 1507
               E E       + + FG+GRR CPG   A +   + +A L Q F++    ++ +DM E
Sbjct: 419  KKGEIE-------KVIAFGMGRRVCPGEALALRTISMTLALLVQCFDWKRTSDDKIDMAE 471

Query: 1508 DVGIILPKLTPLEVLVTPR 1564
              G +L KL PL+ +   R
Sbjct: 472  RDGFVLTKLIPLKAMCKTR 490



>pir|JC7886|JC7886 cytochrome P450 92B1 - garden petunia
          Length = 510

 Score =  274 bits (700), Expect = 5e-72
 Identities = 159/501 (31%), Positives = 265/501 (52%), Gaps = 8/501 (1%)
 Frame = +2

Query: 104  KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWE 283
            K  KR  P     WP+IG+L+   ++    ++L   + KYG +  ++ G   +L+VSS E
Sbjct: 26   KFPKRKLPPGPWPWPVIGNLNLVGSNPH--ESLHYLSQKYGDLMLLKFGSKPVLIVSSPE 83

Query: 284  AVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEK 463
              ++   T+D + A+RP   AGK+  ++++  T++    +WR+ RKL + EI + +RL+ 
Sbjct: 84   MAKEFLKTHDAIFASRPPLAAGKFTSFNFSDMTWAPYGRFWRQARKLYLSEIFNPKRLDS 143

Query: 464  LKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSD 643
             KH+ V E Q  I  L+   ++  +NP    V +       TL+ + +I  GR+Y Y  +
Sbjct: 144  FKHIRVEETQALISRLH---ALSRSNP----VYLRDHLPQFTLSTVSRIAMGRKY-YSDE 195

Query: 644  GTINEEA----QRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKD-V 808
              +NE +    ++LK +      L G    GD +    F  W D +G+VK MK   K  +
Sbjct: 196  SNLNESSPVTFEKLKWMLDDWFMLGGVINLGDWVP---FLSWFDPQGYVKRMKPLGKSFI 252

Query: 809  DAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASE 988
            +       D + K + +   +  IDV+L + DD   +   ++ D ++  ++  M     +
Sbjct: 253  EFYKYVLEDHKAKAKETCVPKDMIDVILQLADDPNLE-VKFTSDQIV-GLIHGMQTGGID 310

Query: 989  TFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYP 1168
            T A+ + W    LL+ P+ +++  +E+D  IGKERW ++ D   LPY++ ++KET R++P
Sbjct: 311  TSASAVEWAFQELLRKPKIIEKANEELDRAIGKERWIQEEDFTRLPYIEAIIKETFRLHP 370

Query: 1169 QGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEA 1348
                L PH ++EDC V GY IPKGT +YVN W + R+PK W  PE+F+PERF+ N     
Sbjct: 371  LCALLPPHYSIEDCCVAGYDIPKGTSVYVNAWSIGRNPKYWDKPEEFIPERFLENDIDIK 430

Query: 1349 AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN---EPLDMMEDVGI 1519
             QN  +  +PFG GRR CPG     ++ +  +A L  GFN+    +   E + M E  G+
Sbjct: 431  GQN--FTLLPFGSGRRRCPGYSLGIKLVRTTMANLLHGFNWKLAQDMKPEDICMEEVYGL 488

Query: 1520 ILPKLTPLEVLVTPRLSPTLF 1582
                  P+ +++ PRL   L+
Sbjct: 489  TTHLKKPISMIMEPRLPLHLY 509



>sp|Q9SD85|F3PH_ARATH Flavonoid 3'-monooxygenase (EC 1.14.13.21)
            (Flavonoid 3'-hydroxylase) (AtF3'H) (Cytochrome P450
            75B1) (TRANSPARENT TESTA 7 protein).>pir|T45624|T45624
            flavonoid 3'-hydroxylase-like protein [imported] -
            Arabidopsis thaliana>gb:ATF13G24_1548449 Arabidopsis
            thaliana DNA chromosome 5, BAC clone F13G24 (ESSA
            project).>gb:AF155171_1772947 Arabidopsis thaliana
            flavonoid 3'-hydroxylase (TT7) gene, complete
            cds.>gb:AF241643S4_1780124 Arabidopsis thaliana flavonoid
            3'hydroxylase gene, exon 4 and complete
            cds.>gb:AF271650_1782158 Arabidopsis thaliana chromosome
            V flavonoid 3'-hydroxylase mRNA, complete
            cds.>gb:AF271651_1782159 Arabidopsis thaliana chromosome
            V flavonoid 3'-hydroxylase mRNA, complete cds.
          Length = 513

 Score =  274 bits (700), Expect = 5e-72
 Identities = 173/516 (33%), Positives = 266/516 (51%), Gaps = 12/516 (2%)
 Frame = +2

Query: 77   LVLLWFSWRKQ---SKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRL 247
            L+L  FS R+    + RLPP     WPIIG+L H  T     +TLS     YGP+  +RL
Sbjct: 16   LILRIFSHRRNRSHNNRLPP-GPNPWPIIGNLPHMGTKPH--RTLSAMVTTYGPILHLRL 72

Query: 248  GISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLV 427
            G   ++V +S          +D   A+RP     K++ Y+Y    F+     WR +RK+ 
Sbjct: 73   GFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGHRWRLLRKIS 132

Query: 428  VEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQ 607
               + S++ LE  KHV   E+ T  +EL               VN+ +      +N + +
Sbjct: 133  SVHLFSAKALEDFKHVRQEEVGTLTRELVRV--------GTKPVNLGQLVNMCVVNALGR 184

Query: 608  IVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTM 787
             + GRR  + +D   + +A   + + +++M L G F  GD +  L    WLD +G    M
Sbjct: 185  EMIGRRL-FGADA--DHKADEFRSMVTEMMALAGVFNIGDFVPSL---DWLDLQGVAGKM 238

Query: 788  KRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQ----GYSYSRDTVIKA 955
            KR  K  DA L   +   ++   + +DQK  D++ ++I  + T     G S + DT IKA
Sbjct: 239  KRLHKRFDAFLSSIL---KEHEMNGQDQKHTDMLSTLISLKGTDLDGDGGSLT-DTEIKA 294

Query: 956  IVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQ 1135
            ++L+M    ++T A+ + W +A L++HP+ + + Q+E+D  +G++R   +SD+  LPYLQ
Sbjct: 295  LLLNMFTAGTDTSASTVDWAIAELIRHPDIMVKAQEELDIVVGRDRPVNESDIAQLPYLQ 354

Query: 1136 GVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLP 1315
             V+KE  R++P  P   PH A E C ++GYHIPKG+ L  N+W + RDP  W DP  F P
Sbjct: 355  AVIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLAFKP 414

Query: 1316 ERFMTNLE--GEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST---V 1480
            ERF+   E  G   +   ++ +PFG GRR C G     +  Q   A L QGF++     V
Sbjct: 415  ERFLPGGEKSGVDVKGSDFELIPFGAGRRICAGLSLGLRTIQFLTATLVQGFDWELAGGV 474

Query: 1481 PNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFRL 1588
              E L+M E  G+ L +  PL V   PRL+P ++ L
Sbjct: 475  TPEKLNMEESYGLTLQRAVPLVVHPKPRLAPNVYGL 510



>gb:AF218296_1778151 Pisum sativum cytochrome P450 mRNA, complete cds.
          Length = 495

 Score =  273 bits (697), Expect = 1e-71
 Identities = 163/504 (32%), Positives = 270/504 (53%), Gaps = 6/504 (1%)
 Frame = +2

Query: 38   VPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWAD 217
            +P  ++     A L+L     R++   LPP     WPIIG+ +   T     ++L     
Sbjct: 8    LPSWVTLFTTFAILLLFSRRLRRRQYNLPP-GPKPWPIIGNFNLIGTLPH--QSLHGLTQ 64

Query: 218  KYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNN 397
            KYGP+  +  G  R++V S+ E  +    T+D  LA RP   AGKY  Y+Y+  T+S   
Sbjct: 65   KYGPIMHLWFGSKRVVVGSTVEMAKAFLKTHDATLAGRPKFSAGKYTTYNYSDITWSQYG 124

Query: 398  SYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWF 577
             YWR+ R++ + E+ S++RLE  +++   EL   + EL+     D+ N +   + +    
Sbjct: 125  PYWRQARRMCLLELFSAKRLESYEYIRKQELHVFLHELF-----DSRNKT---ILLKDHL 176

Query: 578  GHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRW 757
              L+LN+I ++V GR+Y  + + +I    +  K +  ++  L G    GD  F  W   +
Sbjct: 177  SSLSLNVISRMVLGRKYLEKVENSIISPDE-FKNMLDELFLLNGILNIGD--FIPWI-HF 232

Query: 758  LDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNED---QKFIDVMLSMIDDQFTQGYS 928
            LD++G+VK MK  +K  D  ++  ++   + R+  +D   +  +DV+L + +D   +   
Sbjct: 233  LDFQGYVKRMKVLSKKFDGFMEHVLEEHIERRKGVKDYVAKDMVDVLLQLAEDPDLE-VK 291

Query: 929  YSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDS 1108
              R  V KA    ++   +E+ A  + W ++ L++ PE  K+  +E+D  IG+ERW E+ 
Sbjct: 292  LERHGV-KAFTQDLIAGGTESSAVTVEWAISELIRKPEIFKKATEELDRVIGRERWVEEK 350

Query: 1109 DVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKI 1288
            D+ NLPY+  + KET+R++P  P L P EA EDC ++GY IPKG+ + VN W + RD  +
Sbjct: 351  DIANLPYVYAIAKETMRLHPVAPMLVPREAREDCNINGYDIPKGSLILVNTWTIARDSNV 410

Query: 1289 WPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFN 1468
            W +P +F+PERF+   +    +   Y+ +PFG GRR CPG     ++ Q ++A L  GFN
Sbjct: 411  WDNPNEFMPERFLG--KDIDVKGHDYELLPFGAGRRMCPGYPLGIKVIQSSLANLLHGFN 468

Query: 1469 F---STVPNEPLDMMEDVGIILPK 1531
            +     V  E L+M E  G+  PK
Sbjct: 469  WRLSDDVKKEDLNMEEIFGLSTPK 492



>gb:AY087977_1573001 Arabidopsis thaliana clone 40095 mRNA, complete
            sequence.
          Length = 501

 Score =  272 bits (696), Expect = 1e-71
 Identities = 173/518 (33%), Positives = 269/518 (51%), Gaps = 4/518 (0%)
 Frame = +2

Query: 59   ILGIAALVL---LWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGP 229
            +L +A  +L   L+F+ + +   LPP    + PI+GH  H     P+ +     +  +GP
Sbjct: 7    VLPLALFLLANKLFFTSKTKRFNLPPSPPYSLPILGH--HNLLKPPVHRLFHRLSKTHGP 64

Query: 230  VFTIRLGISRILVVSSWEAVRDCFA-TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYW 406
            +F+++ G  R +V+SS      CF   ND +L+ RP     KY+ Y+Y     +    +W
Sbjct: 65   IFSLQFGSRRAVVISSSSLATQCFTGQNDIILSNRPCFLTAKYVAYNYTTVGTAPYGDHW 124

Query: 407  RRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHL 586
            R +R++   EILSS RL    H+   E    I  + T +S D       ++ +      L
Sbjct: 125  RNLRRICSLEILSSNRLTNFLHIRKDE----IHRMLTRLSRDVKK----EIELEPLLSDL 176

Query: 587  TLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDY 766
            T N I+++V G+RY Y  +    EEA   KK+ + +    G    GD + P        +
Sbjct: 177  TFNNIVRMVTGKRY-YGDEVHNEEEANVFKKLVADINDCSGARHPGDYL-PFMKMFGGSF 234

Query: 767  EGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTV 946
            E  VK +  A   +D ILQ  ++  R+++  N     ++ +LS+  ++      Y  D  
Sbjct: 235  EKKVKALAEA---MDEILQRLLEECRRDKDGNT---MVNHLLSLQQNE----PEYYTDVT 284

Query: 947  IKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLP 1126
            IK ++L M+   ++T A  L W ++ LL HPE+L++ + EID  IG+ER  ++ D+ NLP
Sbjct: 285  IKGLMLGMMIAGTDTSAVTLEWAMSSLLNHPEALEKAKLEIDEKIGQERLIDEPDIANLP 344

Query: 1127 YLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEK 1306
            YLQ +V ET R+YP  P L P    ED  V GY +P+GT + VN W +HRDP++W +PEK
Sbjct: 345  YLQNIVSETFRLYPAAPLLVPRSPTEDIKVGGYDVPRGTMVMVNAWAIHRDPELWNEPEK 404

Query: 1307 FLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN 1486
            F PERF    EG       ++ +PFG GRRSCPG     +I  +A+  L Q F++  V  
Sbjct: 405  FKPERF-NGGEGGGRGEDVHKLMPFGNGRRSCPGAGLGQKIVTLALGSLIQCFDWQKVNG 463

Query: 1487 EPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFRL*AYI 1600
            E +DM E  G+ + K  PL  L   R  P + +L A++
Sbjct: 464  EAIDMTETPGMAMRKKIPLSALCQSR--PIMSKLQAHL 499



>pir|T03275|T03275 probable cytochrome P450, hypersensitivity-related
            - common tobacco>gb:NTHSR515_1691588 N.tabacum mRNA for
            HSR515 protein.
          Length = 509

 Score =  272 bits (695), Expect = 2e-71
 Identities = 174/514 (33%), Positives = 275/514 (53%), Gaps = 7/514 (1%)
 Frame = +2

Query: 62   LGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTI 241
            LG   L+ L    R++   LPP     WPIIG+L+    ++P  +++ E + KYGPV  +
Sbjct: 14   LGTLFLLFLSKLLRQRKLNLPP-GPKPWPIIGNLNLIG-NLPY-RSIHELSLKYGPVMQL 70

Query: 242  RLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRK 421
            + G   ++V SS E  +    + D     RP T AGKY  Y+Y+  T+S    YWR+ R+
Sbjct: 71   QFGSFPVVVGSSVEMAKIFLKSMDINFVGRPKTAAGKYTTYNYSDITWSPYGPYWRQARR 130

Query: 422  LVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLI 601
            + + E+ S++ L+  +++   EL + +  L        N  S   + +  +   L+LN+I
Sbjct: 131  MCLTELFSTKCLDSYEYIRAEELHSLLHNL--------NKISGKPIVLKDYLTTLSLNVI 182

Query: 602  MQIVAGRRYEYRSDGT-INEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHV 778
             ++V G+RY   S+ + +N E    KK+  ++  L G    GD+I  + F   +D +G+V
Sbjct: 183  SRMVLGKRYLDESENSFVNPE--EFKKMLDELFLLNGVLNIGDSIPWIDF---MDLQGYV 237

Query: 779  KTMKRAAKDVDAILQDWVDARRKERRSNED---QKFIDVMLSMIDDQFTQGYSYSRDTVI 949
            K MK  +K  D  L+  +D     R   E+   +   DV+L + DD   +     R  V 
Sbjct: 238  KRMKVVSKKFDKFLEHVIDEHNIRRNGVENYVAKDMEDVLLQLADDPKLE-VKLERHGV- 295

Query: 950  KAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPY 1129
            KA    ML   +E+ A  + W ++ L K PE  K+  +E+D  IG+ RW ++ D+ NLPY
Sbjct: 296  KAFTQDMLAGGTESSAVTVEWAISELSKKPEIFKKATEELDRVIGQNRWVQEKDIPNLPY 355

Query: 1130 LQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKF 1309
            ++ +VKET+R++P  P  A  E  E+  V GY + KGT++ V+VW + RDP +W +PE F
Sbjct: 356  IEAIVKETMRLHPVAPMKAT-ECRENSKVAGYDVQKGTRVLVSVWTIGRDPTLWDEPEVF 414

Query: 1310 LPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN- 1486
             PERF      +  +   Y+ +PFG+GRR CPG     ++ Q ++A L  GFN+S   N 
Sbjct: 415  KPERFHEKASID-VKGHDYELLPFGVGRRMCPGYSLGLKVIQASLANLLHGFNWSLPDNM 473

Query: 1487 --EPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
              E L+M E  G+  PK  PL  ++ PRLSP L+
Sbjct: 474  TPEDLNMDEIFGLSTPKKFPLATVIEPRLSPKLY 507



>pir|T03634|T03634 cytochrome P450 - common
            tobacco>gb:NTP450GEN_1691665 N.tabacum cytochrome P-450
            gene.
          Length = 498

 Score =  272 bits (695), Expect = 2e-71
 Identities = 169/507 (33%), Positives = 266/507 (52%), Gaps = 10/507 (1%)
 Frame = +2

Query: 53   SSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGP 229
            ++ L   +L LL    R++   LPP     WPI+G+   F    PL  +++ E + KYGP
Sbjct: 11   AACLATLSLFLLSKFLRQRKLNLPP-GPKPWPIVGN---FNLIAPLAHRSVHELSLKYGP 66

Query: 230  VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWR 409
            +  +R G   ++V SS E  +    + D     RP   AGKY  Y+Y+  T+S    YWR
Sbjct: 67   IMQLRFGSFPVVVGSSVEMAKVFLKSMDINFVDRPKMAAGKYTTYNYSNITWSAYGPYWR 126

Query: 410  RVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLT 589
            + RK+ + E+ +++RLE L+++   ELQ+ + +LY        N +   + +  +   L+
Sbjct: 127  QARKMCLMELFTAKRLESLEYIRTEELQSLLHDLY--------NLTGKPILLKDYLMTLS 178

Query: 590  LNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDY- 766
            LN+I ++V G+RY   S  +I    +  KK+  ++  L G    GD      +  W+D+ 
Sbjct: 179  LNVISRMVLGKRYLDESKNSI-VTPEEFKKMLDELFLLNGVLNIGD------YIPWIDFM 231

Query: 767  --EGHVKTMKRAAKDVDAILQDWVDARRKERRSNED---QKFIDVMLSMIDDQFTQGYSY 931
              +G+VK MK  +   D  L+  +D     R + E+   +  +DV+L   DD  T     
Sbjct: 232  DLQGYVKRMKVLSNKFDRFLEYVLDEHNARRNAEENYVAKDMVDVLLQFADDP-TLEVKL 290

Query: 932  SRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSD 1111
             R  V KA    +L   +E+ A  + W ++ LLK PE   +  +E+D  IG+ RW ++ D
Sbjct: 291  ERHGV-KAFTQDLLAGGTESTAVIVEWAISELLKKPEIFNKATEELDRVIGQNRWVQEKD 349

Query: 1112 VKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIW 1291
            + N PY++ +VKET+R++P  P L P    EDC V GY I KGT++ V+VW + RDP +W
Sbjct: 350  IPNFPYIEAIVKETMRLHPVAPMLTPRLCGEDCKVAGYDILKGTRVLVSVWTIARDPTLW 409

Query: 1292 PDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF 1471
             +PE F PERF+ N       N  ++ +PFG GRR CPG     ++ Q ++A L  GF +
Sbjct: 410  DEPEAFKPERFLGNSIDVKGHN--FELLPFGAGRRMCPGYNLGLKVIQASLANLLHGFKW 467

Query: 1472 STVPN---EPLDMMEDVGIILPKLTPL 1543
            S   N   E L+M E   + +PK  PL
Sbjct: 468  SLPDNMTPEDLNMEEIFCLSIPKKIPL 494



>gb:AX028830_1457176 Sequence 14 from Patent WO9732023.
          Length = 513

 Score =  270 bits (690), Expect = 7e-71
 Identities = 167/509 (32%), Positives = 254/509 (49%), Gaps = 6/509 (1%)
 Frame = +2

Query: 77   LVLLWFSWRKQSKRLP-PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGI 253
            L  L FS + Q   LP P     WP++G+L H         +++E A K+GP+  +RLG 
Sbjct: 15   LFRLLFSGKSQRHSLPLPPGPKPWPVVGNLPHLGPFPH--HSIAELAKKHGPLMHLRLGY 72

Query: 254  SRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVE 433
              ++V +S         T+D   ++RP     K+L Y+Y    F      WR  RK+   
Sbjct: 73   VDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFRPYGPRWRMFRKISSV 132

Query: 434  EILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIV 613
             + S + L+ LKHV   E+      L         N  +  VN+++     T+N + +++
Sbjct: 133  HLFSGKALDDLKHVRQEEVSVLAHALA--------NSGSKVVNLAQLLNLCTVNALGRVM 184

Query: 614  AGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKR 793
             GRR      G  + +A   K +  ++M L G F  GD I  L    WLD +G    MK+
Sbjct: 185  VGRRVFGDGSGGDDPKADEFKSMVVEMMVLAGVFNIGDFIPSL---EWLDLQGVASKMKK 241

Query: 794  AAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSML 973
              K  D  L   V+  +K   +      +  +LS+ +D   +G   + DT IKA++L+M 
Sbjct: 242  LHKRFDDFLTAIVEDHKKGSGTAGHVDMLTTLLSLKEDADGEGGKLT-DTEIKALLLNMF 300

Query: 974  QDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKET 1153
               ++T ++ + W +A L++HP  L RVQ E+D  +G +R   +SD+ NLPYLQ V+KET
Sbjct: 301  TAGTDTSSSTVEWAIAELIRHPHMLARVQKELDDFVGHDRLVTESDIPNLPYLQAVIKET 360

Query: 1154 LRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTN 1333
             R++P  P   P  A E C ++GYHIPKG+ L VNVW + RDP  W DP +F PERF+  
Sbjct: 361  FRLHPSTPLSLPRMAAESCEINGYHIPKGSTLLVNVWAISRDPAEWADPLEFKPERFLPG 420

Query: 1334 LEGEAAQNR--QYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN---EPLD 1498
             E      R   ++ +PFG GRR C G     ++  +  A L   FN++       E L+
Sbjct: 421  GEKPNVDIRGNDFEVIPFGAGRRICAGMSLGLRMVHLMTATLVHAFNWALADGLTAEKLN 480

Query: 1499 MMEDVGIILPKLTPLEVLVTPRLSPTLFR 1585
            M E  G+ L +  PL V    RL+P  ++
Sbjct: 481  MDEAYGLTLQRAAPLMVHPRTRLAPQAYK 509



>gb:AP005285_1849829 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1003_F04.
          Length = 525

 Score =  270 bits (689), Expect = 9e-71
 Identities = 169/521 (32%), Positives = 264/521 (50%), Gaps = 18/521 (3%)
 Frame = +2

Query: 62   LGIAALVLLWFSWRKQSKRL----PPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGP 229
            L +  L+LL  + R++S RL    PPE  G  P++GHLH FR   PL +TL+  A ++G 
Sbjct: 10   LTLVLLLLLLTARRRRSGRLRLRLPPEPPGL-PLVGHLHLFRK--PLHRTLARLAARHGA 66

Query: 230  VFTIRLGISRI-LVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYW 406
            VF +RLG  R+ +VVSS  A  +C   +D   A RP   +   L Y ++    +    YW
Sbjct: 67   VFRLRLGSRRVAVVVSSAPAAEECLGAHDVAFAGRPRLPSAGILSYGWSTMGTAAYGPYW 126

Query: 407  RRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAP----KVNMSRW 574
            R VR++ V EILS+ R+ +       E +   + L    S   +   A     +V +   
Sbjct: 127  RHVRRVAVAEILSAHRVRQFAGAHAREARATARRLCRAASRQRHGAGAAAGRVRVELKSR 186

Query: 575  FGHLTLNLIMQIVAGRRYEYRSD-GTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF 751
               L +N +M ++  + Y    D G ++EEA+  +++  + M L G     D  F     
Sbjct: 187  LFELLMNTMMAMICDKTYYGADDDGEVSEEARWFREMVEETMALSGASTVWD--FLPAAL 244

Query: 752  RWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDV-------MLSMIDDQ 910
            RW+D  G  + + R  +     LQ  +D +RKE   + D + +         M+ ++   
Sbjct: 245  RWVDVGGVGRRLWRLRESRTRFLQGLIDDQRKEMEHDGDGRELPAAAARPRSMIGVLLSV 304

Query: 911  FTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE 1090
              Q      D +I ++ +S L+  + T    + W +++LL +P+ +++ +DEID  IG+ 
Sbjct: 305  QRQDPEECPDQLISSLCISSLEAGTGTSTDTIEWAMSLLLNNPDVMRKARDEIDAFIGQP 364

Query: 1091 -RWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR 1267
             R  E  D+  L YL+ ++ ETLR+YP  P L PHE+  DC V G+HIP+GT L VN + 
Sbjct: 365  VRLLEADDLPKLQYLRCIIMETLRLYPPAPLLVPHESSSDCTVAGFHIPRGTMLLVNTFD 424

Query: 1268 LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA 1447
            +HRDP IW +P  F+PERF      E  ++     +PFG+GRR CP      Q+  + + 
Sbjct: 425  IHRDPHIWDEPTSFIPERF------EDGRSEGKMAIPFGMGRRKCPAENLGMQMVGLGLG 478

Query: 1448 RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS 1570
             + Q F +  V  E +DM E  G+ +PK  PLE    PR S
Sbjct: 479  TMIQCFEWERVGEELVDMTEGSGLTMPKKVPLEAFYQPRAS 519



>gb:AY166658_1586209 Pisum sativum cytochrome P450 mRNA, complete cds.
          Length = 502

 Score =  270 bits (689), Expect = 9e-71
 Identities = 169/511 (33%), Positives = 266/511 (52%), Gaps = 7/511 (1%)
 Frame = +2

Query: 41   PCCLSSILGIAALVLLWFSWRKQSKRLP--PEAGGAWPIIGHLHHFRTSVPLVKTLSEWA 214
            P    S L +  ++ +    + QS+RL   P      PIIG+LHH +   PL +T +  +
Sbjct: 3    PLFYYSFLSLTFIITIKILLQTQSRRLKNLPPGPPTIPIIGNLHHLKH--PLHRTFATLS 60

Query: 215  DKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTN 394
             KYG + ++  G   ++V+SS   V +CF  ND +LA RP    GKY+ YDY      + 
Sbjct: 61   QKYGDIVSLWFGSRLVVVISSASLVEECFIKNDVVLANRPRFLTGKYIFYDYTTLGSVSY 120

Query: 395  NSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRW 574
              +WR +R++   ++LS+ RL     V   E    I+     I     +    KV +   
Sbjct: 121  GDHWRNLRRITTIDVLSNNRLTSFLGVRTDEANRLIQN----IIKHGASRDFIKVELRSI 176

Query: 575  FGHLTLNLIMQIVAGRRYEYRSDGTINE--EAQRLKKVFSQVMYLWGEFVSGDAIFPLWF 748
               +T N +M++++G+RY Y  DG + E  EA++ +++ S+++ L G    GD + PL  
Sbjct: 177  LTEMTFNGMMRMISGKRY-YGDDGDVTEVEEAKQFREIISEILSLLGANNKGDFL-PL-- 232

Query: 749  FRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYS 928
             RW D +   K  K+ A   DA L+  +   R     N D   ID +L + + Q     S
Sbjct: 233  LRWFDLDDLEKRCKKIANRADAFLEGLIQEHRSANHGNGDT-MIDHLLKLSEVQLNIIPS 291

Query: 929  YSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDS 1108
            +    +IK ++ +ML   ++T A  + W+++ LL HPE L + ++EI+T +GK +  ++ 
Sbjct: 292  H----IIKGLIQAMLLAGTDTSALAIEWVMSELLNHPEVLNKAKEEIETQVGKNKIIDEQ 347

Query: 1109 DVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKI 1288
            D+  LPYLQ ++ E L+++P  P L PH + EDC + G+++PK T +  NVW +HRDP  
Sbjct: 348  DLPKLPYLQNIISEALKLHPPAPLLLPHYSSEDCTIGGFNVPKDTIILTNVWAIHRDPTR 407

Query: 1289 WPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPG-NLYATQITQVAVARLFQGF 1465
            W D   F PERF    EGE       + + FG+GRR+CPG +L    +     A  FQ F
Sbjct: 408  WSDALSFKPERF--EKEGEV-----NKLMAFGIGRRACPGLSLAQRTVGLNCGACWFQCF 460

Query: 1466 NFSTVPNEPLDMMEDVGIILP--KLTPLEVL 1552
             +     E LDMME  G +LP  K +P + L
Sbjct: 461  EWKRESEEKLDMME--GKVLPCLKRSPFKAL 489



>gb:AB061212_1521992 Glycine max sf3'h1 mRNA for flavonoid
            3'-hydroxylase, complete cds.>gb:AF499730_1806166 Glycine
            max clone Gm-c1019-10961 cultivar Williams flavonoid
            3'-hydroxylase (T) mRNA, T-T allele, complete
            cds.>gb:AF499731_1806167 Glycine max clone Gm-c1019-7295
            cultivar Williams flavonoid 3'-hydroxylase (T) mRNA, T-T
            allele, complete cds.
          Length = 513

 Score =  268 bits (686), Expect = 2e-70
 Identities = 168/518 (32%), Positives = 267/518 (51%), Gaps = 11/518 (2%)
 Frame = +2

Query: 68   IAALVLLWFSWR---KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFT 238
            IAA +L++   +   + S  LPP     WPI+G+L H    VP   +L+  A  +GP+  
Sbjct: 11   IAAAILIYRIIKFITRPSLPLPP-GPKPWPIVGNLPHMGP-VPH-HSLAALARIHGPLMH 67

Query: 239  IRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVR 418
            +RLG   ++V +S          +D   ++RP     KY+ Y+Y    F+     WR +R
Sbjct: 68   LRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPNAGAKYIAYNYQDLVFAPYGPRWRLLR 127

Query: 419  KLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNL 598
            KL    + S + + + +H+   E+          ++ +  +     VN+ +     T N 
Sbjct: 128  KLTSVHLFSGKAMNEFRHLRQEEVAR--------LTCNLASSDTKAVNLGQLLNVCTTNA 179

Query: 599  IMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHV 778
            + + + GRR     +G  +  A   K +  +VM L G F  GD I  L    WLD +G  
Sbjct: 180  LARAMIGRRVFNDGNGGCDPRADEFKAMVMEVMVLAGVFNIGDFIPSL---EWLDLQGVQ 236

Query: 779  KTMKRAAKDVDAILQDWVDARRKERRSNEDQK-FIDVMLSMIDDQFTQGYSYSRDTVIKA 955
              MK+  K  DA L   ++        NE+ K F+ ++LS+ D +   G ++  DT IKA
Sbjct: 237  AKMKKLHKRFDAFLTSIIEEHNNSSSKNENHKNFLSILLSLKDVRDDHG-NHLTDTEIKA 295

Query: 956  IVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQ 1135
            ++L+M    ++T ++   W +A L+K+P+ L ++Q E+DT +G++R  ++ D+ +LPYLQ
Sbjct: 296  LLLNMFTAGTDTSSSTTEWAIAELIKNPQILAKLQQELDTVVGRDRSVKEEDLAHLPYLQ 355

Query: 1136 GVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLP 1315
             V+KET R++P  P   P  A E C + GYHIPKG  L VN+W + RDPK W DP +F P
Sbjct: 356  AVIKETFRLHPSTPLSVPRAAAESCEIFGYHIPKGATLLVNIWAIARDPKEWNDPLEFRP 415

Query: 1316 ERFMTNLEGEAA----QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF---S 1474
            ERF+  L GE A    +   ++ +PFG GRR C G     Q+ Q+  A L   F++    
Sbjct: 416  ERFL--LGGEKADVDVRGNDFEVIPFGAGRRICAGLSLGLQMVQLLTAALAHSFDWELED 473

Query: 1475 TVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFRL 1588
             +  E L+M E  G+ L +  PL V   PRL+P ++ +
Sbjct: 474  CMNPEKLNMDEAYGLTLQRAVPLSVHPRPRLAPHVYSM 511



>pir|B96691|B96691 probable cytochrome P450 F28G11.4 [imported] -
            Arabidopsis thaliana>gb:AE005173_894302 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC074025_1541172 Arabidopsis thaliana
            chromosome 1 BAC F28G11 genomic sequence, complete
            sequence.
          Length = 481

 Score =  268 bits (686), Expect = 2e-70
 Identities = 179/503 (35%), Positives = 266/503 (52%), Gaps = 4/503 (0%)
 Frame = +2

Query: 68   IAALVLLWFSWRKQSKR--LPPEAGGAWPIIGHLHHFRTSVP-LVKTLSEWADKYGPVFT 238
            I  L+ L F  +K   +  LPP    + PIIGHL   +  +  L  T+S+  +   P+F+
Sbjct: 15   ILTLITLTFLIKKLKPKPNLPPSPPFSLPIIGHLRLLKPPLHRLFLTISKSLND-SPIFS 73

Query: 239  IRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVR 418
            +RLG   + VVSS   V +CF  ND +LA RP                        + +R
Sbjct: 74   LRLGNKLVFVVSSHSIVEECFTKNDVVLANRP------------------------KNLR 109

Query: 419  KLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNL 598
            ++   EI S+ RL     +   E++  I  L       N +    KV M+    +L  N 
Sbjct: 110  RIGAVEIFSNHRLNSFYTIRRDEIRRLIARLSR---SPNASLEFAKVEMNSMLSNLAFNN 166

Query: 599  IMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWL-DYEGH 775
            I+++V G+ Y Y      + EA+R++++ ++ M  +G   +G A   L   RW+ D+E  
Sbjct: 167  IIRMVTGKCY-YGDGAEDDPEAKRVRQLIAEAMSCFG---AGHAADHLPMLRWITDFERR 222

Query: 776  VKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKA 955
            VK   + A  +D   Q  VD +R  +   E+   ID +LS+   Q +Q   Y+ D  IK 
Sbjct: 223  VK---KIAARLDEFFQRLVDEKRVAKEKKENT-MIDHLLSL---QVSQPEYYT-DHTIKG 274

Query: 956  IVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQ 1135
             +LS++   ++T A  L W L+ LL +PE LK+V+DEID  IG +R  E+SD+ NLPYLQ
Sbjct: 275  TMLSLILAGTDTSAVTLEWALSSLLNNPEVLKKVRDEIDNQIGLDRLLEESDIPNLPYLQ 334

Query: 1136 GVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLP 1315
             +V ETLR+YP GP L PH + EDC V GY +P GT L VNVW +HRDP++W DP  F P
Sbjct: 335  NIVSETLRLYPAGPLLVPHISSEDCKVGGYDMPCGTMLLVNVWAIHRDPRLWDDPASFKP 394

Query: 1316 ERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPL 1495
            ERF    EGE      ++ + FGLGRR+CPG+  A ++  +++  L Q F +  +  E +
Sbjct: 395  ERF--EKEGET-----HKLLTFGLGRRACPGSGLARRLVSLSLGSLIQCFEWERIGEEEV 447

Query: 1496 DMMEDVGIILPKLTPLEVLVTPR 1564
            DM E  G+ +P+  PL  +   R
Sbjct: 448  DMTEGGGLTMPRAIPLVAMCRAR 470



>gb:AF466200_1802231 Sorghum bicolor putative protein kinase gene,
            partial cds; putative Cf-2, fertilization-independent
            endosperm proteins, hypothetical protein, putative
            non-LTR retroelement reverse transcriptase, OCL5 protein,
            tryptophan synthase beta-subunit, hypothetical proteins,
            putative AP endonuclease, putative RNA polymerase II
            complex component SRB7, putative beta-1,3-glucanase,
            hypothetical protein, TNP2-like protein, hypothetical
            protein, putative phosphate/phosphoenolpyruvate
            translocator, putative protein, hypothetical proteins,
            putative galactosyltransferase family, hypothetical
            protein, putative cytochrome P450 family, putative lipid
            transfer protein, putative photoreceptor-interacting
            protein, and hypothetical protein genes, complete cds;
            and hypothetical protein gene, partial cds.
          Length = 526

 Score =  267 bits (682), Expect = 6e-70
 Identities = 164/521 (31%), Positives = 273/521 (52%), Gaps = 19/521 (3%)
 Frame = +2

Query: 77   LVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGIS 256
            +V+ W        RLPP     WPI G+L   + S    K  + +  KYGP+  +RLG  
Sbjct: 16   VVVYWRRLNSMRLRLPP-GPPTWPIFGNL--LQLSPLPHKDFARFCTKYGPLVYLRLGTI 72

Query: 257  RILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEE 436
              +     E +R+     D++ A+RP T A  +L Y       +     W+R+R++ +E 
Sbjct: 73   DAITTDDPEVIREILIRQDEVFASRPRTLAAVHLAYGCGDVALAPLGPNWKRMRRVCMEH 132

Query: 437  ILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVA 616
            +L+++RLE     + +      + L  F+   ++  S   VN+    G  ++N + +++ 
Sbjct: 133  LLTTKRLES----FAAHRAQEAEHLCQFVWAKSH--SGKPVNLREVLGAFSMNNVTRMLL 186

Query: 617  GRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRA 796
            G++Y +        EA     +  ++ +L G    GD + P W  RW+D  G  K M+  
Sbjct: 187  GKQY-FGIQSAGPGEAMEFMHITHELFFLLGLIYLGDYL-PAW--RWVDPYGCEKKMRDV 242

Query: 797  AKDVDAILQDWVDARR------KERRSN-------EDQKFIDVMLSMIDDQFTQGYSYSR 937
             K VD   Q  +D  R      K RRS+       ED  F+DV+LS+  +    G  +  
Sbjct: 243  EKKVDDFHQKIIDEHRRAREAKKTRRSSLDDDDGKEDMDFVDVLLSLPGEN---GKEHMD 299

Query: 938  DTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVK 1117
            D  IKA++  M+  A++T +    W++A ++K+P  L+RVQ+E+D  IG++R   +SD+ 
Sbjct: 300  DMEIKALMQDMIAAATDTSSVTNEWVMAEVIKNPRVLRRVQEELDAVIGRDRMVAESDLT 359

Query: 1118 NLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPD 1297
            +LPYL+ VV+E+ RM+P GP+L PHE+++   + GYH+P  T++++N   L R+P++W D
Sbjct: 360  HLPYLRCVVRESFRMHPAGPFLIPHESLKPTTIMGYHVPARTRVFINTHALGRNPRVWDD 419

Query: 1298 PEKFLPERFMTNLEG---EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFN 1468
             + F PER +   EG   E +    ++ +PF  G+R CPG      +  +A+ARLF  F+
Sbjct: 420  VDAFRPERHLPAEEGARVEISHLPDFKILPFSAGKRKCPGAPLGVALVLMALARLFHCFD 479

Query: 1469 FST---VPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
            +S    +  E +D  E  G+ +PK TPL  + TPRL P L+
Sbjct: 480  WSPPDGLRPEDVDTQEVYGMTMPKATPLVAVATPRLPPHLY 520



>gb:AF313491_1785224 Matthiola incana flavonoid 3'-hydroxylase mRNA,
            complete cds.
          Length = 513

 Score =  265 bits (678), Expect = 2e-69
 Identities = 166/503 (33%), Positives = 258/503 (51%), Gaps = 9/503 (1%)
 Frame = +2

Query: 101  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW 280
            R ++ RLPP     WPI+G+L H        +TL+     YGP+  +RLG   ++V +S 
Sbjct: 26   RNRNHRLPP-GPNPWPIVGNLPHMGPKPH--QTLAAMVTTYGPILHLRLGFVNVVVAASK 82

Query: 281  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE 460
                     +D   A+RP     K++ Y+Y    F+     WR +RK+    + S++ LE
Sbjct: 83   SVAEQFLKIHDANFASRPPNSGAKHIAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALE 142

Query: 461  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS 640
              KHV   E+    +E    ++  +  P    VN+ +      +N + + + GRR     
Sbjct: 143  DFKHVRQEEIGRLTRE----VARADTKP----VNLGQLVNMCVVNALGREMIGRRLF--G 192

Query: 641  DGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAIL 820
            DG  + +A+  + + +++M L G F  GD +  L    WLD +G    MKR  K  DA L
Sbjct: 193  DGA-DHKAEEFRSMVTEMMALAGVFNVGDFVPAL---DWLDLQGVAGKMKRLHKRFDAFL 248

Query: 821  QDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQ----GYSYSRDTVIKAIVLSMLQDASE 988
               +  +  E  +  DQK  D++ ++I  + T     G S + DT IKA++L+M    ++
Sbjct: 249  SSIL--KEHEINNGGDQKHTDMLTTLISLKGTDFDGDGASIT-DTEIKALLLNMFTAGTD 305

Query: 989  TFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYP 1168
            T A+ + W +A L++HP  +KR Q+E+D  +G+ R   +SD+  LPYLQ V+KE  R++P
Sbjct: 306  TSASTVDWAIAELIRHPHIMKRTQEELDAVVGRNRPINESDLSRLPYLQAVIKENFRLHP 365

Query: 1169 QGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLE--G 1342
              P   PH A E C ++GYHIPKG+ L  N+W + RDP+ W DP  F PERF+   E  G
Sbjct: 366  PTPLSLPHIAAESCEINGYHIPKGSTLLTNIWAIARDPEQWSDPLAFRPERFLPGGEKFG 425

Query: 1343 EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST---VPNEPLDMMEDV 1513
               +   ++ +PFG GRR C G     +  Q+  A L  GF +     V  E L+M E  
Sbjct: 426  VDVKGSDFELIPFGAGRRICAGLSLGLRTIQLLTATLVHGFEWELAGGVTPEKLNMEETY 485

Query: 1514 GIILPKLTPLEVLVTPRLSPTLF 1582
            GI + +  PL V   PRL+  ++
Sbjct: 486  GITVQRAVPLIVHPKPRLALNVY 508



>gb:AF321856_1786036 Lolium rigidum clone FHH-t putative cytochrome
            P450 mRNA, complete cds.
          Length = 517

 Score =  265 bits (677), Expect = 2e-69
 Identities = 169/495 (34%), Positives = 264/495 (53%), Gaps = 7/495 (1%)
 Frame = +2

Query: 101  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW 280
            +K + +LPP    A P +GHLH      P+  T+   A + GPVF++RLG  R +VVSS 
Sbjct: 31   KKGAVQLPPSPP-AVPFLGHLH--LVDKPIHATMCRLAARLGPVFSLRLGSRRAVVVSSS 87

Query: 281  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE 460
            E  R+CF  +D   A RP   +   + ++      S+   +WR +R++   ++LS+ R+ 
Sbjct: 88   ECARECFTEHDVTFANRPKFPSQLLVSFNGTALVTSSYGPHWRNLRRVATVQLLSAHRVA 147

Query: 461  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVA---GRRYE 631
             +  V  +E++   + L  F + + +   A +V + R    L+L+++M+ +A     R E
Sbjct: 148  CMSGVIAAEVRAMARRL--FHATEASPDGAARVQLKRRLFELSLSVLMETIAQTKATRSE 205

Query: 632  YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD 811
              +D  ++ EAQ  K+V  +++   G     D + P+   RW D  G    +  A    D
Sbjct: 206  ADADTDMSVEAQEFKEVVDKLIPHLGAANMWDYL-PV--MRWFDVFGVRNKILHAVSRRD 262

Query: 812  AILQDWVDARRK---ERRSNEDQK-FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQD 979
            A L+  +DA R+   +  S+ D+K  I V+L++   Q T+   Y+ DT+I A+  ++   
Sbjct: 263  AFLRRLIDAERRRLADGGSDGDKKSMIAVLLTL---QKTEPKVYT-DTMITALCANLFGA 318

Query: 980  ASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLR 1159
             +ET +T   W +++LL HP +LK+ Q EID ++G  R     DV +L YLQ +V ETLR
Sbjct: 319  GTETTSTTTEWAMSLLLNHPAALKKAQAEIDASVGTSRLVSVDDVPSLAYLQCIVSETLR 378

Query: 1160 MYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLE 1339
            +YP  P L PHE+  DC V GY++P  T L VN + +HRDP  W DP +F PERF     
Sbjct: 379  LYPAAPLLLPHESSADCKVGGYNVPADTMLIVNAYAIHRDPAAWEDPLEFRPERF----- 433

Query: 1340 GEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGI 1519
             E  +      +PFG+GRR CPG   A +   + +A L Q F++  V    +DM E  G 
Sbjct: 434  -EDGKAEGLFMIPFGMGRRRCPGETLALRTIGMVLATLVQCFDWEPVDGVKVDMTEGGGF 492

Query: 1520 ILPKLTPLEVLVTPR 1564
             +PK  PLE +  PR
Sbjct: 493  TIPKAVPLEAVCRPR 507



>pir|JC7172|JC7172 cytochrome P450 CYP703A1 - garden
            petunia>gb:AB006790_1510064 Petunia x hybrida IMT-2 mRNA
            for cytochrome P450, complete cds.
          Length = 539

 Score =  265 bits (677), Expect = 2e-69
 Identities = 158/514 (30%), Positives = 279/514 (54%), Gaps = 14/514 (2%)
 Frame = +2

Query: 83   LLWFSWRKQSK----RLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLG 250
            L+ FS+ ++SK    RLPP     WPI+G+L  F+      + ++ + DKYGP+  +RLG
Sbjct: 35   LVHFSFIERSKQKINRLPP-GPKQWPIVGNL--FQLGQLPHRDMASFCDKYGPLVYLRLG 91

Query: 251  ISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVV 430
                +  +  E +R+     D + A+RP T A  +L Y       +     W+R+R++ +
Sbjct: 92   NVDAITTNDPEIIREILVQQDDIFASRPRTLAAIHLAYGCGDVALAPLGPKWKRMRRICM 151

Query: 431  EEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQI 610
            E +L+++RLE        E Q+ +++++              VN+    G  ++N + ++
Sbjct: 152  EHLLTTKRLESFGKHRADEAQSLVEDVWA------KTQKGETVNLRDLLGAFSMNNVTRM 205

Query: 611  VAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMK 790
            + G+++ + ++    +EA     +  ++ +L G    GD + PLW  RW+D  G  K M+
Sbjct: 206  LLGKQF-FGAESAGPQEAMEFMHITHELFWLLGVIYLGDYL-PLW--RWIDPHGCEKKMR 261

Query: 791  RAAKDVDAILQDWVDARRKERRSNEDQK--FIDVMLSMI--DDQFTQGYSYSRDTVIKAI 958
               K VD      ++  RK  ++ ++ +  F+DV+LS+   D+    G  +  DT IKA+
Sbjct: 262  EVEKRVDDFHMRIIEEHRKNGKNVDEGEMDFVDVLLSLPGEDEGDGNGKQHMDDTEIKAL 321

Query: 959  VLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQG 1138
            +  M+  A++T A    W +A ++KHP  LK++Q+E+D  +G +R   +SD+ +L YL+ 
Sbjct: 322  IQDMIAAATDTSAVTNEWPMAEVIKHPNVLKKIQEELDIVVGSDRMVTESDLVHLKYLRC 381

Query: 1139 VVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPE 1318
            VV+ET RM+P GP+L PHE++ D  ++GY+IP  T++++N   L R+ KIW + ++F PE
Sbjct: 382  VVRETFRMHPAGPFLIPHESIRDTKINGYYIPAKTRVFINTHGLGRNTKIWDNIDEFRPE 441

Query: 1319 RFMTNLE---GEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST---V 1480
            R +   E    E +    ++ +PF  G+R CPG     ++  +A+ARLF  F +S    +
Sbjct: 442  RHLPADELSRVEISHGADFKILPFSAGKRKCPGAPLGVKLVLMALARLFHCFEWSPPDGL 501

Query: 1481 PNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
              E +D +E  G+ +PK  PL  +  PRL   L+
Sbjct: 502  RPEDIDTIEVYGMTMPKAKPLMAIARPRLPDHLY 535



>gb:AF386512_1794708 Pyrus communis cytochrome P450 mRNA, complete
            cds.
          Length = 506

 Score =  263 bits (672), Expect = 8e-69
 Identities = 176/522 (33%), Positives = 263/522 (50%), Gaps = 20/522 (3%)
 Frame = +2

Query: 62   LGIAALVLLWFSWR---------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWA 214
            + I  LV L F W          +QS+ LPP    A PIIG+LH     +P  ++L   A
Sbjct: 6    IAILILVFLTFLWSLLRLINVSSRQSRTLPP-GPAALPIIGNLHMLG-DLPH-RSLQNLA 62

Query: 215  DKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTN 394
             KYGP+ ++RLG    +VVSS +  +    T+D + A+RP   A +Y+ Y      F+  
Sbjct: 63   KKYGPIMSMRLGSVPTIVVSSPKTAKLFLKTHDTIFASRPKLQASEYMAYGTKAMAFTEY 122

Query: 395  NSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRW 574
              YWR +RKL   ++L   ++E    +   E+   ++ L           +   V+ S  
Sbjct: 123  GPYWRHIRKLCTLQLLCPSKIESFAPLRREEVGLLVQSLKVAAE------AGEVVDFSEK 176

Query: 575  FGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR 754
             G L   +  ++V GR+         N++   LK +  + ++L G F   D +    F  
Sbjct: 177  VGELVEGITYRMVLGRK---------NDDMFDLKGIIEEALFLTGAFNISDYVP---FLS 224

Query: 755  WLDYEGHVKTMKRAAKDVDA----ILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQG 922
             LD +G  K MKR +K VD     I+QD     R E+  N  + F+DV+LS I       
Sbjct: 225  PLDLQGLTKRMKRVSKTVDQLFEKIIQDHEQVSRSEQ-GNHHKDFVDVLLSSIHQTLKPN 283

Query: 923  ----YSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE 1090
                Y   R T  KA +L M+  A +T AT + W LA LL+HP+ +KR+Q+E+ + IG +
Sbjct: 284  DEEVYMLER-TNAKATLLDMIAGAFDTSATAIIWTLAELLRHPKVMKRLQEELQSVIGMD 342

Query: 1091 RWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRL 1270
            R  E+SD+  L YL  VVKE+ R++P  P L PH+++ED  VDGYH PK +++++N+W +
Sbjct: 343  RMVEESDLPKLDYLSMVVKESFRLHPVAPLLVPHQSMEDITVDGYHTPKKSRIFINIWTI 402

Query: 1271 HRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVAR 1450
             RDPK W + E+F PERFM        +   +Q +PFG GRR CP         ++A+  
Sbjct: 403  GRDPKSWDNAEEFYPERFMN--RNVDLRGHDFQLIPFGSGRRGCPAMQLGLTTVRLALGN 460

Query: 1451 LFQGFNF---STVPNEPLDMMEDVGIILPKLTPLEVLVTPRL 1567
            L    N+   S +  + LDM E  G+ L K   L    T RL
Sbjct: 461  LLHCSNWELPSGMLPKDLDMTEKFGLSLSKAKHLLATPTCRL 502



>gb:AF321855_1786035 Lolium rigidum clone FHH-v putative cytochrome
            P450 mRNA, complete cds.
          Length = 517

 Score =  263 bits (672), Expect = 8e-69
 Identities = 168/496 (33%), Positives = 265/496 (53%), Gaps = 7/496 (1%)
 Frame = +2

Query: 101  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW 280
            +K + +LPP    A P +GHLH      P+  T+   A + GPVF++RLG  R +VVSS 
Sbjct: 31   KKGAVQLPPSPP-AVPFLGHLH--LVEKPIHATMCRLAARLGPVFSLRLGSRRAVVVSSS 87

Query: 281  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE 460
            E  R+CF  +D   A RP   +   + ++      S+   +WR +R++   ++LS+ R+ 
Sbjct: 88   ECARECFTEHDVTFANRPKFPSQLLVSFNGTALVTSSYGPHWRNLRRVATVQLLSAHRVT 147

Query: 461  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVA---GRRYE 631
             +  V  +E++   + L  F + + +   A +V + R    L+L+++M+ +A     R E
Sbjct: 148  CMSGVIAAEVRAMARRL--FHAAEASPDGAARVQLKRRLFELSLSVLMETIAQTKATRSE 205

Query: 632  YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD 811
              +D  ++ EAQ  K+V  +++   G     D + P+   RW D  G    +  A    D
Sbjct: 206  ADADTDMSLEAQEFKEVVDKLIPHLGAANMWDYL-PV--MRWFDVFGVRSKILHAVSRRD 262

Query: 812  AILQDWVDARRK---ERRSNEDQK-FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQD 979
            A L+  ++A R+   +  S+ D+K  I V+L++   Q T+   Y+ DT+I A+  ++   
Sbjct: 263  AFLRRLINAERRRLADGGSDGDKKSMIAVLLTL---QKTEPKVYT-DTMITALCANLFGA 318

Query: 980  ASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLR 1159
             +ET +T   W +++LL HP +LK+ Q EID ++G  R     DV +L YLQ +V ETLR
Sbjct: 319  GTETTSTTTEWAMSLLLNHPAALKKAQAEIDASVGTSRLVSVDDVPSLAYLQCIVSETLR 378

Query: 1160 MYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLE 1339
            +YP  P L PHE+  DC V GY++P  T L VN + +HRDP  W DP +F PERF     
Sbjct: 379  LYPAAPLLLPHESSADCKVGGYNVPADTMLIVNAYAIHRDPAAWEDPLEFKPERF----- 433

Query: 1340 GEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGI 1519
             E  +      +PFG+GRR CPG   A +   + +A L Q F++  V    +DM E  G 
Sbjct: 434  -EDGKAEGLFMIPFGMGRRRCPGETLALRTIGMVLATLVQCFDWEPVDGVKVDMTEGGGF 492

Query: 1520 ILPKLTPLEVLVTPRL 1567
             +PK  PLE +  PR+
Sbjct: 493  TIPKAVPLEAVCRPRV 508



>gb:AC084282_1733421 Oryza sativa chromosome 3 BAC OSJNBb0048A17
            genomic sequence, complete sequence.
          Length = 518

 Score =  263 bits (672), Expect = 8e-69
 Identities = 170/519 (32%), Positives = 265/519 (51%), Gaps = 16/519 (3%)
 Frame = +2

Query: 56   SILGIAALVLLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY 223
            +I  IA L+L+ F +R++ +     LPP    A P  GHLH      P    LS  A+++
Sbjct: 7    AIFSIAVLLLIHFLFRRRGRSNGMPLPPSPP-AIPFFGHLHLI--DKPFHAALSRLAERH 63

Query: 224  GPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSY 403
            GPVF++RLG    +VVSS E  R+CF  ND   A RP   +     ++      +    +
Sbjct: 64   GPVFSLRLGSRNAVVVSSPECARECFTDNDVCFANRPRFPSQMLATFNGTSLGSANYGPH 123

Query: 404  WRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGH 583
            WR +R++    +LSS R+  +  +   + +  ++ +Y   +   +     +V ++R    
Sbjct: 124  WRNLRRIATVHLLSSHRVSGMSGIISGQARHMVRRMYRAATA--SAAGVARVQLNRRLFE 181

Query: 584  LTLNLIMQIVAG----RRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF 751
            L+L+++M+ +A     RR    +D  ++ EAQ L+ V  ++  L G     D +  L   
Sbjct: 182  LSLSVLMEAIAQSKTTRREAPDADTDMSMEAQELRHVLDELNPLIGAANLWDYLPAL--- 238

Query: 752  RWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSN--------EDQKFIDVMLSMIDD 907
            RW D  G  + +  A    +A ++  +DA R+   +N        E +  I V+L++   
Sbjct: 239  RWFDVFGVKRKIVAAVNRRNAFMRRLIDAERQRMDNNDVDGGDDGEKKSMISVLLTL--- 295

Query: 908  QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK 1087
            Q TQ   Y+ DT+I  +   +    +ET +T + W +++LL HPE LK+ Q EID ++G 
Sbjct: 296  QKTQPEVYT-DTLIMTLCAPLFGAGTETTSTTIEWAMSLLLNHPEILKKAQAEIDMSVGN 354

Query: 1088 ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR 1267
             R     DV  L YLQ ++ ETLRMYP  P L PHE+  DC V GYHIP G  L VNV  
Sbjct: 355  SRLISVVDVHRLGYLQCIINETLRMYPAAPLLLPHESSADCKVGGYHIPSGAMLLVNVAA 414

Query: 1268 LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA 1447
            + RDP IW +P +F PERF      E  +      +PFG+GRR CPG + A Q   + + 
Sbjct: 415  IQRDPVIWKEPSEFKPERF------ENGRFEGLFMIPFGMGRRRCPGEMLALQTIGLVLG 468

Query: 1448 RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPR 1564
             + Q F++  V +  +DM +  G+   K+ PLE +  PR
Sbjct: 469  TMIQCFDWGRVDDAMVDMTQSNGLTSLKVIPLEAMCKPR 507



>gb:AB159038_1528422 Lolium rigidum mRNA for P450, complete cds,
            clone:CYP81B1v2.
          Length = 517

 Score =  263 bits (672), Expect = 8e-69
 Identities = 169/495 (34%), Positives = 263/495 (53%), Gaps = 7/495 (1%)
 Frame = +2

Query: 101  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW 280
            +K + +LPP    A P IGHLH      P+  T+   A + GPVF++RLG  R +VVSS 
Sbjct: 31   KKGAVQLPPSPP-AIPFIGHLH--LVEKPIHATMCRLAARLGPVFSLRLGSRRAVVVSSS 87

Query: 281  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE 460
            E  R+CF  +D   A RP++       ++      S+   +WR +R++   ++LS+ R+ 
Sbjct: 88   ECARECFTEHDVTFANRPSSRRKLLASFNGTALVTSSYGPHWRNLRRVATVQLLSAHRVA 147

Query: 461  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVA---GRRYE 631
             +  V  +E++   + L  F + + +   A +V + R    L+L+++M+ +A     R E
Sbjct: 148  CMSGVIAAEVRAMARRL--FHAAEASPDGATRVQLKRRLFELSLSVLMETIAQTKATRSE 205

Query: 632  YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD 811
              +D  ++ EAQ  K+V  +++   G     D + P+   RW D  G    +  A    D
Sbjct: 206  ADADTDMSVEAQEFKEVVDKLIPHLGAANMWDYL-PV--MRWFDVFGVRNKILHAVSRRD 262

Query: 812  AILQDWVDARRK---ERRSNEDQK-FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQD 979
            A L+  +DA R+   +  S+ D+K  I V+L++   Q T+   Y+ DT+I A+  ++   
Sbjct: 263  AFLRRLIDAERRRLADGGSDGDKKSMIAVLLTL---QKTEPKVYT-DTMITALCANLFGA 318

Query: 980  ASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLR 1159
             +ET +T   W +++LL HP +LK+ Q EID ++G  R     DV +L YLQ +V ETLR
Sbjct: 319  GTETTSTTTEWAMSLLLNHPAALKKAQAEIDASVGTSRLVSVDDVLSLAYLQCIVSETLR 378

Query: 1160 MYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLE 1339
            +YP  P L PHE+  DC V GY++P  T L VN + +HRDP  W  P +F PERF     
Sbjct: 379  LYPAAPLLLPHESSADCKVGGYNVPADTMLIVNAYAIHRDPAAWEHPLEFRPERF----- 433

Query: 1340 GEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGI 1519
             E  +      +PFG+GRR CPG   A +   + +A L Q F++  V    +DM E  G 
Sbjct: 434  -EDGKAEGLFMIPFGMGRRRCPGETLALRTIGMVLATLVQCFDWEPVDGVKVDMTEGGGF 492

Query: 1520 ILPKLTPLEVLVTPR 1564
             +PK  PLE +  PR
Sbjct: 493  TIPKAVPLEAVCRPR 507



>gb:BT005895_1638817 Arabidopsis thaliana At5g67310 gene, complete
            cds.>gb:AK117257_1815301 Arabidopsis thaliana At5g67310
            mRNA for putative cytochrome P450, complete cds, clone:
            RAFL16-81-G08.
          Length = 507

 Score =  263 bits (671), Expect = 1e-68
 Identities = 163/500 (32%), Positives = 266/500 (53%), Gaps = 2/500 (0%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYG- 226
            L+ + G  A+  ++ S  KQ K LPP   G +P+IGHLH  +   P+ ++L + +   G 
Sbjct: 21   LALMAGFIAVAYVFRS--KQKKNLPPNPVG-FPVIGHLHLLKE--PVHRSLRDLSRNLGI 75

Query: 227  PVFTIRLGISRILVVSSWEAVRDCFAT-NDKLLAARPTTCAGKYLGYDYAVFTFSTNNSY 403
             VF +RLG  R +VV+S  A  +  +  ND + A RP     +Y+GY+  + + +    +
Sbjct: 76   DVFILRLGSRRAVVVTSASAAEEFLSQQNDVVFANRPLATLTEYMGYNNTLVSTAPYGEH 135

Query: 404  WRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGH 583
            WRR+R+    +ILS+ RL     +   E++  I+++   +     +    ++ +  +   
Sbjct: 136  WRRLRRFCAVDILSTARLRDFSDIRRDEVRAMIRKINVELVTSGGSV---RLKLQPFLYG 192

Query: 584  LTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD 763
            LT N++M +VAG+R E       +EE + ++K+  +V    G    GD +  L  F   D
Sbjct: 193  LTYNILMSMVAGKREE-------DEETKEVRKLIREVFDFAGVNYVGDFLPTLKLF---D 242

Query: 764  YEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDT 943
             +G+ K  K+ A  +D  +Q  VD  RK R   E +K +   L  + +   + Y+   D 
Sbjct: 243  LDGYRKRAKKLASKLDKFMQKLVDEHRKNRGKAELEKTMITRLLSLQESEPECYT---DD 299

Query: 944  VIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNL 1123
            +IK +V  ML   ++T A  L W +A LL HPE L++++ E++    + R  E+SD    
Sbjct: 300  IIKGLVQVMLLAGTDTTAVTLEWAMANLLNHPEVLRKLKTELNEVSKEGRVFEESDTGKC 359

Query: 1124 PYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPE 1303
            PYL  V+ ETLR++P  P L PH +  DC V G+ IP+ T L++N W + RDP +W DPE
Sbjct: 360  PYLNNVISETLRLFPAAPLLVPHASSTDCEVAGFDIPRRTWLFINAWAIQRDPNVWDDPE 419

Query: 1304 KFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVP 1483
             F PERF        ++  + +F+PFG+GRR+CPG   A  +  +A+  L Q F++    
Sbjct: 420  TFKPERF-------ESETHRGKFLPFGIGRRACPGMGLAQLVLSLALGSLIQCFDWERDN 472

Query: 1484 NEPLDMMEDVGIILPKLTPL 1543
            +  +DM E  G+ +PK  PL
Sbjct: 473  DVAVDMSEGKGLTMPKSVPL 492



>gb:AB007645_1510147 Arabidopsis thaliana genomic DNA, chromosome 5,
            TAC clone:K8K14.
          Length = 496

 Score =  263 bits (671), Expect = 1e-68
 Identities = 163/500 (32%), Positives = 266/500 (53%), Gaps = 2/500 (0%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYG- 226
            L+ + G  A+  ++ S  KQ K LPP   G +P+IGHLH  +   P+ ++L + +   G 
Sbjct: 10   LALMAGFIAVAYVFRS--KQKKNLPPNPVG-FPVIGHLHLLKE--PVHRSLRDLSRNLGI 64

Query: 227  PVFTIRLGISRILVVSSWEAVRDCFAT-NDKLLAARPTTCAGKYLGYDYAVFTFSTNNSY 403
             VF +RLG  R +VV+S  A  +  +  ND + A RP     +Y+GY+  + + +    +
Sbjct: 65   DVFILRLGSRRAVVVTSASAAEEFLSQQNDVVFANRPLATLTEYMGYNNTLVSTAPYGEH 124

Query: 404  WRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGH 583
            WRR+R+    +ILS+ RL     +   E++  I+++   +     +    ++ +  +   
Sbjct: 125  WRRLRRFCAVDILSTARLRDFSDIRRDEVRAMIRKINVELVTSGGSV---RLKLQPFLYG 181

Query: 584  LTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD 763
            LT N++M +VAG+R E       +EE + ++K+  +V    G    GD +  L  F   D
Sbjct: 182  LTYNILMSMVAGKREE-------DEETKEVRKLIREVFDFAGVNYVGDFLPTLKLF---D 231

Query: 764  YEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDT 943
             +G+ K  K+ A  +D  +Q  VD  RK R   E +K +   L  + +   + Y+   D 
Sbjct: 232  LDGYRKRAKKLASKLDKFMQKLVDEHRKNRGKAELEKTMITRLLSLQESEPECYT---DD 288

Query: 944  VIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNL 1123
            +IK +V  ML   ++T A  L W +A LL HPE L++++ E++    + R  E+SD    
Sbjct: 289  IIKGLVQVMLLAGTDTTAVTLEWAMANLLNHPEVLRKLKTELNEVSKEGRVFEESDTGKC 348

Query: 1124 PYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPE 1303
            PYL  V+ ETLR++P  P L PH +  DC V G+ IP+ T L++N W + RDP +W DPE
Sbjct: 349  PYLNNVISETLRLFPAAPLLVPHASSTDCEVAGFDIPRRTWLFINAWAIQRDPNVWDDPE 408

Query: 1304 KFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVP 1483
             F PERF        ++  + +F+PFG+GRR+CPG   A  +  +A+  L Q F++    
Sbjct: 409  TFKPERF-------ESETHRGKFLPFGIGRRACPGMGLAQLVLSLALGSLIQCFDWERDN 461

Query: 1484 NEPLDMMEDVGIILPKLTPL 1543
            +  +DM E  G+ +PK  PL
Sbjct: 462  DVAVDMSEGKGLTMPKSVPL 481



>gb:AY072308_1567125 Arabidopsis thaliana cytochrome P450
            monooxygenase - like protein (At4g37410) mRNA, partial
            cds.
          Length = 457

 Score =  262 bits (669), Expect = 2e-68
 Identities = 164/474 (34%), Positives = 255/474 (53%), Gaps = 4/474 (0%)
 Frame = +2

Query: 59   ILGIAALVLLW---FSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGP 229
            IL +A  +L +   F+ +KQ   LPP    + PI+GH  H     P+ +     ++ +GP
Sbjct: 7    ILPLALFLLAYKFFFTSKKQRYYLPPSPSYSLPILGH--HLLIKPPVHRLFHRLSNIHGP 64

Query: 230  VFTIRLGISRILVVSSWEAVRDCFA-TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYW 406
            +F +RLG  R +V+SS    R+CF   ND +++ RP     KY+ Y+Y     ++   +W
Sbjct: 65   IFYLRLGSRRAVVISSSSLARECFTGQNDVIVSNRPRFLTSKYIAYNYTTIATTSYGDHW 124

Query: 407  RRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHL 586
            R +R++   EI+SS+RL    H+   E+Q     + T +S D       +V +      L
Sbjct: 125  RNLRRICSLEIVSSKRLANFLHIRKEEIQ----RMLTRLSRDAR--VGKEVELESILYDL 178

Query: 587  TLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDY 766
            T N I+++V G+ Y Y  D +  EEA+  KK+F+ +    G    G+ + P        +
Sbjct: 179  TFNNIVRMVTGKIY-YGDDVSDKEEAELFKKLFTFITTNSGARHPGEYL-PFMKIFGGSF 236

Query: 767  EGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTV 946
            E   K +K AAK +D +LQ  +D  + ++  N     ++ +LS+  D       Y  D +
Sbjct: 237  E---KEVKAAAKVIDEMLQRLLDECKSDKDGNT---MVNHLLSLQQDD----PEYYTDII 286

Query: 947  IKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLP 1126
            IK ++L ++  +SET A  + W +A LL HP+ L +V+ EID  IG++R  E+SD+ NLP
Sbjct: 287  IKGLMLGIMVASSETSALTIEWAMASLLNHPKVLDKVKLEIDEIIGQDRLIEESDIANLP 346

Query: 1127 YLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEK 1306
            YLQ VV ETLR++P  P L P    ED  + GY +P+ T + VN W +HRDP +W +PE+
Sbjct: 347  YLQNVVSETLRLHPAAPVLVPRSTAEDIKIGGYDVPRDTMVMVNAWAIHRDPDLWTEPER 406

Query: 1307 FLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFN 1468
            F PERF     GE  ++     + FG GRR CPG   A +I  +A+  L Q F+
Sbjct: 407  FNPERFN---GGEGEKDDVRMLIAFGSGRRICPGVGLAHKIVTLALGSLIQCFD 457



>gb:AF321857_1786037 Lolium rigidum clone FHH-y putative cytochrome
            P450 mRNA, complete cds.
          Length = 517

 Score =  261 bits (666), Expect = 4e-68
 Identities = 168/495 (33%), Positives = 262/495 (52%), Gaps = 7/495 (1%)
 Frame = +2

Query: 101  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW 280
            +K + +LPP    A P +GHLH      P+  T+   A + GPVF++RLG  R +VVSS 
Sbjct: 31   KKGAVQLPPSPP-AVPFLGHLH--LVDKPIHATMCRLAARLGPVFSLRLGSRRAVVVSSS 87

Query: 281  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE 460
            E  R+CF  +D   A RP   +   + ++      S+   +WR +R++   ++LS+ R+ 
Sbjct: 88   ECARECFTEHDVTFANRPKFPSQLLVSFNGTALVTSSYGPHWRNLRRVATVQLLSAHRVA 147

Query: 461  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVA---GRRYE 631
             +  V  +E++   + L  F + + +   A +V + R    L+L+++M+ +A     R E
Sbjct: 148  CMSGVIAAEVRAMARRL--FHAAEASPDGAARVQLKRRLFELSLSVLMETIAQTKATRSE 205

Query: 632  YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD 811
              +D  ++ EAQ  K+V  +++   G     D + P+   RW D  G    +  A    D
Sbjct: 206  ADADTDMSVEAQEFKEVVDKLIPHLGAANMWDYL-PV--MRWFDVFGVRNKILHAVSRRD 262

Query: 812  AILQDWVDARRK---ERRSNEDQK-FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQD 979
            A L+  +DA R+   +  S+ D+K  I V+L++   Q T+   Y+ DT+I A+  ++   
Sbjct: 263  AFLRRLIDAERRRLADGGSDGDKKSMIAVLLTL---QKTEPKVYT-DTMITALCANLFGA 318

Query: 980  ASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLR 1159
             +ET +T   W +++LL HP +LK+ Q EID ++G  R     DV +L YLQ +V ETLR
Sbjct: 319  GTETTSTTTEWAMSLLLNHPAALKKAQAEIDASVGTSRLVSVDDVPSLAYLQCIVNETLR 378

Query: 1160 MYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLE 1339
            +YP  P L PHE+  DC V GY++P  T L VN + +HRDP  W  P  F PERF     
Sbjct: 379  LYPAAPLLLPHESSADCKVGGYNVPADTMLIVNAYAIHRDPAAWEHPLVFRPERF----- 433

Query: 1340 GEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGI 1519
             E  +      +PFG+GRR CPG   A +   + +A L Q F++  V    +DM E  G 
Sbjct: 434  -EDGKAEGLFMIPFGMGRRRCPGETLALRTIGMVLATLVQCFDWEPVDGVNVDMTEGGGF 492

Query: 1520 ILPKLTPLEVLVTPR 1564
             +PK  PLE +  PR
Sbjct: 493  TIPKAVPLEAVCRPR 507



>gb:AB159039_1528423 Lolium rigidum mRNA for P450, complete cds,
            clone:CYP81B1v3.
          Length = 517

 Score =  261 bits (666), Expect = 4e-68
 Identities = 168/495 (33%), Positives = 261/495 (52%), Gaps = 7/495 (1%)
 Frame = +2

Query: 101  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW 280
            +K + +LPP    A P IGHLH      P+  T+   A + GPVF++RLG  R +VV S 
Sbjct: 31   KKGAVQLPPSPP-AIPFIGHLH--LVEKPIHATMCRLAARLGPVFSLRLGSRRAVVVPSS 87

Query: 281  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE 460
            E  R+CF  +D   A RP   +     ++      S+   +WR +R++   ++LS+ R+ 
Sbjct: 88   ECARECFTEHDVTFANRPKFPSQLLASFNGTALVTSSYGPHWRNLRRVATVQLLSAHRVA 147

Query: 461  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVA---GRRYE 631
             +  V  +E++   + L  F + + +   A +V + R    L+L+++M+ +A     R E
Sbjct: 148  CMSGVIAAEVRAMARRL--FHAAEASPDGAARVQLKRRLFELSLSVLMETIAQTKATRSE 205

Query: 632  YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD 811
              +D  ++ EAQ  K+V  +++   G     D + P+   RW D  G    +  A    D
Sbjct: 206  ADADTDMSVEAQEFKEVVDKLIPHLGAANMWDYL-PV--MRWFDVFGVRNKILHAVSRRD 262

Query: 812  AILQDWVDARRK---ERRSNEDQK-FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQD 979
            A L+  +DA R+   +  S+ D+K  I V+L++   Q T+   Y+ DT+I A+  ++   
Sbjct: 263  AFLRRLIDAERRRLADGGSDGDKKSMIAVLLTL---QKTEPKVYT-DTMITALCANLFGA 318

Query: 980  ASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLR 1159
             +ET +T   W +++LL HP +LK+ Q EID ++G  R     DV +L YLQ +V ETLR
Sbjct: 319  GTETTSTTTEWAMSLLLNHPAALKKAQAEIDASVGTSRLVSVDDVPSLAYLQCIVNETLR 378

Query: 1160 MYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLE 1339
            +YP  P L PHE+  DC V GY++P  T L VN + +HRDP  W  P +F PERF     
Sbjct: 379  LYPAAPLLLPHESSADCKVGGYNVPADTMLIVNAYAIHRDPAAWEHPLEFRPERF----- 433

Query: 1340 GEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGI 1519
             E  +      +PFG+GRR CPG   A +   + +A L Q F++  V    +DM E  G 
Sbjct: 434  -EDGKAEGLFMIPFGVGRRRCPGETLALRTISMVLATLVQCFDWEPVDGVKVDMTEGGGF 492

Query: 1520 ILPKLTPLEVLVTPR 1564
             +PK  PLE +  PR
Sbjct: 493  TIPKAVPLEAVCRPR 507



>gb:AP005483_1852666 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:B1144B06.
          Length = 520

 Score =  260 bits (665), Expect = 5e-68
 Identities = 168/533 (31%), Positives = 285/533 (53%), Gaps = 17/533 (3%)
 Frame = +2

Query: 41   PCCLSSILG--IAALVLLWFSWRKQSKR---LPPEAGGAWPIIGHLHHFRTSVPLVKTLS 205
            P  L+++L   +AA +LL    RK S+R   LPP     WP+IG+ +    ++P  +++ 
Sbjct: 3    PSALATLLSMALAAFLLLGLIKRKGSRRGYNLPP-GPTPWPVIGNFNLIG-ALPH-RSIH 59

Query: 206  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF 385
            E + KYG +  +R G   ++V SS    R    T+D +   RP T + K+  Y YA  T+
Sbjct: 60   ELSRKYGELMLLRFGSFPVVVGSSVAMARLVLKTHDAVFIDRPRTASRKHTTYGYADITW 119

Query: 386  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM 565
            S   +YWR+ R++ V E+ S+RR+   +H+   E++  ++ L  F +  +    A  +N 
Sbjct: 120  SPYGAYWRQARRICVTELFSARRVASFEHIRADEVRALVRGL--FAAASSGRSGAVHLNR 177

Query: 566  SRWFGHLTLNLIMQIVAGRRY----EYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI 733
                  L++N+I ++V G+R+       ++G ++  ++  K +  +++ L G    GD I
Sbjct: 178  DH-LSTLSMNVITRMVLGKRFFGEGADAAEGPVSTLSE-FKWMLDELLLLNGVLNVGDWI 235

Query: 734  FPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFI-----DVMLSM 898
                +  W+D +G+V+ MK+  K  DA ++  +D    ERR  E + F+     DV++ +
Sbjct: 236  P---WVDWMDLQGYVRRMKKVGKMFDAFMEHVLD-EHSERRRREGEAFVARDMVDVLMDL 291

Query: 899  IDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTN 1078
             DD   +     R   +KA    ++   +E+ +  + W L+ L K+P       DE+D  
Sbjct: 292  ADDPSLE-IKLGR-VGVKAFTQDLIAGGTESSSVTVEWALSELFKNPAIFATATDELDRV 349

Query: 1079 IGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVN 1258
            +G+ RW  + D+ NLPYL  ++KET+RM+P  P L P  A +D  V GY IPKG ++ +N
Sbjct: 350  VGRCRWVTEKDIPNLPYLDAIMKETMRMHPIVPLLIPRVARDDAAVAGYDIPKGARVLIN 409

Query: 1259 VWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV 1438
            VW + RDP++W   E+F+PERF+ +      Q+  ++ +PFG GRR CPG     ++ Q+
Sbjct: 410  VWTIGRDPELWDAAEEFMPERFIGSRIDVKGQD--FELLPFGSGRRMCPGYNLGLKVMQL 467

Query: 1439 AVARLFQGFNF---STVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFRL 1588
            ++A L  GF +     +  E L M E  G+   +  PL+V+V PRL   L+ L
Sbjct: 468  SLANLLHGFAWRLPEGMKEEELSMDEVFGLSTTRKYPLQVVVEPRLPVQLYSL 520



>pir|A86143|A86143 probable cytochrome P450 [imported] - Arabidopsis
            thaliana>gb:AE005172_889178 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC023628_1539182 Arabidopsis thaliana
            chromosome I BAC F6F3 genomic sequence, complete
            sequence.
          Length = 510

 Score =  260 bits (664), Expect = 7e-68
 Identities = 158/524 (30%), Positives = 276/524 (52%), Gaps = 13/524 (2%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFSWRKQS----KRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWA 214
            L+S+  +  L +L + W K S    +RLPP      PI+G+L       PL  + L+   
Sbjct: 5    LASLFAVLILNVLLWRWLKASACKAQRLPP-GPPRLPILGNLLQLG---PLPHRDLASLC 60

Query: 215  DKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTN 394
            DKYGP+  +RLG    +  +  + +R+     D + ++RP T A  +L Y       +  
Sbjct: 61   DKYGPLVYLRLGNVDAITTNDPDTIREILLRQDDVFSSRPKTLAAVHLAYGCGDVALAPM 120

Query: 395  NSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRW 574
              +W+R+R++ +E +L+++RLE        E +  I++++        + +   +N+   
Sbjct: 121  GPHWKRMRRICMEHLLTTKRLESFTTQRAEEARYLIRDVF------KRSETGKPINLKEV 174

Query: 575  FGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR 754
             G  ++N + +++ G+++         +EAQ    +  ++ +L G    GD + P W  R
Sbjct: 175  LGAFSMNNVTRMLLGKQFFGPGSLVSPKEAQEFLHITHKLFWLLGVIYLGDYL-PFW--R 231

Query: 755  WLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQK----FIDVMLSMIDDQFTQG 922
            W+D  G  K M+   K VD      +D  R+ +  +ED+     F+DV+LS+  +    G
Sbjct: 232  WVDPSGCEKEMRDVEKRVDEFHTKIIDEHRRAKLEDEDKNGDMDFVDVLLSLPGEN---G 288

Query: 923  YSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAE 1102
             ++  D  IKA++  M+  A++T A    W +A  +K P  ++++Q+E+D  +G  R  +
Sbjct: 289  KAHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEAIKQPRVMRKIQEELDNVVGSNRMVD 348

Query: 1103 DSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDP 1282
            +SD+ +L YL+ VV+ET RM+P GP+L PHE+V    ++GY+IP  T++++N   L R+ 
Sbjct: 349  ESDLVHLNYLRCVVRETFRMHPAGPFLIPHESVRATTINGYYIPAKTRVFINTHGLGRNT 408

Query: 1283 KIWPDPEKFLPERFMTNLEG----EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVAR 1450
            KIW D E F PER    +EG    E +    ++ +PF  G+R CPG      +  +A+AR
Sbjct: 409  KIWDDVEDFRPERHWP-VEGSGRVEISHGPDFKILPFSAGKRKCPGAPLGVTMVLMALAR 467

Query: 1451 LFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
            LF  F +S+  N  +D +E  G+ +PK  PL  +  PRL+  L+
Sbjct: 468  LFHCFEWSSPGN--IDTVEVYGMTMPKAKPLRAIAKPRLAAHLY 509



>gb:AF315465_1785416 Pelargonium x hortorum flavonoid 3'-hydroxylase
            mRNA, complete cds.
          Length = 511

 Score =  259 bits (663), Expect = 9e-68
 Identities = 166/516 (32%), Positives = 253/516 (49%), Gaps = 6/516 (1%)
 Frame = +2

Query: 53   SSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPV 232
            SS L  AA ++L FS+ K  +RLPP    AWPI+G+L H   S+P  + L+  A  YGP+
Sbjct: 12   SSALAFAAYLVL-FSFSKSRRRLPP-GPKAWPIVGNLPHMG-SMPH-QNLAAMARTYGPL 67

Query: 233  FTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRR 412
              +RLG   ++V  S         T+D   ++RP     K++ Y+Y    F+     WR 
Sbjct: 68   VYLRLGFVDVVVALSASMASQFLKTHDSNFSSRPPNAGAKHIAYNYHDLVFAPYGPRWRL 127

Query: 413  VRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTL 592
             RK+    + S + L+  +HV   E+      L   +S          VN+ +       
Sbjct: 128  FRKITSIHLFSGKALDDYRHVRQEEVGVLASNLARAVSTI--------VNLGQLLNICAT 179

Query: 593  NLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEG 772
            N + + V G++        ++ +A   K +  ++M L G F  GD I PL     LD +G
Sbjct: 180  NALGRAVIGKKVFKDGTDDVDPKADEFKSMVVELMVLAGVFNIGDFIPPL---DCLDLQG 236

Query: 773  HVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIK 952
                MK   K  DA L   +        ++     +  ++S+ D           DT IK
Sbjct: 237  VASKMKNLHKRFDAFLSAILQEHNINSAASATPSMLTTLISLKDSVEDSEGGKLTDTEIK 296

Query: 953  AIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYL 1132
            A++L+M    ++T ++ + W +A L++ PE L R Q EID+ +G++R   + D+  LPYL
Sbjct: 297  ALLLNMFTAGTDTTSSTVEWAIAELIRQPEILIRAQKEIDSVVGRDRLVTELDLSKLPYL 356

Query: 1133 QGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFL 1312
            Q +VKET R++   P   P  A + C ++GYHIPKG  L VNVW + RDP +W DP  F 
Sbjct: 357  QAIVKETFRLHSSTPLSLPRIATQSCEINGYHIPKGATLLVNVWAIARDPDVWADPLSFR 416

Query: 1313 PERFMTNLEGE--AAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF----S 1474
            PERF+   E E    +   ++ +PFG GRR C G     ++ Q+  A L   FN+     
Sbjct: 417  PERFLPGSEKENVDVKGNDFELIPFGAGRRICAGMSLGLRMVQLLTATLLHAFNWDLPQG 476

Query: 1475 TVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
             +P E L+M E  G+ L + +PL V   PRL   L+
Sbjct: 477  QIPQE-LNMDEAYGLTLQRASPLHVRPRPRLPSHLY 511



>gb:AY072297_1567115 Zea mays cytochrome P450 monooxygenase CYP92A1
            mRNA, complete cds.
          Length = 517

 Score =  259 bits (661), Expect = 2e-67
 Identities = 172/530 (32%), Positives = 273/530 (51%), Gaps = 16/530 (3%)
 Frame = +2

Query: 41   PCCLSSILGIA--ALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWA 214
            P   +  LGIA  A   L+ S  ++    PP     WPIIG+L+     +P  ++++E +
Sbjct: 3    PATWAVFLGIALCAAAALFLSRGRRPVYNPPPGPKPWPIIGNLN-LMGELPH-RSMNELS 60

Query: 215  DKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTN 394
             +YGP+  +R G   +LV +S E  +    TND   + RP    GKY  YD++   ++ +
Sbjct: 61   KRYGPLMQLRFGSLPVLVGASVEMAKLFLKTNDAAFSDRPRFAIGKYTAYDFSDLLWAPS 120

Query: 395  NSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRW 574
              Y R+ R++   E+ S+ RLE  +H+   E++  +++L           +   V +  +
Sbjct: 121  GPYLRQARRICATELFSATRLESFEHIRDEEVRVMLRQL--------RQAAGRTVRLRDY 172

Query: 575  FGHLTLNLIMQIVAGRRY--EYRSDGTINEEAQ----RLKKVFSQVMYLWGEFVSGDAIF 736
               L L +I +IV G +Y  E  +DG  +          +++  +   L G F  GD I 
Sbjct: 173  LQMLALGVISRIVLGNKYVMEEVADGEGDSAPAITPAEFREMVDEFFALHGAFNIGDYIP 232

Query: 737  PLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFI-----DVMLSMI 901
               +  WLD +G+V  MKR        L+  +D    ERR  E   F+     DV+L + 
Sbjct: 233  ---WLDWLDLQGYVARMKRMKARFGRFLERVLDVHN-ERRLREGGNFVAKDMLDVLLQLA 288

Query: 902  DDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNI 1081
            DD   +    SRD V KAI   ++   +++ A  L W ++ LLK+P+ L +  +E++  I
Sbjct: 289  DDTSLE-VQLSRDNV-KAITQDLIIAGTDSNANTLEWAVSELLKNPKILAKAMEELNHVI 346

Query: 1082 GKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNV 1261
            G +R   +SD+  LPY++ V+KET+R++P  P LAPH A ED  VDGY +  GT L++NV
Sbjct: 347  GPDRLVTESDLPRLPYIEAVLKETMRVHPAAPMLAPHVAREDTSVDGYDVLAGTVLFINV 406

Query: 1262 WRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVA 1441
            W + RDP +W  PE+F PERF+ +      +   +Q +PFG GRR CPG   A ++  ++
Sbjct: 407  WAIGRDPGLWDAPEEFRPERFVESKID--VRGHDFQLLPFGSGRRMCPGINLALKVMALS 464

Query: 1442 VARLFQGFNF---STVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
            +A L  GF +     V  E L M E   + +P+  PL V+  PRL   L+
Sbjct: 465  LANLLHGFEWRLPDGVTAEELSMDEAFKLAVPRKFPLMVVAEPRLPARLY 514



>sp|Q42798|C931_SOYBN Cytochrome P450 93A1 (EC
            1.14.-.-).>pir|S62899|S62899 cytochrome P450 (CYP93 A1) -
            soybean>gb:SOYCYP93A1_1715995 Soybean mRNA for cytochrome
            P450 (CYP93A1), complete cds.
          Length = 509

 Score =  259 bits (661), Expect = 2e-67
 Identities = 163/514 (31%), Positives = 275/514 (53%), Gaps = 12/514 (2%)
 Frame = +2

Query: 68   IAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRL 247
            ++ +V  +  WRKQSK+  P +  A PIIGHLH   + +P  +   + + ++GP+  + L
Sbjct: 11   VSTIVFAYILWRKQSKKNLPPSPKALPIIGHLH-LVSPIPH-QDFYKLSTRHGPIMQLFL 68

Query: 248  GISRILVVSSWEAVRDCFATNDKLLAARP-TTCAGKYLGYDYA--VFTFSTNNSYWRRVR 418
            G    +V S+ EA ++   T++   + RP    A K L YD    +F F+    YW+ ++
Sbjct: 69   GSVPCVVASTAEAAKEFLKTHEINFSNRPGQNVAVKGLAYDSQDFLFAFAPFGPYWKFMK 128

Query: 419  KLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNL 598
            KL + E+LS R +++   V   E +  I  ++          +   V+    FG   + L
Sbjct: 129  KLCMSELLSGRMMDQFLPVRQQETKRFISRVF------RKGVAGEAVD----FGDELMTL 178

Query: 599  IMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHV 778
               IV+      ++    N+ A+ +KK+ S +  L G+F   D I   W+ +  D +G  
Sbjct: 179  SNNIVSRMTLSQKTSENDNQ-AEEMKKLVSNIAELMGKFNVSDFI---WYLKPFDLQGFN 234

Query: 779  KTMKRAAKDVDAILQDWVDARRKERRSNED-------QKFIDVMLSMIDDQFTQGYSYSR 937
            + +K      D ++   +  R++ERR N++       +  +DV+L M +D+  +     +
Sbjct: 235  RKIKETRDRFDVVVDGIIKQRQEERRKNKETGTAKQFKDMLDVLLDMHEDENAEIKLDKK 294

Query: 938  DTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVK 1117
            +  IKA ++ +    ++T A  + W +A L+ +P+ L++ + EID  +GK R  E+SD+ 
Sbjct: 295  N--IKAFIMDIFVAGTDTSAVSIEWAMAELINNPDVLEKARQEIDAVVGKSRMVEESDIA 352

Query: 1118 NLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPD 1297
            NLPYLQ +V+ETLR++P GP L   E+ +  +V GY IP  T+L+VNVW + RDP  W  
Sbjct: 353  NLPYLQAIVRETLRLHPGGP-LVVRESSKSAVVCGYDIPAKTRLFVNVWAIGRDPNHWEK 411

Query: 1298 PEKFLPERFMTNLEGEA-AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFS 1474
            P +F PERF+ + + +   + + Y F+PFG GRR+CPG   A Q+  V +A + Q F + 
Sbjct: 412  PFEFRPERFIRDGQNQLDVRGQHYHFIPFGSGRRTCPGASLAWQVVPVNLAIIIQCFQWK 471

Query: 1475 TV-PNEPLDMMEDVGIILPKLTPLEVLVTPRLSP 1573
             V  N  +DM E  GI LP+  P+  +  PR++P
Sbjct: 472  LVGGNGKVDMEEKSGITLPRANPIICVPVPRINP 505



>pir|T52256|T52256 cytochrome P-450LXXIA1 [similarity] -
            avocado>gb:AVOCYP_1557688 Avocado cytochrome P-450LXXIA1
            (cyp71A1) mRNA, complete cds.
          Length = 502

 Score =  258 bits (659), Expect = 3e-67
 Identities = 160/499 (32%), Positives = 264/499 (52%), Gaps = 9/499 (1%)
 Frame = +2

Query: 101  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW 280
            R++   LPP      PIIG+LH    ++P  ++L   A++ GP+  + LG    L+VS+ 
Sbjct: 25   REKKPNLPPSPPNL-PIIGNLHQLG-NLPH-RSLRSLANELGPLILLHLGHIPTLIVSTA 81

Query: 281  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE 460
            E   +   T+D + A+RP+T A + + YD     FS    YWR+VRK+ V E+LS +R+ 
Sbjct: 82   EIAEEILKTHDLIFASRPSTTAARRIFYDCTDVAFSPYGEYWRQVRKICVLELLSIKRVN 141

Query: 461  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS 640
              + +   E+   ++ +    S      +   VN+S     L+   I ++  G++YE   
Sbjct: 142  SYRSIREEEVGLMMERISQSCS------TGEAVNLSELLLLLSSGTITRVAFGKKYEGEE 195

Query: 641  DGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDY-EGHVKTMKRAAKDVDAI 817
                 E   +   + +++  L G F  GD  FP   F W+D   G    +KR   ++DA 
Sbjct: 196  -----ERKNKFADLATELTTLMGAFFVGD-YFPS--FAWVDVLTGMDARLKRNHGELDAF 247

Query: 818  LQDWVDARRKERRSN-----EDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDA 982
            +   +D     R++N     E +  +DV+L +  D  + G   +R+  +KA++L M    
Sbjct: 248  VDHVIDDHLLSRKANGSDGVEQKDLVDVLLHLQKDS-SLGVHLNRNN-LKAVILDMFSGG 305

Query: 983  SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM 1162
            ++T A  L W +A L+KHP+ +++ Q E+   +GK+   E+ D+  L YL+ ++KETLR+
Sbjct: 306  TDTTAVTLEWAMAELIKHPDVMEKAQQEVRRVVGKKAKVEEEDLHQLHYLKLIIKETLRL 365

Query: 1163 YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG 1342
            +P  P L P E+  D ++ GYHIP  T++++N W + RDPK W + E+FLPERF+ N   
Sbjct: 366  HPVAPLLVPRESTRDVVIRGYHIPAKTRVFINAWAIGRDPKSWENAEEFLPERFVNNSVD 425

Query: 1343 EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF---STVPNEPLDMMEDV 1513
               Q+  +Q +PFG GRR CPG  +     ++++A L   FN+     +  E LDM E V
Sbjct: 426  FKGQD--FQLIPFGAGRRGCPGIAFGISSVEISLANLLYWFNWELPGDLTKEDLDMSEAV 483

Query: 1514 GIILPKLTPLEVLVTPRLS 1570
            GI +    PL+++    LS
Sbjct: 484  GITVHMKFPLQLVAKRHLS 502



>gb:AP006446_1861782 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC clone:B1097H10.
          Length = 519

 Score =  258 bits (658), Expect = 3e-67
 Identities = 160/521 (30%), Positives = 272/521 (52%), Gaps = 10/521 (1%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGP 229
            L++++ +   VLL    R+++ +LPP     WPIIG+L+   +S+P  +++ E + ++GP
Sbjct: 15   LATVVFLLRAVLLR---RRRAYKLPP-GPKPWPIIGNLNLI-SSLPH-RSIHEISKRHGP 68

Query: 230  VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWR 409
            +  +  G   ++V SS E  +    TND + A RP T AGKY  YD    T+S   +YWR
Sbjct: 69   IVQLWFGSCPVVVGSSVEMAKLFLQTNDAVFADRPRTAAGKYTAYDCTDITWSPYGAYWR 128

Query: 410  RVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLT 589
            + RK+   E+ S+RRLE L+H+   E++  ++EL+       +  +   V +        
Sbjct: 129  QARKMCAAELFSARRLESLEHIRHEEVRALLRELH------GSGAAGNAVQLRDHLSMAA 182

Query: 590  LNLIMQIVAGRRYEYRSD---GTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWL 760
            L +I ++V G++Y  +     G      +  K +  ++  + G    GD  F  W   WL
Sbjct: 183  LGVISRMVLGKKYVEKQPAGGGAAMTTPEEFKWMLEELFLMNGVLNIGD--FIPWL-DWL 239

Query: 761  DYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNED----QKFIDVMLSMIDDQFTQGYS 928
            D +G+++ MK   + +   L   +D   + RR   D    +  +D++L + DD       
Sbjct: 240  DLQGYIRRMKNVNRLIHRFLDRVLDEHDERRRLQGDGFVARDMVDILLQLADDP-NLDVQ 298

Query: 929  YSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDS 1108
             +R+  IK I   ++   ++T    + W ++ +LK+P  L +  +E+DT +G  R   + 
Sbjct: 299  LTRNG-IKGITQDLVTGGADTSTVTVEWAMSEVLKNPAILAKATEELDTIVGVGRLVTEG 357

Query: 1109 DVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKI 1288
            D+ +LPY+  ++KET+RM+P  P L P  + ED  V GY +P GT++ VN W + RDP +
Sbjct: 358  DIPHLPYIHAIMKETMRMHPVVPLLVPRMSREDASVAGYDVPAGTRVLVNTWTIGRDPSV 417

Query: 1289 WPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFN 1468
            W  PE+F PERF+ +  G   + R ++ +PF  GRR CPG     ++ Q+ +A L   F+
Sbjct: 418  WDSPEQFRPERFVGS--GIDVKGRDFELLPFSSGRRMCPGYNLGLKVIQLTLANLLHAFS 475

Query: 1469 F---STVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
            +     V    L M E  G+ +P+  PL  +V PRL   L+
Sbjct: 476  WCLPDGVTAGELSMEEIFGLTMPRKIPLLAVVKPRLPDHLY 516



>gb:AX028832_1457177 Sequence 16 from Patent WO9732023.
          Length = 508

 Score =  258 bits (658), Expect = 3e-67
 Identities = 168/513 (32%), Positives = 263/513 (51%), Gaps = 5/513 (0%)
 Frame = +2

Query: 59   ILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFT 238
            ILG    V L  S RK S RLPP     WPI+G+L H    +P    L+  A KYGP+  
Sbjct: 12   ILGSVLYVFLNLSSRK-SARLPP-GPTPWPIVGNLPHLGP-IPH-HALAALAKKYGPLMH 67

Query: 239  IRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVR 418
            +RLG   ++V +S          +D   A+RP     K++ Y+Y    F+     WR +R
Sbjct: 68   LRLGCVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPYGPRWRLLR 127

Query: 419  KLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNL 598
            K+    + S++ L+  +HV     Q  +  L   +    N+P    V + +       N 
Sbjct: 128  KICSVHLFSAKALDDFRHV----RQEEVAVLTRVLLSAGNSP----VQLGQLLNVCATNA 179

Query: 599  IMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHV 778
            + +++ GRR     DG I+  A   K +  ++M L GEF  GD I  L  F   D +G  
Sbjct: 180  LARVMLGRRVF--GDG-IDRSANEFKDMVVELMVLAGEFNLGDFIPVLDLF---DLQGIT 233

Query: 779  KTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAI 958
            K MK+     D+ L   V+  +           +  ++S+ DD   +G   + DT IKA+
Sbjct: 234  KKMKKLHVRFDSFLSKIVEEHKTAPGGLGHTDLLSTLISLKDDADIEGGKLT-DTEIKAL 292

Query: 959  VLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQG 1138
            +L++    ++T ++ + W +A L++HP+ LK+ ++EID  +G++R   + D+  L YLQ 
Sbjct: 293  LLNLFAAGTDTSSSTVEWAIAELIRHPQILKQAREEIDAVVGQDRLVTELDLSQLTYLQA 352

Query: 1139 VVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPE 1318
            +VKE  R++P  P   P  + E C VDGY+IPKG+ L VNVW + RDPK+W DP +F P 
Sbjct: 353  LVKEVFRLHPSTPLSLPRISSESCEVDGYYIPKGSTLLVNVWAIARDPKMWADPLEFRPS 412

Query: 1319 RFMTNLE--GEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF---STVP 1483
            RF+   E  G   +   ++ +PFG GRR C G     ++ Q+ +A L Q F++   + + 
Sbjct: 413  RFLPGGEKPGADVRGNDFEVIPFGAGRRICAGMSLGLRMVQLLIATLVQTFDWELANGLE 472

Query: 1484 NEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
             E L+M E  G+ L +  PL V   PRL+P ++
Sbjct: 473  PEMLNMEEAYGLTLQRAAPLMVHPKPRLAPHVY 505



>gb:AF313489_1785222 Callistephus chinensis flavonoid
            3',5'-hydroxylase mRNA, complete cds.
          Length = 510

 Score =  257 bits (657), Expect = 4e-67
 Identities = 161/515 (31%), Positives = 263/515 (51%), Gaps = 5/515 (0%)
 Frame = +2

Query: 56   SILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVF 235
            S+L I ALV ++ +  + + RLPP     WP++G+L H   ++P   TL+  A KYGP+ 
Sbjct: 13   SLLVIIALVNMFIT--RHTNRLPP-GPAPWPVVGNLPHLG-AIPH-HTLAALATKYGPLV 67

Query: 236  TIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRV 415
             +RLG   ++V SS          +D   A+RP     K++ Y+Y    F+     W   
Sbjct: 68   YLRLGFVHVVVASSPSVAAQFLKVHDLKFASRPPNSGAKHIAYNYQDMVFAPYGPQWTMF 127

Query: 416  RKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLN 595
            RK+  + + SS+ L+  +HV   E+    + L              KVN+ +     T N
Sbjct: 128  RKICKDHLFSSKALDDFRHVRQEEVAILARGLA--------GAGRSKVNLGQQLNMCTAN 179

Query: 596  LIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGH 775
             + +++  +R      G  + +A   K++ +++M+L G+F  GD I  L    WLD +G 
Sbjct: 180  TLARMMLDKRVFGNESGGDDPKANEFKEMATELMFLAGQFNIGDYIPVL---DWLDLQGI 236

Query: 776  VKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKA 955
            VK MK+     D  L   +D  +     + D   +  ++S+ DD    G   S D  IKA
Sbjct: 237  VKKMKKLHTRFDKFLDVILDEHKVIASGHIDM--LSTLISLKDDTSVDGRKPS-DIEIKA 293

Query: 956  IVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQ 1135
            ++L +    ++T +  + W +A L++ P  LKR Q+E+D+ +G+ R   + D+  L +LQ
Sbjct: 294  LLLELFVAGTDTSSNTVEWAIAELIRQPHLLKRAQEEMDSVVGQNRLVTEMDLSQLTFLQ 353

Query: 1136 GVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLP 1315
             +VKE  R++P  P   P  A E C VDGY+IPKG+ L VN+W + R P++W DP +F P
Sbjct: 354  AIVKEAFRLHPSTPLSLPRIASESCEVDGYYIPKGSTLLVNIWAIGRHPEVWTDPLEFRP 413

Query: 1316 ERFMTNLE--GEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF---STV 1480
             RF+   E  G   +   ++ +PFG GRR C G   A +  Q+ +  L Q F++   + +
Sbjct: 414  TRFLPGGEKPGIVVKVNDFEVLPFGAGRRICAGMSLALRTVQLLMGTLVQAFDWELANGI 473

Query: 1481 PNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR 1585
              E L+M E  G+ + +  PL V   PRL P +++
Sbjct: 474  KPEKLNMDEAFGLSVQRAEPLVVHPRPRLPPHVYK 508



>gb:AX028834_1457178 Sequence 18 from Patent WO9732023.
          Length = 508

 Score =  257 bits (656), Expect = 6e-67
 Identities = 168/523 (32%), Positives = 263/523 (50%), Gaps = 12/523 (2%)
 Frame = +2

Query: 50   LSSILGIA---ALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADK 220
            +S++LG     +L LL FS   Q +RL P     WP++G+L H         +++E A  
Sbjct: 9    ISTLLGFLLYHSLRLLLFSG--QGRRLLPPGPRPWPLVGNLPHLGPKPHA--SMAELARA 64

Query: 221  YGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNS 400
            YGP+  +++G   ++V SS  A   C   +D    +RP     K++ Y+Y    F     
Sbjct: 65   YGPLMHLKMGFVHVVVASSASAAEQCLRVHDANFLSRPPNSGAKHVAYNYEDLVFRPYGP 124

Query: 401  YWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFG 580
             WR +RK+  + I S + ++  + V   E+    + L               V + +   
Sbjct: 125  KWRLLRKICAQHIFSVKAMDDFRRVREEEVAILSRAL----------AGKRAVPIGQMLN 174

Query: 581  HLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWL 760
                N + +++ GRR    +DGT + +A+  K +  ++M L G F  GD I    F   L
Sbjct: 175  VCATNALSRVMMGRRVVGHADGTNDAKAEEFKAMVVELMVLSGVFNIGDFIP---FLEPL 231

Query: 761  DYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSR- 937
            D +G    MK+     DA L + V  R   + +N      D++ ++I  +       SR 
Sbjct: 232  DLQGVASKMKKLHARFDAFLTEIVRERCHGQINNSGAHQDDLLSTLISFKGLDDGDGSRL 291

Query: 938  -DTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDV 1114
             DT IKA++L++L   S T    + W +A LL+HP++L +V+ E+D+ +GK R   ++D+
Sbjct: 292  TDTEIKALLLNLLDTTSST----VEWAVAELLRHPKTLAQVRQELDSVVGKNRLVSETDL 347

Query: 1115 KNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWP 1294
              LPYLQ VVKET R++P  P   P  A +DC +DGY IPKG+ L VNVW + RDPK+W 
Sbjct: 348  NQLPYLQAVVKETFRLHPPTPLSLPRLAEDDCEIDGYLIPKGSTLLVNVWAIARDPKVWA 407

Query: 1295 DPEKFLPERFMTNLEGEAA----QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQG 1462
            DP +F PERF+T   GE A    +   ++ +PFG GRR C G     ++ Q+  A L   
Sbjct: 408  DPLEFRPERFLTG--GEKADVDVKGNDFEVIPFGAGRRICAGVGLGIRMVQLLTASLIHA 465

Query: 1463 FNFSTVPN---EPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
            F+         + L+M E  G+ L +  PL V   PRL+  ++
Sbjct: 466  FDLDLANGLLAQNLNMEEAYGLTLQRAEPLLVHPRPRLATHVY 508



>gb:AC084282_1733420 Oryza sativa chromosome 3 BAC OSJNBb0048A17
            genomic sequence, complete sequence.
          Length = 527

 Score =  256 bits (653), Expect = 1e-66
 Identities = 163/494 (32%), Positives = 253/494 (51%), Gaps = 11/494 (2%)
 Frame = +2

Query: 116  RLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRD 295
            +LPP    A P  GHLH      PL   LS  A+++GPVF++RLG    +VVSS E  R+
Sbjct: 41   QLPPSPP-AIPFFGHLHLI--DKPLHAALSRLAERHGPVFSLRLGSRNAVVVSSPECARE 97

Query: 296  CFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHV 475
            CF  ND   A RP   +     +  A F F+   ++WR +R++    +LS+ R+  +  V
Sbjct: 98   CFTDNDVCFANRPQFPSQMPATFYGAGFGFANYGAHWRNLRRIATVHLLSAHRVRGMAGV 157

Query: 476  WVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAG----RRYEYRSD 643
               E++  ++ +Y   +         +V + R    L+L+++M+ +A     R     +D
Sbjct: 158  VSGEIRPMVQRMYRAAAAAG--VGVARVQLKRRLFELSLSVLMEAIAQTKTTRPEADDAD 215

Query: 644  GTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQ 823
              ++ EAQ  K V  ++  L G     D +  L  F  L  +  + T+   A   DA ++
Sbjct: 216  TDMSVEAQEFKNVLDELNPLLGAANLWDYLPALRVFDVLGVKRKIATL---ANRRDAFVR 272

Query: 824  DWVDARRKERRSNED-------QKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDA 982
              +DA R+   +  D       +  I V+LS+   Q T+   Y +D VI  +  ++    
Sbjct: 273  RLIDAERQRMDNGVDGGDDGEKKSVISVLLSL---QKTEPEVY-KDIVIVNLCAALFAAG 328

Query: 983  SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM 1162
            +ET A  + W +++LL HP+ LK+ + EID ++G  R     D+ +L YLQ ++ ETLR+
Sbjct: 329  TETTAMTIEWAMSLLLNHPKILKKAKAEIDASVGNSRLINGDDMPHLSYLQCIINETLRL 388

Query: 1163 YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG 1342
            YP  P L PHE+  DC V+GYHIP GT L VNV  + RDP +W +P +F PERF      
Sbjct: 389  YPVAPLLIPHESSADCKVNGYHIPSGTMLLVNVIAIQRDPMVWKEPNEFKPERF------ 442

Query: 1343 EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGII 1522
            E  ++     +PFG+GRR CPG   A Q   + +  L Q F++  V    +DM +  G+ 
Sbjct: 443  ENGESEGLFMIPFGMGRRKCPGETMALQTIGLVLGALIQCFDWDRVDGAEVDMTQGSGLT 502

Query: 1523 LPKLTPLEVLVTPR 1564
             P+  PLE +  PR
Sbjct: 503  NPRAVPLEAMCKPR 516



>gb:AB057672_1521704 Torenia hybrida tht mRNA for flavonoid
            3'-hydroxylase, complete cds.
          Length = 512

 Score =  256 bits (653), Expect = 1e-66
 Identities = 167/518 (32%), Positives = 262/518 (50%), Gaps = 12/518 (2%)
 Frame = +2

Query: 50   LSSILGIA---ALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADK 220
            LS++LG     +L LL FS   Q +RL P     WP++G+L H         +++E A  
Sbjct: 9    LSTLLGFLLYHSLRLLLFSG--QGRRLLPPGPRPWPLVGNLPHLGPKPHA--SMAELARA 64

Query: 221  YGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNS 400
            YGP+  +++G   ++V SS  A   C   +D    +RP     K++ Y+Y    F     
Sbjct: 65   YGPLMHLKMGFVHVVVASSASAAEQCLRVHDANFLSRPPNSGAKHVAYNYEDLVFRPYGP 124

Query: 401  YWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFG 580
             WR +RK+  + I S + ++  + V   E+    + L               V + +   
Sbjct: 125  KWRLLRKICAQHIFSVKAMDDFRRVREEEVAILSRAL----------AGKRAVPIGQMLN 174

Query: 581  HLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWL 760
                N + +++ GRR    +DGT + +A+  K +  ++M L G F   D I    F   L
Sbjct: 175  VCATNALSRVMMGRRVVGHADGTNDAKAEEFKAMVVELMVLSGVFNISDFIP---FLEPL 231

Query: 761  DYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSR- 937
            D +G    MK+     DA L + V  R   + +N      D++ ++I  +       SR 
Sbjct: 232  DLQGVASKMKKLHARFDAFLTEIVRERCHGQINNGGAHQDDLLSTLISFKGLDDGDGSRL 291

Query: 938  -DTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDV 1114
             DT IKA++L++    ++T ++ + W +A LL+HP++L +V+ E+D+ +GK R   ++D+
Sbjct: 292  TDTEIKALLLNLFAAGTDTTSSTVEWAVAELLRHPKTLAQVRQELDSVVGKNRLVSETDL 351

Query: 1115 KNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWP 1294
              LPYLQ VVKET R++P  P   P  A +DC +DGY IPKG+ L VNVW + RDPK+W 
Sbjct: 352  NQLPYLQAVVKETFRLHPPTPLSLPRLAEDDCEIDGYLIPKGSTLLVNVWAIARDPKVWA 411

Query: 1295 DPEKFLPERFMTNLEGEAA----QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQG 1462
            DP +F PERF+T   GE A    +   ++ +PFG GRR C G     ++ Q+  A L   
Sbjct: 412  DPLEFRPERFLTG--GEKADVDVKGNDFELIPFGAGRRICAGVGLGIRMVQLLTASLIHA 469

Query: 1463 FNFSTVPN---EPLDMMEDVGIILPKLTPLEVLVTPRL 1567
            F+         + L+M E  G+ L +  PL  LV PRL
Sbjct: 470  FDLDLANGLLPQNLNMEEAYGLTLQRAEPL--LVHPRL 505



>gb:AB122079_1528034 Panax ginseng mRNA for cytochrome P450, complete
            cds.
          Length = 500

 Score =  252 bits (643), Expect = 2e-65
 Identities = 169/498 (33%), Positives = 267/498 (53%), Gaps = 10/498 (2%)
 Frame = +2

Query: 104  KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWE 283
            K+  +LPP   G  PIIG LH    ++P  +TL   A KYGP+ ++RLG    +VVSS +
Sbjct: 28   KRHHKLPPGPRGL-PIIGSLHTLG-ALPH-RTLQTLAKKYGPIMSMRLGSVPTIVVSSPQ 84

Query: 284  AVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEK 463
            A      T+D + A+RP   A +Y+ Y     +F+    +WR +RK VV E+L+  ++  
Sbjct: 85   AAELFLKTHDNIFASRPKLQAAEYMSYGTKGMSFTAYGPHWRNIRKFVVLELLTPAKINS 144

Query: 464  LKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSD 643
               +   EL   +K      S+   + +   V++S    ++  N+  +++ GR  + R D
Sbjct: 145  FVGMRREELGMVVK------SIKEASAANEVVDLSAKVANIIENMTYRLLLGRTKDDRYD 198

Query: 644  GTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQ 823
                     LK + ++ + L G F   D +    F   LD +G  +  K   K +D IL+
Sbjct: 199  ---------LKGIMNEALTLAGRFNIADFVP---FLGPLDIQGLTRQFKDTGKRLDKILE 246

Query: 824  DWVDARRKERRS-NEDQKFIDVMLSMIDDQFTQGYSYSR---DTVIKAIVLSMLQDASET 991
              +D   +   + N    FID MLS+ +         S+    +VIKAI++ ++  A +T
Sbjct: 247  FIIDEHEQNSSNGNASGDFIDDMLSLKNKPSNTHDELSKVIDRSVIKAIMIDIISAAIDT 306

Query: 992  FATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQ 1171
              T + WIL  L+KHP ++K+ Q+EID  +G +R  E++D+ NL Y+  VVKE LR++P 
Sbjct: 307  SDTSIEWILTELIKHPRAMKKCQEEIDAVVGVDRMVEETDLPNLEYVYMVVKEGLRLHPV 366

Query: 1172 GPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIW-PDPEKFLPERFM-TNLEGE 1345
             P L PHE++ED  ++GY IPK +++ VN W L RDP +W  D ++FLPERF  +N++  
Sbjct: 367  APLLGPHESMEDITINGYFIPKQSRVIVNSWALGRDPNVWSEDADEFLPERFEGSNID-- 424

Query: 1346 AAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN----EPLDMMEDV 1513
              + R +Q +PFG GRR CPG        Q+ VARL   F+++ +PN    + LDM E  
Sbjct: 425  -VRGRDFQLLPFGSGRRGCPGMQLGLITVQLVVARLVHCFDWN-LPNGITPDNLDMTEKF 482

Query: 1514 GIILPKLTPLEVLVTPRL 1567
            G+  P++  L  +   RL
Sbjct: 483  GLTTPRVKHLLAVPKYRL 500



>gb:AF313488_1785221 Callistephus chinensis putative flavonoid
            3'-hydroxylase mRNA, complete cds.
          Length = 518

 Score =  251 bits (641), Expect = 3e-65
 Identities = 164/523 (31%), Positives = 267/523 (51%), Gaps = 11/523 (2%)
 Frame = +2

Query: 47   CLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYG 226
            C+++++    L LL     +   RLPP     WPI+G+L H    +P   +L+  A KYG
Sbjct: 11   CITALVLYVLLNLL----TRNPNRLPP-GPTPWPIVGNLPHLGM-IPH-HSLAALAQKYG 63

Query: 227  PVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYW 406
            P+  +RLG   ++V +S         T+D   A+RP     K++ Y+Y    F+     W
Sbjct: 64   PLMHLRLGFVDVVVAASASVAAQFLKTHDANFASRPPNSGAKHIAYNYQDLVFAPYGPRW 123

Query: 407  RRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHL 586
            R +RK+    + S++ L+  +HV   E+    + L         +     V + +     
Sbjct: 124  RMLRKICSVHLFSTKALDDFRHVREEEVAILTRVLV--------HAGESAVKLGQLLNVC 175

Query: 587  TLNLIMQIVAGRR-YEYRSDGT-INEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWL 760
            T N + +++ GRR +   S+G  ++ +A   K +  ++M L GEF  GD I PL     L
Sbjct: 176  TTNALARVMLGRRVFADGSEGRGVDPKADEFKDMVVELMELAGEFNIGDFIPPL---DCL 232

Query: 761  DYEGHVKTMKRAAKDVDAILQDWVDARRKER----RSNEDQKFIDVMLSMIDDQFTQGYS 928
            D +G  K MK+     D  L   +D  + E+    R + D     + L  +D        
Sbjct: 233  DLQGITKKMKKLHARFDKFLNIILDDHKIEKGAAGRRHSDLLTTLISLKDVDAADDDEEG 292

Query: 929  YSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDS 1108
               D  IKA++L++    ++T ++ + W +A L++HPE LK+ ++E+D  +G++R   + 
Sbjct: 293  KLSDIEIKALLLNLFAAGTDTSSSTVEWAVAELIRHPELLKQAREEMDIVVGRDRLVTEL 352

Query: 1109 DVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKI 1288
            D+  L +LQ +VKET R++P  P   P  A E C VDGY+IPKG+ L VNVW + RDPK+
Sbjct: 353  DLSRLTFLQAIVKETFRLHPSTPLSLPRMASESCEVDGYYIPKGSTLLVNVWAIARDPKM 412

Query: 1289 WPDPEKFLPERFMTNLEGEAA--QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQG 1462
            W +P +F P RF+   E   A  +   ++ +PFG GRR C G     ++ Q+ +A L Q 
Sbjct: 413  WTNPLEFRPSRFLPGGEKPDADIKGNDFEVIPFGAGRRICAGMSLGMRMVQLLIATLVQT 472

Query: 1463 FNF---STVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
            F++   + +  E L+M E  G+ L +  PL V   PRLSP ++
Sbjct: 473  FDWELANGLDPEKLNMEEAYGLTLQRAEPLMVHPRPRLSPHVY 515



>gb:AB159037_1528421 Lolium rigidum mRNA for P450, complete cds,
            clone:CYP81B1v1.
          Length = 517

 Score =  251 bits (641), Expect = 3e-65
 Identities = 166/495 (33%), Positives = 259/495 (52%), Gaps = 7/495 (1%)
 Frame = +2

Query: 101  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW 280
            +K + +LPP    A P IGHLH      P+  T+   A + GPVF++RLG  R +VVSS 
Sbjct: 31   KKGAVQLPPSPP-AIPFIGHLH--LVEKPIHATMCRLAARLGPVFSLRLGSRRAVVVSSS 87

Query: 281  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE 460
            E  R+CF  +D   A RP   +     ++       +   +WR +R++   ++LS+ R+ 
Sbjct: 88   ECARECFTEHDVTFANRPKFPSQLLASFNGTALVTPSYGPHWRNLRRVATVQLLSAHRVA 147

Query: 461  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVA---GRRYE 631
             +  V  +E++   + L  F + + +   A +V + R    L+L+++M+ +A     R E
Sbjct: 148  CMSGVIAAEVRAMARRL--FHAAEASPGGAARVQLKRGPFELSLSVLMETIAQTKATRSE 205

Query: 632  YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD 811
              +D  ++ EAQ  K+V  + +   G     D + P+   RW D  G    +  A    D
Sbjct: 206  ADADTDMSVEAQEFKEVVDKPIPHLGAANMWDYL-PV--MRWFDVFGVRNKILHAVSRRD 262

Query: 812  AILQDWVDARRK---ERRSNEDQK-FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQD 979
            A L+  +DA R+   +  S+ D+K  I V+L++   Q T+   Y+ DT+I A+  ++   
Sbjct: 263  AFLRRLIDAERRRLADGGSDGDKKSMIAVLLTL---QKTEPKVYT-DTMITALCANLFGA 318

Query: 980  ASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLR 1159
             +ET +T     +++LL HP +LK+ Q EID ++G  R     D+ +L YLQ +V ETLR
Sbjct: 319  GTETTSTTTERAMSLLLNHPAALKKAQAEIDASVGTSRLVSVDDMPSLAYLQCIVNETLR 378

Query: 1160 MYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLE 1339
            +YP  P L PHE+  DC V GY++P  T L VN + +HRDP  W  P +F PERF     
Sbjct: 379  LYPAAPLLLPHESSADCKVGGYNVPADTMLIVNAYAIHRDPAAWEHPLEFRPERF----- 433

Query: 1340 GEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGI 1519
             E  +      +PFG+GRR CPG   A +   + +A L Q F++  V    +DM E  G 
Sbjct: 434  -EDGKAEGLFMIPFGMGRRRCPGETLALRTIGMVLATLVQCFDWEPVDGVKVDMTEGGGF 492

Query: 1520 ILPKLTPLEVLVTPR 1564
             +PK  PLE +  PR
Sbjct: 493  TIPKAVPLEAVCRPR 507



>gb:AP004591_1842019 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, PAC
            clone:P0582D05.>gb:AP005250_1849563 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 8, BAC
            clone:OSJNBb0009H02.
          Length = 525

 Score =  250 bits (638), Expect = 7e-65
 Identities = 161/534 (30%), Positives = 274/534 (51%), Gaps = 20/534 (3%)
 Frame = +2

Query: 41   PCCLSSILGIAALVLLWFSWRKQS---KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEW 211
            P  LS IL   + + +  SW+K +   +RLPP     WPI G+L   + S    K  + +
Sbjct: 3    PFLLSIIL--CSWIFVVVSWKKLNCMRRRLPP-GPPRWPIFGNL--LQLSPLPHKDFARF 57

Query: 212  ADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFST 391
              KYGP+  +RLG    +     E +R+     D++ A+RP T A  +L Y       + 
Sbjct: 58   CTKYGPLVYLRLGTIDAITTDDPEVIREILIRQDEVFASRPRTLAAVHLAYGCGDVALAP 117

Query: 392  NNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSR 571
                W+R+R++ +E +L+++RLE     + +      + L  F+       S   VN+  
Sbjct: 118  LGPNWKRMRRVCMEHLLTTKRLES----FAAHRALEAEHLCQFVWAKAQ--SGKPVNLRE 171

Query: 572  WFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF 751
              G  ++N + +++ G++Y +        EA     +  ++ +L G    GD + P W  
Sbjct: 172  VLGAFSMNNVTRMLLGKQY-FGLQSAGPGEAMEFMHITHELFWLLGLIYLGDYL-PAW-- 227

Query: 752  RWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSN----------EDQKFIDVMLSMI 901
            RWLD  G  K M+   K VD   Q  +D  RK R +           ED  F+DV+LS+ 
Sbjct: 228  RWLDPYGCEKKMREVEKKVDDFHQKIIDEHRKAREAKKSASLDDDNKEDMDFVDVLLSLP 287

Query: 902  DDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNI 1081
             +    G  +  D  IKA++  M+  A++T +    W++A ++K+P  L+++Q+E+D  +
Sbjct: 288  GEN---GKEHMDDVEIKALMQDMIAAATDTSSVTNEWVMAEVIKNPRVLRKIQEELDGVV 344

Query: 1082 GKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNV 1261
            G+ R   +SD+  L YL+ VV+E+ RM+P GP+L PHE+++   + GY IP  T++++N 
Sbjct: 345  GRGRMVAESDLGQLTYLRCVVRESFRMHPAGPFLIPHESLKPTTIMGYDIPARTRIFINT 404

Query: 1262 WRLHRDPKIWPDPEKFLPERFM-TNLEG---EAAQNRQYQFVPFGLGRRSCPGNLYATQI 1429
              L R+ +IW D + F PER +  + +G   E +    ++ +PF  G+R CPG      +
Sbjct: 405  HALGRNTRIWDDVDAFRPERHLPASADGGRVEISHLPDFKILPFSAGKRKCPGAPLGVIL 464

Query: 1430 TQVAVARLFQGFNFST---VPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
              +A+ARLF  F++S    +  + +D  E  G+ +PK  PL  + TPRL P ++
Sbjct: 465  VLMALARLFHCFDWSPPDGLRPDDIDTQEVYGMTMPKAKPLVAVATPRLPPQMY 518



>gb:AP004022_1836496 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC
            clone:OJ1126_B06.>gb:AP005069_1847541 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, PAC
            clone:P0654A08.
          Length = 537

 Score =  250 bits (638), Expect = 7e-65
 Identities = 169/546 (30%), Positives = 276/546 (50%), Gaps = 27/546 (4%)
 Frame = +2

Query: 26   VMDAVPCCLSSILGIAALVLLW------FSWRKQSKRLP---PEAGGAWPIIGHLHHFRT 178
            V + VP   SS      LVL        F  R+Q  R     P     WP+IG+L+    
Sbjct: 3    VQELVPSPWSSSSSFLVLVLATLLFVAAFLRRRQGARRKYNIPPGPRPWPVIGNLNLIG- 61

Query: 179  SVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYL 358
            ++P  +++ + + +YGP+ ++R G   ++V SS +  R     ND     RP T AG+Y 
Sbjct: 62   ALPY-RSIRDLSRRYGPLMSLRFGSFPVVVGSSVDMARYFLRANDLAFLDRPRTAAGRYT 120

Query: 359  GYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNN 538
             Y+YA   +S    YWR+ R+L V E+LS+RRL   +HV   E++  ++ L         
Sbjct: 121  VYNYAGVLWSHYGEYWRQARRLWVTELLSARRLASTEHVRAEEVRAMLRGL------SRR 174

Query: 539  NPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS-DGTINEEAQRLKKVFSQVMYLWGEF 715
              +   V +      +TLN+I ++V G++Y     +G+    A+  + +  ++ +L G F
Sbjct: 175  AGAGTAVVLKEHMLMVTLNVISRMVFGKKYIVEEGEGSSPTTAEEFRWMIEEIFFLNGVF 234

Query: 716  VSGDAIFPLWFFRWLDYEGHVKTMKRAA----KDVDAILQDWVDARRKERRSNEDQKFID 883
              GD +    +  WLD +G++  MKR      + ++ IL + V+ RR+E      +  +D
Sbjct: 235  NIGDMVP---WLGWLDPQGYIGRMKRLGGMFDRFLEHILDEHVERRRREGDGFAARDMVD 291

Query: 884  VMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQD 1063
            ++L   DD   +     RD V KA +L ++  +++T +  + W ++ +L++P  L R  D
Sbjct: 292  LLLQFADDPSLK-VPIQRDGV-KAFILELITGSTDTTSVSVEWAMSEVLRNPSVLARATD 349

Query: 1064 EIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCI-------VDG 1222
            E+D  +G+ R   + D+ NLPYL  VVKE++R++P  P L P  + ED            
Sbjct: 350  ELDRVVGRRRLVAEGDIPNLPYLDAVVKESMRLHPVVPLLVPRVSREDAFSVSVAGAAAS 409

Query: 1223 YHIPKGTQLYVNVWRLHRDPKIW-PDPEKFLPERFMTNLE--GEAAQNRQYQFVPFGLGR 1393
            Y IP GT++ VNVW + RDP +W  D E+F PERF    E  G   + + ++ +PFG GR
Sbjct: 410  YDIPAGTRVLVNVWAIGRDPAVWGDDAEEFRPERFAAGGERGGVDVKGQDFELLPFGSGR 469

Query: 1394 RSCPGNLYATQITQVAVARLFQGFNF---STVPNEPLDMMEDVGIILPKLTPLEVLVTPR 1564
            R CPG     ++ Q+ +A L  GF +        E L M E  GI + +L  L+ +  P+
Sbjct: 470  RMCPGFGLGLKMVQLTLANLLHGFAWRLPGGAAAEELSMEEKFGISVSRLVQLKAIPEPK 529

Query: 1565 LSPTLF 1582
            L   L+
Sbjct: 530  LPAHLY 535



>gb:AP005285_1849830 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1003_F04.
          Length = 509

 Score =  249 bits (635), Expect = 2e-64
 Identities = 156/496 (31%), Positives = 250/496 (50%), Gaps = 13/496 (2%)
 Frame = +2

Query: 122  PPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYG-PVFTIRLGISRILVVSSWEAVRDC 298
            PPE  G  P++GHLH FR   PL +TL+  A ++G  VF +RLG  R+ VVSS  A  +C
Sbjct: 38   PPEPAGL-PLVGHLHLFRK--PLHRTLARLAARHGGAVFGLRLGSRRVAVVSSAPAAEEC 94

Query: 299  FATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVW 478
               +D   A RP   +G+ L YD++    ++   YWR VR++ V EILS+RR++    V 
Sbjct: 95   LGAHDVAFADRPRLPSGRILSYDWSTMGTASYGPYWRHVRRVAVTEILSARRVQHFADVH 154

Query: 479  VSELQTNIKELY-TFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSD-GTI 652
            V E +   + L+   +       +  +V +      L +N +M ++  + Y    D G +
Sbjct: 155  VREARAMARHLHRAAVRHGVGGAARVRVELKSRLFELLMNTMMAMICDKTYYGDDDDGKV 214

Query: 653  NEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWV 832
            ++EA+  +++  + M L G     D  F     RW+D  G  + + R  +     LQ  +
Sbjct: 215  SKEARWFREMVEETMALSGASTVWD--FLPAALRWVDVGGVGRRLWRLRESRTRFLQGLI 272

Query: 833  DARRKERRSNED----------QKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDA 982
            +  RKE    +           +  I V+LS+      Q      D +I+++ +S L+  
Sbjct: 273  NDERKEMEQEQGGDRAQPAARRRTMIGVLLSVQ----RQDPDACPDQLIRSLCISSLEAG 328

Query: 983  SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM 1162
            ++T A  + W +++LL +P  +++ +DEID  IG+                 ++ ETLR+
Sbjct: 329  TDTSADTIEWAMSLLLNNPNVMRKARDEIDAFIGQPC---------------IIMETLRL 373

Query: 1163 YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG 1342
            YP  P L PHEA  DC + G+HI +GT L VN + +HRDP++W +P  F+PERF      
Sbjct: 374  YPPAPLLVPHEASTDCSIAGFHITRGTMLLVNTFAIHRDPQVWNEPTSFIPERF------ 427

Query: 1343 EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGII 1522
            E  ++     +PFG+GR  CP      Q+  +A+  + Q F +  V  E +DM E  G+ 
Sbjct: 428  ENGRSEGKMAIPFGMGRCKCPAENLGMQMVGLALGTMIQCFEWERVGEELVDMTEGSGLT 487

Query: 1523 LPKLTPLEVLVTPRLS 1570
            +PK  PL+    PR S
Sbjct: 488  MPKEVPLQAFYQPRAS 503



>gb:AY541035_1612618 Allium cepa flavonoid 3'-hydroxylase mRNA,
            complete cds.
          Length = 510

 Score =  249 bits (635), Expect = 2e-64
 Identities = 161/525 (30%), Positives = 261/525 (49%), Gaps = 8/525 (1%)
 Frame = +2

Query: 38   VPCCLSSILGIAALVLLWFSWRK--QSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEW 211
            +P  L   + +A L+ L+F   K  + KR+P   G  WPI+G+L          ++L E 
Sbjct: 3    IPVLLLLTIFLALLLYLFFFVAKKHEGKRVPGPKG--WPILGNLPQLGAKPH--QSLCEL 58

Query: 212  ADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFST 391
            +  YGP+F +R G   ++V +S +        +D   + RP     +++ Y+Y    F+ 
Sbjct: 59   SRTYGPLFGLRFGYVDVVVAASADVAEQFLRVHDVNFSNRPPNSGAEHIAYNYQDLVFAP 118

Query: 392  NNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSR 571
                WR +RKL    + S + LE L  V   E+ T    LY     D      P VN+++
Sbjct: 119  YGPRWRMLRKLCALHLFSPKALEDLSPVRSLEVATLANTLYLRAQSDQ-----PTVNLAQ 173

Query: 572  WFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF 751
                 T N + + + GRR       T + E  + K +  ++M L G F  GD      F 
Sbjct: 174  MLTTCTTNALSKAMMGRRVFVNE--TTDTETSKFKDMVLEIMSLAGVFNVGD------FV 225

Query: 752  RWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNED-QKFIDVMLSMIDDQFTQGYS 928
             WL     ++ + R  KDV A    ++D    E R  ++    + +++   DD    G  
Sbjct: 226  PWLR-PFDLQRVVRKMKDVHARFDSFLDKVIAEHRMVDNAHDLLSLLIRSKDDVDNDGVK 284

Query: 929  YSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDS 1108
             + +T IKA++L++    ++T ++ + W L+ +++HP++LKR Q E+D  +G++R   ++
Sbjct: 285  LT-NTDIKALLLNLFTAGTDTSSSTVEWALSEMIRHPDALKRAQRELDEVVGRDRLVSET 343

Query: 1109 DVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKI 1288
            D+++LPY+Q +VKET R++P  P   P  + E C V+GY IPK T L VNVW + RDP +
Sbjct: 344  DIRSLPYIQAIVKETFRLHPSTPLSLPRISSEACTVNGYLIPKNTTLLVNVWAISRDPGV 403

Query: 1289 WPDPEKFLPERFM--TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQG 1462
            W +P +F PERF+     E    +   ++ +PFG GRR C G     ++ Q   A L  G
Sbjct: 404  WKEPLEFRPERFLGGGGYETVDLKGNDFELIPFGAGRRVCAGLSLGLRMVQFLTATLVHG 463

Query: 1463 FNFSTVPN---EPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFRL 1588
            F++  V     E LDM E  G+ L +  PL V   PRL    + +
Sbjct: 464  FDWKLVDGQSAEKLDMEEAYGLPLQRAVPLMVRPVPRLDEKAYHV 508



>gb:AP003711_1832299 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC clone:P0417G12.
          Length = 528

 Score =  248 bits (633), Expect = 3e-64
 Identities = 167/525 (31%), Positives = 273/525 (52%), Gaps = 20/525 (3%)
 Frame = +2

Query: 59   ILGIAALVLLWFSWRKQSKR------LPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWAD 217
            +L +A L++L+   R++  R      LPP   G  PI+GHLH      PL  + L   A 
Sbjct: 15   LLFVAGLIVLYALRRRRRHRRSSGLRLPPSPFGL-PILGHLHLL---APLPHQALHRLAA 70

Query: 218  KYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNN 397
            ++GP+  +RLG    +   S +A R+   T++     RP   A   L Y    F+FS   
Sbjct: 71   RHGPLLFLRLGSVPCVAACSPDAAREVLKTHEAAFLDRPKPAAVHRLTYGGQDFSFSAYG 130

Query: 398  SYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWF 577
             YWR +++  V E+L+ R L++L+HV   E+   +  L    S D       +V++    
Sbjct: 131  PYWRFMKRACVHELLAGRTLDRLRHVRREEVARLVGSLRA--SADGGE----RVDVDAAL 184

Query: 578  GHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRW 757
              LT +++ ++V GRR+     G  N+ A+ ++ V ++   L G F   D I     F++
Sbjct: 185  MGLTGDIVSRMVMGRRWT----GDDND-AEEMRSVVAETAELTGTFNLQDYI---GVFKY 236

Query: 758  LDYEGHVKTMKRAAKDVDAILQDWVDARRKERR---------SNEDQKFIDVMLSMIDDQ 910
             D +G  K +    +  DA+++  + AR  +R+          ++++  +D++  M +D+
Sbjct: 237  WDVQGLGKRIDAVHRKFDAMMERILTAREAKRKLRRQAAADGEDDEKDLLDMLFDMHEDE 296

Query: 911  FTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE 1090
              +    +RD  IKA +L +    ++T    L W L+ L+ +P  L+++Q E+D  +G  
Sbjct: 297  AAE-MRLTRDN-IKAFMLDIFAAGTDTTTITLEWALSELINNPPVLRKLQAELDAVVGGA 354

Query: 1091 RWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRL 1270
            R A++SD+ +LPYLQ V KETLR++P GP L    ++E   V GY +P G  ++VNVW +
Sbjct: 355  RLADESDIPSLPYLQAVAKETLRLHPTGP-LVVRRSLERATVAGYDVPAGATVFVNVWAI 413

Query: 1271 HRDPKIWPDPEKFLPERFMTNLEGEA----AQNRQYQFVPFGLGRRSCPGNLYATQITQV 1438
             RD   WP+P  F PERF++   G       + + +  +PFG GRR CPG   A  + Q 
Sbjct: 414  GRDAAWWPEPTAFRPERFVSGGGGGGTAADVRGQHFHLLPFGSGRRICPGASLAMLVVQA 473

Query: 1439 AVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSP 1573
            A+A + Q F +S V   P+DM E  G+ LP+  PL   V+PR+ P
Sbjct: 474  ALAAMVQCFEWSPVGGAPVDMEEGPGLTLPRKRPLVCTVSPRIHP 518



>gb:NRCYP71A5_1691150 Nepeta racemosa mRNA for cytochrome P450,
            CYP71A5.
          Length = 509

 Score =  248 bits (632), Expect = 4e-64
 Identities = 156/520 (30%), Positives = 271/520 (52%), Gaps = 16/520 (3%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFSWRKQ-SKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYG 226
            L ++L     +L    WR+  S + PP +    P+IG+LH     +   + L   + +YG
Sbjct: 8    LIALLCTLPFLLFLNKWRRSYSGKTPPPSPPKLPVIGNLHQL--GLYPHRYLQSLSRRYG 65

Query: 227  PVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYW 406
            P+  +  G   +LV SS EA R+     D + + RP       L ++     F+    YW
Sbjct: 66   PLMQLHFGSVPVLVASSPEAAREIMKNQDIVFSNRPKMSIANRLFFNNRDVAFTQYGEYW 125

Query: 407  RRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHL 586
            R++R + V ++LS++R++  + V   E    ++++     M   + S+  VN+S     L
Sbjct: 126  RQIRSICVLQLLSNKRVQSFRRVREEETSIMVEKI-----MQLGSSSSTPVNLSELLLSL 180

Query: 587  TLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW-FFRWLD 763
            T +++ ++  G++Y     G  +EE  +LK++ +++  L G       I P+W F  WL+
Sbjct: 181  TNDVVCRVTLGKKY---GGGNGSEEVDKLKEMLTEIQNLMG-------ISPVWEFIPWLN 230

Query: 764  ----YEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQK------FIDVMLSMIDDQF 913
                ++G  + + R  K  D  L+  +    KER  ++D        F+D++L     + 
Sbjct: 231  WTRRFDGVDQRVDRIVKAFDGFLESVIQ-EHKERDGDKDGDGDGALDFVDILLQF--QRE 287

Query: 914  TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER 1093
             +  S   D  +KA++L M    ++T AT L W +A L+K+P ++KR+Q+E+    G + 
Sbjct: 288  NKNRSPVEDDTVKALILDMFVAGTDTTATALEWAVAELIKNPRAMKRLQNEVREVAGSKA 347

Query: 1094 WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH 1273
              E+ D++ +PYL+  +KE+LR++     L P E+  D  V GY I  GT++ +N W + 
Sbjct: 348  EIEEEDLEKMPYLKASIKESLRLHVPVVLLVPRESTRDTNVLGYDIASGTRVLINAWAIA 407

Query: 1274 RDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL 1453
            RDP +W +PE+FLPERF+ +      +   ++ +PFG GRR CPG  +A  I ++A+A+L
Sbjct: 408  RDPSVWENPEEFLPERFLDS--SIDYKGLHFELLPFGAGRRGCPGATFAVAIDELALAKL 465

Query: 1454 FQGFNFSTVPN----EPLDMMEDVGIILPKLTPLEVLVTP 1561
               F+F  +PN    E LDM E  G+ + K +PL +L  P
Sbjct: 466  VHKFDFG-LPNGARMEELDMSETSGMTVHKKSPLLLLPIP 504



>gb:AY675558_1621947 Solanum tuberosum flavonoid 3',5'-hydroxylase (P)
            mRNA, complete cds.>gb:AY675559_1621948 Solanum tuberosum
            flavonoid 3',5'-hydroxylase (P) gene, complete cds.
          Length = 509

 Score =  248 bits (632), Expect = 4e-64
 Identities = 163/496 (32%), Positives = 258/496 (52%), Gaps = 6/496 (1%)
 Frame = +2

Query: 101  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW 280
            R++ +RLPP   G WP+IG L     S+P V  L++ A  YGP+  +++G   ++V S+ 
Sbjct: 30   RERGRRLPPGPTG-WPVIGALS-LLGSMPHV-ALAKMAKNYGPIMYLKVGTCGMVVASTP 86

Query: 281  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE 460
             A +    T D   + RP      +L Y+     F+     W+ +RKL   ++L  + LE
Sbjct: 87   NAAKAFLKTLDINFSNRPPNAGATHLAYNAQDMVFAPYGPRWKLLRKLSNLQMLGGKALE 146

Query: 461  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS 640
               +V  +EL   IK      SM + +     V ++        N+I Q++  +R     
Sbjct: 147  NWANVRANELGHMIK------SMFDASHVGECVVIADMLTFAMANMIGQVMLSKRVFVEK 200

Query: 641  DGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAIL 820
               +NE     K +  ++M + G F  GD I  L    W+D +G  K MK   K  D +L
Sbjct: 201  GAEVNE----FKNMVVELMTVAGYFNIGDFIPKL---AWMDLQGIEKGMKSLHKKFDDLL 253

Query: 821  QDWVD---ARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASET 991
                D   A   ER+ N D  F+DV+++  D+   +  S    T IKA++L++    ++T
Sbjct: 254  TKMFDEHEATTYERKENPD--FLDVVMANKDNSEGERLS---TTNIKALLLNLFTAGTDT 308

Query: 992  FATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQ 1171
             ++ + W LA ++K+P+  K+ Q+E+D  IGK R   +SD+ NLPYL+ + KET R +P 
Sbjct: 309  SSSVIEWALAEMMKNPKIFKKAQEEMDQVIGKNRRLIESDIPNLPYLRAICKETFRKHPS 368

Query: 1172 GPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGE-A 1348
             P   P  + E C VDGY+IPK T+L VN+W + RDP +W +P +F PERF++    +  
Sbjct: 369  TPLNLPRVSTEPCTVDGYYIPKNTRLSVNIWAIGRDPDVWENPLEFNPERFLSGKNAKIE 428

Query: 1349 AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLD--MMEDVGII 1522
             +   ++ +PFG GRR C G      + +  +  L   F++  +PN+ +D  M E  G+ 
Sbjct: 429  PRGNDFELIPFGAGRRICAGTRMGIVMVEYILGTLVHSFDWK-LPNDVIDINMEESFGLA 487

Query: 1523 LPKLTPLEVLVTPRLS 1570
            L K  PLE +VTPRLS
Sbjct: 488  LQKAVPLEAMVTPRLS 503



>gb:OSJN00014_1693289 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0068L06, complete
            sequence.>gb:OSJN00294_1698095 Oryza sativa genomic DNA,
            chromosome 4, BAC clone: B1160F02, complete sequence.
          Length = 499

 Score =  247 bits (630), Expect = 6e-64
 Identities = 153/495 (30%), Positives = 267/495 (53%), Gaps = 8/495 (1%)
 Frame = +2

Query: 113  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVR 292
            +RLPP      P+IGHLH  R   P+ +T  E A + GP+  +RLG +  +V SS E   
Sbjct: 24   RRLPPSPASL-PVIGHLHLLRP--PVHRTFHELAARLGPLMHVRLGSTHCVVASSAEVAA 80

Query: 293  DCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKH 472
            +   +++  ++ RP T   +   Y+ A F F+  + +WR +++L + E+L  R +E+L+ 
Sbjct: 81   ELIRSHEAKISERPLTAVARQFAYESAGFAFAPYSPHWRFMKRLCMSELLGPRTVEQLRP 140

Query: 473  VWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTI 652
            V  + L + ++ + +        P A  V+++R    ++   I+++ A          ++
Sbjct: 141  VRRAGLVSLLRHVLS-------QPEAEAVDLTRELIRMSNTSIIRMAAST-----VPSSV 188

Query: 653  NEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWV 832
             EEAQ L KV ++++   G F + D I      R  D +G  +      K  DA+L++ +
Sbjct: 189  TEEAQELVKVVAELV---GAFNADDYIA---LCRGWDLQGLGRRAADVHKRFDALLEEMI 242

Query: 833  ----DARRKERRSNE--DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETF 994
                +AR +++   +   +  +D++L   +D   +    +RD  IKA ++ ++   S+T 
Sbjct: 243  RHKEEARMRKKTDTDVGSKDLLDILLDKAEDGAAE-VKLTRDN-IKAFIIDVVTAGSDTS 300

Query: 995  ATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQG 1174
            A  + W++A L+ HPE+L++V++EI+  +G++R A + D+  LPYLQ   KETLR+ P  
Sbjct: 301  AAMVEWMVAELMNHPEALRKVREEIEAVVGRDRIAGEGDLPRLPYLQAAYKETLRLRPAA 360

Query: 1175 PYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ 1354
            P +A  ++ E+  + G+ +P  T +++NVW + RDP  W +P +F PERF+    GE  +
Sbjct: 361  P-IAHRQSTEEIQIRGFRVPAQTAVFINVWAIGRDPAYWEEPLEFRPERFLAGGGGEGVE 419

Query: 1355 NR--QYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILP 1528
             R   +QF+PFG GRR CPG   A Q     VA L Q F++  + N+ +DM E  G++  
Sbjct: 420  PRGQHFQFMPFGSGRRGCPGMGLALQSVPAVVAALLQCFDWQCMDNKLIDMEEADGLVCA 479

Query: 1529 KLTPLEVLVTPRLSP 1573
            +   L +   PRL P
Sbjct: 480  RKHRLLLHAHPRLHP 494



>gb:AY675561_1621950 Solanum tuberosum flavonoid 3',5'-hydroxylase (P)
            mRNA, P-recessive allele, complete cds.
          Length = 509

 Score =  245 bits (626), Expect = 2e-63
 Identities = 162/496 (32%), Positives = 258/496 (52%), Gaps = 6/496 (1%)
 Frame = +2

Query: 101  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW 280
            R++ +RLPP   G WP+IG L     S+P V  L++ A KYGP+  +++G   ++V S+ 
Sbjct: 30   RERGRRLPPGPTG-WPVIGALS-LLGSMPHV-ALAKMAKKYGPIMYLKVGTCGMVVASTP 86

Query: 281  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE 460
             A +    T D   + RP      +L Y+     F+     W+ +RKL    +L  + LE
Sbjct: 87   NAAKAFLKTLDINFSNRPPNAGATHLAYNAQDMVFAPYGPRWKLLRKLSNSHMLGGKALE 146

Query: 461  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS 640
               +V  +EL   +K      SM + +     V ++        N+I Q++  +R     
Sbjct: 147  NWANVRANELGHMLK------SMFDASHVGECVVIADMLTFAMANMIGQVMLSKRVFVEK 200

Query: 641  DGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAIL 820
               +NE     K +  ++M + G F  GD I  L    W+D +G  K MK   K  D +L
Sbjct: 201  GVEVNE----FKNMVVELMTVAGYFNIGDFIPKL---AWMDLQGIEKGMKSLHKKFDDLL 253

Query: 821  QDWV---DARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASET 991
                   +A   ER+ N D  F+DV+++  D+   +  S    T IKA++L++    ++T
Sbjct: 254  TKMFNEHEATTYERKENPD--FLDVVMANKDNSEGERLS---TTNIKALLLNLFTAGTDT 308

Query: 992  FATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQ 1171
             ++ + W LA ++K+P+  K+VQ+E+D  IGK R   +SD+ NLPYL+ + KET R +P 
Sbjct: 309  SSSVIEWALAEMMKNPQIFKKVQEEMDQVIGKNRRLIESDIPNLPYLRAICKETFRKHPS 368

Query: 1172 GPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGE-A 1348
             P   P  + E C VDGY+IPK T+L VN+W + RDP +W +P +F PERF++    +  
Sbjct: 369  TPLNLPRVSTEPCTVDGYYIPKNTRLSVNIWAIGRDPDVWENPLEFNPERFLSGKNAKIE 428

Query: 1349 AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLD--MMEDVGII 1522
             +   ++ +PF  GRR C G      + +  +  L   F++  +PN+ +D  M E  G+ 
Sbjct: 429  PRGNDFELIPFWAGRRICAGTRMGIVMVEYILGTLVHSFDWK-LPNDVIDINMEESFGLA 487

Query: 1523 LPKLTPLEVLVTPRLS 1570
            L K  PLE +VTPRLS
Sbjct: 488  LQKAVPLEAMVTPRLS 503



>sp|P24465|CP71_PERAE Cytochrome P450 71A1 (EC 1.14.-.-) (CYPLXXIA1)
            (ARP-2).>pir|A35867|A35867 cytochrome P450 71A1 - avocado
          Length = 471

 Score =  245 bits (626), Expect = 2e-63
 Identities = 148/463 (31%), Positives = 247/463 (53%), Gaps = 6/463 (1%)
 Frame = +2

Query: 101  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW 280
            R++   LPP      PIIG+LH    ++P  ++L   A++ GP+  + LG    L+VS+ 
Sbjct: 25   REKKPNLPPSPPNL-PIIGNLHQLG-NLPH-RSLRSLANELGPLILLHLGHIPTLIVSTA 81

Query: 281  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE 460
            E   +   T+D + A+RP+T A + + YD     FS    YWR+VRK+ V E+LS +R+ 
Sbjct: 82   EIAEEILKTHDLIFASRPSTTAARRIFYDCTDVAFSPYGEYWRQVRKICVLELLSIKRVN 141

Query: 461  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS 640
              + +   E+   ++ +    S      +   VN+S     L+   I ++  G++YE   
Sbjct: 142  SYRSIREEEVGLMMERISQSCS------TGEAVNLSELLLLLSSGTITRVAFGKKYEGEE 195

Query: 641  DGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDY-EGHVKTMKRAAKDVDAI 817
                 E   +   + +++  L G F  GD  FP   F W+D   G    +KR   ++DA 
Sbjct: 196  -----ERKNKFADLATELTTLMGAFFVGD-YFPS--FAWVDVLTGMDARLKRNHGELDAF 247

Query: 818  LQDWVDARRKERRSN-----EDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDA 982
            +   +D     R++N     E +  +DV+L +  D  + G   +R+  +KA++L M    
Sbjct: 248  VDHVIDDHLLSRKANGSDGVEQKDLVDVLLHLQKDS-SLGVHLNRNN-LKAVILDMFSGG 305

Query: 983  SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM 1162
            ++T A  L W +A L+KHP+ +++ Q E+   +GK+   E+ D+  L YL+ ++KETLR+
Sbjct: 306  TDTTAVTLEWAMAELIKHPDVMEKAQQEVRRVVGKKAKVEEEDLHQLHYLKLIIKETLRL 365

Query: 1163 YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG 1342
            +P  P L P E+  D ++ GYHIP  T++++N W + RDPK W + E+FLPERF+ N   
Sbjct: 366  HPVAPLLVPRESTRDVVIRGYHIPAKTRVFINAWAIGRDPKSWENAEEFLPERFVNNSVD 425

Query: 1343 EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF 1471
               Q+  +Q +PFG GRR CPG  +     ++++A L   FN+
Sbjct: 426  FKGQD--FQLIPFGAGRRGCPGIAFGISSVEISLANLLYWFNW 466



>sp|P37117|C714_SOLME Cytochrome P450 71A4 (EC 1.14.-.-) (CYPLXXIA4)
            (P-450EG2).>pir|S36805|S36805 cytochrome P450 71A4 -
            eggplant>gb:SMCYPEG2_1715486 S.melongena CYP71A1 mRNA for
            P450 hydroxylase.
          Length = 507

 Score =  245 bits (626), Expect = 2e-63
 Identities = 168/529 (31%), Positives = 269/529 (50%), Gaps = 21/529 (3%)
 Frame = +2

Query: 38   VPCCLSSILGIAALVLLW-----FSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTL 202
            VPC   S+L +  L +       F+  K      P +    PIIG+LH   +     ++L
Sbjct: 3    VPCLWYSLLILLLLFIFLLIHHCFTTSKTQNMFLPPSPRKLPIIGNLHQLGSHPH--RSL 60

Query: 203  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT 382
             + + KYGPV  + LG   ++V SS +A RD   T+D + A RP       L Y      
Sbjct: 61   RKLSQKYGPVMLLHLGSKPVIVASSVDAARDILKTHDHVWATRPKYSIADSLLYGSKDVG 120

Query: 383  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVN 562
            FS    YW +VR +VV  +LS++R++  + V   E    I+++            A  +N
Sbjct: 121  FSPFGEYWWQVRSIVVLHLLSNKRVQSYRDVREEETANMIEKI-------RQGCDASVIN 173

Query: 563  MSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL 742
            +      LT N+  ++  GR Y+ R  G         K +  Q + L   F  GD     
Sbjct: 174  LGEHLCFLTNNITSRVALGRTYDERESGI------DAKDILEQFLQLLDTFNVGD----- 222

Query: 743  WFFRWLDYEGHV--------KTMKRAAKDVDAILQDWVDARRKERR--SNEDQKFIDVML 892
             +  WL +   +        K  K+    +D+++++ +   +KE    ++E + F+DV+L
Sbjct: 223  -YIPWLKWVNKITGLDTKVEKIAKKLDTFLDSVIEEHIIRNKKEEYAITDEAKDFVDVLL 281

Query: 893  SMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEI- 1069
             + + + T  +   RD+ +KAI+L      ++T  T+L W +A +L+ P ++K +Q+E+ 
Sbjct: 282  EIQNGKETD-FPLQRDS-LKAILLDAFAAGTDTIYTNLDWTMADVLRQPRAMKTLQNEVR 339

Query: 1070 DTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDG-YHIPKGTQ 1246
                GK    ED D+KN+ YL+ V+KE+LR++P    L P E++ED  + G YHIP  TQ
Sbjct: 340  GLAQGKSEITED-DLKNMQYLRAVIKESLRLHPPNSLLVPRESMEDVKLLGYYHIPARTQ 398

Query: 1247 LYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQ 1426
              +NVW + RDP  W +PE+F PERF+ N      +  +++ +PFG GRR CPG+ +A  
Sbjct: 399  ALINVWAIGRDPLSWENPEEFCPERFLNN--DIDMKGLKFELLPFGSGRRGCPGSSFAIA 456

Query: 1427 ITQVAVARLFQGFNFS----TVPNEPLDMMEDVGIILPKLTPLEVLVTP 1561
            + ++A+ARL   FNF+    T P E LDM E  GI   + +PL V+ TP
Sbjct: 457  VIELALARLVHKFNFALPKGTKP-EDLDMTECTGIATRRKSPLPVVATP 504



>sp|O04773|C756_CAMME Flavonoid 3',5'-hydroxylase (EC 1.14.-.-)
            (F3'5'H) (Cytochrome P450 75A6).>gb:D14590_1674472
            Campanula medium mRNA for flavonoid 3',5'-hydroxylase,
            complete cds.
          Length = 523

 Score =  244 bits (622), Expect = 5e-63
 Identities = 158/498 (31%), Positives = 252/498 (50%), Gaps = 10/498 (2%)
 Frame = +2

Query: 119  LPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDC 298
            LPP   G WPIIG L    T +P V +L++ A KYGP+  ++LG    +V S+ +A R  
Sbjct: 38   LPPGPTG-WPIIGALPLLGT-MPHV-SLADMAVKYGPIMYLKLGSKGTVVASNPKAARAF 94

Query: 299  FATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVW 478
              T+D   + RP      YL Y+     F+     W+ +RKL    +L  + LE   HV 
Sbjct: 95   LKTHDANFSNRPIDGGPTYLAYNAQDMVFAEYGPKWKLLRKLCSLHMLGPKALEDWAHVK 154

Query: 479  VSELQTNIKELYTFISMDNNNPSAP-KVNMSRWFGHLTLNLIMQIVAGRR-----YEYRS 640
            VSE+   +KE+Y     + ++ S P  V +     +   N+I +I+  RR      +  S
Sbjct: 155  VSEVGHMLKEMY-----EQSSKSVPVPVVVPEMLTYAMANMIGRIILSRRPFVITSKLDS 209

Query: 641  DGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAIL 820
              + +      + +  ++M + G F  GD I    +  W+D +G  + MK   K  D +L
Sbjct: 210  SASASASVSEFQYMVMELMRMAGLFNIGDFIP---YIAWMDLQGIQRDMKVIQKKFDVLL 266

Query: 821  QDWVDARRKERRSNEDQK-FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFA 997
               +    +     +D   F+D++++   +  T+G   +   V KA++L +    ++T +
Sbjct: 267  NKMIKEHTESAHDRKDNPDFLDILMAATQEN-TEGIQLNLVNV-KALLLDLFTAGTDTSS 324

Query: 998  THLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGP 1177
            + + W LA +L H + L R  +E+D  IG+ R  E SD+ NLPY Q + KET R +P  P
Sbjct: 325  SVIEWALAEMLNHRQILNRAHEEMDQVIGRNRRLEQSDIPNLPYFQAICKETFRKHPSTP 384

Query: 1178 YLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEA-AQ 1354
               P  + E C VDG+HIPK T+L VN+W + RDPK+W +P  F PERF++    +   +
Sbjct: 385  LNLPRISTEACEVDGFHIPKNTRLIVNIWAIGRDPKVWENPLDFTPERFLSEKHAKIDPR 444

Query: 1355 NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN--EPLDMMEDVGIILP 1528
               ++ +PFG GRR C G        +  +  L   F++  +P+    ++M E  GI L 
Sbjct: 445  GNHFELIPFGAGRRICAGARMGAASVEYILGTLVHSFDWK-LPDGVVEVNMEESFGIALQ 503

Query: 1529 KLTPLEVLVTPRLSPTLF 1582
            K  PL  +VTPRL P+ +
Sbjct: 504  KKVPLSAIVTPRLPPSSY 521



>gb:AY226829_1591041 Vitis vinifera cytochrome P-450-like protein
            (CYP82) mRNA, partial cds.
          Length = 259

 Score =  243 bits (620), Expect = 9e-63
 Identities = 118/256 (46%), Positives = 165/256 (64%), Gaps = 4/256 (1%)
 Frame = +2

Query: 827  WVDARRKERRSNED----QKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETF 994
            WV+  R+ R S  D    Q FI  MLS+IDD    G+    DT+IK    +++   ++T 
Sbjct: 1    WVEEHRQNRLSANDNGAEQDFIHAMLSVIDDGQFSGHD--PDTIIKGTCSNLILAGNDTT 58

Query: 995  ATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQG 1174
            +  LTW L++LL +  +LK+ Q E++ ++GK R  + SD+KNL YLQ +VKETLR+YP G
Sbjct: 59   SITLTWALSLLLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPPG 118

Query: 1175 PYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ 1354
            P   PHEA+EDC V G+HI  GT+L VN+W+LHRDP++W DP +F PERF+T   G   +
Sbjct: 119  PLSLPHEAMEDCTVAGFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFLTKHAGLDVR 178

Query: 1355 NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKL 1534
             + Y+ +PFG GRR CPG  +A ++T + +ARL  GF    V + P+DM E  G+  PK 
Sbjct: 179  GKNYELLPFGSGRRVCPGISFALELTHLTLARLLHGFELGAVADSPVDMTESPGLTAPKA 238

Query: 1535 TPLEVLVTPRLSPTLF 1582
            TPLEV + PRL   L+
Sbjct: 239  TPLEVTIVPRLPFELY 254



>gb:AB045592_1520403 Perilla frutescens PFSII3 mRNA for flavone
            synthase II, complete cds.
          Length = 506

 Score =  243 bits (619), Expect = 1e-62
 Identities = 155/503 (30%), Positives = 261/503 (51%), Gaps = 12/503 (2%)
 Frame = +2

Query: 101  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW 280
            RK+ +   P      PIIGHLH       L +T  + + +YGP+  +RLG  R ++ +S 
Sbjct: 21   RKRGRPPYPPGPFPLPIIGHLHLLGPR--LHQTFHDLSQRYGPLMQLRLGSIRCVIAASP 78

Query: 281  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE 460
            E  ++C  T++ + ++R  + A   + YD + F FS    YW+ ++KL   E+L +R L 
Sbjct: 79   ELAKECLKTHELVFSSRKHSTAIDIVTYDSS-FAFSPYGPYWKFIKKLCTYELLGARNLA 137

Query: 461  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS 640
              + +   E+++ ++ L           S    N++     LT N+I  ++   R     
Sbjct: 138  HFQPIRTLEVKSFLQILM------RKGESGESFNVTEELVKLTSNVISHMMLSIRCS--- 188

Query: 641  DGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAIL 820
                  EA+  + V  +V  ++GEF   D I   W  +  D++G  K  +   +  DA+L
Sbjct: 189  --ETESEAEAARTVIREVTQIFGEFDVSDII---WLCKNFDFQGIRKRSEDIQRRYDALL 243

Query: 821  QDWVDARRKERRSN-------EDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQD 979
            +  +  R K+RR++       E + F+D+ L +++    +   ++R+  +KA++L     
Sbjct: 244  EKIITDREKQRRTHGGGGGGGEAKDFLDMFLDIMESGKAE-VKFTREH-LKALILDFFTA 301

Query: 980  ASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLR 1159
             ++T A    W +A ++ +P  LK+ Q+EI   +G +R  ++SD  NLPYLQ ++KET R
Sbjct: 302  GTDTTAIVCEWAIAEVINNPNVLKKAQEEIANIVGFDRILQESDAPNLPYLQALIKETFR 361

Query: 1160 MYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLE 1339
            ++P  P LA  +++ DC++DGY IP  T L+VN+W + R+PKIW  P  F PERF   LE
Sbjct: 362  LHPPIPMLA-RKSISDCVIDGYMIPANTLLFVNLWSMGRNPKIWDYPTAFQPERF---LE 417

Query: 1340 GEAA----QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNE-PLDMM 1504
             E A    + + ++ +PFG GRR CPG L A Q   + +  + Q F++        +DM 
Sbjct: 418  KEKAAIDVKGQHFELLPFGTGRRGCPGMLLAIQEVVIIIGTMIQCFDWKLPDGSGHVDMA 477

Query: 1505 EDVGIILPKLTPLEVLVTPRLSP 1573
            E  G+  P+ T L   V PR+ P
Sbjct: 478  ERPGLTAPRETDLFCRVVPRVDP 500



>gb:AX028838_1457180 Sequence 22 from Patent WO9732023.
          Length = 476

 Score =  242 bits (618), Expect = 1e-62
 Identities = 153/493 (31%), Positives = 253/493 (51%), Gaps = 14/493 (2%)
 Frame = +2

Query: 146  PIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLA 325
            PI+G++ H  +     +TL+E A  YGP+  ++ G+   +V SS          +D   +
Sbjct: 1    PILGNIPHLGSKPH--QTLAEMAKTYGPLMHLKFGLKDAVVASSASVAEQFLKKHDVNFS 58

Query: 326  ARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIK 505
             RP     K++ Y+Y    F+     WR +RK+    + SS+ L+  +HV   E+   I+
Sbjct: 59   NRPPNSGAKHIAYNYQDLVFAPYGPRWRLLRKICSVHLFSSKALDDFQHVRHEEICILIR 118

Query: 506  ELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVF 685
             + +          AP VN+ +  G  T N + +++ GRR  +  DG  N  A   K + 
Sbjct: 119  AIAS-------GGHAP-VNLGKLLGVCTTNALARVMLGRRV-FEGDGGENPHADEFKSMV 169

Query: 686  SQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMK----RAAKDVDAILQDWVDARRKER 853
             ++M L G F  GD I  L    W D +G    MK    R  K ++ IL+D     RK  
Sbjct: 170  VEIMVLAGAFNLGDFIPVL---DWFDLQGIAGKMKKLHARFDKFLNGILED-----RKSN 221

Query: 854  RSNEDQKFID---VMLSMIDDQFTQGYSYSR--DTVIKAIVLSMLQDASETFATHLTWIL 1018
             SN  ++++D   V++S+ D     G   ++  DT IKA++L++    ++T ++ + W +
Sbjct: 222  GSNGAEQYVDLLSVLISLQDSNIDGGDEGTKLTDTEIKALLLNLFIAGTDTSSSTVEWAM 281

Query: 1019 AVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEA 1198
            A L+++P+ L + Q+E+D  +G  R+  +SD+  L +LQ V+KET R++P  P   P  A
Sbjct: 282  AELIRNPKLLVQAQEELDRVVGPNRFVTESDLPQLTFLQAVIKETFRLHPSTPLSLPRMA 341

Query: 1199 VEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLE--GEAAQNRQYQF 1372
             EDC ++GY++ +G+ L VNVW + RDP  W +P  F P RF+   E      +   ++ 
Sbjct: 342  AEDCEINGYYVSEGSTLLVNVWAIARDPNAWANPLDFNPTRFLAGGEKPNVDVKGNDFEV 401

Query: 1373 VPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN---EPLDMMEDVGIILPKLTPL 1543
            +PFG GRR C G     ++ Q+  A L   F+++ +     E LDM E  G+ L + +PL
Sbjct: 402  IPFGAGRRICAGMSLGIRMVQLVTASLVHSFDWALLDGLKPEKLDMEEGYGLTLQRASPL 461

Query: 1544 EVLVTPRLSPTLF 1582
             V   PRLS  ++
Sbjct: 462  IVHPKPRLSAQVY 474



>pir|T49979|T49979 cytochrome P450-like protein - Arabidopsis
            thaliana>gb:ATF12B17_1548314 Arabidopsis thaliana DNA
            chromosome 5, BAC clone F12B17 (ESSA project).
          Length = 561

 Score =  242 bits (618), Expect = 1e-62
 Identities = 153/490 (31%), Positives = 248/490 (50%)
 Frame = +2

Query: 92   FSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVV 271
            F W  Q+ +LPP      PIIGHLH      PL + L   +  YGPV  ++ G   +L++
Sbjct: 21   FLW-SQNPKLPPSPTPL-PIIGHLHLIN-KYPLPQALHHLSSNYGPVLFLKFGCREVLIL 77

Query: 272  SSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSR 451
            SS +++ +CF  +D  LA RP T    +  Y Y  F F+     WR +R+L   E+ SS 
Sbjct: 78   SSPDSIEECFTNHDIALANRPKTITSDHFSYGYKNFGFAPYGDLWRTLRRLSTLEVFSSV 137

Query: 452  RLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYE 631
             L+K   +   E+      L+ F     +  ++ KV++   F  LT ++++++V+G R  
Sbjct: 138  SLQKNSSIRTEEVSNLCSSLFRF-----SGGNSCKVDLRYQFTLLTAHVMLRLVSGNRGV 192

Query: 632  YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD 811
              SD   +E   +    F    +     ++    FP+   RW+ Y+G    +    +  D
Sbjct: 193  NESD---SESETKFLDEFKSRFFSSLSSMNVCDYFPV--LRWIGYKGLENRVIEIQRMRD 247

Query: 812  AILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASET 991
              LQ  +D  R ++  +       V+   +  Q ++   YS D VIK IV+ M    S+T
Sbjct: 248  EYLQRLIDDIRMKKFDSTGS----VVEKFLKLQESEPEFYS-DDVIKGIVVLMFNAGSDT 302

Query: 992  FATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQ 1171
                + W +A+LL HP+ L +V++EI +N+  +   +DSD+ +LPYL+ V+ ETLR++P 
Sbjct: 303  SPVTMEWAMALLLNHPDKLDKVREEIKSNVKHKGIIQDSDLSSLPYLRCVIYETLRLHPA 362

Query: 1172 GPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA 1351
             P L PH + +   +  Y IP+ T L VN W +HRD ++W + + F PERF    E    
Sbjct: 363  APILPPHCSSKRFNLGNYEIPENTVLLVNAWAVHRDGELWEEADVFKPERF----EEFVG 418

Query: 1352 QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPK 1531
                ++F+PFG+GRR+CP    A ++  +AV  L Q F +  V  E +DM     + + +
Sbjct: 419  DRDGFRFLPFGVGRRACPAAGLAMRVVSLAVGALVQCFEWEKVEKEDIDMRPAFSVAMDR 478

Query: 1532 LTPLEVLVTP 1561
              PL  L+ P
Sbjct: 479  AEPLIALLKP 488



>sp|Q9SBQ9|F3PH_PETHY Flavonoid 3'-monooxygenase (EC 1.14.13.21)
            (Flavonoid 3'-hydroxylase) (Cytochrome P450
            75B2).>gb:AX028817_1457168 Sequence 1 from Patent
            WO9732023.>gb:AF155332_1772958 Petunia x hybrida
            flavonoid 3'-hydroxylase (Ht1) mRNA, complete cds.
          Length = 512

 Score =  242 bits (618), Expect = 1e-62
 Identities = 148/493 (30%), Positives = 244/493 (49%), Gaps = 8/493 (1%)
 Frame = +2

Query: 113  KRLP---PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWE 283
            KR P   P     WPIIG+L H        ++ +  A  YGP+  +++G   ++V +S  
Sbjct: 27   KRYPLPLPPGPKPWPIIGNLVHLGPKPH--QSTAAMAQTYGPLMYLKMGFVDVVVAASAS 84

Query: 284  AVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEK 463
                   T+D   ++RP     +++ Y+Y    F+     WR +RK+    + S++ L+ 
Sbjct: 85   VAAQFLKTHDANFSSRPPNSGAEHMAYNYQDLVFAPYGPRWRMLRKICSVHLFSTKALDD 144

Query: 464  LKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSD 643
             +HV     Q  +K L   ++     P    V + +     T N + +++ G+R      
Sbjct: 145  FRHV----RQDEVKTLTRALASAGQKP----VKLGQLLNVCTTNALARVMLGKRVFADGS 196

Query: 644  GTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQ 823
            G ++ +A   K +  ++M + G F  GD I  L    WLD +G    MK+     DA L 
Sbjct: 197  GDVDPQAAEFKSMVVEMMVVAGVFNIGDFIPQL---NWLDIQGVAAKMKKLHARFDAFLT 253

Query: 824  DWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATH 1003
            D ++   K +   E +  +  ++S+ +D          DT IKA++L++    ++T ++ 
Sbjct: 254  DILE-EHKGKIFGEMKDLLSTLISLKNDDADNDGGKLTDTEIKALLLNLFVAGTDTSSST 312

Query: 1004 LTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYL 1183
            + W +A L+++P+ L + Q EID  +G++R   + D+  L YL+ +VKET R++P  P  
Sbjct: 313  VEWAIAELIRNPKILAQAQQEIDKVVGRDRLVGELDLAQLTYLEAIVKETFRLHPSTPLS 372

Query: 1184 APHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNR- 1360
             P  A E C ++GY IPKG+ L +NVW + RDP  W DP +F PERF+   E      R 
Sbjct: 373  LPRIASESCEINGYFIPKGSTLLLNVWAIARDPNAWADPLEFRPERFLPGGEKPKVDVRG 432

Query: 1361 -QYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN---EPLDMMEDVGIILP 1528
              ++ +PFG GRR C G     ++ Q+ +A L   FN+  V     E L+M E  G+ L 
Sbjct: 433  NDFEVIPFGAGRRICAGMNLGIRMVQLMIATLIHAFNWDLVSGQLPEMLNMEEAYGLTLQ 492

Query: 1529 KLTPLEVLVTPRL 1567
            +  PL V   PRL
Sbjct: 493  RADPLVVHPRPRL 505



>gb:AF135485_1771085 Glycine max cytochrome P450 monooxygenaseCYP93D1
            (CYP93E1) mRNA, complete cds.
          Length = 513

 Score =  242 bits (617), Expect = 2e-62
 Identities = 166/525 (31%), Positives = 273/525 (52%), Gaps = 20/525 (3%)
 Frame = +2

Query: 59   ILGIAALVLLWFSW---------RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEW 211
            I G   L  LWF           + Q  RLPP    + P++GH  + R+   L + L + 
Sbjct: 4    IKGYLVLFFLWFISTILIRSIFKKPQRLRLPPGPPISIPLLGHAPYLRSL--LHQALYKL 61

Query: 212  ADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFST 391
            + +YGP+  + +G   ++V SS E  +    T+++    RP   A + L Y  A + F  
Sbjct: 62   SLRYGPLIHVMIGSKHVVVASSAETAKQILKTSEEAFCNRPLMIASESLTYGAADYFFIP 121

Query: 392  NNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSR 571
              +YWR ++KL + E+LS + LE    +  SE++  +K +     M+ +     +V M +
Sbjct: 122  YGTYWRFLKKLCMTELLSGKTLEHFVRIRESEVEAFLKRM-----MEISGNGNYEVVMRK 176

Query: 572  WFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF 751
                 T N+I +++ G++         N+E  RL+KV  +V  L G F  GD I    F 
Sbjct: 177  ELITHTNNIITRMIMGKK-----SNAENDEVARLRKVVREVGELLGAFNLGDVI---GFM 228

Query: 752  RWLDYEGHVKTMKRAAKDVDA----ILQDWVDARRKERRSNEDQK-FIDVMLSMIDDQFT 916
            R LD +G  K        VDA    +L++  +AR KE   ++ +K   D++L++I+    
Sbjct: 229  RPLDLQGFGKKNMETHHKVDAMMEKVLREHEEARAKEDADSDRKKDLFDILLNLIEADGA 288

Query: 917  QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW 1096
                 +R++  KA  L M    +   A+ L W LA L+++P   K+ ++EI++ +GKER 
Sbjct: 289  DN-KLTRESA-KAFALDMFIAGTNGPASVLEWSLAELVRNPHVFKKAREEIESVVGKERL 346

Query: 1097 AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR 1276
             ++SD+ NLPYLQ V+KETLR++P  P  A  EA+  C V+GY IP+ + + ++ W + R
Sbjct: 347  VKESDIPNLPYLQAVLKETLRLHPPTPIFA-REAMRTCQVEGYDIPENSTILISTWAIGR 405

Query: 1277 DPKIWPDPEKFLPERFM-TNLEGEA---AQNRQYQFVPFGLGRRSCPGNLYATQITQVAV 1444
            DP  W D  ++ PERF+ ++  G++    + + YQ +PFG GRRSCPG   A  + Q  +
Sbjct: 406  DPNYWDDALEYKPERFLFSDDPGKSKIDVRGQYYQLLPFGSGRRSCPGASLALLVMQATL 465

Query: 1445 ARLFQGFNF--STVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSP 1573
            A L Q F++  +   N  +DM E+  + +    PL+    PR +P
Sbjct: 466  ASLIQCFDWIVNDGKNHHVDMSEEGRVTVFLAKPLKCKPVPRFTP 510



>gb:A29011_1448320 pCGP602 DNA from patent EP0522880.
          Length = 505

 Score =  242 bits (617), Expect = 2e-62
 Identities = 163/511 (31%), Positives = 264/511 (51%), Gaps = 6/511 (1%)
 Frame = +2

Query: 53   SSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPV 232
            +SI  IA +++     +   + LPP   G WP+IG L     ++P V +L++ A KYG +
Sbjct: 10   TSIFLIAHIIISTLISKTTGRHLPPGPRG-WPVIGALP-LLGAMPHV-SLAKMAKKYGAI 66

Query: 233  FTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRR 412
              +++G   + V S+ +A +    T D   + RP      +L Y+     F+     W+ 
Sbjct: 67   MYLKVGTCGMAVASTPDAAKAFLKTLDINFSNRPPNAGATHLAYNAQDMVFAHYGPRWKL 126

Query: 413  VRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTL 592
            +RKL    +L  + LE   +V  +EL   +K      SM + +    +V ++        
Sbjct: 127  LRKLSNLHMLGGKALENWANVRANELGHMLK------SMSDMSREGQRVVVAEMLTFAMA 180

Query: 593  NLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEG 772
            N+I Q++  +R        +NE     K +  ++M + G F  GD I  L    W+D +G
Sbjct: 181  NMIGQVMLSKRVFVDKGVEVNE----FKDMVVELMTIAGYFNIGDFIPCL---AWMDLQG 233

Query: 773  HVKTMKRAAKDVDAILQDWVDARRK---ERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDT 943
              K MKR  K  DA+L    D  +    ER+   D  F+DV++   D+   +  S    T
Sbjct: 234  IEKRMKRLHKKFDALLTKMFDEHKATTYERKGKPD--FLDVVMENGDNSEGERLS---TT 288

Query: 944  VIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNL 1123
             IKA++L++    ++T ++ + W LA ++K+P  LK+ Q E+D  IG+ R   +SD+ NL
Sbjct: 289  NIKALLLNLFTAGTDTSSSAIEWALAEMMKNPAILKKAQAEMDQVIGRNRRLLESDIPNL 348

Query: 1124 PYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPE 1303
            PYL+ + KET R +P  P   P  + E CIVDGY+IPK T+L VN+W + RDP++W +P 
Sbjct: 349  PYLRAICKETFRKHPSTPLNLPRISNEPCIVDGYYIPKNTRLSVNIWAIGRDPQVWENPL 408

Query: 1304 KFLPERFMTNLEGEA-AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTV 1480
            +F PERF++    +   +   ++ +PFG GRR C G      + +  +  L   F++  +
Sbjct: 409  EFNPERFLSGRNSKIDPRGNDFELIPFGAGRRICAGTRMGIVMVEYILGTLVHSFDWK-L 467

Query: 1481 PNE--PLDMMEDVGIILPKLTPLEVLVTPRL 1567
            P+E   L+M E  G+ L K  PLE +VTPRL
Sbjct: 468  PSEVIELNMEEAFGLALQKAVPLEAMVTPRL 498



>gb:AE016959_1021729 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC021892_1538791 Genomic
            sequence for Oryza sativa, Nipponbare strain, clone
            OSJNBa0053D03, from chromosome 10, complete
            sequence.>gb:AC131968_1741080 Oryza sativa (japonica
            cultivar-group) chromosome 10 clone OSJNAa0053D03,
            complete sequence.>gb:AE017074_1751548 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 28 of 77
            of the complete sequence.
          Length = 526

 Score =  242 bits (617), Expect = 2e-62
 Identities = 167/549 (30%), Positives = 271/549 (49%), Gaps = 31/549 (5%)
 Frame = +2

Query: 29   MDAVPC--CLSSILGIAALVLLWFSWR--------KQSKRLPPEAGGAWPIIGHL----- 163
            MD VP    L S+   AA+  L +  R        ++ + LPP   G WP++G+L     
Sbjct: 1    MDVVPLPLLLGSLAVSAAVWYLVYFLRGGSGGDAARKRRPLPPGPRG-WPVLGNLPQLGD 59

Query: 164  --HHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPT 337
              HH         T+   A +YGP+F +R G + ++V +S          +D   + RP 
Sbjct: 60   KPHH---------TMCALARQYGPLFRLRFGCAEVVVAASAPVAAQFLRGHDANFSNRPP 110

Query: 338  TCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYT 517
                +++ Y+Y    F+   + WR +RKL    + S++ L+ L+ V   E+   ++ L  
Sbjct: 111  NSGAEHVAYNYQDLVFAPYGARWRALRKLCALHLFSAKALDDLRAVREGEVALMVRNLA- 169

Query: 518  FISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVM 697
                      A  V + +       N + +   G R  +  DG   E A+  K++  ++M
Sbjct: 170  -------RQQAASVALGQEANVCATNTLARATIGHRV-FAVDG--GEGAREFKEMVVELM 219

Query: 698  YLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSN----- 862
             L G F  GD +  L   RWLD +G V  MKR  +  D ++  +++ R+   + +     
Sbjct: 220  QLAGVFNVGDFVPAL---RWLDPQGVVAKMKRLHRRYDNMMNGFINERKAGAQPDGVAAG 276

Query: 863  -EDQKFIDVMLS-MIDDQFTQGYSYS-RDTVIKAIVLSMLQDASETFATHLTWILAVLLK 1033
                  + V+L+ M ++Q   G      +T IKA++L++    ++T ++ + W LA L++
Sbjct: 277  EHGNDLLSVLLARMQEEQKLDGDGEKITETDIKALLLNLFTAGTDTTSSTVEWALAELIR 336

Query: 1034 HPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCI 1213
            HP+ LK  Q E+DT +G+ R   +SD+  LPYL  V+KET R++P  P   P EA E+C 
Sbjct: 337  HPDVLKEAQHELDTVVGRGRLVSESDLPRLPYLTAVIKETFRLHPSTPLSLPREAAEECE 396

Query: 1214 VDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMT-NLEGEA-AQNRQYQFVPFGL 1387
            VDGY IPKG  L VNVW + RDP  WPDP ++ P RF+   +  +   +   +  +PFG 
Sbjct: 397  VDGYRIPKGATLLVNVWAIARDPTQWPDPLQYQPSRFLPGRMHADVDVKGADFGLIPFGA 456

Query: 1388 GRRSCPGNLYATQITQVAVARLFQGFNFSTVPN----EPLDMMEDVGIILPKLTPLEVLV 1555
            GRR C G  +  ++  +  A L  GF++ T+ N    + L+M E  G+ L +  PL V  
Sbjct: 457  GRRICAGLSWGLRMVTLMTATLVHGFDW-TLANGATPDKLNMEEAYGLTLQRAVPLMVQP 515

Query: 1556 TPRLSPTLF 1582
             PRL P+ +
Sbjct: 516  VPRLLPSAY 524



>sp|P48418|C751_PETHY Flavonoid 3',5'-hydroxylase 1 (EC 1.14.-.-)
            (F3'5'H) (Cytochrome P450 75A1)
            (CYPLXXVA1).>pir|S38985|S38985 flavonoid
            3',5'-hydroxylase Hf1 - garden
            petunia>gb:AY245545_1592552 Petunia x hybrida
            flavonoid-3',5'-hydroxylase mRNA, complete
            cds.>gb:PETHF1_1699850 Petunia hybrida F3'5'H mRNA for
            flavonoid-3',5'-hydroxylase, complete
            cds.>gb:PHFLAHYDB_1700113 P.hybrida flavonoid
            3',5'-hydroxylase mRNA.>gb:AF081575_1766556 Petunia x
            hybrida flavonoid 3',5'-hydroxylase (Hf1) gene, complete
            cds.
          Length = 506

 Score =  242 bits (617), Expect = 2e-62
 Identities = 163/511 (31%), Positives = 264/511 (51%), Gaps = 6/511 (1%)
 Frame = +2

Query: 53   SSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPV 232
            +SI  IA +++     +   + LPP   G WP+IG L     ++P V +L++ A KYG +
Sbjct: 11   TSIFLIAHIIISTLISKTTGRHLPPGPRG-WPVIGALP-LLGAMPHV-SLAKMAKKYGAI 67

Query: 233  FTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRR 412
              +++G   + V S+ +A +    T D   + RP      +L Y+     F+     W+ 
Sbjct: 68   MYLKVGTCGMAVASTPDAAKAFLKTLDINFSNRPPNAGATHLAYNAQDMVFAHYGPRWKL 127

Query: 413  VRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTL 592
            +RKL    +L  + LE   +V  +EL   +K      SM + +    +V ++        
Sbjct: 128  LRKLSNLHMLGGKALENWANVRANELGHMLK------SMSDMSREGQRVVVAEMLTFAMA 181

Query: 593  NLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEG 772
            N+I Q++  +R        +NE     K +  ++M + G F  GD I  L    W+D +G
Sbjct: 182  NMIGQVMLSKRVFVDKGVEVNE----FKDMVVELMTIAGYFNIGDFIPCL---AWMDLQG 234

Query: 773  HVKTMKRAAKDVDAILQDWVDARRK---ERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDT 943
              K MKR  K  DA+L    D  +    ER+   D  F+DV++   D+   +  S    T
Sbjct: 235  IEKRMKRLHKKFDALLTKMFDEHKATTYERKGKPD--FLDVVMENGDNSEGERLS---TT 289

Query: 944  VIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNL 1123
             IKA++L++    ++T ++ + W LA ++K+P  LK+ Q E+D  IG+ R   +SD+ NL
Sbjct: 290  NIKALLLNLFTAGTDTSSSAIEWALAEMMKNPAILKKAQAEMDQVIGRNRRLLESDIPNL 349

Query: 1124 PYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPE 1303
            PYL+ + KET R +P  P   P  + E CIVDGY+IPK T+L VN+W + RDP++W +P 
Sbjct: 350  PYLRAICKETFRKHPSTPLNLPRISNEPCIVDGYYIPKNTRLSVNIWAIGRDPQVWENPL 409

Query: 1304 KFLPERFMTNLEGEA-AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTV 1480
            +F PERF++    +   +   ++ +PFG GRR C G      + +  +  L   F++  +
Sbjct: 410  EFNPERFLSGRNSKIDPRGNDFELIPFGAGRRICAGTRMGIVMVEYILGTLVHSFDWK-L 468

Query: 1481 PNE--PLDMMEDVGIILPKLTPLEVLVTPRL 1567
            P+E   L+M E  G+ L K  PLE +VTPRL
Sbjct: 469  PSEVIELNMEEAFGLALQKAVPLEAMVTPRL 499



>gb:AF156976_1773054 Gerbera hybrida flavone synthase II (CYP93B2)
            mRNA, complete cds.
          Length = 511

 Score =  241 bits (614), Expect = 4e-62
 Identities = 152/486 (31%), Positives = 259/486 (53%), Gaps = 9/486 (1%)
 Frame = +2

Query: 101  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSS 277
            R Q+ R  P +  ++PIIGHLHH     PL+ ++    + +YG +  +RLG    +VVS+
Sbjct: 26   RNQNHRRLPPSPPSFPIIGHLHHLG---PLIHQSFHALSTRYGSLIHLRLGSVPCVVVST 82

Query: 278  WEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRL 457
             +  +D   TN+   ++R  + A  ++ Y  A F F+   +YW+ ++KL   E+L ++ L
Sbjct: 83   PDLAKDFLKTNELAFSSRKHSLAIDHITYGVA-FAFAPYGTYWKFIKKLFTVELLGTQNL 141

Query: 458  EKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYR 637
                 +   E++  ++ L         + +  +VN++     LT N+I Q++       R
Sbjct: 142  SHFLPIRTHEIRELLRTLMV------KSRAKERVNLTEELLKLTNNVISQMMMS----IR 191

Query: 638  SDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAI 817
              GT N EA   K +  +V  ++G+F   D I   WF + +D +G  K  +   +  DA+
Sbjct: 192  CSGT-NSEADEAKNLVREVTKIFGQFNVSDFI---WFCKNIDLQGFKKRYEGTHRRYDAL 247

Query: 818  LQDWVDARRKERR-----SNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDA 982
            L+  +  R + RR       E + F+D++L +++D   +    +RD  IKA++L  L   
Sbjct: 248  LERIIMGREENRRRGKIKDGEGKDFLDMLLDVLEDGKAE-IKITRDH-IKALILDFLTAG 305

Query: 983  SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM 1162
            ++T A  + W L  L+ +P +L++ + EID  IG ER  ++SD  NLPY+Q ++KE LR+
Sbjct: 306  TDTTAIAIEWALVELINNPNALEKARQEIDQVIGDERLVQESDTPNLPYIQAIIKEALRL 365

Query: 1163 YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG 1342
            +P  P L   ++ E+ IV GY IP GT L+VN+W + R+P+ W  P +F P RF+   + 
Sbjct: 366  HPPIPMLI-RKSTENVIVQGYDIPAGTLLFVNIWSIGRNPQCWETPLEFKPHRFLDGGDL 424

Query: 1343 EAA---QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDV 1513
            +++   +   +Q +PFG GRR CPG   A +   V +A L Q F++  V    L+  E  
Sbjct: 425  KSSLDIKGHNFQLLPFGTGRRGCPGVNLAMRELSVVIANLIQCFDWDVVGERLLNTDERA 484

Query: 1514 GIILPK 1531
            G+  P+
Sbjct: 485  GLTAPR 490



>gb:AF082028_1766570 Hemerocallis hybrid cultivar
            senescence-associated protein 3 (SA3) mRNA, partial cds.
          Length = 372

 Score =  240 bits (613), Expect = 6e-62
 Identities = 142/379 (37%), Positives = 208/379 (54%)
 Frame = +2

Query: 434  EILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIV 613
            EI S  R+  L  V   E++  I  +    S DN+     KVNM   F  L  N+IM+I+
Sbjct: 3    EIFSPVRIRSLAAVRQEEVKLMITGILASTSTDNS----VKVNMKVVFSELMFNVIMKII 58

Query: 614  AGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKR 793
            AG+RY   +  +  EE Q+ + VF + M+   E  S     P  F +W  ++     + +
Sbjct: 59   AGKRYFGVNTDSEVEEGQKFRVVFDE-MFSTLEVASPQDFLP--FLKWFGFKRMENRLTK 115

Query: 794  AAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSML 973
             AK++D + Q  ++ RR ER        IDV+LS+   Q T    YS D +IK ++LS++
Sbjct: 116  LAKELDQLFQKLIEERRSER-GKVQSTVIDVLLSL---QETDREQYS-DKLIKGMILSLI 170

Query: 974  QDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKET 1153
               + T A  + W +++LL HPE+L +V+DEID  +G++R  + SD++NL YL   +KE+
Sbjct: 171  AAGTHTTAGTMEWAMSLLLNHPEALLKVRDEIDKKVGQDRLIDHSDLQNLSYLNNAIKES 230

Query: 1154 LRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTN 1333
            LR++P  P L  HE+  +C V G+ IP  T L+ N + LHRDPK+W DP  F PERF  N
Sbjct: 231  LRLFPTAPLLLAHESSAECTVGGFTIPSNTILFANAYALHRDPKVWTDPVSFKPERFENN 290

Query: 1334 LEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDV 1513
                  Q     +VPFGLGRRSCPG   ATQ+  +A+  L Q F +     E +DM +  
Sbjct: 291  -----GQQGSRIYVPFGLGRRSCPGEGLATQVVGLALGTLIQCFEWDRNGEEKVDMTDGS 345

Query: 1514 GIILPKLTPLEVLVTPRLS 1570
            G+ +    PLE +  PR S
Sbjct: 346  GLAMHMEKPLEAMCKPRQS 364



>gb:AY463157_1607680 Ipomoea quamoclit flavonoid 3'-hydroxylase mRNA,
            complete cds.
          Length = 519

 Score =  240 bits (612), Expect = 7e-62
 Identities = 149/520 (28%), Positives = 250/520 (48%), Gaps = 17/520 (3%)
 Frame = +2

Query: 80   VLLWFSWRKQSKRLP---PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLG 250
            + L+F   +  +R P   P     WP++G+L H        ++++  A KYGP+  +RLG
Sbjct: 15   IFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPH--QSIAAMAQKYGPLMHLRLG 72

Query: 251  ISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVV 430
               ++V +S          +D   ++RP     +++ Y+Y    F+     WR +RK+  
Sbjct: 73   FVDVVVAASAAVAAQFLKVHDANFSSRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITS 132

Query: 431  EEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQI 610
              + S++ L+   HV   E+ T  + L +             V + +     T N + ++
Sbjct: 133  VHLFSAKALDDFSHVRQEEVATLTRSLAS--------AGKTPVKLGQLLNVCTTNALARV 184

Query: 611  VAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMK 790
            + GR+         + +A+  K +  ++M L G F  GD I  L    W D +G V  MK
Sbjct: 185  MLGRKVFNDGSSKSDPKAEEFKSMVEEMMVLAGSFNLGDFIPVLG---WFDLQGIVGKMK 241

Query: 791  RAAKDVDA----ILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSR--DTVIK 952
            +     DA    IL++      +   S++D  F+  +L + D          +  DT IK
Sbjct: 242  KLHARFDAFLNAILEEHKFVNNQHTTSSKDVDFLSTLLRLRDSGADMDGEEGKLTDTEIK 301

Query: 953  AIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYL 1132
            A++L++    ++T ++ + W  A LL++P+ L + Q E+D  +G  R   +SD+  LP+L
Sbjct: 302  ALLLNLFTAGTDTSSSTVEWAFAELLRNPKILSQAQQELDLVVGTNRLVTESDLTQLPFL 361

Query: 1133 QGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFL 1312
            Q +VKET R++P  P   P    E C ++GY IPKG  L VNVW + RDP  W +P +F 
Sbjct: 362  QAIVKETFRLHPSTPLSLPRIGAESCEINGYFIPKGATLLVNVWAIARDPNAWTNPLQFN 421

Query: 1313 PERFM-----TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST 1477
            P RF+     TN++    +   ++ +PFG GRR C G     ++  + +A L   F++  
Sbjct: 422  PNRFLPGGEKTNVD---IKGNDFEVIPFGAGRRICSGMSLGIRMVHLLIATLVHAFDWDL 478

Query: 1478 VPN---EPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFRL 1588
            V     E L+M E  G+ L +  PL +   PRL P L+ L
Sbjct: 479  VNGQSVETLNMEESYGLTLQRAVPLMLHPKPRLQPHLYTL 518



>sp|Q42799|C932_SOYBN Cytochrome P450 93A2 (EC
            1.14.-.-).>pir|T07141|T07141 cytochrome P450 CYP93A2 -
            soybean>gb:D86351_1674983 Glycine max CYP93A2 mRNA for
            cytochrome P-450, complete cds.
          Length = 502

 Score =  240 bits (612), Expect = 7e-62
 Identities = 157/512 (30%), Positives = 269/512 (52%), Gaps = 10/512 (1%)
 Frame = +2

Query: 68   IAALVLLWFSWRKQ-SKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIR 244
            ++++V  +  WRK+  K+LPP   G  PIIGHLH   + +P  +   + + ++GP+  + 
Sbjct: 11   VSSIVFAYIVWRKERKKKLPPSPKGL-PIIGHLH-LVSPIPH-QDFYKLSLRHGPIMQLF 67

Query: 245  LGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKL 424
            LG    +V S+ EA ++   T++   + RP    G+ +   +  + F       + ++KL
Sbjct: 68   LGSVPCVVASTAEAAKEFLKTHEINFSNRP----GQNVAVQFLTYVFGPYGPSVKFIKKL 123

Query: 425  VVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIM 604
             + E+L  R L++   V   E +  IK +           +   V+    F  L+ N+I 
Sbjct: 124  CMSELLGGRMLDQFLPVRQQETKKFIKRVL------QKGIAGEAVDFGGEFMRLSNNIIS 177

Query: 605  QIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKT 784
            ++   +     +     ++A+ ++ + + V  L G F   D I   WF +  D +G  K 
Sbjct: 178  RMTMNQ-----TSSEDEKQAEEMRMLVADVAELMGTFNVSDFI---WFLKPFDLQGFNKR 229

Query: 785  MKRAAKDVDAILQDWVDARRKERRSNED-------QKFIDVMLSMIDDQFTQGYSYSRDT 943
            +++     DA+L   +  R +ERR+N++       +  +DV+L + +D  ++    +++ 
Sbjct: 230  IRKTRIRFDAVLDRIIKQREEERRNNKEIGGTRQFKDILDVLLDIGEDDSSE-IKLTKEN 288

Query: 944  VIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNL 1123
             IKA ++ +    ++T A  + W +A L+ +P  L++ + EID  +G  R  E+SD+ NL
Sbjct: 289  -IKAFIMDIFVAGTDTSAATMEWAMAELINNPCVLEKARQEIDAVVGNSRIIEESDIVNL 347

Query: 1124 PYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPE 1303
            PYLQ +V+ETLR++P GP L   E+ +  +V GY IP  T+L+VNVW + RDP  W +P 
Sbjct: 348  PYLQAIVRETLRIHPGGP-LIVRESSKSVVVCGYEIPAKTRLFVNVWAIGRDPNHWENPF 406

Query: 1304 KFLPERFMTNLEGEA-AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFS-T 1477
            +F PERF  N + +   + + Y F+PFG GRRSCPG   A QI  V +A + Q F +   
Sbjct: 407  EFRPERFFENGQSQLDVRGQHYHFIPFGSGRRSCPGTSLALQIVHVNLAIMIQCFQWKFD 466

Query: 1478 VPNEPLDMMEDVGIILPKLTPLEVLVTPRLSP 1573
              N  +DM E  GI LP+  P+  +  PRL+P
Sbjct: 467  NGNNKVDMEEKSGITLPRAHPIICVPVPRLNP 498



>gb:AP005846_1858998 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:B1307A11.
          Length = 511

 Score =  239 bits (611), Expect = 1e-61
 Identities = 161/527 (30%), Positives = 272/527 (51%), Gaps = 17/527 (3%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFS----WRKQSKRLPPEAGGAW--PIIGHLHHFRTSVPLVKTLSEW 211
            L S L +A L ++  +     +KQ+    P   G W  P+IG +HH    +   + L + 
Sbjct: 10   LLSALAVAVLQIVKLAVVNRGKKQAAAAAPTPPGPWRLPVIGSMHHLAGKLAH-RALRDL 68

Query: 212  ADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFST 391
            A  +GP+  ++LG + ++VVSS E  R+   T+D   A RP   AG+ + Y  A   FS 
Sbjct: 69   AAVHGPLMMLQLGETPLVVVSSREVAREVLRTHDANFATRPRLLAGEVVLYGGADILFSP 128

Query: 392  NNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSR 571
            +  YWR++R+L   E+L  +R+   +H+   E+ + ++ +          PS P V++S 
Sbjct: 129  SGEYWRKLRQLCAAEVLGPKRVLSFRHIREQEMASRVERIRAV------GPSVP-VDVSA 181

Query: 572  WFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF 751
             F  + ++++     G++         +E    +K   S    L   F   D +FP W  
Sbjct: 182  LFYDMAISIVSCASFGKKQR-----NADEYLSAIKTGIS----LASGFKIPD-LFPTWRT 231

Query: 752  RWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRS--------NEDQKFIDVMLSMIDD 907
                  G  + ++   + VD+ L++ ++ RR   R         + ++  +DV++ + + 
Sbjct: 232  VLAAVTGMRRALENVHRIVDSTLEEVIEERRGAARECKGRLDMEDNEENLVDVLIKLHE- 290

Query: 908  QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEI-DTNIG 1084
               QG   SR++ IK+++  M    + T A+ L W ++ L+++P  + ++Q EI +   G
Sbjct: 291  ---QGGHLSRNS-IKSVIFDMFTAGTGTLASSLNWGMSELMRNPRVMTKLQGEIREAFHG 346

Query: 1085 KERWAE-DSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNV 1261
            K    E D  V NLPYL+  +KETLR++P  P L P E+++ C V+GY IP  +++ VN 
Sbjct: 347  KATVGEGDIQVSNLPYLRLFIKETLRLHPPVPLLVPRESIDMCEVNGYTIPARSRIVVNA 406

Query: 1262 WRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVA 1441
            W + RDPK W DPE+F PERF  N    A  +  Y+++PFG GRR CPG  YA  + ++A
Sbjct: 407  WAIGRDPKYWDDPEEFKPERFEGNKVDFAGTS--YEYLPFGAGRRICPGITYALPVLEIA 464

Query: 1442 VARLFQGFNFSTVPN-EPLDMMEDVGIILPKLTPLEVLVTPRLSPTL 1579
            + +L   FN+S       +DM E+ G+   ++TPL +  TP + P L
Sbjct: 465  LVQLLYHFNWSLPKGVTEVDMEEEPGLGARRMTPLLLFATPFVVPLL 511



>gb:AF313490_1785223 Lycianthes rantonnei flavonoid 3',5'-hydroxylase
            mRNA, complete cds.
          Length = 511

 Score =  239 bits (610), Expect = 1e-61
 Identities = 168/517 (32%), Positives = 267/517 (51%), Gaps = 10/517 (1%)
 Frame = +2

Query: 47   CLSSILGIAALV----LLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWA 214
            C S+I+ I   +    L+   W ++ +RLPP   G WP+IG L    T +P V  L++ A
Sbjct: 10   CASAIIFIIVHIIISKLIATGWGRR-QRLPPGPMG-WPVIGALPLLGT-MPHV-ALAKMA 65

Query: 215  DKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTN 394
             KYGP+  +++G   ++V S+  A +    T D   + RP      +L YD     F+  
Sbjct: 66   KKYGPIMYLKVGTCGMVVASTPNAAKAFLKTLDINFSNRPPNAGATHLAYDAQDMVFAHY 125

Query: 395  NSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRW 574
               W+ +RKL    +L  + LE   +V  +EL   +K      SM + +    +V ++  
Sbjct: 126  GPRWKLLRKLSNLHMLGGKALEDWANVRANELGHMLK------SMFDASRVGGRVVVADM 179

Query: 575  FGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR 754
                  N+I Q++  +R        +N    + K +  ++M + G F  GD I  L    
Sbjct: 180  LTFAMANMIGQVILSKRVFVEKGAEVN----KFKDMVVELMTVAGYFNIGDFIPQL---A 232

Query: 755  WLDYEGHVKTMKRAAKDVDAILQDWVD---ARRKERRSNEDQKFIDVMLSMIDDQFTQGY 925
            W+D +G  K MK   K  D +L    D   A   ER+   D  F+DV+++  D+  ++G 
Sbjct: 233  WMDLQGIEKGMKCLHKKFDDLLTKMFDEHKATTNERKGKPD--FLDVVMANRDN--SEGE 288

Query: 926  SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED 1105
              S +  IKA++L++    ++T ++ + W LA ++K+P+ LK+VQ E+D  IGK R   +
Sbjct: 289  RLSTNN-IKALLLNLFTAGTDTSSSAIEWALAEMMKNPQILKKVQQEMDQIIGKNRRLIE 347

Query: 1106 SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK 1285
            SD+ NLPYL+ V KET R +P  P   P  + E C+VDGY+IPK  +L VN+W + RDP 
Sbjct: 348  SDIPNLPYLRAVCKETFRKHPSTPLNLPRISNEPCMVDGYYIPKNIRLSVNIWAIGRDPD 407

Query: 1286 IWPDPEKFLPERFMTNLEGEA-AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQG 1462
            +W +P +F PERF++    +   +   ++ +PFG GRR C G      + +  +  L   
Sbjct: 408  VWENPLEFNPERFLSGKNVKIDPRGNDFELIPFGAGRRICAGTRMGIVMVEYILGTLVHS 467

Query: 1463 FN--FSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRL 1567
            F+  FS    E ++M E  G+ L K  PLE +VTPRL
Sbjct: 468  FDWKFSNDVKE-INMEESFGLALQKAVPLEAMVTPRL 503



>gb:CRO011862_1673459 Catharanthus roseus mRNA for flavonoid
            3',5'-hydroxylase.
          Length = 512

 Score =  239 bits (609), Expect = 2e-61
 Identities = 155/520 (29%), Positives = 262/520 (50%), Gaps = 4/520 (0%)
 Frame = +2

Query: 20   KCVMDAVPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKT 199
            K V+      +S ++ +   + + F       RLPP   G WPIIG L +  T    +  
Sbjct: 5    KLVLFDFLAAISILILVQKFIQIVFLRSSSRIRLPPGPKG-WPIIGALPYLGTMPHSI-- 61

Query: 200  LSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVF 379
            L+  A KYGP+  ++LG + ++V S+ +AV+    T D   + RP      +L Y+    
Sbjct: 62   LANMAKKYGPIMYLKLGTNGMVVASTPDAVKAFLRTLDMNFSNRPIDAGATHLAYNAQDM 121

Query: 380  TFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKV 559
             F+     W+ +RKL    +L  + LE   +V  +EL   ++ +Y       ++     V
Sbjct: 122  VFAHYGPKWKLLRKLSNLHMLGGKALENWSNVRATELGYMLQAMY------ESSRKGETV 175

Query: 560  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFP 739
             +     +   N+I Q++  RR       T + E+   K +  ++M   G F  GD I  
Sbjct: 176  VVPEMLTYAMANMIGQVILSRRVFV----TKSLESNEFKDMVVELMTTAGYFNIGDFIPS 231

Query: 740  LWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKE-RRSNEDQKFIDVMLSMIDDQFT 916
            +    W+D +G  + MKR  K  DA+L   ++  +    +  E   F+D +L+  D+   
Sbjct: 232  I---AWMDLQGIERGMKRLHKKFDALLTKMLEEHKSSSHKRKEKPDFLDYVLANRDNSEG 288

Query: 917  QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW 1096
            +  +    T IKA++L++    ++T ++ + W ++ +LK+P  LKR Q+E+D  IG+ R 
Sbjct: 289  ERLT---TTNIKALLLNLFTAGTDTSSSVIEWAISEMLKNPTILKRAQEEMDQVIGRNRR 345

Query: 1097 AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR 1276
              +SD+  LPYLQ + KET R +P  P   P  A +DC V+GY+IPKGT+L VN+W + R
Sbjct: 346  LMESDIPKLPYLQAICKETFRKHPSTPLNLPRIAQKDCQVNGYYIPKGTRLSVNIWAIGR 405

Query: 1277 DPKIWPDPEKFLPERFMTNLEGE-AAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL 1453
            DP +W +P +F P+RF++    +   +   ++ +PFG GRR C G      + +  +  L
Sbjct: 406  DPNVWENPLEFNPDRFLSGKMAKIEPRGNDFELIPFGAGRRICAGTRMGIVLVEYILGTL 465

Query: 1454 FQGFNFSTVPNE--PLDMMEDVGIILPKLTPLEVLVTPRL 1567
               F++    ++   L+M E  G+ L K  PL  +V+PRL
Sbjct: 466  VHSFDWKLPFDDINELNMDESFGLALQKAVPLVAMVSPRL 505



>sp|P48419|C753_PETHY Flavonoid 3',5'-hydroxylase 2 (EC 1.14.-.-)
            (F3'5'H) (Cytochrome P450 75A3)
            (CYPLXXVA3).>pir|S38984|S38984 flavonoid
            3',5'-hydroxylase Hf2 - garden petunia>gb:A29013_1448321
            pCGP175 DNA for dehydrokaempferol hydroxylating enzyme
            from patent EP0522880.>gb:PHFLAHYDA_1700112 P.hybrida
            flavonoid 3',5'-hydroxylase mRNA.
          Length = 508

 Score =  238 bits (608), Expect = 2e-61
 Identities = 159/491 (32%), Positives = 253/491 (51%), Gaps = 6/491 (1%)
 Frame = +2

Query: 113  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVR 292
            +RLPP   G WP+IG L     ++P V +L++ A KYG +  +++G   ++V S+ +A +
Sbjct: 31   RRLPPGPRG-WPVIGALP-LLGAMPHV-SLAKMAKKYGAIMYLKVGTCGMVVASTPDAAK 87

Query: 293  DCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKH 472
                T D   + RP      +L Y      F+     W+ +RKL    +L  + LE   +
Sbjct: 88   AFLKTLDLNFSNRPPNAGATHLAYGAQDMVFAHYGPRWKLLRKLSNLHMLGGKALENWAN 147

Query: 473  VWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTI 652
            V  +EL   +K      SM + +    +V ++        N+I Q++  +R        +
Sbjct: 148  VRANELGHMLK------SMFDMSREGERVVVAEMLTFAMANMIGQVILSKRVFVNKGVEV 201

Query: 653  NEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWV 832
            NE     K +  ++M   G F  GD I  L    W+D +G  K MKR  K  DA+L    
Sbjct: 202  NE----FKDMVVELMTTAGYFNIGDFIPCL---AWMDLQGIEKGMKRLHKKFDALLTKMF 254

Query: 833  DARRK---ERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATH 1003
            D  +    ER+   D  F+D ++   D+   +  S    T IKA++L++    ++T ++ 
Sbjct: 255  DEHKATSYERKGKPD--FLDCVMENRDNSEGERLS---TTNIKALLLNLFTAGTDTSSSA 309

Query: 1004 LTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYL 1183
            + W LA ++K+P  LK+ Q E+D  IG  R   +SD+ NLPYL+ + KET R +P  P  
Sbjct: 310  IEWALAEMMKNPAILKKAQGEMDQVIGNNRRLLESDIPNLPYLRAICKETFRKHPSTPLN 369

Query: 1184 APHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEA-AQNR 1360
             P  + E CIVDGY+IPK T+L VN+W + RDP++W +P +F PERF++    +   +  
Sbjct: 370  LPRISNEPCIVDGYYIPKNTRLSVNIWAIGRDPEVWENPLEFYPERFLSGRNSKIDPRGN 429

Query: 1361 QYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNE--PLDMMEDVGIILPKL 1534
             ++ +PFG GRR C G      + +  +  L   F++  +P+E   L+M E  G+ L K 
Sbjct: 430  DFELIPFGAGRRICAGTRMGIVMVEYILGTLVHSFDWK-LPSEVIELNMEEAFGLALQKA 488

Query: 1535 TPLEVLVTPRL 1567
             PLE +VTPRL
Sbjct: 489  VPLEAMVTPRL 499



>gb:AX028819_1457169 Sequence 3 from Patent WO9732023.
          Length = 496

 Score =  238 bits (607), Expect = 3e-61
 Identities = 144/487 (29%), Positives = 244/487 (50%), Gaps = 5/487 (1%)
 Frame = +2

Query: 98   WRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSS 277
            +R   K LPP     WPI+G+L H   +    + L+  A KYGP+  +RLG   ++V +S
Sbjct: 12   FRGHQKPLPP-GPRPWPIVGNLPHMGQAPH--QGLAALAQKYGPLLYMRLGYVDVVVAAS 68

Query: 278  WEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRL 457
                     T+D   ++RP     K++ Y+Y    F+     WR +RK+    + SS+ L
Sbjct: 69   ASVATQFLKTHDLNFSSRPPNSGAKHIAYNYQDLVFAPYGPKWRMLRKICSLHMFSSKAL 128

Query: 458  EKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYR 637
            +  + V     Q  +  L   I+     P    V + +     T N + +++ G+R    
Sbjct: 129  DDFRLV----RQEEVSILVNAIAKAGTKP----VQLGQLLNVCTTNALSRVMLGKRVLGD 180

Query: 638  SDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAI 817
              G  + +A+  K +  ++M L G F  GD +  L     LD +G    MK+  K +D  
Sbjct: 181  GTGKSDPKAEEFKDMVLELMVLTGVFNIGDFVPAL---ECLDLQGVASKMKKLHKRLDNF 237

Query: 818  LQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFA 997
            + + ++  +           + +++S+ D+   +G  +S  T IKA++L +    ++T +
Sbjct: 238  MSNILEEHKSVAHQQNGGDLLSILISLKDNCDGEGGKFSA-TEIKALLLDLFTAGTDTSS 296

Query: 998  THLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGP 1177
            +   W +A L++HP+ L +VQ E+D+ +G++R   ++D+ NL Y Q V+KE  R++P  P
Sbjct: 297  STTEWAIAELIRHPKILAQVQQEMDSVVGRDRLIAEADIPNLTYFQAVIKEVFRLHPSTP 356

Query: 1178 YLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLE--GEAA 1351
               P  A E C ++GYHIPK T L VNVW + RDP++W DP +F PERF+   E      
Sbjct: 357  LSLPRVANESCEINGYHIPKNTTLLVNVWAIARDPEVWADPLEFKPERFLPGGEKPNVDV 416

Query: 1352 QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN---EPLDMMEDVGII 1522
            +   ++ +PFG GRR C G     ++ Q+  A L   ++++       E L+M E  G+ 
Sbjct: 417  KGNDFELIPFGAGRRICAGLSLGLRMVQLMTATLAHTYDWALADGLMPEKLNMDEAYGLT 476

Query: 1523 LPKLTPL 1543
            L +  PL
Sbjct: 477  LQRKVPL 483



>sp|O81973|C933_SOYBN Cytochrome P450 93A3 (EC 1.14.-.-) (P450
            CP5).>pir|T07119|T07119 cytochrome P450 CP5 -
            soybean>gb:GMC450CP5_1680416 G.max mRNA for putative
            cytochrome P450, clone CP5.
          Length = 510

 Score =  238 bits (607), Expect = 3e-61
 Identities = 156/514 (30%), Positives = 264/514 (51%), Gaps = 12/514 (2%)
 Frame = +2

Query: 68   IAALVLLWFSWRKQSKR--LPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTI 241
            I+ +V     WRKQ+K   L P +    PIIGHLH    +    +   + + +YGP+  +
Sbjct: 11   ISTIVFASILWRKQNKNKTLLPPSPMPLPIIGHLHLLSPTPH--QDFHKLSLRYGPIIHL 68

Query: 242  RLGISRILVVSSWEAVRDCFATNDKLLAARPT-TCAGKYLGYDYAVFTFSTNNSYWRRVR 418
             LG    +V S+ EA ++   T++   + RP  T A + L Y +  F F+    YW+ ++
Sbjct: 69   FLGSVPCVVASTAEAAKEFLKTHEPAFSNRPANTVAVETLTYGFQDFLFAPYGPYWKFMK 128

Query: 419  KLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNL 598
            KL + E+L    L++   V   E +  IK +           S   V+    F  L+ N+
Sbjct: 129  KLCMSELLGGHMLDQFLPVRQXETKKFIKRVL------QKGISGEAVDFGGEFITLSNNI 182

Query: 599  IMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHV 778
            + +++  +      +  + E    ++K+      L G+F   D +    F +  D +G  
Sbjct: 183  VSRMIVSQTSTTEDENEVEE----MRKLVKDAAELSGKFNISDFVS---FLKRFDLQGFN 235

Query: 779  KTMKRAAKDVDAILQDWVDARRKERRSNED-------QKFIDVMLSMIDDQFTQGYSYSR 937
            K +++     D +L   +  R +ERR+  +       +  +DV+  + +D+ ++    ++
Sbjct: 236  KRLEKIRDCFDTVLDRIIKQREEERRNKNETVGKREFKDMLDVLFDISEDESSE-IKLNK 294

Query: 938  DTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVK 1117
            +  IKA +L +L   ++T A  + W +A L+ +P  L++ + E+D  +GK R  E+SD+ 
Sbjct: 295  EN-IKAFILDILIAGTDTSAVTMEWAMAELINNPGVLEKARQEMDAVVGKSRIVEESDIA 353

Query: 1118 NLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPD 1297
            NLPYLQG+V+ETLR++P GP L   E+    +V GY IP  T+L+VNVW + RDP  W +
Sbjct: 354  NLPYLQGIVRETLRLHPAGPLLF-RESSRRAVVCGYDIPAKTRLFVNVWAIGRDPNHWEN 412

Query: 1298 PEKFLPERFMTNLEGEA-AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFS 1474
            P +F PERF+ N + +   + + Y  +PFG GRR+CPG   A Q+  V +A L Q F + 
Sbjct: 413  PLEFRPERFVENGKSQLDVRGQHYHLLPFGSGRRACPGTSLALQVVHVNLAVLIQCFQWK 472

Query: 1475 T-VPNEPLDMMEDVGIILPKLTPLEVLVTPRLSP 1573
                N  ++M E  GI LP+  P+  +   RL+P
Sbjct: 473  VDCDNGKVNMEEKAGITLPRAHPIICVPIRRLNP 506



>sp|P37118|C712_SOLME Cytochrome P450 71A2 (EC 1.14.-.-) (CYPLXXIA2)
            (P-450EG4).>pir|S36806|S36806 cytochrome P450 71A2 -
            eggplant>gb:POTCPEG4_1701083 Eggplant mRNA for cytochrome
            P-450EG4, complete cds.>gb:SMCYP71B3_1715485 S.melongena
            CYP71A2 mRNA for hydroxylase.
          Length = 505

 Score =  237 bits (605), Expect = 5e-61
 Identities = 168/528 (31%), Positives = 274/528 (51%), Gaps = 20/528 (3%)
 Frame = +2

Query: 38   VPCCLSSILGIAALVLLW-------FSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVK 196
            VPC   S+L I   V ++       F+  K+   L   +    PIIG+LH    S+P  +
Sbjct: 3    VPCPWYSLL-IPLFVFIFLLIHHCFFTTSKKQNMLLLPSPRKLPIIGNLHQLG-SLPH-R 59

Query: 197  TLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAV 376
            +L + + KYGPV  +  G   ++V SS +A RD   T+D + A+RP +     L Y    
Sbjct: 60   SLHKLSQKYGPVMLLHFGSKPVIVASSVDAARDIMKTHDVVWASRPKSSIVDRLSYGSKD 119

Query: 377  FTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPK 556
              FS    YWRR + + V  +LS+ R++  ++V   E    I ++            +  
Sbjct: 120  VGFSPFGEYWRRAKSITVLHLLSNTRVQSYRNVRAEETANMIGKI-------RQGCDSSV 172

Query: 557  VNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIF 736
            +N+      LT N+I ++  GR Y+ +  G        ++ +  Q + L G F  GD I 
Sbjct: 173  INLGEHLCSLTNNIISRVALGRTYDEKESG--------IEHIIEQFVELLGIFNVGDYIP 224

Query: 737  PLWFFRWLD-YEGHVKTMKRAAKDVD----AILQDWVDARRKER--RSNEDQKFIDVMLS 895
             L    W++ + G    +K+ AK++D     ++++ +  ++KE    + E + F+DV+L 
Sbjct: 225  RL---EWVNKFTGLDAKVKKVAKELDMFLEIVIEEHIIRKKKEEYTSTGEAKDFVDVLLE 281

Query: 896  MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEI-D 1072
            + +   T  +   RD+ +KAI+L      ++T    L W +A LL+ P +LK +QDE+  
Sbjct: 282  IQNGNETD-FPLQRDS-LKAILLDSFAAGTDTTFATLDWTMAELLRQPRALKTLQDEVRG 339

Query: 1073 TNIGKERWAEDSDVKNLPYLQGVVKETLRMYP-QGPYLAPHEAVEDCIVDG-YHIPKGTQ 1246
               GK    ED D+KN+ YL+ V+KE+LR++P Q   L P E++ED  + G YHIP  TQ
Sbjct: 340  LAQGKSEITED-DLKNMQYLRAVIKESLRLHPTQESLLVPRESMEDVNLLGYYHIPARTQ 398

Query: 1247 LYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQ 1426
              +N W + RDP  W +PE++ PERF+ +      +   ++ +PFG GRR CPG+ +A  
Sbjct: 399  AIINAWAIGRDPLSWENPEEYQPERFLNS--DADVKGLNFKLLPFGAGRRGCPGSSFAIA 456

Query: 1427 ITQVAVARLFQGFNFST---VPNEPLDMMEDVGIILPKLTPLEVLVTP 1561
            + ++A+ARL   F+F+    +  E LDM E +GI   +  PL V+ TP
Sbjct: 457  VIELALARLVHKFDFALPEGIKPEDLDMTETIGITTRRKLPLLVVATP 504



>gb:AB078514_1523730 Nierembergia sp. NB17 f3',5'h mRNA for flavonoid
            3',5'-hydroxylase, complete cds.
          Length = 503

 Score =  236 bits (603), Expect = 8e-61
 Identities = 163/513 (31%), Positives = 262/513 (51%), Gaps = 7/513 (1%)
 Frame = +2

Query: 50   LSSILGIAALVLLW---FSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADK 220
            LS+ L IAA++ L       +   +RLPP   G WP+IG L      +P V +L++ A K
Sbjct: 4    LSTELAIAAIIFLLAHILISKTSGRRLPPGPRG-WPVIGALP-LLGDMPHV-SLAKMAKK 60

Query: 221  YGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNS 400
            YGP+  +++G   + V S+  A +    T D   + RP      +  Y+     F+    
Sbjct: 61   YGPIMYLKVGTCGMAVASTPHAAKAFLKTLDINFSNRPPNAGATHFAYNAQDMVFAPYGP 120

Query: 401  YWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFG 580
             W+ +RKL    +L  + LE   +V  +EL   +K      SM + +    +V ++    
Sbjct: 121  RWKLLRKLSNLHMLGGKALEDWSNVRANELGHMLK------SMLDLSREGQRVVIADMLT 174

Query: 581  HLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWL 760
                N+I Q++  +R        +NE     K +  ++M + G F  GD I  L    WL
Sbjct: 175  FAMANMIGQVILSKRVFVDKGVEVNE----FKNMVVELMTVAGYFNIGDYIPCL---AWL 227

Query: 761  DYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQK-FIDVMLSMIDDQFTQGYSYSR 937
            D +G  K MK   K  D +L    D  +      E +  F+D++++  D+   +  S   
Sbjct: 228  DLQGIEKGMKILHKKFDVLLTKMFDEHKTTSHEREGKSDFLDMVMANRDNSEGERLS--- 284

Query: 938  DTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVK 1117
             T IKA++L++    ++T ++ + W L  +LK+P  LK+ Q E+D  IGK R   +SD+ 
Sbjct: 285  TTNIKALLLNLFTAGTDTSSSVIEWALTEMLKNPSILKKAQVEMDQVIGKNRRLLESDIS 344

Query: 1118 NLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPD 1297
            NLPYL+ + KET R +P  P   P  + E C VDGY+IPK T+L VN+W + RDP +W +
Sbjct: 345  NLPYLRAICKETFRKHPSTPLNLPRISSESCEVDGYYIPKNTRLSVNIWAIGRDPDVWEN 404

Query: 1298 PEKFLPERFMTNLEGEA-AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFS 1474
            P KF PERF++    +   +   ++ +PFG GRR C G      + +  +  L   F++ 
Sbjct: 405  PLKFNPERFLSGKYAKIDPRGNDFELIPFGAGRRICAGTRMGIVMVEYILGTLVHSFDWK 464

Query: 1475 TVPNEPLDM-MEDV-GIILPKLTPLEVLVTPRL 1567
             +P++ +++ ME+V G+ L K  PLE +VTPRL
Sbjct: 465  -LPSDVIELNMEEVFGLALQKAVPLEAMVTPRL 496



>sp|P37120|C752_SOLME Flavonoid 3',5'-hydroxylase (EC 1.14.-.-)
            (F3'5'H) (Cytochrome P450 75A2) (CYPLXXVA2)
            (P-450EG1).>pir|S43342|S43342 flavonoid 3',5'-hydroxylase
            (EC 1.14.-.-) cytochrome P450 -
            eggplant>gb:SMPEG1_1715518 S.melongena pEG1 mRNA for
            hydroxylase P450.
          Length = 513

 Score =  236 bits (602), Expect = 1e-60
 Identities = 154/503 (30%), Positives = 258/503 (51%), Gaps = 6/503 (1%)
 Frame = +2

Query: 95   SWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVS 274
            SWR+  +RLPP   G WP+IG L      +P V  L++ A KYGP+  +++G   ++V S
Sbjct: 30   SWRR--RRLPPGPEG-WPVIGALP-LLGGMPHV-ALAKMAKKYGPIMYLKVGTCGMVVAS 84

Query: 275  SWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRR 454
            +  A +    T D   + RP      ++ Y+     F+     W+ +RKL    +L  + 
Sbjct: 85   TPNAAKAFLKTLDINFSNRPPNAGATHMAYNAQDMVFAPYGPRWKLLRKLSNLHMLGGKA 144

Query: 455  LEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEY 634
            LE   +V  +EL   +K      SM + +    ++ ++        N+I Q++  +R   
Sbjct: 145  LENWANVRANELGHMLK------SMFDASHVGERIVVADMLTFAMANMIGQVMLSKRVFV 198

Query: 635  RSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDA 814
                 +NE     K +  ++M + G F  GD I  +    W+D +G  K MK+  K  D 
Sbjct: 199  EKGKEVNE----FKNMVVELMTVAGYFNIGDFIPQI---AWMDLQGIEKGMKKLHKKFDD 251

Query: 815  ILQDWVD---ARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDAS 985
            +L    +   A   ER+   D  F+D +++  D+   +  S    T IKA++L++    +
Sbjct: 252  LLTKMFEEHEATSNERKGKPD--FLDFIMANRDNSEGERLSI---TNIKALLLNLFTAGT 306

Query: 986  ETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMY 1165
            +T ++ + W L  ++K+P   K+ Q E+D  IGK R   +SD+ NLPYL+ + KE  R +
Sbjct: 307  DTSSSVIEWALTEMMKNPTIFKKAQQEMDQIIGKNRRFIESDIPNLPYLRAICKEAFRKH 366

Query: 1166 PQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGE 1345
            P  P   P  + + C +DGY+IPK T+L VN+W + RDP +W +P +F+PERF++    +
Sbjct: 367  PSTPLNLPRVSSDACTIDGYYIPKNTRLSVNIWAIGRDPDVWENPLEFIPERFLSEKNAK 426

Query: 1346 AA-QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLD--MMEDVG 1516
               +   ++ +PFG GRR C G      + +  +  L   F++  +PN+ +D  M E  G
Sbjct: 427  IEHRGNDFELIPFGAGRRICAGTRMGIVMVEYILGTLIHSFDWK-LPNDVVDINMEETFG 485

Query: 1517 IILPKLTPLEVLVTPRLSPTLFR 1585
            + L K  PLE +VTPRLS  +++
Sbjct: 486  LALQKAVPLEAIVTPRLSFDIYQ 508



>sp|O04164|C716_NEPRA Cytochrome P450 71A6 (EC 1.14.-.-)
            (Fragment).>gb:NRCYP71A6_1691151 N.racemosa mRNA for
            cytochrome P450, CYP71A6, partial.
          Length = 511

 Score =  236 bits (601), Expect = 1e-60
 Identities = 154/519 (29%), Positives = 263/519 (50%), Gaps = 21/519 (4%)
 Frame = +2

Query: 68   IAALVLLWF--SWRKQ-SKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFT 238
            +  L  L+F   WR+  S + PP +    P++G+LH   T     ++L   + +YGPV  
Sbjct: 6    LCTLPFLFFLKKWRRSYSGKTPPPSPPKLPVLGNLHQLGTFPH--RSLQSLSRRYGPVMQ 63

Query: 239  IRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVR 418
            +  G   +LV SS EA R+     D   + RP     + L YD     F+    YWR++R
Sbjct: 64   LHFGSVPVLVASSPEAAREIMKNQDLNFSNRPNLSIPRRLLYDNHDVAFAPYGEYWRQIR 123

Query: 419  KLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNL 598
             + V ++LS++R++  + V   E    ++++   + +    P+A  VN++     LT ++
Sbjct: 124  SICVLQLLSNKRVQSFRRVREEETSIMVEKI---MQLQKTTPTAA-VNLTDLLTCLTNDV 179

Query: 599  IMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW-FFRWLDYEGH 775
              +I  G++Y   + G      + LKK  ++   L G       I PLW +  WL++   
Sbjct: 180  FCRIALGKKYGGTTTGDGEYHVRSLKKNLAEFYVLLG-------ISPLWEYIPWLEWTRR 232

Query: 776  VKTMKRAAKDVDAILQDWVDARRKERRSNEDQK------------FIDVMLSMIDDQFTQ 919
               + R  ++V     +++    +E R  + ++            F+D++L    +   +
Sbjct: 233  FDGVDRRIEEVSRTFDEFLGKVIQEHRVRDKREDTTVVGDTVGLDFVDLLLQFQREN-ER 291

Query: 920  GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWA 1099
              S   D  IKA++L M    ++T  T L W L+ L+K+P ++K +Q E+    G +   
Sbjct: 292  SSSPVDDLTIKAVILDMFLAGTDTTVTALEWALSELIKNPRAMKILQKEVRGVAGSKGEI 351

Query: 1100 EDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRD 1279
            E+SD++ +PYL+ V+KE+LR++   P L P E+  D  V GY +  GT++ +N W + RD
Sbjct: 352  EESDLEKMPYLKAVMKESLRLHAPVPLLVPRESTRDTKVLGYDVASGTRVLINCWAIGRD 411

Query: 1280 PKIWPDPEKFLPERFM-TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLF 1456
              +W + E FLPERF+ T+++    +   ++ +PFG GRR CPG  +A  I ++A+A L 
Sbjct: 412  SSVWEESETFLPERFLETSID---YRGMHFELIPFGSGRRGCPGATFAAAIDELALATLV 468

Query: 1457 QGFNFSTVPN----EPLDMMEDVGIILPKLTPLEVLVTP 1561
              F+F  +PN    E LDM E  G  + K  PL V+ TP
Sbjct: 469  HKFDFK-LPNGVRVEDLDMSEGSGFTIHKKFPLLVVPTP 506



>gb:AB113261_1527232 Ipomoea nil Magenta mRNA for flavonoid
            3'-hydroxylase, complete cds.>gb:AB113264_1527235 Ipomoea
            nil Magenta gene for flavonoid 3'-hydroxylase, complete
            cds.
          Length = 519

 Score =  235 bits (599), Expect = 2e-60
 Identities = 144/517 (27%), Positives = 251/517 (48%), Gaps = 14/517 (2%)
 Frame = +2

Query: 80   VLLWFSWRKQSKRLP---PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLG 250
            + L+F   +  +R P   P     WP++G+L H        ++++  A++YGP+  +RLG
Sbjct: 15   IFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGKKPH--QSIAAMAERYGPLMHLRLG 72

Query: 251  ISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVV 430
               ++V +S          +D   + RP     +++ Y+Y    F+     WR +RK+  
Sbjct: 73   FVDVVVAASAAVAAQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITS 132

Query: 431  EEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQI 610
              + S++ L+   HV   E+ T  + L +             V + +     T N + ++
Sbjct: 133  VHLFSAKALDDFCHVRQEEVATLTRSLAS--------AGKTPVKLGQLLNVCTTNALARV 184

Query: 611  VAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMK 790
            + GR+         + +A+  K +  ++M L G F  GD I  L    W D +G V  MK
Sbjct: 185  MLGRKVFNDGGSKSDPKAEEFKSMVEEMMVLAGSFNIGDFIPVLG---WFDVQGIVGKMK 241

Query: 791  RAAKDVDA----ILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSR--DTVIK 952
            +     DA    IL++      +    ++D  F+  ++ + D+         +  DT IK
Sbjct: 242  KLHARFDAFLNTILEEHKCVNNQHTTLSKDVDFLSTLIRLKDNGADMDCEEGKLTDTEIK 301

Query: 953  AIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYL 1132
            A++L++    ++T ++ + W +A LL++P+ L + Q E+D  +G+ +   +SD+ +LP+L
Sbjct: 302  ALLLNLFTAGTDTSSSTVEWAIAELLRNPKILNQAQQELDLVVGQNQLVTESDLTDLPFL 361

Query: 1133 QGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFL 1312
            Q +VKET R++P  P   P    + C ++GY IPKG  L VNVW + RDP +W +P +F 
Sbjct: 362  QAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFN 421

Query: 1313 PERFMTNLE--GEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN 1486
            P RF+   E      +   ++ +PFG GRR C G     ++  + VA L   F++  V  
Sbjct: 422  PHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVATLVHAFDWDLVNG 481

Query: 1487 ---EPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFRL 1588
               E L+M E  G+ L +  PL +   PRL P L+ L
Sbjct: 482  QSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL 518



>gb:AX028836_1457179 Sequence 20 from Patent WO9732023.
          Length = 517

 Score =  235 bits (599), Expect = 2e-60
 Identities = 144/517 (27%), Positives = 251/517 (48%), Gaps = 14/517 (2%)
 Frame = +2

Query: 80   VLLWFSWRKQSKRLP---PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLG 250
            + L+F   +  +R P   P     WP++G+L H        ++++  A++YGP+  +RLG
Sbjct: 13   IFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGKKPH--QSIAAMAERYGPLMHLRLG 70

Query: 251  ISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVV 430
               ++V +S          +D   + RP     +++ Y+Y    F+     WR +RK+  
Sbjct: 71   FVDVVVAASAAVAAQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITS 130

Query: 431  EEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQI 610
              + S++ L+   HV   E+ T  + L +             V + +     T N + ++
Sbjct: 131  VHLFSAKALDDFCHVRQEEVATLTRSLAS--------AGKTPVKLGQLLNVCTTNALARV 182

Query: 611  VAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMK 790
            + GR+         + +A+  K +  ++M L G F  GD I  L    W D +G V  MK
Sbjct: 183  MLGRKVFNDGGSKSDPKAEEFKSMVEEMMVLAGSFNIGDFIPVLG---WFDVQGIVGKMK 239

Query: 791  RAAKDVDA----ILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSR--DTVIK 952
            +     DA    IL++      +    ++D  F+  ++ + D+         +  DT IK
Sbjct: 240  KLHARFDAFLNTILEEHKCVNNQHTTLSKDVDFLSTLIRLKDNGADMDCEEGKLTDTEIK 299

Query: 953  AIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYL 1132
            A++L++    ++T ++ + W +A LL++P+ L + Q E+D  +G+ +   +SD+ +LP+L
Sbjct: 300  ALLLNLFTAGTDTSSSTVEWAIAELLRNPKILNQAQQELDLVVGQNQLVTESDLTDLPFL 359

Query: 1133 QGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFL 1312
            Q +VKET R++P  P   P    + C ++GY IPKG  L VNVW + RDP +W +P +F 
Sbjct: 360  QAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFN 419

Query: 1313 PERFMTNLE--GEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN 1486
            P RF+   E      +   ++ +PFG GRR C G     ++  + VA L   F++  V  
Sbjct: 420  PHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVATLVHAFDWDLVNG 479

Query: 1487 ---EPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFRL 1588
               E L+M E  G+ L +  PL +   PRL P L+ L
Sbjct: 480  QSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL 516



>gb:AB113263_1527234 Ipomoea tricolor Fuchsia mRNA for flavonoid
            3'-hydroxylase, complete cds.>gb:AB113267_1527237 Ipomoea
            tricolor Fuchsia gene for flavonoid 3'-hydroxylase,
            complete cds, strain: Heavenly Blue.
          Length = 522

 Score =  234 bits (598), Expect = 3e-60
 Identities = 145/520 (27%), Positives = 248/520 (47%), Gaps = 17/520 (3%)
 Frame = +2

Query: 80   VLLWFSWRKQSKRLP---PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLG 250
            + L+F   +  +R P   P     WP++G+L H        ++++  A  YGP+  +RLG
Sbjct: 15   ICLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPH--QSIAAMAQSYGPLMHLRLG 72

Query: 251  ISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVV 430
               ++V +S          +D   ++RP     +++ Y+Y    F+     WR +RK+  
Sbjct: 73   FVDVVVAASAAVAAQFLKVHDANFSSRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITS 132

Query: 431  EEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQI 610
              + S++ L+   HV   E+ T  + L +             V + +     T N + ++
Sbjct: 133  VHLFSAKALDDFCHVRQEEVATLTRSLAS--------AGKTPVKLGQLLNVCTTNALARV 184

Query: 611  VAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMK 790
            + GR+         + +A+  K +  ++M L G F  GD I  L    WLD +G V  MK
Sbjct: 185  MLGRKVFNDGSSKSDPKAEEFKSMVEEMMVLAGSFNIGDFIPVLG---WLDLQGIVGKMK 241

Query: 791  RAAKDVDA----ILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSR-----DT 943
            +     DA    IL++      ++    +D  F+  ++ + D+         +     DT
Sbjct: 242  KLHARFDAFLNTILEEHKFVNNQDTTLFKDMDFLSTLIRLRDNGAAMDGEDGKVTGVTDT 301

Query: 944  VIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNL 1123
             IKA++L++    ++T ++ + W  A LL++P+ L + Q E+D  +G  R   +SD+  L
Sbjct: 302  EIKALLLNLFTAGTDTSSSTVEWAFAELLRNPKILNQAQQELDLVVGPNRLVTESDLTQL 361

Query: 1124 PYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPE 1303
            P+LQ +VKET R++P  P   P    E C ++GY IPKG  L VNVW + RDP +W +P 
Sbjct: 362  PFLQAIVKETFRLHPSTPLSLPRMGAESCEINGYFIPKGATLLVNVWAIARDPNVWTNPL 421

Query: 1304 KFLPERFMTNLE--GEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST 1477
            +F P RF+   E      +   ++ +PFG GRR C G     ++  + VA L   F++  
Sbjct: 422  EFNPHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVATLVHAFDWGL 481

Query: 1478 VPNEPLD---MMEDVGIILPKLTPLEVLVTPRLSPTLFRL 1588
            V  + +D   M E  G+ L +  PL +   PRL P ++ L
Sbjct: 482  VDGQSVDTLNMEEAYGLTLQRAVPLMLHPKPRLQPHIYTL 521



>gb:AY117551_1579411 Glycine max flavonoid 3', 5'-hydroxylase mRNA,
            complete cds.
          Length = 508

 Score =  234 bits (597), Expect = 4e-60
 Identities = 156/496 (31%), Positives = 259/496 (52%), Gaps = 6/496 (1%)
 Frame = +2

Query: 113  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVR 292
            ++LPP   G WP++G L     S+P V TL++ A KYGP+  +++G + ++V S+  A R
Sbjct: 33   QKLPPGPKG-WPVVGALP-LMGSMPHV-TLAKMAKKYGPIMYLKMGTNNMVVASTPAAAR 89

Query: 293  DCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKH 472
                T D+  + RP+     +L YD     F+   S W+ +RKL    +L  + L+    
Sbjct: 90   AFLKTLDQNFSNRPSNAGATHLAYDARDMVFAHYGSRWKLLRKLSNLHMLGGKALDDWAQ 149

Query: 473  VWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTI 652
            +   E+   +  +Y      N    A  V     F     N+I Q++  RR  + + G+ 
Sbjct: 150  IRDEEMGHMLGAMYDC----NKRDEAVVVAEMLIF---MANMIGQVILSRRV-FETKGS- 200

Query: 653  NEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWV 832
              E+   K +  ++M + G F  GD I    F   LD +G  + MK+  K  DA+L   +
Sbjct: 201  --ESNEFKDMVVELMTVAGYFNIGDFIP---FLAKLDLQGIERGMKKLHKKFDALLTSMI 255

Query: 833  D---ARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATH 1003
            +   A   +R+   D  F+D++++   +  + G   S  T IKA++L++    ++T ++ 
Sbjct: 256  EEHVASSHKRKGKPD--FLDMVMAHHSEN-SDGEELSL-TNIKALLLNLFTAGTDTSSSI 311

Query: 1004 LTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYL 1183
            + W LA +LK P  +K+  +E+D  IG++R  ++SD+  LPY Q + KET R +P  P  
Sbjct: 312  IEWSLAEMLKKPSIMKKAHEEMDQVIGRDRRLKESDIPKLPYFQAICKETYRKHPSTPLN 371

Query: 1184 APHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEA-AQNR 1360
             P  + E C V+GY+IP+ T+L VN+W + RDP +W +P +F+PERF++    +   +  
Sbjct: 372  LPRISSEPCQVNGYYIPENTRLNVNIWAIGRDPDVWNNPLEFMPERFLSGKNAKIDPRGN 431

Query: 1361 QYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN--EPLDMMEDVGIILPKL 1534
             ++ +PFG GRR C G      +    +  L   F++  +PN    LDM E  G+ L K 
Sbjct: 432  DFELIPFGAGRRICAGTRMGIVLVHYILGTLVHSFDWK-LPNGVRELDMEESFGLALQKK 490

Query: 1535 TPLEVLVTPRLSPTLF 1582
             PL  LVTPRL+P+ +
Sbjct: 491  VPLAALVTPRLNPSAY 506



>pir|T49978|T49978 cytochrome P450-like protein - Arabidopsis
            thaliana>gb:ATF12B17_1548313 Arabidopsis thaliana DNA
            chromosome 5, BAC clone F12B17 (ESSA project).
          Length = 500

 Score =  234 bits (597), Expect = 4e-60
 Identities = 152/493 (30%), Positives = 250/493 (50%), Gaps = 3/493 (0%)
 Frame = +2

Query: 92   FSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVV 271
            F W   SK LPP      PIIGHLH  +   PL + L   +  YGPV  ++ G   +L +
Sbjct: 24   FLWSLNSK-LPPSPTPL-PIIGHLHLIK-KYPLPQALRHLSSNYGPVLFLKFGCRNVLTL 80

Query: 272  SSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSR 451
            SS +++ +CF  +D  LA RP T    +  Y Y  F F+     WR +R+L   E+ SS 
Sbjct: 81   SSPDSIEECFTNHDVTLANRPKTITSDHFSYGYKNFGFAPYGDLWRTLRRLSTLEVFSSA 140

Query: 452  RLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYE 631
             L+K   +   E+ +N+  +   +S D+       V++   F  LT ++++++V+G+R  
Sbjct: 141  SLQKNSSIRNEEV-SNLCLIIFRLSRDSRI-----VDLKYQFTLLTAHIMLRLVSGKRGV 194

Query: 632  YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD 811
             +SD    E  +R    F ++ +     ++    FP+   RW+ Y+G  K +    +  D
Sbjct: 195  KKSDP---ESEKRFLDDF-KLRFFSSMSMNVCDYFPV--LRWIGYKGLEKRVIDMQRMRD 248

Query: 812  AILQDWVDARRKERRSNED---QKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDA 982
              LQ  +D  R +   +     +KF+ +  S  +        +  D VIK I++ M    
Sbjct: 249  EYLQRLIDDIRMKNIDSSGSVVEKFLKLQESEPE--------FYADDVIKGIIVLMFNGG 300

Query: 983  SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM 1162
            ++T    + W +++LL HP+ L+++++EI +N+  +   +DSD+ +LPYL+ V+ ETLR+
Sbjct: 301  TDTSPVAMEWAVSLLLNHPDKLEKLREEIKSNVKHKGLIQDSDLSSLPYLRCVIYETLRL 360

Query: 1163 YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG 1342
            YP  P L PH + +   +  Y IP+   L VN W +HRD ++W +   F PERF    EG
Sbjct: 361  YPAAPLLLPHCSSKRFNLGNYEIPENIMLLVNAWAVHRDGELWEEANVFKPERF----EG 416

Query: 1343 EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGII 1522
                   ++F+PFG+GRR+CP      ++  +AV  L Q F +  V    +DM    G+ 
Sbjct: 417  FVGDRDGFRFLPFGVGRRACPAAGLGMRVVSLAVGALVQCFEWEKVEAGDIDMRPVFGVA 476

Query: 1523 LPKLTPLEVLVTP 1561
            + K  PL  L  P
Sbjct: 477  MAKAEPLVALPKP 489



>sp|Q9STL2|C71L_ARATH Cytochrome P450 71A21 (EC
            1.14.-.-).>pir|T06710|T06710 probable cytochrome P450
            T29H11.160 - Arabidopsis thaliana>gb:ATT29H11_1555644
            Arabidopsis thaliana DNA chromosome 3, BAC clone T29H11.
          Length = 490

 Score =  234 bits (597), Expect = 4e-60
 Identities = 150/504 (29%), Positives = 264/504 (52%), Gaps = 7/504 (1%)
 Frame = +2

Query: 68   IAALVLLWFSWRKQSKRL-PPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIR 244
            I  + +L+F  +K+ K+   P +    P+IG+LH         ++L   + +YGP+  + 
Sbjct: 13   IIFITILFFKKQKRGKKSNTPRSPPRLPLIGNLHQLGHHPH--RSLCSLSHRYGPLMLLH 70

Query: 245  LGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKL 424
            LG   +LVVSS +  RD   T+D++ A+RP +   + L YD     F+    YWR+++ +
Sbjct: 71   LGRVPVLVVSSADVARDILKTHDRVFASRPRSKLFEKLFYDGRDVAFAPYGEYWRQIKSV 130

Query: 425  VVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIM 604
             V  +LS++ +   ++V   E+   ++++           S+ +VN+S   G LT ++I 
Sbjct: 131  CVLRLLSNKMVTSFRNVRQEEISLMMEKI--------QKSSSLQVNVSELLGSLTNDVIS 182

Query: 605  QIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD-YEGHV- 778
            +I  GR+Y   +D          K++  ++M L GEF  G  +  L +  W+   +G + 
Sbjct: 183  RIALGRKYSGETDS---------KELMKRLMMLMGEFSVGTYVPWLGWIDWISGLDGQLN 233

Query: 779  KTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAI 958
            KT     + ++ ++QD VD         +   F+DV+L  I  + + G+   R   IKAI
Sbjct: 234  KTGNDLDEFLEKVVQDHVDG------DGQRTDFVDVLLR-IQREKSIGFEIDR-LCIKAI 285

Query: 959  VLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQG 1138
            VL +L   +++    + W +  LL+HPE L+ +Q+E+ T         + D++N+ YL+ 
Sbjct: 286  VLDVLVAGTDSSYALMDWAMTELLRHPECLRTLQEEVRTICKGNLSVSEEDIQNMSYLKA 345

Query: 1139 VVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIW-PDPEKFLP 1315
            V+KET R++P  P LAPHE+++D I+  YHIP GTQ+ +N W + R+   W PD EKF P
Sbjct: 346  VIKETTRLHPPLPLLAPHESIQDVILGDYHIPAGTQVMINAWAIGREAATWGPDAEKFRP 405

Query: 1316 ERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN--- 1486
            ER + +       N  ++ VPFG GRR CP   +A  + +VA+A     +++    +   
Sbjct: 406  ERHLDSSVDFRGHN--FELVPFGAGRRICPAISFAVVLIEVALANFVHRYDWKLPEDSKE 463

Query: 1487 EPLDMMEDVGIILPKLTPLEVLVT 1558
               ++ E  G+++ +L PL  + +
Sbjct: 464  NQTNVAESTGMVIHRLFPLYAIAS 487



>gb:AF188612_1775231 Callistephus chinensis flavone synthase II
            (CYP93B5) mRNA, complete cds.
          Length = 514

 Score =  234 bits (596), Expect = 5e-60
 Identities = 165/530 (31%), Positives = 271/530 (51%), Gaps = 11/530 (2%)
 Frame = +2

Query: 26   VMDAVPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVK-TL 202
            V  +V   + +I  I++L +     R Q     P +  A PIIGHLHH     PL+  + 
Sbjct: 6    VFQSVSPAIIAIFFISSLFIYLVLIRNQKSLSLPPSPPALPIIGHLHHLG---PLIHHSF 62

Query: 203  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT 382
             + + +YGP+  +RLG    +V S+ +  RD   TN+   ++R  + A  ++ Y  + F 
Sbjct: 63   HDLSTRYGPLIHLRLGSVPCVVASTPDLARDFLKTNELAFSSRKHSLAIDHVTYGVS-FA 121

Query: 383  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVN 562
            F+    YW+ ++K  + E+L ++ L     +   E+    + L T +     N S   VN
Sbjct: 122  FAPYGPYWKFIKKTSIVELLGNQNLSNFLPIRTQEVH---ELLQTLMVKSKKNES---VN 175

Query: 563  MSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL 742
            +S     LT N+I Q++       R  GT N EA   K +  +V  ++GEF   D I   
Sbjct: 176  LSEELLKLTNNVICQMMMS----IRCSGT-NNEADEAKNLVREVTKIFGEFNISDFIC-- 228

Query: 743  WFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRS--NEDQK---FIDVMLSMIDD 907
              F+ +D +G  K         +A+L+  +  R ++R+   +ED K   F+D++L +++D
Sbjct: 229  -LFKNIDLQGFKKRYVDTHTRYNALLEKMIFEREEKRKQKKSEDGKGKDFLDILLDVLED 287

Query: 908  QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK 1087
            +  +    +RD  IKA++L     A++T A  + W L  L  +P+ L+  + EI   +G 
Sbjct: 288  ENAE-IKITRDH-IKALILDFFTAATDTTAISIEWTLVELTNNPKVLENARKEIAEVVGD 345

Query: 1088 ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR 1267
            ER  ++SD+ NLPY+Q ++KETLRM+P  P +   +++++  V GY I  GT L+VN+W 
Sbjct: 346  ERLVQESDIPNLPYIQAIIKETLRMHPPIP-MVIRKSIDNVTVQGYDIRAGTMLFVNIWS 404

Query: 1268 LHRDPKIWPDPEKFLPERFMTNLEGEA----AQNRQYQFVPFGLGRRSCPGNLYATQITQ 1435
            + R+P  W  P +F P RF   L+G A     + + +Q +PFG GRR CPG   A +   
Sbjct: 405  IGRNPLYWESPLEFKPHRF---LDGHARNLDVKGQCFQLLPFGTGRRGCPGISLAMRELP 461

Query: 1436 VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS-PTLF 1582
            V +A L Q F ++    E L M E  G+  P+   LE +   R + P +F
Sbjct: 462  VVIAGLIQCFEWNANDKEVLSMDERAGLTAPRAVDLEFVPLMRQNCPNIF 511



>gb:AY532370_1612053 Ammi majus cytochrome P450 (CYP71AJ1) mRNA,
            complete cds.
          Length = 494

 Score =  234 bits (596), Expect = 5e-60
 Identities = 155/510 (30%), Positives = 259/510 (50%), Gaps = 6/510 (1%)
 Frame = +2

Query: 56   SILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVF 235
            S+  +   +  W + +K   +  P +   +PIIG+LH          +L + A KYGP+ 
Sbjct: 15   SLFLVTIFLYKWLTLKKTPLKNLPPSPPQYPIIGNLHQIGPDPQA--SLRDLAQKYGPLM 72

Query: 236  TIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRV 415
             ++ G   +LVVSS +A R+   T+D + A RP +     + Y+     F+    YWR+V
Sbjct: 73   FLKFGTVPVLVVSSADAAREALKTHDLVFADRPYSSVANKIFYNGKDMVFARYTEYWRQV 132

Query: 416  RKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLN 595
            + + V ++LS++R+    +V   E+   ++ L         N  +   N++     +T N
Sbjct: 133  KSICVTQLLSNKRVNSFHYVREEEVDLLVQNL--------ENSHSKVANLTELLIEVTGN 184

Query: 596  LIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDY-EG 772
            ++ ++  G            ++    K +  ++M + G   S +  FPL    W+D+  G
Sbjct: 185  VVCRVSVGS----------GDKVDSYKILILEIMDMLGYSRSIEDFFPL--LGWVDWLTG 232

Query: 773  HVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIK 952
                +  AAK VD  L+  +    KE  S    K+ D +  +++ Q     S   +  IK
Sbjct: 233  LRGKVAEAAKGVDTFLEGVL----KEHLSTTGSKYNDFVSILLEIQEADAGSSMDNECIK 288

Query: 953  AIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEI-DTNIGKERWAEDSDVKNLPY 1129
            +++  ML   +ET +T L W LA L+K+P+++ ++Q+E+ +   GK + +E +D+  + Y
Sbjct: 289  SLIWDMLGAGTETISTALEWTLAALIKNPDAMFKLQNEVREIGKGKSKISE-ADLVKMNY 347

Query: 1130 LQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKF 1309
            LQ V+KE++R+Y   P L P EA +D    GY I  GTQ+ +N W + RDP +W  PE+F
Sbjct: 348  LQAVMKESMRLYFTAPLLVPREARQDIKFMGYDISSGTQVLINAWAIARDPLLWDKPEEF 407

Query: 1310 LPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN- 1486
             PERF+ +      +   Y+F+PFG GRR CPG  +A  I ++ VA L   FNF  +P+ 
Sbjct: 408  RPERFLNS--PIDYKGFHYEFLPFGAGRRGCPGIQFAMCINELVVANLVHKFNFE-LPDG 464

Query: 1487 ---EPLDMMEDVGIILPKLTPLEVLVTPRL 1567
               E LDM    GI L K +PL V+  P +
Sbjct: 465  KRLEDLDMTAASGITLRKKSPLLVVARPHV 494



>sp|O48922|C982_SOYBN Cytochrome P450 98A2 (EC
            1.14.-.-).>pir|T05937|T05937 cytochrome P450
            monooxygenase 98A2p - soybean>gb:AF022458_1761993 Glycine
            max cytochrome P450 monooxygenase CYP98A2p (CYP98A2)
            mRNA, complete cds.
          Length = 509

 Score =  234 bits (596), Expect = 5e-60
 Identities = 146/510 (28%), Positives = 258/510 (50%), Gaps = 6/510 (1%)
 Frame = +2

Query: 74   ALVLLWFSWRKQSK---RLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIR 244
            +LV LW  +    +   +LPP     WP++G+L+  +      +  +EWA  YGP+ ++ 
Sbjct: 10   SLVTLWLGYTLYQRLRFKLPP-GPRPWPVVGNLYDIKPV--RFRCFAEWAQSYGPIISVW 66

Query: 245  LGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKL 424
             G +  ++VS+ E  ++    +D+LLA R  + +      D     ++    ++ +VRK+
Sbjct: 67   FGSTLNVIVSNSELAKEVLKEHDQLLADRHRSRSAAKFSRDGKDLIWADYGPHYVKVRKV 126

Query: 425  VVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIM 604
               E+ S +RLE L+ +   E+ + +  +Y   +   N      + + +  G +  N I 
Sbjct: 127  CTLELFSPKRLEALRPIREDEVTSMVDSVYNHCTSTENLGKG--ILLRKHLGVVAFNNIT 184

Query: 605  QIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKT 784
            ++  G+R+   S+G ++E+    K +    + L       + I  L +   L+     K 
Sbjct: 185  RLAFGKRF-VNSEGVMDEQGVEFKAIVENGLKLGASLAMAEHIPWLRWMFPLEEGAFAKH 243

Query: 785  MKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVL 964
              R  +   AI+ +  +AR+K       Q F+D +L++ D      Y  S DT+I  ++ 
Sbjct: 244  GARRDRLTRAIMAEHTEARKKS--GGAKQHFVDALLTLQDK-----YDLSEDTII-GLLW 295

Query: 965  SMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVV 1144
             M+    +T A  + W +A L+++P   ++VQ+E+D  IG ER   ++D  NLPYLQ V 
Sbjct: 296  DMITAGMDTTAISVEWAMAELIRNPRVQQKVQEELDRVIGLERVMTEADFSNLPYLQCVT 355

Query: 1145 KETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERF 1324
            KE +R++P  P + PH A  +  V GY IPKG+ ++VNVW + RDP +W DP +F PERF
Sbjct: 356  KEAMRLHPPTPLMLPHRANANVKVGGYDIPKGSNVHVNVWAVARDPAVWKDPLEFRPERF 415

Query: 1325 MTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST---VPNEPL 1495
            +   E    +   ++ +PFG GRR CPG      +    +  L   F ++    +  E +
Sbjct: 416  LE--EDVDMKGHDFRLLPFGSGRRVCPGAQLGINLAASMLGHLLHHFCWTPPEGMKPEEI 473

Query: 1496 DMMEDVGIILPKLTPLEVLVTPRLSPTLFR 1585
            DM E+ G++    TP++ +V+PRL   L++
Sbjct: 474  DMGENPGLVTYMRTPIQAVVSPRLPSHLYK 503



>gb:AE016959_1021701 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC119149_1739608 Oryza sativa
            (japonica cultivar-group) chromosome 10 clone
            OSJNBb0079E01, complete sequence.>gb:AE017074_1751520
            Oryza sativa (japonica cultivar-group) chromosome 10,
            section 28 of 77 of the complete sequence.
          Length = 535

 Score =  233 bits (595), Expect = 7e-60
 Identities = 150/505 (29%), Positives = 251/505 (49%), Gaps = 15/505 (2%)
 Frame = +2

Query: 119  LPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDC 298
            LPP   G WP++G+L          +TL E    YGP+  +R G S ++V  S       
Sbjct: 41   LPPGPRG-WPVLGNLPQLGGKTH--QTLHEMTKVYGPLIRLRFGSSDVVVAGSAPVAAQF 97

Query: 299  FATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVW 478
              T+D   ++RP    G+++ Y+     F      WR +RK+    + S+R L+ L+   
Sbjct: 98   LRTHDANFSSRPRNSGGEHMAYNGRDVVFGPYGPRWRAMRKICAVNLFSARALDDLRAFR 157

Query: 479  VSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINE 658
              E    ++ L    +   ++  A  V + +     T N + +   GRR      G   E
Sbjct: 158  EREAVLMVRSLAEASAAPGSSSPAAVV-LGKEVNVCTTNALSRAAVGRRVFAAGAG---E 213

Query: 659  EAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDA 838
             A+  K++  +VM + G    GD +  L   RWLD +G V  MK+  +  D ++   +  
Sbjct: 214  GAREFKEIVLEVMEVGGVLNVGDFVPAL---RWLDPQGVVARMKKLHRRFDDMMNAIIAE 270

Query: 839  RR-----KERRSNEDQK-FIDVMLSMIDDQFTQGYSYS---RDTVIKAIVLSMLQDASET 991
            RR     K   S E+ K  + ++L+M+ +Q            DT IKA++L++    ++T
Sbjct: 271  RRAGSLLKPTDSREEGKDLLGLLLAMVQEQEWLAAGEDDRITDTEIKALILNLFVAGTDT 330

Query: 992  FATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQ 1171
             +T + W +A L++HP+ LK  Q+E+D  +G++R   +SD+ +L +   ++KET R++P 
Sbjct: 331  TSTIVEWTMAELIRHPDILKHAQEELDVVVGRDRLLSESDLSHLTFFHAIIKETFRLHPS 390

Query: 1172 GPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFM---TNLEG 1342
             P   P  A E+C + GY IPKG +L VNVW + RDP IWPDP ++ P RF+   T+ + 
Sbjct: 391  TPLSLPRMASEECEIAGYRIPKGAELLVNVWGIARDPAIWPDPLEYKPSRFLPGGTHTDV 450

Query: 1343 EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN---EPLDMMEDV 1513
            +   N  +  +PFG GRR C G  +  ++  +  A L   F++    +   + L+M E  
Sbjct: 451  DVKGN-DFGLIPFGAGRRICAGLSWGLRMVTMTAATLVHAFDWQLPADQTPDKLNMDEAF 509

Query: 1514 GIILPKLTPLEVLVTPRLSPTLFRL 1588
             ++L +  PL V   PRL P+ + +
Sbjct: 510  TLLLQRAEPLVVHPVPRLLPSAYNI 534



>gb:AY082612_1569191 Ocimum basilicum p-coumaroyl shikimate
            3'-hydroxylase isoform 2 mRNA, complete cds.
          Length = 509

 Score =  233 bits (594), Expect = 9e-60
 Identities = 148/512 (28%), Positives = 258/512 (50%), Gaps = 3/512 (0%)
 Frame = +2

Query: 59   ILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFT 238
            +L + A+ LL   + +   RLPP      P++G+L+  +      +  ++WA  YGP+ +
Sbjct: 8    LLLLPAIFLLHHLYYRLRFRLPP-GPRPLPVVGNLYDVKPV--RFRCFADWAQSYGPIIS 64

Query: 239  IRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVR 418
            +  G +  ++VS+ E  ++     D+ LA R  + +      D     ++    ++ +VR
Sbjct: 65   VWFGSTLNVIVSNTELAKEVLKEKDQQLADRHRSRSAAKFSRDGQDLIWADYGPHYVKVR 124

Query: 419  KLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNL 598
            K+ + E+ S +RLE L+ +   E+   ++ +Y   +  +N  +   + + ++ G +  N 
Sbjct: 125  KVCMLELFSPKRLEALRPIREDEVTAMVESIYHDCTAPDN--AGKSLLVKKYLGAVAFNN 182

Query: 599  IMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHV 778
            I ++  G+R+   S+G I+++    K + S  + L       + I  L +   LD +   
Sbjct: 183  ITRLAFGKRF-VNSEGIIDKQGLEFKAIVSNGLKLGASLAMAEHIPWLRWMFPLDEDAFA 241

Query: 779  KTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAI 958
            K   R  +    I+++   AR  E      Q F D +L++ D      Y  S DT+I  +
Sbjct: 242  KHGARRDQLTREIMEEHTRAR--EESGGAKQHFFDALLTLKDK-----YDLSEDTII-GL 293

Query: 959  VLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQG 1138
            +  M+    +T A  + W +A L+K+P   ++ Q+E+D  IG ER   + D  NLPYLQ 
Sbjct: 294  LWDMITAGMDTTAISVEWAMAELIKNPRVQQKAQEELDRVIGYERVMTELDFSNLPYLQC 353

Query: 1139 VVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPE 1318
            V KE LR++P  P + PH +  +  + GY IPKG+ ++VNVW + RDP +W +P +F PE
Sbjct: 354  VAKEALRLHPPTPLMLPHRSNSNVKIGGYDIPKGSNVHVNVWAVARDPAVWKNPSEFRPE 413

Query: 1319 RFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF---STVPNE 1489
            RF+   E    +   ++ +PFG GRR CPG      +    +  L   FN+   S V  +
Sbjct: 414  RFLE--EDVDMKGHDFRLLPFGAGRRVCPGAQLGINLVTSMIGHLLHHFNWAPPSGVSTD 471

Query: 1490 PLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR 1585
             LDM E+ G++    TPLE + TPRL   L++
Sbjct: 472  ELDMGENPGLVTYMRTPLEAVPTPRLPSDLYK 503



>sp|O64718|C729_ARATH Cytochrome P450 71B9 (EC
            1.14.-.-).>gb:AC004136_1531456 Arabidopsis thaliana
            chromosome 2 BAC T8K22 genomic sequence, complete
            sequence.
          Length = 500

 Score =  233 bits (594), Expect = 9e-60
 Identities = 155/510 (30%), Positives = 259/510 (50%), Gaps = 8/510 (1%)
 Frame = +2

Query: 56   SILGIAALVLLWFSWRKQ--SKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGP 229
            S+L +  ++L  F  +K+  +++ PP   G +PIIG+LH     +P  ++L   +  YGP
Sbjct: 8    SLLFLCCILLAAFKHKKRRTNQQQPPSPPG-FPIIGNLHQLG-ELPH-QSLWSLSKTYGP 64

Query: 230  VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWR 409
            V  ++LG    +VVSS E  +     ND    +RP+    K L Y+Y    FS  + YW+
Sbjct: 65   VMLLKLGSVPTVVVSSSETAKQVLKINDLHCCSRPSLAGAKELSYNYLDIAFSPFDDYWK 124

Query: 410  RVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLT 589
             +R++ V+E+ S++R+  ++ +   E++  I      +S   +      VN+S  F  LT
Sbjct: 125  ELRRICVQELFSAKRVHSIQPIKEEEVRKLI------VSATESASQKSPVNLSEKFLDLT 178

Query: 590  LNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL--WFFRWLD 763
            +++I +      +       +N +     K+        G F S    FP   W   WL 
Sbjct: 179  VSVICKAAFSLDFH---TSVLNNDG--FDKLIHDAFLFLGSF-SASNFFPNGGWIIDWLT 232

Query: 764  YEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDT 943
              G  +  +++ KD+D   Q   D  ++E +   +  F+D++L +  ++   GY      
Sbjct: 233  --GLQRRREKSVKDLDVFYQQMFDLHKQENKQGVED-FVDLLLKLEKEETVLGYGKLTRN 289

Query: 944  VIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNL 1123
             +KAI++++L  A  T A  +TW +A L+++P  +K+VQ EI   +  +      D+ +L
Sbjct: 290  HVKAILMNVLLGAINTSAMTMTWAMAELIRNPRVMKKVQSEIRNQMINKSVITLDDIDHL 349

Query: 1124 PYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPE 1303
            PYL+ V+KET R++P  P L P E + +  ++GY I   T LYVNVW + RDP  W D +
Sbjct: 350  PYLKMVIKETWRLHPPVPLLLPREVMSEFEINGYKIQPKTLLYVNVWAIGRDPDSWKDAD 409

Query: 1304 KFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVP 1483
             F PERFM N      QN  ++ +PFG GRR CPG    T + +  +A +   F++  VP
Sbjct: 410  MFYPERFMDNNIDAKGQN--FELLPFGSGRRICPGMYMGTTMVEFGLANMLYQFDWE-VP 466

Query: 1484 N----EPLDMMEDVGIILPKLTPLEVLVTP 1561
            +    E +DM E  G+ + K    E+L+ P
Sbjct: 467  DGMVVEDIDMEESPGLAVGKKN--ELLLVP 494



>sp|O65788|C722_ARATH Cytochrome P450 71B2 (EC
            1.14.-.-).>pir|H86264|H86264 cytochrome P450
            monooxygenase F3F19.10 - Arabidopsis
            thaliana>gb:AE005172_890319 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:BT003811_1636942 Arabidopsis thaliana clone
            C105429 putative cytochrome P450 monooxygenase
            (At1g13080) mRNA, complete cds.>gb:F3F19_1678233
            Arabidopsis thaliana chromosome 1 BAC F3F19 sequence,
            complete sequence.
          Length = 502

 Score =  233 bits (594), Expect = 9e-60
 Identities = 164/514 (31%), Positives = 271/514 (52%), Gaps = 9/514 (1%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGP 229
            L S+L I + + L     K SK   P +  + PIIG+LHH    +P  +   + + KYGP
Sbjct: 9    LVSLLTIVSSIFL--KQNKTSKFNLPPSPSSLPIIGNLHHL-AGLPH-RCFHKLSIKYGP 64

Query: 230  VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWR 409
            +  +RLG   ++V+SS EA      TND    +RP T     L Y +   TF+    YWR
Sbjct: 65   LVFLRLGSVPVVVISSSEAAEAVLKTNDLECCSRPKTVGSGKLSYGFKDITFAPYGEYWR 124

Query: 410  RVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLT 589
             VRKL V E+ SS++++  +++   E+   +K++    S    +P    V++S+ F  LT
Sbjct: 125  EVRKLAVIELFSSKKVQSFRYIREEEVDFVVKKVSE--SALKQSP----VDLSKTFFSLT 178

Query: 590  LNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD-- 763
             ++I ++  G+ +   S   I+++  R++++ ++     G F   D  FP    R++D  
Sbjct: 179  ASIICRVALGQNFN-ESGFVIDQD--RIEELVTESAEALGTFTFSD-FFPGGLGRFVDWL 234

Query: 764  YEGHVKTMKRAAKDVDAILQDWVDARRK-ERRSNEDQKFIDVMLSMIDDQF-TQGYSYSR 937
            ++ H K + +  K++DA  Q  +D   K E R N+D   + ++L MID Q  +  +  + 
Sbjct: 235  FQRH-KKINKVFKELDAFYQHVIDDHLKPEGRKNQD--IVTLILDMIDKQEDSDSFKLNM 291

Query: 938  DTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG--KERWAEDSD 1111
            D  +KAIV+ +     +T A  + W +  L+++P  +K+ Q+ I T +G  KER  E+ D
Sbjct: 292  DN-LKAIVMDVFLAGIDTSAVTMIWAMTELIRNPRVMKKAQESIRTTLGLKKERITEE-D 349

Query: 1112 VKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIW 1291
            +  + YL  ++KET R++P  P++ P E +    + GY IP  TQ+ +NVW + RDPK W
Sbjct: 350  LGKVEYLNHILKETFRLHPALPFVVPRETMSHIKIQGYDIPPKTQIQLNVWTIGRDPKRW 409

Query: 1292 PDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF 1471
             DPE+F PERF  +      Q+  +  +PFG GRR CPG   A    ++A+  L   F++
Sbjct: 410  NDPEEFNPERFANSSVDFRGQH--FDLLPFGSGRRICPGMPMAIASVELALMNLLYYFDW 467

Query: 1472 ST---VPNEPLDMMEDVGIILPKLTPLEVLVTPR 1564
            S       E +DM E   I + K  PL+++   R
Sbjct: 468  SMPDGTKGEDIDMEEAGNISIVKKIPLQLVPVQR 501



>gb:AB057673_1521705 Torenia hybrida ght mRNA for flavonoid
            3'-hydroxalase, complete cds.
          Length = 457

 Score =  233 bits (593), Expect = 1e-59
 Identities = 146/471 (30%), Positives = 240/471 (50%), Gaps = 14/471 (2%)
 Frame = +2

Query: 212  ADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFST 391
            A  YGP+  ++ G+   +V SS          +D   + RP     K++ Y+Y    F+ 
Sbjct: 2    AKTYGPLMHLKFGLKDAVVASSASVAEQFLKKHDVNFSNRPPNSGAKHIAYNYQDLVFAP 61

Query: 392  NNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSR 571
                WR +RK+    + SS+ L+  +HV   E+   I+ + +          AP VN+ +
Sbjct: 62   YGPRWRLLRKICSVHLFSSKALDDFQHVRHEEICILIRAIAS-------GGHAP-VNLGK 113

Query: 572  WFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF 751
              G  T N + +++ GRR  +  DG  N  A   K +  ++M L G F  GD I  L   
Sbjct: 114  LLGVCTTNALARVMLGRRV-FEGDGGENPHADEFKSMVVEIMVLAGAFNLGDFIPVL--- 169

Query: 752  RWLDYEGHVKTMK----RAAKDVDAILQDWVDARRKERRSNEDQKFID---VMLSMIDDQ 910
             W D +G    MK    R  K ++ IL+D     RK   SN  ++++D   V++S+ D  
Sbjct: 170  DWFDLQGIAGKMKKLHARFDKFLNGILED-----RKSNGSNGAEQYVDLLSVLISLQDSN 224

Query: 911  FTQGYSYSR--DTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG 1084
               G   ++  DT IKA++L++    ++T ++ + W +A L+++P+ L + Q+E+D  +G
Sbjct: 225  IDGGDEGTKLTDTEIKALLLNLFIAGTDTSSSTVEWAMAELIRNPKLLVQAQEELDRVVG 284

Query: 1085 KERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW 1264
              R+  +SD+  L +LQ V+KET R++P  P   P  A EDC ++GY++ +G+ L VNVW
Sbjct: 285  PNRFVTESDLPQLTFLQAVIKETFRLHPSTPLSLPRMAAEDCEINGYYVSEGSTLLVNVW 344

Query: 1265 RLHRDPKIWPDPEKFLPERFMTNLE--GEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV 1438
             + RDP  W +P  F P RF+   E      +   ++ +PFG GRR C G     ++ Q+
Sbjct: 345  AIARDPNAWANPLDFNPTRFLAGGEKPNVDVKGNDFEVIPFGAGRRICAGMSLGIRMVQL 404

Query: 1439 AVARLFQGFNFSTVPN---EPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
              A L   F+++ +     E LDM E  G+ L + +PL V   PRLS  ++
Sbjct: 405  VTASLVHSFDWALLDGLKPEKLDMEEGYGLTLQRASPLIVHPKPRLSAQVY 455



>sp|Q42600|C84A_ARATH Cytochrome P450 84A1 (Ferulate-5-hydroxylase)
            (EC 1.14.-.-) (F5H).>pir|T04591|T04591
            ferulate-5-hydroxylase (EC 1.-.-.-) - Arabidopsis
            thaliana>gb:ATCHRIV85_1547582 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 85.>gb:ATF23E13_1549750
            Arabidopsis thaliana DNA chromosome 4, BAC clone F23E13
            (ESSAII project).>gb:ATH295566_1552349 Arabidopsis
            thaliana fah1 gene for ferulate-5-hydroxylase, exons 1-3
            CAN-0 ecotype.>gb:ATH295567_1552350 Arabidopsis thaliana
            fah1 gene for ferulate-5-hydroxylase, exons 1-3 YO-0
            ecotype.>gb:ATH295568_1552351 Arabidopsis thaliana fah1
            gene for ferulate-5-hydroxylase, exons 1-3 LA-0
            ecotype.>gb:ATH295569_1552352 Arabidopsis thaliana fah1
            gene for ferulate-5-hydroxylase, exons 1-3 COL-2
            ecotype.>gb:ATH295570_1552353 Arabidopsis thaliana fah1
            gene for ferulate-5-hydroxylase, exons 1-3 COND
            ecotype.>gb:ATH295571_1552354 Arabidopsis thaliana fah1
            gene for ferulate-5-hydroxylase, exons 1-3 ME-0
            ecotype.>gb:ATH295572_1552355 Arabidopsis thaliana fah1
            gene for ferulate-5-hydroxylase, exons 1-3 RUB-1
            ecotype.>gb:ATH295573_1552356 Arabidopsis thaliana fah1
            gene for ferulate-5-hydroxylase, exons 1-3 TUL-0
            ecotype.>gb:ATH295574_1552357 Arabidopsis thaliana fah1
            gene for ferulate-5-hydroxylase, exons 1-3 GR-5
            ecotype.>gb:ATH295575_1552358 Arabidopsis thaliana fah1
            gene for ferulate-5-hydroxylase, exons 1-3 NC-1
            ecotype.>gb:ATH295578_1552361 Arabidopsis thaliana fah1
            gene for ferulate-5-hydroxylase, exons 1-3 CHA-0
            ecotype.>gb:ATH295579_1552362 Arabidopsis thaliana fah1
            gene for ferulate-5-hydroxylase, exons 1-3 PER-1
            ecotype.>gb:ATU38416_1556950 Arabidopsis thaliana
            ferulate-5-hydroxylase (FAH1) mRNA, complete
            cds.>gb:AF068574_1765642 Arabidopsis thaliana
            ferulate-5-hydroxylase (F5H) gene, complete cds.
          Length = 520

 Score =  233 bits (593), Expect = 1e-59
 Identities = 162/526 (30%), Positives = 259/526 (49%), Gaps = 21/526 (3%)
 Frame = +2

Query: 53   SSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPV 232
            S ++ ++  + + F  R++    PP   G WPIIG++          + L+  A KYG +
Sbjct: 18   SLVIVVSLFIFISFITRRRRPPYPPGPRG-WPIIGNM--LMMDQLTHRGLANLAKKYGGL 74

Query: 233  FTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRR 412
              +R+G   +  VSS E  R      D + + RP T A  YL YD A   F+    +WR+
Sbjct: 75   CHLRMGFLHMYAVSSPEVARQVLQVQDSVFSNRPATIAISYLTYDRADMAFAHYGPFWRQ 134

Query: 413  VRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTL 592
            +RK+ V ++ S +R E     W S ++  + ++   +S +   P    +N+      LT 
Sbjct: 135  MRKVCVMKVFSRKRAES----WAS-VRDEVDKMVRSVSCNVGKP----INVGEQIFALTR 185

Query: 593  NLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEG 772
            N+  +   G   E   D  I     R+ + FS+   L+G F   D I    +F W+D +G
Sbjct: 186  NITYRAAFGSACEKGQDEFI-----RILQEFSK---LFGAFNVADFIP---YFGWIDPQG 234

Query: 773  HVKTMKRAAKDVDAILQDWVDARRKERRSNE--------DQKFIDVMLSMIDDQ------ 910
              K + +A  D+D  + D +D   K++ +          D   +D +L+   ++      
Sbjct: 235  INKRLVKARNDLDGFIDDIIDEHMKKKENQNAVDDGDVVDTDMVDDLLAFYSEEAKLVSE 294

Query: 911  ---FTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNI 1081
                      +RD  IKAI++ ++   +ET A+ + W L  LL+ PE LKRVQ E+   +
Sbjct: 295  TADLQNSIKLTRDN-IKAIIMDVMFGGTETVASAIEWALTELLRSPEDLKRVQQELAEVV 353

Query: 1082 GKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNV 1261
            G +R  E+SD++ L YL+  +KETLRM+P  P L  HE  ED  +DG+ IPK +++ +N 
Sbjct: 354  GLDRRVEESDIEKLTYLKCTLKETLRMHPPIPLLL-HETAEDTSIDGFFIPKKSRVMINA 412

Query: 1262 WRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVA 1441
            + + RDP  W DP+ F P RF+     +  +   ++F+PFG GRRSCPG         +A
Sbjct: 413  FAIGRDPTSWTDPDTFRPSRFLEPGVPD-FKGSNFEFIPFGSGRRSCPGMQLGLYALDLA 471

Query: 1442 VARLFQGFNF----STVPNEPLDMMEDVGIILPKLTPLEVLVTPRL 1567
            VA +   F +       P+E LDM +  G+  PK T L  + T RL
Sbjct: 472  VAHILHCFTWKLPDGMKPSE-LDMNDVFGLTAPKATRLFAVPTTRL 516



>gb:OSJN00041_1693755 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0046P18, complete
            sequence.>gb:OSJN00229_1697069 Oryza sativa genomic DNA,
            chromosome 4, BAC clone: OSJNBa0017P10, complete
            sequence.
          Length = 546

 Score =  232 bits (592), Expect = 2e-59
 Identities = 158/493 (32%), Positives = 250/493 (50%), Gaps = 12/493 (2%)
 Frame = +2

Query: 122  PPEAGGAWPII--GHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRD 295
            PP A  A P    GHLH F+   PL + LS  A  +GPV  +  G   +L V+      +
Sbjct: 55   PPPAEPAVPPRHRGHLHLFKK--PLHRALSGLAATHGPVLLLHFGSRAVLHVTDPAVAEE 112

Query: 296  CFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHV 475
            C   +D   A RP   +  +L   Y     S+    WR +R++   E+ S+ RL +   V
Sbjct: 113  CLTDHDVTFANRPRLPSSCHLSNGYTTLGSSSYGPNWRNLRRIATVEVFSAHRLLRSADV 172

Query: 476  WVSELQTNIKELYTFISMDNNNPSAP-KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTI 652
               E+    + LY  ++     PS P + ++      L LN++ ++VAG++Y Y  +G  
Sbjct: 173  RGGEVPHMARWLY--LAAPAAGPSEPARADVKARAFELVLNVVARMVAGKQY-YGGEGDA 229

Query: 653  N---EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQ 823
                EEA R +++  +   + G     D +  L     +D  G  +   + +++ +   Q
Sbjct: 230  EAETEEAARFREMVREYFAMHGASNLQDFVLLLGL---VDIGGAKRRAVKLSRERNTWAQ 286

Query: 824  DWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATH 1003
              +D  R    +    +   ++  ++  Q ++  +YS D VI A+ L+     ++T ++ 
Sbjct: 287  RLIDEHRATATAAAATEARTMVGDLLKMQASEPEAYS-DKVITALCLT----GTDTSSST 341

Query: 1004 LTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYL 1183
            + W +A+LL HP ++ + + EID  +G  R  E++D+ NLPYLQ +++E LR+YP GP L
Sbjct: 342  IEWGMALLLNHPAAMAKARAEIDRFVGTGRVVEEADLPNLPYLQCIIRENLRLYPVGPLL 401

Query: 1184 APHEAVEDCIVD-----GYHIPKGTQLYVNVWRLHRDPKIW-PDPEKFLPERFMTNLEGE 1345
            APHE+  DC V       Y +P GT L VNV  +HRD + W PDPE F PERF      E
Sbjct: 402  APHESSADCSVSVAGGGRYAVPAGTMLLVNVHAMHRDARFWGPDPESFSPERF------E 455

Query: 1346 AAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIIL 1525
              ++     +PFG+GRR CPG   A ++  +A+A L Q F +  V +E +DM E  G+ +
Sbjct: 456  GGRSEGKWMLPFGMGRRRCPGEGLAVKVVGLALATLVQCFEWRRVGDEEVDMTEGSGLTM 515

Query: 1526 PKLTPLEVLVTPR 1564
            PK  PLE L  PR
Sbjct: 516  PKAVPLEALYWPR 528



>gb:AY082611_1569190 Ocimum basilicum p-coumaroyl shikimate
            3'-hydroxylase isoform 1 mRNA, complete cds.
          Length = 512

 Score =  232 bits (592), Expect = 2e-59
 Identities = 148/509 (29%), Positives = 256/509 (50%), Gaps = 3/509 (0%)
 Frame = +2

Query: 68   IAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRL 247
            + A+ LL   + +   RLPP      PI+G+L+  +      +  ++WA  YGP+ ++  
Sbjct: 14   LPAIFLLHHLYYRLRFRLPP-GPRPLPIVGNLYDVKPV--RFRCFADWAQSYGPIISVWF 70

Query: 248  GISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLV 427
            G +  ++VS+ E  ++     D+ LA R  + +      D     ++    ++ +VRK+ 
Sbjct: 71   GSTLNVIVSNTELAKEVLKEKDQQLADRHRSRSAAKFSRDGQDLIWADYGPHYVKVRKVC 130

Query: 428  VEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQ 607
              E+ S +RLE L+ +   E+   ++ +Y   +  +N  +   + + ++ G +  N I +
Sbjct: 131  TLELFSPKRLEALRPIREDEVTAMVESIYHDCTAPDN--AGKSLLVKKYLGAVAFNNITR 188

Query: 608  IVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTM 787
            +  G+R+   S+G I+++    K + S  + L       + I  L +   LD +   K  
Sbjct: 189  LAFGKRF-VNSEGIIDKQGLEFKAIVSNGLKLGASLAMAEHIPSLRWMFPLDEDAFAKHG 247

Query: 788  KRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLS 967
             R  +    I+++   AR  E      Q F D +L++ D      Y  S DT+I  ++  
Sbjct: 248  ARRDQLTREIMEEHTRAR--EESGGAKQHFFDALLTLKDK-----YDLSEDTII-GLLWD 299

Query: 968  MLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVK 1147
            M+    +T A  + W +A L+K+P   ++ Q+E+D  IG ER   + D  NLPYLQ V K
Sbjct: 300  MITAGMDTTAISVEWAMAELIKNPRVQQKAQEELDRVIGYERVMTELDFSNLPYLQCVAK 359

Query: 1148 ETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFM 1327
            E LR++P  P + PH +  +  + GY IPKG+ ++VNVW + RDP +W +P +F PERF+
Sbjct: 360  EALRLHPPTPLMLPHRSNSNVKIGGYDIPKGSNVHVNVWAVARDPAVWKNPCEFRPERFL 419

Query: 1328 TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF---STVPNEPLD 1498
               E    +   ++ +PFG GRR CPG      +    +  L   FN+   S V ++ LD
Sbjct: 420  E--EDVDMKGHDFRLLPFGAGRRVCPGAQLGINLVTSMIGHLLHHFNWAPPSGVSSDELD 477

Query: 1499 MMEDVGIILPKLTPLEVLVTPRLSPTLFR 1585
            M E+ G++    TPLE + TPRL   L++
Sbjct: 478  MGENPGLVTYMRTPLEAVPTPRLPSDLYK 506



>gb:AX028821_1457170 Sequence 5 from Patent WO9732023.
          Length = 512

 Score =  232 bits (592), Expect = 2e-59
 Identities = 156/518 (30%), Positives = 254/518 (49%), Gaps = 9/518 (1%)
 Frame = +2

Query: 38   VPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWAD 217
            VPC       I   +LL+    K+ K LPP     WPI+G+L H        ++++  A 
Sbjct: 21   VPCTF-----ILGFLLLYSFLNKKVKPLPP-GPKPWPIVGNLPHLGPKPH--QSMAALAR 72

Query: 218  KYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNN 397
             +GP+  +++G   ++V SS          +D   ++RP     K++ Y+Y    F+   
Sbjct: 73   VHGPLIHLKMGFVHVVVASSASVAEKFLKVHDANFSSRPPNSGAKHVAYNYQDLVFAPYG 132

Query: 398  SYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWF 577
              WR +RK+    + S++ L    HV     Q  +  L   ++     P    + + +  
Sbjct: 133  PRWRMLRKICALHLFSAKALNDFTHV----RQDEVGILTRVLADAGETP----LKLGQMM 184

Query: 578  GHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRW 757
                 N I +++ GRR    +D     +A+  K +  ++M L G F  GD I PL     
Sbjct: 185  NTCATNAIARVMLGRRVVGHADS----KAEEFKAMVVELMVLAGVFNLGDFIPPL---EK 237

Query: 758  LDYEGHVKTMKRAAKDVDA----ILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGY 925
            LD +G +  MK+     D+    IL D       E + + D   +++++S+ D    +G 
Sbjct: 238  LDLQGVIAKMKKLHLRFDSFLSKILGDHKINSSDETKGHSD--LLNMLISLKDADDAEGG 295

Query: 926  SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED 1105
              + D  IKA++L++    ++T ++ + W +A L++HPE L +VQ E+D+ +GK R  ++
Sbjct: 296  RLT-DVEIKALLLNLFAAGTDTTSSTVEWCIAELVRHPEILAQVQKELDSVVGKNRVVKE 354

Query: 1106 SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK 1285
            +D+  LP+LQ VVKE  R++P  P   P  A E C V+GY IPKG+ L VNVW + RDP 
Sbjct: 355  ADLAGLPFLQAVVKENFRLHPSTPLSLPRIAHESCEVNGYLIPKGSTLLVNVWAIARDPN 414

Query: 1286 IWPDPEKFLPERFMTNLE--GEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQ 1459
            +W +P +F PERF+   E      +   ++ +PFG GRR C G     ++ Q+  A L  
Sbjct: 415  VWDEPLEFRPERFLKGGEKPNVDVRGNDFELIPFGAGRRICAGMSLGIRMVQLLTATLNH 474

Query: 1460 GFNFSTVPN---EPLDMMEDVGIILPKLTPLEVLVTPR 1564
             F+F        E L+M E  G+ L +  PL V   PR
Sbjct: 475  AFDFDLADGQLPESLNMEEAYGLTLQRADPLVVHPKPR 512



>gb:ATH295576_1552359 Arabidopsis thaliana fah1 gene for
            ferulate-5-hydroxylase, exons 1-3 RI-0
            ecotype.>gb:ATH295577_1552360 Arabidopsis thaliana fah1
            gene for ferulate-5-hydroxylase, exons 1-3 RSCH-0
            ecotype.
          Length = 520

 Score =  232 bits (591), Expect = 2e-59
 Identities = 161/524 (30%), Positives = 258/524 (49%), Gaps = 21/524 (4%)
 Frame = +2

Query: 59   ILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFT 238
            ++ ++  + + F  R++    PP   G WPIIG++          + L+  A KYG +  
Sbjct: 20   VIVVSLFIFISFITRRRRPPYPPGPRG-WPIIGNM--LMMDQLTHRGLANLAKKYGGLCH 76

Query: 239  IRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVR 418
            +R+G   +  VSS E  R      D + + RP T A  YL YD A   F+    +WR++R
Sbjct: 77   LRMGFLHMYAVSSPEVARQVLQVQDSVFSNRPATIAISYLTYDRADMAFAHYGPFWRQMR 136

Query: 419  KLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNL 598
            K+ V ++ S +R E     W S ++  + ++   +S +   P    +N+      LT N+
Sbjct: 137  KVCVMKVFSRKRAES----WAS-VRDEVDKMVRSVSCNVGKP----INVGEQIFALTRNI 187

Query: 599  IMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHV 778
              +   G   E   D  I     R+ + FS+   L+G F   D I    +F W+D +G  
Sbjct: 188  TYRAAFGSACEKGQDEFI-----RILQEFSK---LFGAFNVADFIP---YFGWIDPQGIN 236

Query: 779  KTMKRAAKDVDAILQDWVDARRKERRSNE--------DQKFIDVMLSMIDDQ-------- 910
            K + +A  D+D  + D +D   K++ +          D   +D +L+   ++        
Sbjct: 237  KRLVKARNDLDGFIDDIIDEHMKKKENQNAVDDGDVVDTDMVDDLLAFYSEEAKLVSETA 296

Query: 911  -FTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK 1087
                    +RD  IKAI++ ++   +ET A+ + W L  LL+ PE LKRVQ E+   +G 
Sbjct: 297  DLQNSIKLTRDN-IKAIIMDVMFGGTETVASAIEWALTELLRSPEDLKRVQQELAEVVGL 355

Query: 1088 ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR 1267
            +R  E+SD++ L YL+  +KETLRM+P  P L  HE  ED  +DG+ IPK +++ +N + 
Sbjct: 356  DRRVEESDIEKLTYLKCTLKETLRMHPPIPLLL-HETAEDTSIDGFFIPKKSRVMINAFA 414

Query: 1268 LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA 1447
            + RDP  W DP+ F P RF+     +  +   ++F+PFG GRRSCPG         +AVA
Sbjct: 415  IGRDPTSWTDPDTFRPSRFLEPGVPD-FKGSNFEFIPFGSGRRSCPGMQLGLYALDLAVA 473

Query: 1448 RLFQGFNF----STVPNEPLDMMEDVGIILPKLTPLEVLVTPRL 1567
             +   F +       P+E LDM +  G+  PK T L  + T RL
Sbjct: 474  HILHCFTWKLPDGMKPSE-LDMNDVFGLTAPKATRLFAVPTTRL 516



>gb:AB113262_1527233 Ipomoea purpurea Pink mRNA for flavonoid
            3'-hydroxylase, complete cds.>gb:AB113265_1527236 Ipomoea
            purpurea Pink gene for flavonoid 3'-hydroxylase, complete
            cds, strain: YO/FP-39.>gb:AY333419_1600104 Ipomoea
            purpurea flavonoid 3'-hydroxylase (F3'H) gene,
            F3'H-purple allele, complete cds.
          Length = 519

 Score =  232 bits (591), Expect = 2e-59
 Identities = 141/517 (27%), Positives = 252/517 (48%), Gaps = 14/517 (2%)
 Frame = +2

Query: 80   VLLWFSWRKQSKRLP---PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLG 250
            + L+F   +  +R P   P     WP++G+L H        ++++  A+++GP+  +R+G
Sbjct: 15   IFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPH--QSIAAMAERHGPLMHLRMG 72

Query: 251  ISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVV 430
               ++V +S          +D   + RP     +++ Y+Y    F+     WR +RK+  
Sbjct: 73   FVDVVVAASAAVAAQFLKVHDANFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITS 132

Query: 431  EEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQI 610
              + S++ L+   HV   E+ T  + L +             V + +     T N + ++
Sbjct: 133  VHLFSAKALDDFCHVRQEEVATLTRSLAS--------AGKTPVKLGQLLNVCTTNALARV 184

Query: 611  VAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMK 790
            + GR+         + +A+  K +  ++M L G F  GD I P+    W D +G V  MK
Sbjct: 185  MLGRKVFNDGGSKSDPKAEEFKSMVEEMMVLAGSFNIGDFI-PI--LGWFDLQGIVGKMK 241

Query: 791  RAAKDVDAILQDWVDARR----KERRSNEDQKFIDVMLSMIDDQFTQGYSYSR--DTVIK 952
            +     DA L   ++  +    +    ++D  F+  ++ + D+         +  DT IK
Sbjct: 242  KLHARFDAFLNSILEEHKFVNNQHTTLSKDVDFLTTLIRLKDNGADTDSEEGKLTDTEIK 301

Query: 953  AIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYL 1132
            A++L++    ++T ++ + W  A LL++P+ L + Q E+D+ +G+ R   +SD+ +LP+L
Sbjct: 302  ALLLNLFTAGTDTSSSTVEWAFAELLRNPKILNQAQQELDSVVGQNRLVTESDLTHLPFL 361

Query: 1133 QGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFL 1312
            Q +VKET R++P  P   P    + C ++GY IPKG  L VNVW + RDP +W +P +F 
Sbjct: 362  QAIVKETFRLHPSTPLSLPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFK 421

Query: 1313 PERFMTNLE--GEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN 1486
            P RF+   E      +   ++ +PFG GRR C G     ++  + VA L   F++  +  
Sbjct: 422  PHRFLPGGEKPNVDIKGNDFEVIPFGAGRRICSGMSLGIRMVHLLVATLVHAFDWDLMNG 481

Query: 1487 ---EPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFRL 1588
               E L+M E  G+ L +  PL +   PRL P L+ L
Sbjct: 482  QSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL 518



>sp|Q9LVD2|C72A_ARATH Cytochrome P450 71B10 (EC
            1.14.-.-).>gb:AB019233_1514195 Arabidopsis thaliana
            genomic DNA, chromosome 5, P1 clone:MJB24.
          Length = 502

 Score =  232 bits (591), Expect = 2e-59
 Identities = 157/516 (30%), Positives = 265/516 (51%), Gaps = 14/516 (2%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGP 229
            +S IL I+ L++     +++  R PP   G  PIIG+LH     +P  ++L + + KYGP
Sbjct: 7    VSLILLISILLVAVKHSKRRWVRQPPSPPGL-PIIGNLHQLG-ELPH-QSLCKLSKKYGP 63

Query: 230  VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWR 409
            V  ++LG    ++VS+ E  +      D    +RP+    + L Y+Y    FS  + YW+
Sbjct: 64   VMLLKLGRVPTVIVSTPETAKQVLKDYDLHCCSRPSLEGTRKLSYNYLDIAFSRFDDYWK 123

Query: 410  RVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLT 589
             +RKL VEE+  ++R+  ++ +  +E++  I  +    S          VN+S  F  L 
Sbjct: 124  ELRKLCVEELFCNKRINSIQPIKEAEMEKLIDSIAESASQKT------LVNLSDTFLSLN 177

Query: 590  LNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL--WFFRWLD 763
            +N+I + V G  ++    GT+     + + +  + + + G F + D  FP   W   W  
Sbjct: 178  VNVICKAVFGVNFQ----GTVLNN-DKFQDLVHEALEMLGSFSASD-FFPYVGWIVDW-- 229

Query: 764  YEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDT 943
            + G     +R+ +D+DA  +  +D   ++ R   +  F+D++L +  ++   GY      
Sbjct: 230  FTGLHARRERSVRDLDAFYEQMIDLHLQKNREESEDDFVDLLLRLEKEEAVLGYGKLTRN 289

Query: 944  VIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE---RWAEDSDV 1114
             IKAI++++L     T A  +TW +A L+++P  +K+VQ EI   IGK    R     ++
Sbjct: 290  HIKAILMNILLGGINTSAITMTWAMAELIRNPRVMKKVQSEIRAQIGKNNKTRIISLDEI 349

Query: 1115 KNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWP 1294
             +L YL  V+KET R++P  P L P E + +  ++GY I   T+L+VNVW + RDP+IW 
Sbjct: 350  NHLSYLNMVIKETCRLHPVAPLLVPREVISEFKINGYTIQPKTRLHVNVWAIGRDPEIWK 409

Query: 1295 DPEKFLPERFM-TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF 1471
            DPE+FLPERFM  +++    + + Y+ +PFG GRR CP         +  +A L   F++
Sbjct: 410  DPEEFLPERFMDCDID---VKGQDYELLPFGSGRRICPAVYMGITTVEFGLANLLYHFDW 466

Query: 1472 ST---VPNEPLDMMEDVGIILPK-----LTPLEVLV 1555
                 V  E + M E  G+   K     L P++ LV
Sbjct: 467  KLPEGVAVEDIYMDEASGLTSHKKHDLLLVPVKSLV 502



>gb:AY054214_1563035 Arabidopsis thaliana AT4g37310/C7A10_50 mRNA,
            complete cds.>gb:BT010179_1640245 Arabidopsis thaliana
            At4g37310/C7A10_50 mRNA, complete cds.
          Length = 414

 Score =  231 bits (589), Expect = 3e-59
 Identities = 132/412 (32%), Positives = 227/412 (55%), Gaps = 6/412 (1%)
 Frame = +2

Query: 347  GKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFIS 526
            GKY+ YDY     +    +WR +R++   E+ S+ RL     +   E++  +++L+    
Sbjct: 2    GKYVAYDYTSMVTAPYGDHWRNLRRITALEVFSTNRLNASAEIRHDEVKMLLQKLH---- 57

Query: 527  MDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLW 706
             D +     KV + +    LTLN+IM+++ G+R+    DG     +   +++ ++++ L 
Sbjct: 58   -DLSVERPAKVELRQLLTGLTLNVIMRMMTGKRFFEEDDGGKAGISLEFRELVAEILELS 116

Query: 707  GEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQ-KFID 883
                  D +  L   RW DY+G VK  KR  + +D++LQ ++D    E R+N+D+ +F +
Sbjct: 117  AADNPADFLPAL---RWFDYKGLVKRAKRIGERMDSLLQGFLD----EHRANKDRLEFKN 169

Query: 884  VMLS-MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQ 1060
             M++ ++D Q  + ++YS D  IK ++L M+   ++T A  + W ++ LL HP+ L+  +
Sbjct: 170  TMIAHLLDSQEKEPHNYS-DQTIKGLILMMVVGGTDTSALTVEWAMSNLLNHPQILETTR 228

Query: 1061 DEIDTNI---GKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHI 1231
              IDT +      R  ++ D+ N+ YL+ VV ETLR+YP  P + PH    DC++ G+++
Sbjct: 229  QNIDTQMETSSSRRLLKEEDLVNMNYLKNVVSETLRLYPVAPLMVPHVPSSDCVIGGFNV 288

Query: 1232 PKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG-EAAQNRQYQFVPFGLGRRSCPG 1408
            P+ T + VN+W +HRDP +W DP  F PERF    EG +   +   + +PFGLGRR+CPG
Sbjct: 289  PRDTIVLVNLWAIHRDPSVWDDPTSFKPERF----EGSDQFGHYNGKMMPFGLGRRACPG 344

Query: 1409 NLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPR 1564
               A ++  + +  + Q F + +     +DM E  G+ LPK  PL V    R
Sbjct: 345  LSLANRVVGLLLGSMIQCFEWESGSGGQVDMTEGPGLSLPKAEPLVVTCRTR 396



>gb:AJ583530_1811350 Triticum aestivum mRNA for cytochrome P450
            (CYP98A10 gene).
          Length = 511

 Score =  231 bits (588), Expect = 4e-59
 Identities = 150/522 (28%), Positives = 260/522 (49%), Gaps = 9/522 (1%)
 Frame = +2

Query: 29   MDAVPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSE 208
            MDA      +I  +A  + L    R +  RLPP     WP++G+L   +   P+ +   E
Sbjct: 1    MDAASLLPFAIALVAIPISLALLDRLRLGRLPP-GPRPWPVVGNLRQIK---PVRRCFQE 56

Query: 209  WADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFS 388
            WA++YGP+ ++  G S  +VVS+ E  ++    +D+ LA RP   + +    +     ++
Sbjct: 57   WAERYGPIISVWFGSSLTVVVSTSELAKEVLKEHDQQLADRPRNRSTQRFSRNGQDLIWA 116

Query: 389  TNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMS 568
                ++ +VRKL   E+ + +RLE L+ +   E+   ++ ++   +    N   P V + 
Sbjct: 117  DYGPHYIKVRKLCNLELFTQKRLEALRSIREDEVTAMVESVHR-AAAGPGNEGKPLV-VR 174

Query: 569  RWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWF 748
                 ++ N I ++  G+R+   ++G I+EE Q  K + +  + +       + I   W+
Sbjct: 175  NHLAMVSFNNITRLAFGKRF-MNANGDIDEEGQEFKIIVNNGIKIGASLSVAEYI---WY 230

Query: 749  FRWLD------YEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQ 910
             RWL       Y+ H +   R  K    I+++   A ++       Q F+D + ++    
Sbjct: 231  LRWLCPLNEELYKTHNERRDRLTKK---IIEEHAQALQER---GAKQHFVDALFTL---- 280

Query: 911  FTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE 1090
              + Y  S DTV   ++  M+    +T    + W +A L+++P   K++Q+E+D+ +G++
Sbjct: 281  -REKYDLSDDTVF-GLLWDMITAGMDTTVISVEWAMAELVRNPRVQKKLQEELDSVVGRD 338

Query: 1091 RWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRL 1270
            R   ++D  NLPYL  VVKE+LR++P  P + PH+A     V GY IPKG  + VNVW +
Sbjct: 339  RVMSETDFPNLPYLMAVVKESLRLHPPTPLMLPHKASASVKVGGYSIPKGANVMVNVWAV 398

Query: 1271 HRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVAR 1450
             RDPK+W  P +F PERF+   E    +   ++ +PFG GRR CPG      +    +  
Sbjct: 399  ARDPKVWSSPLEFRPERFLE--ESIDIKGSDFRVLPFGAGRRVCPGAQLGINLVASMIGH 456

Query: 1451 LFQGFNFSTVPN---EPLDMMEDVGIILPKLTPLEVLVTPRL 1567
            +   F +S       E + MME  G++    TPL+ + TPRL
Sbjct: 457  MLHHFEWSLPEGARPEDISMMESPGLVTFMGTPLQAVATPRL 498



>sp|O64636|C7C1_ARATH Cytochrome P450 76C1 (EC
            1.14.-.-).>pir|T00869|T00869 probable cytochrome P450
            [imported] - Arabidopsis thaliana>gb:AY078939_1568100
            Arabidopsis thaliana At2g45560/F17K2.9 mRNA, complete
            cds.>gb:AY124874_1580239 Arabidopsis thaliana
            At2g45560/F17K2.9 mRNA, complete cds.
          Length = 512

 Score =  231 bits (588), Expect = 4e-59
 Identities = 155/480 (32%), Positives = 261/480 (54%), Gaps = 11/480 (2%)
 Frame = +2

Query: 146  PIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLA 325
            PIIG++H         ++ +E +  YGPV +++LG    +V++S EA R+   T+D++L+
Sbjct: 46   PIIGNIHLVGKHPH--RSFAELSKTYGPVMSLKLGSLNTVVIASPEAAREVLRTHDQILS 103

Query: 326  ARPTTCAGKYLGY-DYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNI 502
            AR  T A + + + D ++    ++++ WR +R+L V ++LS +R+E  K + +++    +
Sbjct: 104  ARSPTNAVRSINHQDASLVWLPSSSARWRLLRRLSVTQLLSPQRIEATKALRMNK----V 159

Query: 503  KELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSD-GTINEEAQRLKK 679
            KEL +FIS  ++   +  V++SR     TLN+I  I+      +  D G+ N +A  +  
Sbjct: 160  KELVSFISESSDREES--VDISRVAFITTLNIISNIL------FSVDLGSYNAKAS-ING 210

Query: 680  VFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRS 859
            V   V+ +     + DA     F R+LD +G+VKT K   + +  + + ++DA+  E+ S
Sbjct: 211  VQDTVISVMDAAGTPDAANYFPFLRFLDLQGNVKTFKVCTERLVRVFRGFIDAKIAEKSS 270

Query: 860  NEDQK------FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILA 1021
              + K      F+D +L    D+     S      I+ ++L M    ++T ++ L W + 
Sbjct: 271  QNNPKDVSKNDFVDNLLDYKGDESELSISD-----IEHLLLDMFTAGTDTSSSTLEWAMT 325

Query: 1022 VLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAV 1201
             LLK+P+++ + Q EID  IG+    E+SD+  LPYLQ VVKET R++   P L P +A 
Sbjct: 326  ELLKNPKTMAKAQAEIDCVIGQNGIVEESDISKLPYLQAVVKETFRLHTPVPLLIPRKAE 385

Query: 1202 EDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPF 1381
             D  + G+ + K TQ+ VNVW + RDP +W +P +F PERF+   +    + R Y+  PF
Sbjct: 386  SDAEILGFMVLKDTQVLVNVWAIGRDPSVWDNPSQFEPERFLG--KDMDVRGRDYELTPF 443

Query: 1382 GLGRRSCPGNLYATQITQVAVARLFQGFNFST---VPNEPLDMMEDVGIILPKLTPLEVL 1552
            G GRR CPG   A +   + +A L   F++     V +E LDM E  G+ L K  PL  +
Sbjct: 444  GAGRRICPGMPLAMKTVSLMLASLLYSFDWKLPKGVLSEDLDMDETFGLTLHKTNPLHAV 503



>gb:AP005878_1859536 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC
            clone:OSJNBb0012I09.>gb:AP005893_1859761 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 9, BAC
            clone:OSJNBa0030K05.
          Length = 509

 Score =  230 bits (587), Expect = 6e-59
 Identities = 156/520 (30%), Positives = 264/520 (50%), Gaps = 17/520 (3%)
 Frame = +2

Query: 53   SSILGIAALVLLWFSW----RKQSKRLPPEAGGAW--PIIGHLHHFRTSVPLVKTLSEWA 214
            S +L +AA+ +L        R +  R PP   G W  P+IG +HH    +P  K L E A
Sbjct: 8    SLLLSVAAVTVLQLLKLLLVRHRRPRTPP---GPWRLPVIGSMHHLVNVLPHRK-LRELA 63

Query: 215  DKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTN 394
              +GP+  ++LG + ++V +S E  R    T+D   A RP   AG+ +GY++    FS +
Sbjct: 64   AVHGPLMMLQLGETPLVVATSKETARAVLKTHDTNFATRPRLLAGEIVGYEWVDILFSPS 123

Query: 395  NSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRW 574
              YWR++R+L   EILS +R+   +H+   E+   + E+          P+ P VN+S  
Sbjct: 124  GDYWRKLRQLCAAEILSPKRVLSFRHIREDEVMMRVNEIRAA------GPTTP-VNLSVM 176

Query: 575  FGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR 754
            F  +T +++ +   G++ +          A+ L  + S V    G  +    +FP W   
Sbjct: 177  FHSVTNSIVSRAAFGKKRK--------NAAEFLAAIKSGVGLASGFNIPD--LFPTWTGI 226

Query: 755  WLDYEGHVKTMKRAAKDVDAILQDWVDARRKER-------RSNEDQKFIDVMLSMIDDQF 913
                 G  ++++     VD IL++ +  R+  R         N D+  +DV++ +   Q 
Sbjct: 227  LATVTGMKRSLRAIYTTVDGILEEIIAERKGIRDEKISGGAENVDENLVDVLIGL---QG 283

Query: 914  TQGYSYSRD-TVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE 1090
              G+ +  D + IKAI+L M    + T A+ + W ++ L+++P  +K++Q EI   +  +
Sbjct: 284  KGGFGFHLDNSKIKAIILDMFAGGTGTSASAMEWGMSELMRNPSVMKKLQAEIREVLRGK 343

Query: 1091 RWAEDSDVK--NLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW 1264
                ++D++  NL YL+ V++E LR++P  P L P E+++ C +DGY IP  +++ +N W
Sbjct: 344  ATVTEADMQAGNLRYLKMVIREALRLHPPAPLLVPRESIDVCELDGYTIPAKSRVIINAW 403

Query: 1265 RLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAV 1444
             + RDPK W +PE+F PERF          N  Y+F+PFG GRR CPG  Y     ++  
Sbjct: 404  AIGRDPKYWDNPEEFRPERFEDGTLDFTGSN--YEFIPFGSGRRMCPGFNYGLASMELMF 461

Query: 1445 ARLFQGFNFSTVPN-EPLDMMEDVGIILPKLTPLEVLVTP 1561
              L   F++S       +DM E  G+ + + +PL +  TP
Sbjct: 462  TGLLYHFDWSLPEGVNEVDMAEAPGLGVRRRSPLMLCATP 501



>sp|Q9LIP3|C72Y_ARATH Cytochrome P450 71B37 (EC 1.14.-.-).
          Length = 500

 Score =  230 bits (587), Expect = 6e-59
 Identities = 157/515 (30%), Positives = 261/515 (50%), Gaps = 6/515 (1%)
 Frame = +2

Query: 38   VPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWAD 217
            +P    S L +AAL L     R+Q +R PP   G +PIIG+LH     +P  ++L   + 
Sbjct: 7    LPLLFLSCLLLAALRL---KKRRQHQRKPPSPPG-FPIIGNLHQLG-ELPH-QSLWSLSK 60

Query: 218  KYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNN 397
            KYGPV  ++ G    +VVSS E  +     +D    +RP+    + L Y+Y    FS  N
Sbjct: 61   KYGPVMLLKFGSIPTVVVSSSETAKQALKIHDLNCCSRPSLAGPRALSYNYLDIVFSPFN 120

Query: 398  SYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWF 577
             YW+ +R++ V+E+ S +++  ++ +   E    +K+L    S   +      VN+S   
Sbjct: 121  DYWKELRRMCVQELFSPKQVHLIQPIREEE----VKKLMN--SFSESAAQKTPVNLSEKL 174

Query: 578  GHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL--WFF 751
              LT+ +I +   G  ++    GT+       K +    ++L G F + D  FP   W  
Sbjct: 175  ASLTVGVICKAAFGVSFQ----GTVLNSDNFDKLIHDAFLFL-GSFSASD-YFPNVGWII 228

Query: 752  RWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSY 931
             WL   G     +R+ + +DA  +   D  ++  +   +  F+D++L +  ++   GY  
Sbjct: 229  DWLT--GLQGQRERSVRGLDAFYEQMFDLHKQGNKEGVED-FVDLLLKLEKEETVLGYGK 285

Query: 932  SRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSD 1111
                 IKA+++++L     T A  +TW +  L+++P  +K+VQ EI   IG +      D
Sbjct: 286  LTRNHIKAVLMNVLLGGIGTSAITMTWAMTELMRNPRVMKKVQSEIRNQIGGKSMICLDD 345

Query: 1112 VKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIW 1291
            +  L YL+ V+ ET R++P  P L P E + +  ++GY IP  T+LYVNVW + RDP  W
Sbjct: 346  IDQLHYLKMVINETWRLHPPAPLLVPREVMSEFEINGYTIPAKTRLYVNVWGIGRDPDTW 405

Query: 1292 PDPEKFLPERFM-TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFN 1468
             DPE+FLPERF+ +N++   A+ + ++ +PFG GRR CP     T + +  +A L   F+
Sbjct: 406  KDPEEFLPERFVNSNID---AKGQNFELLPFGSGRRMCPAMYMGTTMVEFGLANLLYHFD 462

Query: 1469 FSTVPN---EPLDMMEDVGIILPKLTPLEVLVTPR 1564
            +        E +DM E  G+   K    E+++ PR
Sbjct: 463  WKLPEGMVVEDIDMEESPGLNASKKN--ELVLVPR 495



>gb:AY072124_1567018 Arabidopsis thaliana putative cytochrome P450
            protein (At2g02580) mRNA, complete cds.
          Length = 500

 Score =  230 bits (586), Expect = 8e-59
 Identities = 154/510 (30%), Positives = 258/510 (50%), Gaps = 8/510 (1%)
 Frame = +2

Query: 56   SILGIAALVLLWFSWRKQ--SKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGP 229
            S+L +  ++L  F  +K+  +++ PP   G +PIIG+LH     +P  ++L   +  YGP
Sbjct: 8    SLLFLCCILLAAFKHKKRRTNQQQPPSPPG-FPIIGNLHQLG-ELPH-QSLWSLSKTYGP 64

Query: 230  VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWR 409
            V  ++LG    +VVSS E  +     ND    +RP+    K L Y+Y    FS  + YW+
Sbjct: 65   VMLLKLGSVPTVVVSSSETAKQVLKINDLHCCSRPSLAGAKELSYNYLDIAFSPFDDYWK 124

Query: 410  RVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLT 589
             +R++ V+E+ S++R+  ++ +   E++  I      +S   +      VN+S  F  LT
Sbjct: 125  ELRRICVQELFSAKRVHSIQPIKEEEVRKLI------VSATESASQKSPVNLSEKFLDLT 178

Query: 590  LNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL--WFFRWLD 763
            +++I +      +       +N +     K+        G F S    FP   W   WL 
Sbjct: 179  VSVICKAAFSLDFH---TSVLNNDG--FDKLIHDAFLFLGSF-SASNFFPNGGWIIDWLT 232

Query: 764  YEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDT 943
              G  +  +++ KD+D   Q   D  ++E +   +  F+D++L +  ++   GY      
Sbjct: 233  --GLQRRREKSVKDLDVFYQQMFDLHKQENKQGVED-FVDLLLKLEKEETVLGYGKLTRN 289

Query: 944  VIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNL 1123
             +KAI++++L  A  T A  +TW +A L+++   +K+VQ EI   +  +      D+ +L
Sbjct: 290  HVKAILMNVLLGAINTSAMTMTWAMAELIRNARVMKKVQSEIRNQMINKSVITLDDIDHL 349

Query: 1124 PYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPE 1303
            PYL+ V+KET R++P  P L P E + +  ++GY I   T LYVNVW + RDP  W D +
Sbjct: 350  PYLKMVIKETWRLHPPVPLLLPREVMSEFEINGYKIQPKTLLYVNVWAIGRDPDSWKDAD 409

Query: 1304 KFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVP 1483
             F PERFM N      QN  ++ +PFG GRR CPG    T + +  +A +   F++  VP
Sbjct: 410  MFYPERFMDNNIDAKGQN--FELLPFGSGRRICPGMYMGTTMVEFGLANMLYQFDWE-VP 466

Query: 1484 N----EPLDMMEDVGIILPKLTPLEVLVTP 1561
            +    E +DM E  G+ + K    E+L+ P
Sbjct: 467  DGMVVEDIDMEESPGLAVGKKN--ELLLVP 494



>gb:AF022460_1761995 Glycine max cytochrome P450 monooxygenase
            CYP83D1p (CYP83D1) mRNA, partial cds.
          Length = 516

 Score =  229 bits (585), Expect = 1e-58
 Identities = 148/520 (28%), Positives = 261/520 (50%), Gaps = 22/520 (4%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFSWRKQSKRLP--PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY 223
            L S+L I   ++L+ +   +    P  P      P+IG+LH    S P +  L + A  +
Sbjct: 3    LLSLLSIVISIVLFITHTHKRNNTPRGPPGPPPLPLIGNLHQLHNSSPHL-CLWQLAKLH 61

Query: 224  GPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSY 403
            GP+ + RLG  + +VVSS         T+D   A+RP     + L YD     F+    Y
Sbjct: 62   GPLMSFRLGAVQTVVVSSARIAEQILKTHDLNFASRPLFVGPRKLSYDGLDMGFAPYGPY 121

Query: 404  WRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGH 583
            WR ++KL +  + S++R+   + +  +E+   +++L        +  S   VN++     
Sbjct: 122  WREMKKLCIVHLFSAQRVRSFRPIRENEVAKMVRKL------SEHEASGTVVNLTETLMS 175

Query: 584  LTLNLIMQIVAGRRY--EYRS---DGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWF 748
             T +LI +I  G+ Y  EY     D  +     RL+ + ++   L  EF   D   P+  
Sbjct: 176  FTNSLICRIALGKSYGCEYEEVVVDEVLGNRRSRLQVLLNEAQALLSEFFFSDYFPPIG- 234

Query: 749  FRWLD-YEGHVKTMKRAAKDVDAILQ----DWVDARRKERRSNEDQK---FIDVMLSMID 904
             +W+D   G +  + +  K++DA  +    D +D+ +  ++ N++++    ID++L ++D
Sbjct: 235  -KWVDRVTGILSRLDKTFKELDACYERSSYDHMDSAKSGKKDNDNKEVKDIIDILLQLLD 293

Query: 905  DQFTQGYSYSRDTV---IKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT 1075
            D+     S++ D     IKA+++++    ++  +  + W +  LLK+P  + +VQ E+  
Sbjct: 294  DR-----SFTFDLTLDHIKAVLMNIFIAGTDPSSATIVWAMNALLKNPNVMSKVQGEVRN 348

Query: 1076 NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV 1255
              G + +  + DV++LPYL+ VVKETLR++P  P L P   +E C ++GY I   T ++V
Sbjct: 349  LFGDKDFINEDDVESLPYLKAVVKETLRLFPPSPLLLPRVTMETCNIEGYEIQAKTIVHV 408

Query: 1256 NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ 1435
            N W + RDP+ W +PEKF PERF+ +   E   N +++ +PFG GRR CP         +
Sbjct: 409  NAWAIARDPENWEEPEKFFPERFLES-SMELKGNDEFKVIPFGSGRRMCPAKHMGIMNVE 467

Query: 1436 VAVARLFQGFNFSTV----PNEPLDMMEDVGIILPKLTPL 1543
            +++A L   F++         E LD     GI + K + L
Sbjct: 468  LSLANLIHTFDWEVAKGFDKEEMLDTQMKPGITMHKKSDL 507



>pir|T05940|T05940 cytochrome P450 83D1p - soybean (fragment)
          Length = 516

 Score =  229 bits (585), Expect = 1e-58
 Identities = 148/520 (28%), Positives = 261/520 (50%), Gaps = 22/520 (4%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFSWRKQSKRLP--PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY 223
            L S+L I   ++L+ +   +    P  P      P+IG+LH    S P +  L + A  +
Sbjct: 3    LLSLLSIVISIVLFITHTHKRNNTPRGPPGPPPLPLIGNLHQLHNSSPHL-CLWQLAKLH 61

Query: 224  GPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSY 403
            GP+ + RLG  + +VVSS         T+D   A+RP     + L YD     F+    Y
Sbjct: 62   GPLMSFRLGAVQTVVVSSARIAEQILKTHDLNFASRPLFVGPRKLSYDGLDMGFAPYGPY 121

Query: 404  WRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGH 583
            WR ++KL +  + S++R+   + +  +E+   +++L        +  S   VN++     
Sbjct: 122  WREMKKLCIVHLFSAQRVRSFRPIRENEVAKMVRKL------SEHEASGTVVNLTETLMS 175

Query: 584  LTLNLIMQIVAGRRY--EYRS---DGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWF 748
             T +LI +I  G+ Y  EY     D  +     RL+ + ++   L  EF   D   P+  
Sbjct: 176  FTNSLICRIALGKSYGCEYEEVVVDEVLGNRRSRLQVLLNEAQALLSEFFFSDYFPPIG- 234

Query: 749  FRWLD-YEGHVKTMKRAAKDVDAILQ----DWVDARRKERRSNEDQK---FIDVMLSMID 904
             +W+D   G +  + +  K++DA  +    D +D+ +  ++ N++++    ID++L ++D
Sbjct: 235  -KWVDRVTGILSRLDKTFKELDACYERSSYDHMDSAKSGKKDNDNKEVKDIIDILLQLLD 293

Query: 905  DQFTQGYSYSRDTV---IKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT 1075
            D+     S++ D     IKA+++++    ++  +  + W +  LLK+P  + +VQ E+  
Sbjct: 294  DR-----SFTFDLTLDHIKAVLMNIFIAGTDPSSATIVWAMNALLKNPNVMSKVQGEVRN 348

Query: 1076 NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV 1255
              G + +  + DV++LPYL+ VVKETLR++P  P L P   +E C ++GY I   T ++V
Sbjct: 349  LFGDKDFINEDDVESLPYLKAVVKETLRLFPPSPLLLPRVTMETCNIEGYEIQAKTIVHV 408

Query: 1256 NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ 1435
            N W + RDP+ W +PEKF PERF+ +   E   N +++ +PFG GRR CP         +
Sbjct: 409  NAWAIARDPENWEEPEKFFPERFLES-SMELKGNDEFKVIPFGSGRRMCPAKHMGIMNVE 467

Query: 1436 VAVARLFQGFNFSTV----PNEPLDMMEDVGIILPKLTPL 1543
            +++A L   F++         E LD     GI + K + L
Sbjct: 468  LSLANLIHTFDWEVAKGFDKEEMLDTQMKPGITMHKKSDL 507



>sp|Q9LIP5|C72W_ARATH Cytochrome P450 71B35 (EC
            1.14.-.-).>gb:BT011754_1641276 Arabidopsis thaliana
            At3g26310 gene, complete cds.>gb:AP001298_1820967
            Arabidopsis thaliana genomic DNA, chromosome 3, BAC
            clone:F20C19.
          Length = 500

 Score =  229 bits (585), Expect = 1e-58
 Identities = 155/511 (30%), Positives = 261/511 (51%), Gaps = 5/511 (0%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGP 229
            L  ++ +  ++L  F+ +K  K         +PIIG+LH     +P  +TL + + KYGP
Sbjct: 6    LLPLIFLVCILLAVFNHKKHPKYRQFPCPPGFPIIGNLHQIG-ELPH-QTLWKLSKKYGP 63

Query: 230  VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWR 409
            V  + LG    +VVSS +  R     +D     RP+    + L Y+Y    FS  + YW+
Sbjct: 64   VMHLMLGRVPTVVVSSSDTARQVLRVHDLHCCTRPSLSGPRELSYNYLDIAFSPYDDYWK 123

Query: 410  RVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLT 589
             VRKL V+E+ S++++  ++ +   E++  I  +    S  N       VN++     LT
Sbjct: 124  EVRKLCVQELFSTKQVHSIQPIKDEEVKKMIDSIAESASQKN------PVNLNNKCLELT 177

Query: 590  LNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI-FPLWFFRWLDY 766
            ++++ +   G  +E    GT+   + R  K+  + + + G F + D I +  W    L  
Sbjct: 178  VSVVCRTAFGVSFE----GTVLN-SDRFNKIVREALEMLGSFSAADFIPYVGWIIDVLT- 231

Query: 767  EGHVKTMKRAAKDVDAILQDWVDARRK-ERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDT 943
             G     +R+ +D++A  +   D  ++ ++  NED  F+D++L +  ++   G       
Sbjct: 232  -GLQGRRERSKRDLNAFFEQMFDLHKEGKKEGNED--FVDLLLRLEKEEAVLGNDKLTRN 288

Query: 944  VIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNL 1123
             IKAI+L +L    +T A  +TW +  L ++P  +K+VQ EI T +G        D+  L
Sbjct: 289  HIKAILLDVLLAGIDTSAITMTWAMTELARNPRVMKKVQSEIRTQMGNRSMISFEDMDQL 348

Query: 1124 PYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPE 1303
             YL+ V+KET R++P  P L P EA+ +  ++GY IP  T+L+VNVW + RDP  W DPE
Sbjct: 349  EYLKMVIKETWRLHPTTPLLLPREAMSEFDINGYTIPVKTRLHVNVWAIGRDPDTWKDPE 408

Query: 1304 KFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST-- 1477
             FLPERFM N     A+ + ++ +PFG GRR CP     T + +  +A L   F++    
Sbjct: 409  VFLPERFMDN--NIDAKGQHFELLPFGGGRRICPAIYMGTTMVEFGLANLLYHFDWKLPE 466

Query: 1478 -VPNEPLDMMEDVGIILPKLTPLEVLVTPRL 1567
             V  + +D+ E  G+ + K    E+L+ P +
Sbjct: 467  GVEVKDIDVEEAPGLTVNKKN--ELLLVPEM 495



>gb:BT004038_1637150 Arabidopsis thaliana clone RAFL15-05-J07 (R20236)
            putative cytochrome p450 (At5g57260) mRNA, complete cds.
          Length = 502

 Score =  229 bits (584), Expect = 1e-58
 Identities = 156/516 (30%), Positives = 264/516 (51%), Gaps = 14/516 (2%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGP 229
            +S IL I+ L++     +++  R PP   G  PIIG+LH     +P  ++L + + KYGP
Sbjct: 7    VSLILLISILLVAVKHSKRRWVRQPPSPPGL-PIIGNLHQLG-ELPH-QSLCKLSKKYGP 63

Query: 230  VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWR 409
            V  ++LG    ++VS+    +      D    +RP+    + L Y+Y    FS  + YW+
Sbjct: 64   VMLLKLGRVPTVIVSTPGTAKQVLKDYDLHCCSRPSLEGTRKLSYNYLDIAFSRFDDYWK 123

Query: 410  RVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLT 589
             +RKL VEE+  ++R+  ++ +  +E++  I  +    S          VN+S  F  L 
Sbjct: 124  ELRKLCVEELFCNKRINSIQPIKEAEMEKLIDSIAESASQKT------LVNLSDTFLSLN 177

Query: 590  LNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL--WFFRWLD 763
            +N+I + V G  ++    GT+     + + +  + + + G F + D  FP   W   W  
Sbjct: 178  VNVICKAVFGVNFQ----GTVLNN-DKFQDLVHEALEMLGSFSASD-FFPYVGWIVDW-- 229

Query: 764  YEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDT 943
            + G     +R+ +D+DA  +  +D   ++ R   +  F+D++L +  ++   GY      
Sbjct: 230  FTGLHARRERSVRDLDAFYEQMIDLHLQKNREESEDDFVDLLLRLEKEEAVLGYGKLTRN 289

Query: 944  VIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE---RWAEDSDV 1114
             IKAI++++L     T A  +TW +A L+++P  +K+VQ EI   IGK    R     ++
Sbjct: 290  HIKAILMNILLGGINTSAITMTWAMAELIRNPRVMKKVQSEIRAQIGKNNKTRIISLDEI 349

Query: 1115 KNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWP 1294
             +L YL  V+KET R++P  P L P E + +  ++GY I   T+L+VNVW + RDP+IW 
Sbjct: 350  NHLSYLNMVIKETCRLHPVAPLLVPREVISEFKINGYTIQPKTRLHVNVWAIGRDPEIWK 409

Query: 1295 DPEKFLPERFM-TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF 1471
            DPE+FLPERFM  +++    + + Y+ +PFG GRR CP         +  +A L   F++
Sbjct: 410  DPEEFLPERFMDCDID---VKGQDYELLPFGSGRRICPAVYMGITTVEFGLANLLYHFDW 466

Query: 1472 ST---VPNEPLDMMEDVGIILPK-----LTPLEVLV 1555
                 V  E + M E  G+   K     L P++ LV
Sbjct: 467  KLPEGVAVEDIYMDEASGLTSHKKHDLLLVPVKSLV 502



>gb:ATH295580_1552363 Arabidopsis thaliana fah1 gene for
            ferulate-5-hydroxylase, exons 1-3 MH-0
            ecotype.>gb:ATH295581_1552364 Arabidopsis thaliana fah1
            gene for ferulate-5-hydroxylase, exons 1-3 CVI-0
            ecotype.>gb:ATH295582_1552365 Arabidopsis thaliana fah1
            gene for ferulate-5-hydroxylase, exons 1-3 ITA-0
            ecotype.>gb:ATH295583_1552366 Arabidopsis thaliana fah1
            gene for ferulate-5-hydroxylase, exons 1-3 KAS-1
            ecotype.>gb:ATH295584_1552367 Arabidopsis thaliana fah1
            gene for ferulate-5-hydroxylase, exons 1-3 MR-0
            ecotype.>gb:ATH295585_1552368 Arabidopsis thaliana fah1
            gene for ferulate-5-hydroxylase, exons 1-3 WS-0 ecotype.
          Length = 520

 Score =  229 bits (584), Expect = 1e-58
 Identities = 160/524 (30%), Positives = 257/524 (49%), Gaps = 21/524 (4%)
 Frame = +2

Query: 59   ILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFT 238
            ++ ++  + + F  R++    PP   G WPIIG++          + L+  A KYG +  
Sbjct: 20   VIVVSLFIFIGFITRRRRPPYPPGPRG-WPIIGNM--LMMDQLTHRGLANLAKKYGGLCH 76

Query: 239  IRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVR 418
            +R+G   +  VSS E  R      D + + RP T A  YL YD A   F+    +WR++R
Sbjct: 77   LRMGFLHMYAVSSPEVARQVLQVQDSVFSNRPATIAISYLTYDRADMAFAHYGPFWRQMR 136

Query: 419  KLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNL 598
            K+ V ++ S +R E     W S ++  + ++   +S +        +N+      LT N+
Sbjct: 137  KVCVMKVFSRKRAES----WAS-VRDEVDKMVRSVSCNVGKT----INVGEQIFALTRNI 187

Query: 599  IMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHV 778
              +   G   E   D  I     R+ + FS+   L+G F   D I    +F W+D +G  
Sbjct: 188  TYRAAFGSACEKGQDEFI-----RILQEFSK---LFGAFNVADFIP---YFGWIDPQGIN 236

Query: 779  KTMKRAAKDVDAILQDWVDARRKERRSNE--------DQKFIDVMLSMIDDQ-------- 910
            K + +A  D+D  + D +D   K++ +          D   +D +L+   ++        
Sbjct: 237  KRLVKARNDLDGFIDDIIDEHMKKKENQNAVDDGDVVDTDMVDDLLAFYSEEAKLVSETA 296

Query: 911  -FTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK 1087
                    +RD  IKAI++ ++   +ET A+ + W L  LL+ PE LKRVQ E+   +G 
Sbjct: 297  DLQNSIKLTRDN-IKAIIMDVMFGGTETVASAIEWALTELLRSPEDLKRVQQELAEVVGL 355

Query: 1088 ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR 1267
            +R  E+SD++ L YL+  +KETLRM+P  P L  HE  ED  +DG+ IPK +++ +N + 
Sbjct: 356  DRRVEESDIEKLTYLKCTLKETLRMHPPIPLLL-HETAEDTSIDGFFIPKKSRVMINAFA 414

Query: 1268 LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA 1447
            + RDP  W DP+ F P RF+     +  +   ++F+PFG GRRSCPG         +AVA
Sbjct: 415  IGRDPTSWTDPDTFRPSRFLEPGVPD-FKGSNFEFIPFGSGRRSCPGMQLGLYALDLAVA 473

Query: 1448 RLFQGFNF----STVPNEPLDMMEDVGIILPKLTPLEVLVTPRL 1567
             +   F +       P+E LDM +  G+  PK T L  + T RL
Sbjct: 474  HILHCFTWKLPDGMKPSE-LDMNDVFGLTAPKATRLFAVPTTRL 516



>gb:AB078781_1523781 Vinca major VFH gene for Flavonoid
            3',5'-hydroxylase, complete cds.
          Length = 505

 Score =  229 bits (584), Expect = 1e-58
 Identities = 153/493 (31%), Positives = 247/493 (50%), Gaps = 4/493 (0%)
 Frame = +2

Query: 101  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW 280
            R   ++LPP   G WP+IG L +  T      +L+  A KYGPV  +++G + ++VVS+ 
Sbjct: 26   RTYRRKLPPGPKG-WPVIGALPYLGTMPHT--SLAYMAKKYGPVMYLKVGTNDMVVVSTP 82

Query: 281  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE 460
            +A R    T D   + RP      +L Y      F+     W+ +RKL    +   + LE
Sbjct: 83   DAARAFLKTLDINFSNRPPNAGATHLAYGAQDMVFAHYGPKWKLLRKLSNLHMRGGKALE 142

Query: 461  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS 640
               +V +SEL   ++ +Y       ++     V ++    +   N+I Q++  RR     
Sbjct: 143  DWSNVRISELGHMLETMY------ESSKKGEAVVVAEMLTYAMANMIGQVILSRRVFVTK 196

Query: 641  DGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAIL 820
                NE     K +  ++M   G F  GD I  +    W+D +G    MKR  K  D +L
Sbjct: 197  GSDSNE----FKDMVVELMTSAGLFNIGDFIPSI---AWMDLQGIEGGMKRLHKKFDVLL 249

Query: 821  QDWVDARRKERRSNEDQK--FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETF 994
               ++   KE  S    K   +D +L+  D+   +  +    T IKA++L++    ++T 
Sbjct: 250  TKLLE-EHKESSSKRKGKPDLLDYVLANRDNSEGERLT---TTNIKALLLNLFSAGTDTS 305

Query: 995  ATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQG 1174
            ++ + W L+ +L++P  LKR Q E+   IG+ R   +SD+  LPYLQ + KET R +P  
Sbjct: 306  SSIIEWALSEMLRNPSILKRAQHEMVQVIGRNRRLVESDISRLPYLQAICKETFRKHPST 365

Query: 1175 PYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEA-A 1351
            P   P  A E C V+GY+IPKGT+L VN+W + RDP +W +P +F P+RF++    +   
Sbjct: 366  PLNLPRIATEACEVNGYYIPKGTRLSVNIWAIGRDPDVWENPLEFNPDRFLSGKNAKIDP 425

Query: 1352 QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN-EPLDMMEDVGIILP 1528
            +   ++ +PFG GRR C G      + +  +  L   F+++   +   L+M E  G+ L 
Sbjct: 426  RGNDFELIPFGAGRRICAGTRMGILLVEYILGTLVHSFDWNLPSSVTKLNMDESFGLALQ 485

Query: 1529 KLTPLEVLVTPRL 1567
            K+ PL  LVTPRL
Sbjct: 486  KVVPLAALVTPRL 498



>pir|T52173|T52173 cytochrome P450 monooxygenase [imported] -
            Arabidopsis thaliana>gb:D78605_1674787 Arabidopsis
            thaliana mRNA for cytochrome P450 monooxygenase, complete
            cds, clone P450-48.
          Length = 502

 Score =  229 bits (584), Expect = 1e-58
 Identities = 163/514 (31%), Positives = 269/514 (52%), Gaps = 9/514 (1%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGP 229
            L S+L I + + L     K SK   P +  + PIIG+LHH    +P  +   + + KYGP
Sbjct: 9    LVSLLTIVSSIFL--KQNKTSKFNLPPSPSSLPIIGNLHHL-AGLPH-RCFHKLSIKYGP 64

Query: 230  VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWR 409
            +  +RLG   ++V+SS EA      TND    +RP T     L Y +   TF+    YWR
Sbjct: 65   LVFLRLGSVPVVVISSSEAAEAVLKTNDLECCSRPKTVGSGKLSYGFKDITFAPYGEYWR 124

Query: 410  RVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLT 589
             VRKL V E+ SS++++  +++   E+   +K++    S    +P    V++S+ F  LT
Sbjct: 125  EVRKLAVIELFSSKKVQSFRYIREEEVDFVVKKVSE--SALKQSP----VDLSKTFFSLT 178

Query: 590  LNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD-- 763
             ++I ++  G+ +   S   I+++  R++++ ++     G F   D  FP    R++D  
Sbjct: 179  ASIICRVALGQNFN-ESGFVIDQD--RIEELVTESAEALGTFTFSD-FFPGGLGRFVDWL 234

Query: 764  YEGHVKTMKRAAKDVDAILQDWVDARRK-ERRSNEDQKFIDVMLSMIDDQF-TQGYSYSR 937
            ++ H K + +  K++DA  Q  +D   K E R N+D   + ++L MID Q  +  +  + 
Sbjct: 235  FQRH-KKINKVFKELDAFYQHVIDDHLKPEGRKNQD--IVTLILDMIDKQEDSDSFKLNM 291

Query: 938  DTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG--KERWAEDSD 1111
            D  +KAIV+ +     +T A  + W +  L+++P  +K+ Q  I T +G  KER   + D
Sbjct: 292  DN-LKAIVMDVFLAGIDTSAVTMIWAMTELIRNPRVMKKAQGSIRTTLGLKKERITVE-D 349

Query: 1112 VKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIW 1291
            +  + YL  ++KET R++P  P++ P E +    + GY IP  TQ+ +NVW + RDPK W
Sbjct: 350  LGKVEYLNHILKETFRLHPALPFVVPRETMSHIKIQGYDIPPKTQIQLNVWTIGRDPKRW 409

Query: 1292 PDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF 1471
             DPE+F PERF  +      Q+  +  +PFG GRR CPG   A    ++A+  L   F++
Sbjct: 410  NDPEEFNPERFANSSVDFRGQH--FDLLPFGSGRRICPGMPMAIASVELALMNLLYYFDW 467

Query: 1472 ST---VPNEPLDMMEDVGIILPKLTPLEVLVTPR 1564
            S       E +DM E   I + K  PL+++   R
Sbjct: 468  SMPDGTKGEDIDMEEAGNISIVKKIPLQLVPVQR 501



>sp|Q9LIP6|C72V_ARATH Cytochrome P450 71B34 (EC
            1.14.-.-).>gb:AP001298_1820966 Arabidopsis thaliana
            genomic DNA, chromosome 3, BAC clone:F20C19.
          Length = 500

 Score =  229 bits (584), Expect = 1e-58
 Identities = 155/513 (30%), Positives = 262/513 (51%), Gaps = 5/513 (0%)
 Frame = +2

Query: 50   LSSILGIAALVLLW-FSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYG 226
            LS I  I  LV ++    R+  +R PP   G  PIIG+LH     +P  ++L + + KYG
Sbjct: 7    LSLIFVICILVAVFNHKNRRNYQRTPPSPPGC-PIIGNLHQLG-ELPH-QSLWKLSKKYG 63

Query: 227  PVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYW 406
            PV  ++LG    ++VSS E  +     +D    +RP     + L Y+Y    FS  + YW
Sbjct: 64   PVMLLKLGRVPTVIVSSSETAKQALKIHDLHCCSRPGFAGARELSYNYLDIAFSPYDDYW 123

Query: 407  RRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHL 586
            + VRKL V+E+ SS+++  ++ +   E++  I       S+  +      +N+++    L
Sbjct: 124  KEVRKLAVQELFSSKQVHSIQPIKDEEVKKLID------SISESAAQKTPINLNKTLLAL 177

Query: 587  TLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDY 766
            T++++ +      +E    GT+   ++R   +  + + + G F + D  F  +  R +D 
Sbjct: 178  TVSVVCRTAFSVNFE----GTVLN-SERFNNIVREALEMLGSFSASD--FIPYVGRIIDL 230

Query: 767  -EGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDT 943
              G     +R+ +D+DA  +   D   K+++    + F+D++L +  ++   G       
Sbjct: 231  LTGLQGRRERSMRDLDAFYEQMFDLH-KQKKEEGSEDFVDLLLRLEKEEAVLGNDKLTRN 289

Query: 944  VIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNL 1123
             IKAI++ +L    +T A  +TW +A L K+P  +K+VQ EI + I  +      D   L
Sbjct: 290  HIKAILMDVLLAGMDTSAITMTWAMAELAKNPRVMKKVQSEIRSQIKNKERISFDDTDKL 349

Query: 1124 PYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPE 1303
             YL+ V+KET R++P  P L P EA+ +  ++GY IP  T+L+VNVW + RDP  W DPE
Sbjct: 350  EYLKMVIKETWRLHPTTPLLIPREAMSEFEINGYTIPVKTRLHVNVWAIGRDPDTWKDPE 409

Query: 1304 KFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST-- 1477
             FLPERF  N     A+ + ++ +PFG GRR CP     T + +  +A L   F++    
Sbjct: 410  VFLPERFTDN--NIDAKGQHFELLPFGGGRRMCPAVYMGTTMVEFGLANLLYHFDWKLPE 467

Query: 1478 -VPNEPLDMMEDVGIILPKLTPLEVLVTPRLSP 1573
             +  + +DM E  G+ + K   L ++ T  L P
Sbjct: 468  GMKVDDIDMEEAPGLTVNKKNELILVPTKFLDP 500



>gb:AB028151_1517807 Antirrhinum majus AFNS2 mRNA for cytochrome P450,
            complete cds.
          Length = 506

 Score =  229 bits (583), Expect = 2e-58
 Identities = 153/518 (29%), Positives = 266/518 (51%), Gaps = 10/518 (1%)
 Frame = +2

Query: 56   SILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVF 235
            S L I + +LL    R + K  PP    A P+IGHLH       L  T  +++ +YGP+ 
Sbjct: 7    STLFILSTLLLTLLTRTRRKTRPP-GPLALPLIGHLHLLGPK--LHHTFHQFSQRYGPLI 63

Query: 236  TIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRV 415
             + LG    +V S+ E  R+   T++   ++R  + A   + YD + F F+    YW+ +
Sbjct: 64   QLYLGSVPCVVASTPELAREFLKTHELDFSSRKHSTAIDIVTYDSS-FAFAPYGPYWKFI 122

Query: 416  RKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLN 595
            +KL   E+L +R L   + +   E+ + ++ LY              VN++     LT N
Sbjct: 123  KKLCTYELLGARNLSHFQPIRALEVNSFLRILY------EKTEQKQSVNVTEELVKLTSN 176

Query: 596  LIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGH 775
            +I  ++ G     R  GT   EA+  + V  +V  ++GEF   + +   WF + LD +G 
Sbjct: 177  VISNMMLG----IRCSGT-EGEAEVARTVIREVTQIFGEFDVSEIV---WFCKNLDLQGI 228

Query: 776  VKTMKRAAKDVDAILQDWVDARRKERR-------SNEDQKFIDVMLSMIDDQFTQGYSYS 934
             K  +   +  DA+L+  +  R + R          E + F+D++L +++ + ++   ++
Sbjct: 229  RKRSEDIRRRYDALLEKIISDRERLRLRGGGGGGGGEVKDFLDMLLDVMESEKSE-VEFT 287

Query: 935  RDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDV 1114
            R+  +KA++L      ++T A    W +A L+ +P  LK+ Q+E+D  IG +R  ++SD 
Sbjct: 288  REH-LKALILDFFTAGTDTTAITTEWAIAELISNPNVLKKAQEEMDKVIGSQRLLQESDA 346

Query: 1115 KNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWP 1294
             NLPYL  ++KET R++P  P L   +++ D +V+GY IP  T L+VN+W + R+P  W 
Sbjct: 347  PNLPYLNAIIKETFRLHPPIPMLT-RKSISDVVVNGYTIPAKTLLFVNLWSMGRNPNYWE 405

Query: 1295 DPEKFLPERFMTNLEGEA-AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF 1471
            +P +F PERF+    G    + + ++ +PFG GRR CPG L   Q     +  + Q F++
Sbjct: 406  NPMEFRPERFLEKGTGSIDVKGQHFELLPFGTGRRGCPGMLLGMQELFSIIGAMVQCFDW 465

Query: 1472 STVPN--EPLDMMEDVGIILPKLTPLEVLVTPRLSPTL 1579
              +P+  + +DM E  G+  P+   L   + PR+ P +
Sbjct: 466  K-LPDGVKSVDMTERPGLTAPRANDLVCQLVPRIDPVV 502



>sp|Q96418|C755_EUSGR Flavonoid 3',5'-hydroxylase (EC 1.14.-.-)
            (F3'5'H) (Cytochrome P450 75A5).>gb:EGU72654_1676529
            Eustoma grandiflorum flavonoid 3'5'-hydroxylase (F3'5'H)
            mRNA, complete cds.
          Length = 510

 Score =  228 bits (581), Expect = 3e-58
 Identities = 158/500 (31%), Positives = 254/500 (50%), Gaps = 6/500 (1%)
 Frame = +2

Query: 86   LWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRIL 265
            LW + R+   RLPP   G WP++G L    T +P V  L+  A KYGPV  +++G   + 
Sbjct: 28   LWMNSRRH--RLPPGPIG-WPVLGALPLLGT-MPHV-ALANMAKKYGPVMYLKVGSCGLA 82

Query: 266  VVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILS 445
            V S+ EA +    T D   + RP      +L Y+     F+     W+ +RKL    IL 
Sbjct: 83   VASTPEAAKAFLKTLDMNFSNRPPNAGATHLAYNAQDMVFADYGPRWKLLRKLSNIHILG 142

Query: 446  SRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRR 625
             + L+  + V   EL       Y   +M  +      V +S    +   N++ Q++  +R
Sbjct: 143  GKALQGWEEVRKKELG------YMLYAMAESGRHGQPVVVSEMLTYAMANMLGQVMLSKR 196

Query: 626  YEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKD 805
                  G+   E+   K +  ++M + G F  GD I  +    W+D +G    MKR  K 
Sbjct: 197  V----FGSQGSESNEFKDMVVELMTVAGYFNIGDFIPSI---AWMDLQGIQGGMKRLHKK 249

Query: 806  VDAILQDWVD---ARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQ 976
             DA+L   ++   A   ER+ + D  F+D +++  D+  ++G        IKA++L+M  
Sbjct: 250  FDALLTRLLEEHTASAHERKGSPD--FLDFVVANRDN--SEG-ERLHTVNIKALLLNMFT 304

Query: 977  DASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETL 1156
              ++T ++ + W LA LLK+P  LKR Q+E+D  IG++R   ++D+  LPYLQ + KE  
Sbjct: 305  AGTDTSSSVIEWALAELLKNPIILKRAQEEMDGVIGRDRRFLEADISKLPYLQAICKEAF 364

Query: 1157 RMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNL 1336
            R +P  P   P  A + C V+G++IPKGT+L VN+W + RDP +W +P +F P+RF+   
Sbjct: 365  RKHPSTPLNLPRIASQACEVNGHYIPKGTRLSVNIWAIGRDPSLWENPNEFNPDRFLERK 424

Query: 1337 EGEA-AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNE--PLDMME 1507
              +   +   ++ +PFG GRR C G      + +  +  L   F++  +P+    L+M E
Sbjct: 425  NAKIDPRGNDFELIPFGAGRRICAGTRLGILLVEYILGTLVHSFDWE-LPSSVIELNMDE 483

Query: 1508 DVGIILPKLTPLEVLVTPRL 1567
              G+ L K  PL  +VTPRL
Sbjct: 484  PFGLALQKAVPLAAMVTPRL 503



>gb:AF122821_1769853 Capsicum annuum cytochrome P450 (PepCYP) mRNA,
            complete cds.
          Length = 502

 Score =  228 bits (580), Expect = 4e-58
 Identities = 161/516 (31%), Positives = 255/516 (49%), Gaps = 15/516 (2%)
 Frame = +2

Query: 59   ILGIAALVLLWFSWRKQSKRLPPEAGGAW--PIIGHLHHFRTSVPLVKT-LSEWADKYGP 229
            +L +++++LL   W+ Q   LPP   G W  P IG LHH   + PL    L   A  YGP
Sbjct: 12   LLFLSSIILLLKKWKTQKLNLPP---GPWKLPFIGSLHHLAVAGPLPHHGLKNLAKLYGP 68

Query: 230  VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWR 409
            +  +RLG    +++SS    ++   T+D   A RP       + YD     FS    YWR
Sbjct: 69   LMHLRLGEIPTVIISSPRMAKEVLKTHDLAFATRPKLVVADIVHYDSTDIAFSPYGEYWR 128

Query: 410  RVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLT 589
            ++RK+ + E+LS++ ++    +   EL   +  + T        P+ P VN++      T
Sbjct: 129  QIRKICILELLSAKMVKFFSSIRQDELSMMVSSIRTM-------PNFP-VNLTDKIFWFT 180

Query: 590  LNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYE 769
             ++  +   G+         I  +  +L     +++ L G F   D  FP W  + L   
Sbjct: 181  SSVTCRSALGK---------ICRDQDKLIIFMREIISLTGGFSIAD-FFPTW--KMLHDV 228

Query: 770  GHVKT-MKRAAKDVDAILQDWVDARRKERRSNED-------QKFIDVMLSMIDDQFTQGY 925
            G  KT + +A + +D IL+  V+  ++ R   +        +  IDV+L + +    Q  
Sbjct: 229  GGSKTRLLKAHRKIDEILEHVVNEHKQNRADGQKGNGEFGGEDLIDVLLRVRESGEVQ-I 287

Query: 926  SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED 1105
            S + D  IK+I++ M    SET +T + W LA ++K P  L + Q E+   + +++  + 
Sbjct: 288  SITDDN-IKSILVDMFSAGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQVLKEKKGFQQ 346

Query: 1106 SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK 1285
             D+  L YL+ V+KETLRM+P  P L P E ++D  +DGY+IP  T++ VN W + RDP+
Sbjct: 347  IDLDELKYLKLVIKETLRMHPPIPLLVPRECMKDTKIDGYNIPFKTRVIVNAWAIGRDPE 406

Query: 1286 IWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF 1465
             W DPE F PERF  +       +  +QF+PFG GRR CPG L+        +A+L   F
Sbjct: 407  SWDDPESFSPERFENSSVDFLGSH--HQFIPFGAGRRICPGMLFGLANVGQPLAQLLYHF 464

Query: 1466 NFSTVPN----EPLDMMEDVGIILPKLTPLEVLVTP 1561
            +   +PN    E LDM E  GI   +   L ++ TP
Sbjct: 465  D-RKLPNGQSHENLDMTESPGISATRKDDLVLIATP 499



>gb:AX146629_1462494 Sequence 5 from Patent WO0134817.
          Length = 526

 Score =  228 bits (580), Expect = 4e-58
 Identities = 169/532 (31%), Positives = 262/532 (49%), Gaps = 25/532 (4%)
 Frame = +2

Query: 62   LGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTI 241
            LG  ALV+L    R++ K   P      PI+G++          + L+  A++YG +  +
Sbjct: 21   LGTLALVVLQL--RRRGKAPLPPGPKPLPIVGNMAMMDQLTH--RGLAALAERYGGLLHL 76

Query: 242  RLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRK 421
            RLG      VS+ E  R+     D   + RP T A  YL YD A   F+    +WR++RK
Sbjct: 77   RLGRLHAFAVSTPEYAREVLQAQDGAFSNRPATIAIAYLTYDRADMAFAHYGPFWRQMRK 136

Query: 422  LVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLI 601
            L V ++ S RR E     WV+ ++     L   ++          VN+     +LT N+ 
Sbjct: 137  LCVMKLFSRRRAE----TWVA-VRDECAALVRAVASGGGG-GGEAVNLGELIFNLTKNVT 190

Query: 602  MQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVK 781
             +   G R     DG   EE   + + FS+   L+G F   D  F  W   W+D +G  +
Sbjct: 191  FRAAFGTR-----DGEDQEEFIAILQEFSK---LFGAFNVVD--FLPWL-SWMDLQGINR 239

Query: 782  TMKRAAKDVDAILQDWVD--ARRKERRSNEDQKFIDVMLSMI---------------DDQ 910
             ++ A   +D  +   +D   RR +   + D   +D ML+                  D 
Sbjct: 240  RLRAARSALDRFIDKIIDEHVRRGKNPDDADADMVDDMLAFFAEAKPPKKGPAAAADGDD 299

Query: 911  FTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE 1090
                   +RD  IKAI++ ++   +ET A+ + W +A ++  P+ L+R+Q E+   +G +
Sbjct: 300  LHNTLRLTRDN-IKAIIMDVMFGGTETVASAIEWAMAEMMHSPDDLRRLQQELADVVGLD 358

Query: 1091 RWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRL 1270
            R   +SD+  LP+L+ V+KETLR++P  P L  HE   DC+V GY +P+G+++ VNVW +
Sbjct: 359  RNVNESDLDKLPFLKCVIKETLRLHPPIPLLL-HETAGDCVVGGYSVPRGSRVMVNVWAI 417

Query: 1271 HRDPKIWPDPEKFLPERFMTNLEGEAA----QNRQYQFVPFGLGRRSCPGNLYATQITQV 1438
             R    W D + F P RF    EGEAA    +   ++F+PFG GRRSCPG        ++
Sbjct: 418  GRHRASWKDADAFRPSRFTP--EGEAAGLDFKGGCFEFLPFGSGRRSCPGTALGLYALEL 475

Query: 1439 AVARLFQGFNFS----TVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
            AVA+L  GFN+S      P+E LDM +  G+  P+ T L  + TPRL+  L+
Sbjct: 476  AVAQLAHGFNWSLPDGMKPSE-LDMGDVFGLTAPRATRLYAVPTPRLNCPLY 526



>sp|O04790|C757_EUSGR Flavonoid 3',5'-hydroxylase (EC 1.14.-.-)
            (F3'5'H) (Cytochrome P450 75A7).>gb:AB078957_1523809
            Eustoma grandiflorum EgF3'5'H mRNA for flavonoid
            3',5'-hydroxylase, complete cds.>gb:D14589_1674471
            Eustoma russellianum mRNA for flavonoid
            3',5'-hydroxylase, complete cds.
          Length = 510

 Score =  228 bits (580), Expect = 4e-58
 Identities = 160/518 (30%), Positives = 260/518 (50%), Gaps = 15/518 (2%)
 Frame = +2

Query: 59   ILGIAALVLLWFSWRK---------QSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEW 211
            +L IAA ++L+F  +K         +  RLPP   G WP++G L    T +P V  L+  
Sbjct: 8    LLHIAASLMLFFHVQKLVQYLWMNSRRHRLPPGPIG-WPVLGALRLLGT-MPHV-ALANM 64

Query: 212  ADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFST 391
            A KYGPV  +++G   + V S+ EA +    T D   + RP      +L Y+     F+ 
Sbjct: 65   AKKYGPVMYLKVGSCGLAVASTPEAAKAFLKTLDMNFSNRPPNAGATHLAYNAQDMVFAD 124

Query: 392  NNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSR 571
                W+ +RKL    IL  + L+  + V   EL       Y   +M  +      V +S 
Sbjct: 125  YGPRWKLLRKLSNIHILGGKALQGWEEVRKKELG------YMLYAMAESGRHGQPVVVSE 178

Query: 572  WFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF 751
               +   N++ Q++  +R      G+   E+   K +  ++M + G F  GD I  +   
Sbjct: 179  MLTYAMANMLGQVMLSKRVF----GSQGSESNEFKDMVVELMTVAGYFNIGDFIPSI--- 231

Query: 752  RWLDYEGHVKTMKRAAKDVDAILQDWVD---ARRKERRSNEDQKFIDVMLSMIDDQFTQG 922
             W+D +G    MKR  K  DA+L   ++   A   ER+ + D  F+D +++  D+   + 
Sbjct: 232  AWMDLQGIQGGMKRLHKKFDALLTRLLEEHTASAHERKGSPD--FLDFVVANGDNSEGER 289

Query: 923  YSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAE 1102
                +   IKA++L+M    ++T ++ + W LA LLK+P  L+R Q+E+D  IG++R   
Sbjct: 290  L---QTVNIKALLLNMFTAGTDTSSSVIEWALAELLKNPIILRRAQEEMDGVIGRDRRFL 346

Query: 1103 DSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDP 1282
            ++D+  LPYLQ + KE  R +P  P   P  A + C V+G++IPKGT+L VN+W + RDP
Sbjct: 347  EADISKLPYLQAICKEAFRKHPSTPLNLPRIASQACEVNGHYIPKGTRLSVNIWAIGRDP 406

Query: 1283 KIWPDPEKFLPERFMTNLEGEA-AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQ 1459
             +W +P +F P+RF+     +   +   ++ +PFG GRR C G      + +  +  L  
Sbjct: 407  SVWENPNEFNPDRFLERKNAKIDPRGNDFELIPFGAGRRICAGTRLGILLVEYILGTLVH 466

Query: 1460 GFNFSTVPNE--PLDMMEDVGIILPKLTPLEVLVTPRL 1567
             F +  +P+    L+M E  G+ L K  PL  +VTPRL
Sbjct: 467  SFVWE-LPSSVIELNMDESFGLALQKAVPLAAMVTPRL 503



>gb:AY532371_1612054 Ammi majus cytochrome P450 (CYP98A21) mRNA,
            complete cds.
          Length = 509

 Score =  227 bits (579), Expect = 5e-58
 Identities = 141/506 (27%), Positives = 256/506 (50%), Gaps = 3/506 (0%)
 Frame = +2

Query: 77   LVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGIS 256
            ++LL   + K   +LPP     WPI+G+L+         +  + W+  YGP+ ++  G +
Sbjct: 13   IILLHQLYHKLRFKLPP-GPRPWPIVGNLYDIEPV--RFRCFNNWSKTYGPIISVWFGST 69

Query: 257  RILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEE 436
              ++V++ E  ++     D+ LA R  + +      D     ++    ++ +VRK+   E
Sbjct: 70   LNVIVNNTELAKEVLKDKDQQLADRHRSRSAAKFSRDGQDLIWADYGPHYVKVRKVCTLE 129

Query: 437  ILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVA 616
            + + +RLE ++ V   E+   ++ +Y      N++     + + ++ G +  N I ++  
Sbjct: 130  LFTPKRLEAIRPVREDEVTAMVESIYK--DCTNSDTIGKSLLVRQYLGGVAFNNITRLAF 187

Query: 617  GRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRA 796
            G+R+   S+G ++E+ +  K + +  + L     + + I  L +   L+ E   K   R 
Sbjct: 188  GKRF-VNSEGVMDEQGKEFKSIIANGLKLGASLATAEHIQWLRWLFPLEEEAFAKHGARR 246

Query: 797  AKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQ 976
                 AI+++   AR+K       Q F+D +L++        Y  S DT+I  ++  M+ 
Sbjct: 247  DNLTRAIMEEHTLARQKS--GGTKQHFVDALLTL-----QSKYDLSEDTII-GLLWDMIT 298

Query: 977  DASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETL 1156
              ++T A  + W +A L+K+P   ++ Q+E+D  IG ER   + D  NLPYLQ V KE L
Sbjct: 299  AGADTTAIVVEWGMAELIKNPRVQEKAQEELDRVIGYERVLTELDFSNLPYLQCVAKEAL 358

Query: 1157 RMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNL 1336
            R++P  P + PH A  +  + GY IPKG+ ++VNVW + RDP +W +P +F PERF+   
Sbjct: 359  RLHPPTPLMLPHRANANVKIGGYDIPKGSNVHVNVWAVARDPAVWKNPLEFRPERFLE-- 416

Query: 1337 EGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF---STVPNEPLDMME 1507
            E    +   Y+ +PFG GRR CPG      +    +  L   +++   S + ++ +DM E
Sbjct: 417  EDVDMKGHDYRLLPFGAGRRVCPGAQLGINLVTSMLGHLLHHYSWAPPSGLSSDEIDMSE 476

Query: 1508 DVGIILPKLTPLEVLVTPRLSPTLFR 1585
              G++    TPL+ + TPRL   L++
Sbjct: 477  SPGMVTYMKTPLQAVPTPRLPSQLYK 502



>gb:AY065995_1566582 Sesamum indicum p-coumarate 3-hydroxylase mRNA,
            complete cds.
          Length = 509

 Score =  227 bits (579), Expect = 5e-58
 Identities = 155/520 (29%), Positives = 257/520 (49%), Gaps = 11/520 (2%)
 Frame = +2

Query: 59   ILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFT 238
            IL    + + +  +++   +LPP      P++G+L+  +    LV+  +EW+  YGP+F+
Sbjct: 7    ILSFLTIFIAYKLFQRLRYKLPP-GPRPLPVVGNLYDIKPL--LVRCFTEWSQVYGPIFS 63

Query: 239  IRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVR 418
            + LG    +VV+S E  ++    ND+ LA R  T        + A   +S    ++ +VR
Sbjct: 64   VYLGSHLSVVVNSAELAKEVLKDNDQQLANRNRTRQIAKFSKNGADLIWSDYGPHYVKVR 123

Query: 419  KLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNL 598
            KL   E+ S +RLE L+ +   E+   ++ ++   +   N   A  + +  + G +    
Sbjct: 124  KLCTLELFSMKRLEGLRPIREDEVTAMVESIFKDCNKPENKGKA--LVLREYLGMMAFLH 181

Query: 599  IMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYL-----WGEFVSGDAIFPLWFFRWLD 763
            I ++  G+R+   S+G ++ + + LK +    + L     W EF+        WF     
Sbjct: 182  IARLTFGKRF-MDSNGVVDGQGEELKAILHNGIKLGTKKSWAEFLP-------WFRFLFK 233

Query: 764  YEGHVKTMKRAAKD--VDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSR 937
             E  +     A  D     I+Q+   AR+K    N    F+D +L++  +     Y  S 
Sbjct: 234  TENQLLAEHDALADSFTKKIMQEHTLARQKT--GNTKNHFVDALLTLQKE-----YDLSD 286

Query: 938  DTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVK 1117
            DTVI  ++  M+     T    + W +A L+++P   ++VQ+E+D  +G +R   ++D+ 
Sbjct: 287  DTVI-GLLWDMISAGMVTTTITVEWAMAELVRNPRVQQKVQEELDRVVGSDRVMTEADIP 345

Query: 1118 NLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPD 1297
            NLPYLQ V KE  RM+P  P + PH+A  +  + GY IPKG  + VNVW L RDP +W +
Sbjct: 346  NLPYLQCVTKECFRMHPPTPLMLPHKASTNVKIGGYDIPKGATVSVNVWALARDPAVWKN 405

Query: 1298 PEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFS- 1474
            P +F PERF    E    +   Y+ +PFG GRR CPG   A  +    +  +   F ++ 
Sbjct: 406  PLEFRPERFQE--EDIDMKGTDYRLLPFGSGRRICPGAQLAIYLVTSMLGHMLHHFTWTP 463

Query: 1475 ---TVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR 1585
               T P E +DMME  G +    TPL+ + TPRL   LF+
Sbjct: 464  PAGTKP-EDMDMMEQPGTVTYMRTPLQAVPTPRLPADLFK 502



>gb:AB045593_1520404 Perilla frutescens SHT12 mRNA for flavonoid
            3'-hydroxylase, complete cds.
          Length = 523

 Score =  226 bits (577), Expect = 8e-58
 Identities = 153/528 (28%), Positives = 261/528 (49%), Gaps = 17/528 (3%)
 Frame = +2

Query: 53   SSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPV 232
            +SILG+    L        + R  P     WPI+G+L          ++++  A  +GP+
Sbjct: 12   TSILGVLVYFLFLRRGGGSNGRPLPPGPRPWPIVGNLPQLGPKPH--QSMAALARVHGPL 69

Query: 233  FTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRR 412
              +++G   ++V +S          +D    +RP     +++ Y+Y    F+ +   WR 
Sbjct: 70   MHLKMGFVHVVVAASATVAEKFLKVHDTNFLSRPPNSGAEHIAYNYNDLVFAPHGPRWRL 129

Query: 413  VRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTL 592
            +RK+    + SS+ L+  +HV   E+   I+ L +   M          ++ +       
Sbjct: 130  LRKICALHLFSSKALDDFRHVREEEVGILIRNLASVGEMP--------ASIGQMMYVCAT 181

Query: 593  NLIMQIVAGRRY---EYR-SDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWL 760
            N I +++ GR     E+R + G  +  A+  K +  ++M L G F  GD I PL   + L
Sbjct: 182  NAISRVMLGRHVLGDEHRGAAGGGDTTAEEFKAMVVELMALAGVFNVGDFIPPL---KGL 238

Query: 761  DYEGHVKTMKRAAKDVDA----ILQDWVDARRKERRSNEDQKFIDVMLSMID----DQFT 916
            D +G V  MK+  +  DA    IL D      K   SN  +  +D++ ++I     D   
Sbjct: 239  DLQGVVAKMKKLHQRFDAFFSGILHD-----HKINGSNAAEGHVDLLTTLISLKDVDNNG 293

Query: 917  QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW 1096
            +G   + DT IKA++L++    ++T ++ + W +  L+++P  L RV+ E+D  +GK++ 
Sbjct: 294  EGGKLT-DTEIKALLLNLFTAGTDTTSSTVEWAITELIRNPNILARVRKELDLIVGKDKL 352

Query: 1097 AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR 1276
             ++SD+  L YLQ V+KE  R++P  P   P  A E C ++GY+IPK + L VNVW + R
Sbjct: 353  VKESDLGQLTYLQAVIKENFRLHPSTPLSLPRVAQESCEINGYYIPKDSTLLVNVWAIGR 412

Query: 1277 DPKIWPDPEKFLPERFMTNLE--GEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVAR 1450
            DP +WPDP +F PERF+   E      +   ++ +PFG GRR C G     ++ Q+ +A 
Sbjct: 413  DPNVWPDPLEFRPERFLMGGEKPNVDVRGNDFELIPFGSGRRICAGMNLGIRMVQLLIAT 472

Query: 1451 LFQGFNFSTVPNE---PLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR 1585
            +   F+F     +    L+M E  GI L +  PL V   PRL+  +++
Sbjct: 473  MVHAFDFELANGQLAKDLNMEEAYGITLQRADPLVVHPRPRLARHVYQ 520



>pir|T04566|T04566 cytochrome P450 homolog T12H17.100 - Arabidopsis
            thaliana>gb:ATCHRIV57_1546108 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 57.>gb:ATT12H17_1554356
            Arabidopsis thaliana DNA chromosome 4, BAC clone T12H17
            (ESSAII project).>gb:AK175743_1817731 Arabidopsis
            thaliana mRNA for cytochrome P450-like protein, complete
            cds, clone: RAFL22-29-D13.>gb:AK175975_1817963
            Arabidopsis thaliana mRNA for cytochrome P450-like
            protein, complete cds, clone: RAFL22-67-E24.
          Length = 526

 Score =  226 bits (577), Expect = 8e-58
 Identities = 156/520 (30%), Positives = 256/520 (49%), Gaps = 10/520 (1%)
 Frame = +2

Query: 53   SSILGIAALVL----LWFSWRKQSKRLPPEAGGAWP--IIGHLHHFRTSVPLVKTLSEWA 214
            S +L +AAL+     LW   + +SK+ PP   G WP  I+G+L    + V L        
Sbjct: 24   SVMLAVAALLAVVCYLWIQGKSKSKKEPPLPPGPWPLPIVGNLPFLNSDV-LHTQFQALT 82

Query: 215  DKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTN 394
             KYGP+  I LG    +VVSS +  R+   T+D   A       GK   Y      +S  
Sbjct: 83   LKYGPLMKIHLGSKLAIVVSSPDMAREVLKTHDITFANHDLPEVGKINTYGGEDILWSPY 142

Query: 395  NSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKEL-YTFISMDNNNPSAPKVNMSR 571
             ++WRR+RKL V ++ ++  LE       +   T  +E   T + M         VN+  
Sbjct: 143  GTHWRRLRKLCVMKMFTTPSLE-------ASYSTRREETRQTIVHMSEMAREGSPVNLGE 195

Query: 572  WFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF 751
                   N++ +++ G   E     ++  E   LK + S +  + G     D  FPL  F
Sbjct: 196  QIFLSIFNVVTRMMWGATVEGDERTSLGNE---LKTLISDISDIEGIQNYSD-FFPL--F 249

Query: 752  RWLDYEGHVKTMKRAAKDVDAILQDWVDARRKE--RRSNEDQKFIDVMLSMIDDQFTQGY 925
               D++G VK MK   K +D +    +++  K   ++S E++ F+  +L + DD      
Sbjct: 250  SRFDFQGLVKQMKGHVKKLDLLFDRVMESHVKMVGKKSEEEEDFLQYLLRVKDDDEKAPL 309

Query: 926  SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED 1105
            S    T +K++++ M+    +T      + +A ++  PE L +++ E+D  +GK+   E+
Sbjct: 310  SM---THVKSLLMDMVLGGVDTSVNASEFAMAEIVSRPEVLNKIRLELDQVVGKDNIVEE 366

Query: 1106 SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK 1285
            S +  LPYLQ V+KETLR++P  P L PH   E  +V GY +PK +++++NVW +HRDPK
Sbjct: 367  SHLPKLPYLQAVMKETLRLHPTLPLLVPHRNSETSVVAGYTVPKDSKIFINVWAIHRDPK 426

Query: 1286 IWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF 1465
             W +P +F PERF+ N          ++++PFG GRR C     A ++    +A L   F
Sbjct: 427  NWDEPNEFKPERFLEN--SLDFNGGDFKYLPFGSGRRICAAINMAERLVLFNIASLLHSF 484

Query: 1466 NFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS-PTLF 1582
            ++     +  ++ E  G++L   +PL  +  PRLS P L+
Sbjct: 485  DWKAPQGQKFEVEEKFGLVLKLKSPLVAIPVPRLSDPKLY 524



>sp|O48956|C981_SORBI Cytochrome P450 98A1 (EC
            1.14.-.-).>pir|T14638|T14638 cytochrome P450 CYP98A1 -
            sorghum>gb:AF029856_1762426 Sorghum bicolor cytochrome
            P450 CYP98A1 (CYP98A1) mRNA, complete cds.
          Length = 512

 Score =  226 bits (577), Expect = 8e-58
 Identities = 153/519 (29%), Positives = 265/519 (51%), Gaps = 14/519 (2%)
 Frame = +2

Query: 53   SSILGIA-ALVLLWFSW----RKQSKRLPPEAGGAWPIIGHLHHFRTSVPL-VKTLSEWA 214
            S +L +A A+VL+  S     R +  RLPP     WP++G+L   +   P+  +   EWA
Sbjct: 4    SLLLSVALAVVLIPLSLALLNRLRLGRLPP-GPRPWPVLGNLRQIK---PIRCRCFQEWA 59

Query: 215  DKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTN 394
            ++YGPV ++  G    +VVS+ E  ++    ND+ LA RP   + +    +     ++  
Sbjct: 60   ERYGPVISVWFGSGLTVVVSTSELAKEVLKENDQQLADRPRNRSTQRFSRNGQDLIWADY 119

Query: 395  NSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRW 574
              ++ +VRKL   E+ + +RLE L+ +   E+   ++ +Y   +   N      V     
Sbjct: 120  GPHYIKVRKLCNLELFTPKRLEALRPIREDEVTAMVESVYRAATAPGNEGKPMVVR---- 175

Query: 575  FGHLTL---NLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW 745
              HL++   N I ++  G+R+   ++G I+E+ +  K + +  + +       + I   W
Sbjct: 176  -NHLSMVAFNNITRLAFGKRF-MNANGDIDEQGREFKTIVNNGIKIGASLSVAEFI---W 230

Query: 746  FFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKE-RRSNEDQKFIDVMLSMIDDQFTQG 922
            + RWL    + +  K   +  D +    ++   K  + S   Q F+D + ++      Q 
Sbjct: 231  YLRWL-CPLNEELYKTHNERRDRLTMKIIEEHAKSLKESGAKQHFVDALFTL-----KQQ 284

Query: 923  YSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAE 1102
            Y  S DTVI  ++  M+    +T    + W +A L+++P   K++Q+E+D  +G++R   
Sbjct: 285  YDLSEDTVI-GLLWDMITAGMDTTVISVEWAMAELVRNPRVQKKLQEELDRVVGRDRVML 343

Query: 1103 DSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDP 1282
            ++D +NLPYLQ VVKE+LR++P  P + PH+A  +  + GY IPKG  + VNVW + RDP
Sbjct: 344  ETDFQNLPYLQAVVKESLRLHPPTPLMLPHKASTNVKIGGYDIPKGANVMVNVWAVARDP 403

Query: 1283 KIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQG 1462
            K+W +P ++ PERF+   E    +   ++ +PFG GRR CPG      +    +  L   
Sbjct: 404  KVWSNPLEYRPERFLE--ENIDIKGSDFRVLPFGAGRRVCPGAQLGINLVASMIGHLLHH 461

Query: 1463 FNFS----TVPNEPLDMMEDVGIILPKLTPLEVLVTPRL 1567
            F +S    T P E ++MME  G++    TPL+ +  PRL
Sbjct: 462  FEWSLPEGTRP-EDVNMMESPGLVTFMGTPLQAVAKPRL 499



>gb:AF214009_1777815 Brassica napus cytochrome p450-dependent
            monooxygenase (BNF5H3) mRNA, partial cds.
          Length = 513

 Score =  226 bits (576), Expect = 1e-57
 Identities = 160/527 (30%), Positives = 258/527 (48%), Gaps = 22/527 (4%)
 Frame = +2

Query: 53   SSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPV 232
            ++IL I +L +      ++ +  PP   G WPIIG++          + L+  A KYG +
Sbjct: 11   TAILIIVSLFIFIGLITRRRRSYPPGPRG-WPIIGNM--LMMDQLTHRGLANLAKKYGGL 67

Query: 233  FTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRR 412
              +R+G   +  VSS    R      D + + RP T A  YL YD A   F+    +WR+
Sbjct: 68   CHLRMGFLHMYAVSSPHVARQVLQVQDSIFSNRPATIAISYLTYDRADMAFAHYGPFWRQ 127

Query: 413  VRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTL 592
            +RK+ V ++ S +R E     W S ++  + ++   +S +        +N+      LT 
Sbjct: 128  MRKVCVMKVFSRKRAES----WAS-VRDEVDKMIRSVSSNVGK----SINVGEQIFALTR 178

Query: 593  NLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEG 772
            N+  +   G   E   D  I     R+ + FS+   L+G F   D I    +F W+D +G
Sbjct: 179  NITYRAAFGSACEKGQDEFI-----RILQEFSK---LFGAFNVADFIP---YFGWIDPQG 227

Query: 773  HVKTMKRAAKDVDAILQDWVDARRKERRSNE--------DQKFIDVMLSMIDDQ------ 910
              K + +A  D+D  + D +D   K++ +          D   +D +L+   ++      
Sbjct: 228  ISKRLVKARNDLDGFIDDIIDEHMKKKENQNTVDDGDVGDTDMVDDLLAFYSEEAKLVSE 287

Query: 911  ---FTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNI 1081
                      +RD  IKAI++ ++   +ET A+ + W L  LL+ PE LKRVQ E+   +
Sbjct: 288  TTDLQNSIKLTRDN-IKAIIMDVMFGGTETVASAIEWALTELLRSPEDLKRVQQELAEVV 346

Query: 1082 GKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNV 1261
            G +R  E+SD++ L +L+  +KETLR++P  P L  HE  ED  +DGY +PK +++ +N 
Sbjct: 347  GLDRRVEESDIEKLTFLKCTLKETLRLHPPIPLLL-HETAEDTEIDGYFVPKKSRVMINA 405

Query: 1262 WRLHRDPKIWPDPEKFLPERFMTNLEGEAA--QNRQYQFVPFGLGRRSCPGNLYATQITQ 1435
            + + RDPK WPD E F P RF   LE   A  +   ++F+PFG GR+SCPG        +
Sbjct: 406  FAIGRDPKSWPDAETFRPSRF---LEPGVADFKGSNFEFIPFGSGRKSCPGMQLGLYALE 462

Query: 1436 VAVARLFQGFNFST---VPNEPLDMMEDVGIILPKLTPLEVLVTPRL 1567
            +AVA +   F +     +    LDM +  G+  PK T L  + + RL
Sbjct: 463  LAVAHILHCFTWKLPDGMKASELDMNDVFGLTAPKATRLFAVPSTRL 509



>gb:AY056209_1563532 Arabidopsis thaliana putative cytochrome P450
            protein (At4g22690) mRNA, complete cds.
          Length = 524

 Score =  226 bits (576), Expect = 1e-57
 Identities = 156/520 (30%), Positives = 257/520 (49%), Gaps = 10/520 (1%)
 Frame = +2

Query: 53   SSILGIAALVLL----WFSWRKQSKRLPPEAGGAWP--IIGHLHHFRTSVPLVKTLSEWA 214
            S +LG+AAL+ +    W   + +SK  PP   G WP  I+G+L    + V L        
Sbjct: 22   SVMLGVAALLAVVCYFWIQGKSKSKNGPPLPPGPWPLPIVGNLPFLNSDV-LHTQFQALT 80

Query: 215  DKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTN 394
             K+GP+  I LG    +VVSS +  R+   T+D   A       GK   Y      +S  
Sbjct: 81   LKHGPLMKIHLGSKLAIVVSSPDMAREVLKTHDITFANHDLPEVGKINTYGGEDILWSPY 140

Query: 395  NSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKEL-YTFISMDNNNPSAPKVNMSR 571
             ++WRR+RKL V ++ ++  LE       +   T  +E   T + M         VN+  
Sbjct: 141  GTHWRRLRKLCVMKMFTTPTLE-------ASYSTRREETRQTIVHMSEMAREGSPVNLGE 193

Query: 572  WFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF 751
                   N++ +++ G   E     ++  E   LK + S +  + G     D IFPL  F
Sbjct: 194  QIFLSIFNVVTRMMWGATVEGDERTSLGNE---LKTLISDISDIEGIQNYSD-IFPL--F 247

Query: 752  RWLDYEGHVKTMKRAAKDVDAILQDWVDARRKE--RRSNEDQKFIDVMLSMIDDQFTQGY 925
               D++G VK MK   K +D +    +++  K   ++S E++ F+  +L + DD      
Sbjct: 248  SRFDFQGLVKQMKGHVKKLDLLFDRVMESHVKMVGKKSEEEEDFLQYLLRVKDDDEKAPL 307

Query: 926  SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED 1105
            S    T +K++++ M+    +T      + +A ++  PE L +++ E+D  +GK+   E+
Sbjct: 308  SM---THVKSLLMDMVLGGVDTSVNASEFAMAEIVSRPEVLNKIRLELDQVVGKDNIVEE 364

Query: 1106 SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK 1285
            S +  LPYLQ V+KETLR++P  P L PH   E  +V GY +PK +++++NVW +HRDPK
Sbjct: 365  SHLPKLPYLQAVMKETLRLHPTLPLLVPHRNSETSVVAGYTVPKDSKIFINVWAIHRDPK 424

Query: 1286 IWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF 1465
             W +P +F PERF+ N          ++++PFG GRR C     A ++    +A L   F
Sbjct: 425  NWDEPNEFKPERFLEN--SLDFNGGDFKYLPFGSGRRICAAINMAERLVLFNIASLLHSF 482

Query: 1466 NFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS-PTLF 1582
            ++     +  ++ E  G++L   +PL  +  PRLS P L+
Sbjct: 483  DWKAPQGQKFEVEEKFGLVLKLKSPLVAIPVPRLSDPKLY 522



>gb:AY275430_1594368 Gossypium hirsutum flavonoid 3',5'-hydroxylase
            mRNA, complete cds.
          Length = 510

 Score =  226 bits (575), Expect = 1e-57
 Identities = 147/495 (29%), Positives = 247/495 (49%), Gaps = 5/495 (1%)
 Frame = +2

Query: 113  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVR 292
            + LPP   G WPI+G L     S+P V+ L++ A KYGPV  +++G   ++V S+ +A R
Sbjct: 35   RTLPPGPKG-WPIVGALP-LLGSMPHVE-LAKLAKKYGPVMYLKMGTCNMVVASTPDAAR 91

Query: 293  DCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKH 472
                T D   + RP+     ++ Y+     F+     W+ +RKL    +L  + LE    
Sbjct: 92   AFLKTLDLNFSNRPSNAGATHIAYNSQDMVFAEYGPRWKLLRKLSNLHMLGGKALEDWSQ 151

Query: 473  VWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTI 652
            V   EL   ++      +M  ++     V +     +   N+I Q++  RR       T 
Sbjct: 152  VRAVELGHMLR------AMCESSRKGEPVVVPEMLTYAMANMIGQVILSRRVFV----TK 201

Query: 653  NEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWV 832
              E+   K +  ++M   G F  GD I  +    W+D +G    MK+     D +L   +
Sbjct: 202  GSESNEFKDMVVELMTSAGLFNIGDFIPSI---AWMDLQGIEGEMKKLHNRWDVLLTKMM 258

Query: 833  DARRK---ERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATH 1003
                +   ER+   D  F+D+++   ++   +  S    T +KA++L++    ++T ++ 
Sbjct: 259  KEHEETAYERKGKPD--FLDIIMDNRENSAGERLSL---TNVKALLLNLFTAGTDTSSSI 313

Query: 1004 LTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYL 1183
            + W LA +LK+P+ L +  +E+D  IG+ R  E+SD+  LPYLQ + KET R +P  P  
Sbjct: 314  IEWALAEILKNPKILNKAHEEMDKVIGRNRRLEESDIPKLPYLQAICKETFRKHPSTPLN 373

Query: 1184 APHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEA-AQNR 1360
             P  + + C ++GY+IPK T+L VN+W + RDP +W +P  F PERF++    +   +  
Sbjct: 374  LPRVSTQACEINGYYIPKNTRLSVNIWAIGRDPDVWGNPLDFTPERFLSGRFAKIDPRGN 433

Query: 1361 QYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNE-PLDMMEDVGIILPKLT 1537
             ++ +PFG GRR C G      + +  +  L   F++   P    L+M E  G+ L K  
Sbjct: 434  DFELIPFGAGRRICAGTRMGIVLVEYILGTLLHSFDWMLPPGTGELNMDEAFGLALQKAV 493

Query: 1538 PLEVLVTPRLSPTLF 1582
            PL  +V PRL+PT +
Sbjct: 494  PLSAMVRPRLAPTAY 508



>gb:AX146625_1462493 Sequence 1 from Patent WO0134817.
          Length = 532

 Score =  226 bits (575), Expect = 1e-57
 Identities = 166/534 (31%), Positives = 261/534 (48%), Gaps = 27/534 (5%)
 Frame = +2

Query: 62   LGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTI 241
            LG   LV+L    R++ K   P      PI+G++          + L+  A+ YG +  +
Sbjct: 22   LGTVCLVVLQQLRRRRGKAPLPPGPKPLPIVGNMGMMDQLTH--RGLAALAETYGGLLHL 79

Query: 242  RLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRK 421
            RLG      VS+ E  R+     D   + RP T A  YL YD A   F+    +WR++RK
Sbjct: 80   RLGRLHAFAVSTPEYAREVLQAQDGAFSNRPATAAIAYLTYDRADMAFAHYGPFWRQMRK 139

Query: 422  LVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLI 601
            L V ++ S RR E     W + ++     L   +++   +     VN+      LT N+ 
Sbjct: 140  LCVMKLFSRRRAE----TWAA-VRDECAALVRAVAVGGGS-GGEAVNLGELIFSLTKNVT 193

Query: 602  MQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVK 781
             +   G R     DG   EE   + + FS+   L+G F  GD  F  W   W+D +G  +
Sbjct: 194  FRAAFGTR-----DGEGQEEFIAILQEFSK---LFGAFNVGD--FLPWL-GWMDLQGINR 242

Query: 782  TMKRAAKDVDAILQDWVD--ARRKERRSNEDQKFIDVMLSMI-----------------D 904
             ++ A   +D  +   +D   RR +   + D   +D ML+                    
Sbjct: 243  RLRAARSALDRFIDKIIDEHVRRGKSPDDADADMVDDMLAFFVEATPGKATGAAAAADGG 302

Query: 905  DQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG 1084
            D        +RD  IKAI++ ++   +ET A+ + W +A ++  P+ ++RVQ E+   +G
Sbjct: 303  DDLHNTLRLTRDN-IKAIIMDVMFGGTETVASAIEWAMAEMMHSPDDMRRVQQELADVVG 361

Query: 1085 KERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW 1264
             +R   +SD+  LP+L+ V+KETLR++P  P L  HE  +DC+V GY +P+G+++ VNVW
Sbjct: 362  LDRNVSESDLDRLPFLRCVIKETLRLHPPIPLLL-HETADDCVVAGYSVPRGSRVMVNVW 420

Query: 1265 RLHRDPKIWPDPEKFLPERFMTNLEGEAA----QNRQYQFVPFGLGRRSCPGNLYATQIT 1432
             + R    W D + F P RF    EGEAA    +   ++F+PFG GRRSCPG        
Sbjct: 421  AIGRHRASWKDADAFRPSRFAAP-EGEAAGLDFKGGCFEFLPFGSGRRSCPGMALGLYAL 479

Query: 1433 QVAVARLFQGFNFS----TVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
            ++AVA+L   FN+S      P+E +DM +  G+  P+ T L  + TPRL+  L+
Sbjct: 480  ELAVAQLAHAFNWSLPDGMKPSE-MDMGDIFGLTAPRATRLYAVPTPRLNCPLY 532



>gb:AJ583531_1811351 Triticum aestivum mRNA for cytochrome P450
            (CYP98A11 gene).
          Length = 512

 Score =  225 bits (574), Expect = 2e-57
 Identities = 150/522 (28%), Positives = 256/522 (49%), Gaps = 9/522 (1%)
 Frame = +2

Query: 29   MDAVPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSE 208
            MD       +I  +A  + L    R +  RLPP     WP++G+L   +      +   E
Sbjct: 1    MDVASLLPFAIALVAIPISLALLDRLRLGRLPP-GPRPWPVVGNLRQIKPV--RCRCFQE 57

Query: 209  WADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFS 388
            WA +YGP+ ++  G S  +VVS+ E  ++    +D+ LA RP   + +    +     ++
Sbjct: 58   WAARYGPIISVWFGSSLTVVVSTSELAKEVLKEHDQQLADRPRNRSTQRFSRNGQDLIWA 117

Query: 389  TNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMS 568
                ++ +VRKL   E+ + +RLE L+ +   E+   ++ ++   +    N   P V + 
Sbjct: 118  DYGPHYIKVRKLCNLELFTQKRLEALRPIREDEVTAMVESVHR-AAAGPGNEGKPLV-VR 175

Query: 569  RWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWF 748
                 ++ N I ++  G+R+   +DG I+EE Q  K + +  + +       + I   W+
Sbjct: 176  NHLAMVSFNNITRLAFGKRF-MNADGDIDEEGQEFKLIVNNGIKIGASLSVAEYI---WY 231

Query: 749  FRWLD------YEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQ 910
             RWL       Y  H +   R  K    I+++   A R+   S   Q F+D + ++    
Sbjct: 232  LRWLCPLNEELYNTHNERRDRLTKK---IIEEHAQALRE---SGAKQHFVDALFTL---- 281

Query: 911  FTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE 1090
              + Y  S DTV   ++  M+    +T    + W +A L+++P   K++Q+E+D+ +G++
Sbjct: 282  -REKYDLSDDTVF-GLLWDMITAGMDTTVISVEWAMAELVRNPRVQKKLQEELDSVVGRD 339

Query: 1091 RWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRL 1270
            R   ++D +NLPYL  VVKE+LR++P  P + PH+A     V GY IPKG  + VNVW +
Sbjct: 340  RVMSETDFQNLPYLMAVVKESLRLHPPTPLMLPHKASASVKVGGYSIPKGANVMVNVWAV 399

Query: 1271 HRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVAR 1450
             RDPK+W  P +F PERF+   E    +   ++ +PFG GRR CPG      +    +  
Sbjct: 400  ARDPKVWSSPLEFRPERFLE--ESIDIKGSDFRVLPFGAGRRVCPGAQLGINLVASMIGH 457

Query: 1451 LFQGFNFSTVPN---EPLDMMEDVGIILPKLTPLEVLVTPRL 1567
            +   F +S       E + MME  G++    T L+ + TPRL
Sbjct: 458  MLHHFEWSLPEGARPEDISMMESPGLVTFMGTLLQAVATPRL 499



>gb:AP005846_1858999 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:B1307A11.
          Length = 508

 Score =  225 bits (573), Expect = 2e-57
 Identities = 156/528 (29%), Positives = 262/528 (49%), Gaps = 18/528 (3%)
 Frame = +2

Query: 50   LSSILGIAALVLL--WFSWRKQSKRLPPEAGGAW--PIIGHLHHFRTSVPLVKTLSEWAD 217
            L S+L +A L ++  +    +     PP   G W  P+IG +HH    +P  + L + A 
Sbjct: 10   LLSVLAVALLQIIKAFLIIIRAKPAAPPLPPGPWRLPVIGSMHHLAGKLPH-RALRDLAA 68

Query: 218  KYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNN 397
             +GP+  +RLG + ++V SS E  R+   T+D   A RP   AG+ + Y  A   FS + 
Sbjct: 69   AHGPLMMLRLGETPLVVASSREMAREVLRTHDANFATRPRLLAGEVVLYGGADILFSPSG 128

Query: 398  SYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWF 577
             YWRR+R+L   E+L  +R+   +H+   E+++ ++E+          PS P V+++  F
Sbjct: 129  EYWRRLRQLCAAEVLGPKRVLSFRHIREQEMESQVEEIRAA------GPSTP-VDLTAMF 181

Query: 578  GHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRW 757
              L ++ + +   G ++            +  KK  S V    G  ++     P  F  W
Sbjct: 182  SFLVISNVSRASFGSKH------------RNAKKFLSAVKT--GVTLASGFKIPDLFPTW 227

Query: 758  LDYEGHVKTMKRAAKD----VDAILQDWVDARRKERRSNE-------DQKFIDVMLSMID 904
                  V  M+RA +D    VD+ L++ ++ RR  R           ++  +DV++ + +
Sbjct: 228  RKVLAAVTGMRRALEDIHRVVDSTLEEVIEERRSAREDKARCGMVGTEENLVDVLIGLHE 287

Query: 905  DQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEI-DTNI 1081
                QG   SR++ IK+++  M    + T ++ L W ++ L++ P  + ++Q EI +   
Sbjct: 288  ----QGGCLSRNS-IKSVIFDMFTAGTGTLSSTLGWGMSELMRSPMVMSKLQGEIREAFY 342

Query: 1082 GKERWAE-DSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVN 1258
            GK    E D     L YL   +KETLR++P  P L P E+++ C + GY IP  +++ VN
Sbjct: 343  GKATVGEEDIQASRLTYLGLFIKETLRLHPPVPLLVPRESIDTCEIKGYMIPARSRIIVN 402

Query: 1259 VWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV 1438
             W + RDP+ W D E+F P+RF  N+         Y+++PFG GRR CPG  Y   I ++
Sbjct: 403  AWAIGRDPRYWDDAEEFKPKRFEKNMVDFTGS--CYEYLPFGAGRRMCPGVAYGIPILEM 460

Query: 1439 AVARLFQGFNFSTVPN-EPLDMMEDVGIILPKLTPLEVLVTPRLSPTL 1579
            A+ +L   F++S       +DM E  G+   + TPL +  TP + P L
Sbjct: 461  ALVQLLYHFDWSLPKGVVDVDMEESSGLGARRKTPLLLCATPFVVPVL 508



>gb:AB028152_1517808 Torenia hybrida TFNS5 mRNA for cytochrome P450,
            complete cds.
          Length = 512

 Score =  225 bits (573), Expect = 2e-57
 Identities = 151/502 (30%), Positives = 255/502 (50%), Gaps = 15/502 (2%)
 Frame = +2

Query: 113  KRLPPEAGG--AWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEA 286
            +R PP   G  + PIIGHLH       L  T  E++ KYGP+  ++LG    +V S+ E 
Sbjct: 25   RRGPPSPPGPLSLPIIGHLHLLGPR--LHHTFHEFSLKYGPLIQLKLGSIPCVVASTPEL 82

Query: 287  VRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKL 466
             R+   TN+   ++R  + A   + YD + F FS    YW+ ++KL   E+L +R L   
Sbjct: 83   AREFLKTNELAFSSRKHSTAIDIVTYDSS-FAFSPYGPYWKYIKKLCTYELLGARNLGHF 141

Query: 467  KHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDG 646
            + +   E+++ ++ L       + +     VN++     LT N+I  ++   R     +G
Sbjct: 142  QPIRNLEVRSFLQLLM------HKSFKGESVNVTDELVRLTSNVISHMMLSIRCS-EDEG 194

Query: 647  TINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQD 826
                +A+  + V  +V  ++GEF   D I   WF +  D +G  K  +   +  DA+L+ 
Sbjct: 195  ----DAEAARTVIREVTQIFGEFDVTDII---WFCKKFDLQGIKKRSEDIQRRYDALLEK 247

Query: 827  WVDARRKERRSNEDQK----------FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQ 976
             +  R + RR N D+           F+D++L +++   T+   ++R+  +KA++L    
Sbjct: 248  IISDRERSRRQNRDKHGGGNNEEAKDFLDMLLDVMESGDTE-VKFTREH-LKALILDFFT 305

Query: 977  DASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETL 1156
              ++T A    W +A L+ +P  LK+ Q+EI   IG +R  ++SD  +LPYLQ ++KET 
Sbjct: 306  AGTDTTAIATEWAIAELINNPNVLKKAQEEISRIIGTKRIVQESDAPDLPYLQAIIKETF 365

Query: 1157 RMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFM-TN 1333
            R++P  P L+  ++  DC V+GY I   + L+VN+W + R+P  W  P +F PERF+   
Sbjct: 366  RLHPPIPMLS-RKSTSDCTVNGYKIQAKSLLFVNIWSIGRNPNYWESPMEFRPERFLEKG 424

Query: 1334 LEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTV--PNEPLDMME 1507
             E    + + ++ +PFG GRR CPG L A Q     +  + Q F++         +DM E
Sbjct: 425  RESIDVKGQHFELLPFGTGRRGCPGMLLAIQEVVSIIGTMVQCFDWKLADGSGNNVDMTE 484

Query: 1508 DVGIILPKLTPLEVLVTPRLSP 1573
              G+  P+   L   + PR+ P
Sbjct: 485  RSGLTAPRAFDLVCRLYPRVDP 506



>gb:AB012925_1511971 Torenia hybrida mRNA for flavonoid
            3',5'-hydroxylase, complete cds.
          Length = 511

 Score =  225 bits (573), Expect = 2e-57
 Identities = 148/487 (30%), Positives = 247/487 (50%), Gaps = 2/487 (0%)
 Frame = +2

Query: 113  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVR 292
            KRLPP   G +P++G L     S+P V  L++ A KYGPV  ++ G   ++V S+  + R
Sbjct: 39   KRLPPGPTG-FPVVGALP-LLGSMPHV-ALAKMAKKYGPVMYLKTGTLGMVVASTPSSAR 95

Query: 293  DCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKH 472
                T D   + RP      +L Y      F+     WR +R+L    +L  + L+   +
Sbjct: 96   AFLKTLDSNFSNRPANAGATHLAYGAQDMVFAPYGPRWRLLRRLSNLHMLGGKALDGWAN 155

Query: 473  VWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTI 652
            V  SEL   ++      +M+  +     V +     +   N+I Q++  RR       T 
Sbjct: 156  VRASELGHMLE------AMNRASREGEVVVVPEMLVYAMANMIGQVILSRRVFV----TK 205

Query: 653  NEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWV 832
             EE    K +  ++M   G F  GD + P+    W+D +G  + MK   K  D ++   +
Sbjct: 206  GEEVNEFKDMVVELMTSAGYFNIGDFV-PI--LAWMDLQGIERGMKALHKKFDKLITRML 262

Query: 833  DARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTW 1012
            +   +   S     F+D +++   D ++        + IKA++L++    ++T ++ + W
Sbjct: 263  E---QHEASAHKPDFLDAIIAASLDDYSSEEERLSTSNIKALLLNLFTAGTDTSSSTIEW 319

Query: 1013 ILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPH 1192
             L+ +LK  + LKR Q+E+D  +G+ER   +SD++ L YL+ + KET R +P  P   P 
Sbjct: 320  ALSEMLKKGKILKRAQEEMDRVVGRERRLVESDIEKLGYLKAICKETFRKHPSTPLNLPR 379

Query: 1193 EAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQF 1372
             + E C+V+G++IPKGT+L VN+W + RDP++W DP +F P+RF+ +      +   ++ 
Sbjct: 380  ISSEACVVNGHYIPKGTRLSVNIWAIGRDPEVWEDPLEFNPDRFLHSKMD--PRGNDFEL 437

Query: 1373 VPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTV--PNEPLDMMEDVGIILPKLTPLE 1546
            +PFG GRR C G      + +  +A L   F++      N  ++M E  GI L K TPL+
Sbjct: 438  MPFGAGRRICAGTRMGIVLVEYILATLVHSFDWKAADQDNNIMNMEEAFGIALQKATPLK 497

Query: 1547 VLVTPRL 1567
             LVTPRL
Sbjct: 498  ALVTPRL 504



>pir|T04564|T04564 cytochrome P450 homolog T12H17.80 - Arabidopsis
            thaliana>gb:ATCHRIV57_1546106 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 57.>gb:ATT12H17_1554354
            Arabidopsis thaliana DNA chromosome 4, BAC clone T12H17
            (ESSAII project).
          Length = 524

 Score =  224 bits (572), Expect = 3e-57
 Identities = 155/520 (29%), Positives = 256/520 (49%), Gaps = 10/520 (1%)
 Frame = +2

Query: 53   SSILGIAALVLL----WFSWRKQSKRLPPEAGGAWP--IIGHLHHFRTSVPLVKTLSEWA 214
            S +LG+AAL+ +    W   + +SK  PP   G WP  I+G+L    + V L        
Sbjct: 22   SVMLGVAALLAVVCYFWIQGKSKSKNGPPLPPGPWPLPIVGNLPFLNSDV-LHTQFQALT 80

Query: 215  DKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTN 394
             K+GP+  I LG    +VVSS +  R+   T+D   A       GK   Y      +S  
Sbjct: 81   LKHGPLMKIHLGSKLAIVVSSPDMAREVLKTHDITFANHDLPEVGKINTYGGEDILWSPY 140

Query: 395  NSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKEL-YTFISMDNNNPSAPKVNMSR 571
             ++WRR+RKL V ++ ++  LE       +   T  +E   T + M         VN+  
Sbjct: 141  GTHWRRLRKLCVMKMFTTPTLE-------ASYSTRREETRQTIVHMSEMAREGSPVNLGE 193

Query: 572  WFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF 751
                   N++ +++ G   E     ++  E   LK + S +  + G     D  FPL  F
Sbjct: 194  QIFLSIFNVVTRMMWGATVEGDERTSLGNE---LKTLISDISDIEGIQNYSD-FFPL--F 247

Query: 752  RWLDYEGHVKTMKRAAKDVDAILQDWVDARRKE--RRSNEDQKFIDVMLSMIDDQFTQGY 925
               D++G VK MK   K +D +    +++  K   ++S E++ F+  +L + DD      
Sbjct: 248  SRFDFQGLVKQMKGHVKKLDLLFDRVMESHVKMVGKKSEEEEDFLQYLLRVKDDDEKAPL 307

Query: 926  SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED 1105
            S    T +K++++ M+    +T      + +A ++  PE L +++ E+D  +GK+   E+
Sbjct: 308  SM---THVKSLLMDMVLGGVDTSVNASEFAMAEIVSRPEVLNKIRLELDQVVGKDNIVEE 364

Query: 1106 SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK 1285
            S +  LPYLQ V+KETLR++P  P L PH   E  +V GY +PK +++++NVW +HRDPK
Sbjct: 365  SHLPKLPYLQAVMKETLRLHPTLPLLVPHRNSETSVVAGYTVPKDSKIFINVWAIHRDPK 424

Query: 1286 IWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF 1465
             W +P +F PERF+ N          ++++PFG GRR C     A ++    +A L   F
Sbjct: 425  NWDEPNEFKPERFLEN--SLDFNGGDFKYLPFGSGRRICAAINMAERLVLFNIASLLHSF 482

Query: 1466 NFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS-PTLF 1582
            ++     +  ++ E  G++L   +PL  +  PRLS P L+
Sbjct: 483  DWKAPQGQKFEVEEKFGLVLKLKSPLVAIPVPRLSDPKLY 522



>pir|T00605|T00605 probable cytochrome P450 At2g02580 [imported] -
            Arabidopsis thaliana
          Length = 512

 Score =  224 bits (572), Expect = 3e-57
 Identities = 155/522 (29%), Positives = 260/522 (49%), Gaps = 20/522 (3%)
 Frame = +2

Query: 56   SILGIAALVLLWFSWRKQ--SKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGP 229
            S+L +  ++L  F  +K+  +++ PP   G +PIIG+LH     +P  ++L   +  YGP
Sbjct: 8    SLLFLCCILLAAFKHKKRRTNQQQPPSPPG-FPIIGNLHQLG-ELPH-QSLWSLSKTYGP 64

Query: 230  VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPT------------TCAGKYLGYDYA 373
            V  ++LG    +VVSS E  +     ND    +RP+            +   K L Y+Y 
Sbjct: 65   VMLLKLGSVPTVVVSSSETAKQVLKINDLHCCSRPSLAELNKNHDFDHSLGAKELSYNYL 124

Query: 374  VFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAP 553
               FS  + YW+ +R++ V+E+ S++R+  ++ +   E++  I      +S   +     
Sbjct: 125  DIAFSPFDDYWKELRRICVQELFSAKRVHSIQPIKEEEVRKLI------VSATESASQKS 178

Query: 554  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI 733
             VN+S  F  LT+++I +      +       +N +     K+        G F S    
Sbjct: 179  PVNLSEKFLDLTVSVICKAAFSLDFH---TSVLNNDG--FDKLIHDAFLFLGSF-SASNF 232

Query: 734  FPL--WFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDD 907
            FP   W   WL   G  +  +++ KD+D   Q   D  ++E +   +  F+D++L +  +
Sbjct: 233  FPNGGWIIDWLT--GLQRRREKSVKDLDVFYQQMFDLHKQENKQGVED-FVDLLLKLEKE 289

Query: 908  QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK 1087
            +   GY       +KAI++++L  A  T A  +TW +A L+++P  +K+VQ EI   +  
Sbjct: 290  ETVLGYGKLTRNHVKAILMNVLLGAINTSAMTMTWAMAELIRNPRVMKKVQSEIRNQMIN 349

Query: 1088 ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR 1267
            +      D+ +LPYL+ V+KET R++P  P L P E + +  ++GY I   T LYVNVW 
Sbjct: 350  KSVITLDDIDHLPYLKMVIKETWRLHPPVPLLLPREVMSEFEINGYKIQPKTLLYVNVWA 409

Query: 1268 LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA 1447
            + RDP  W D + F PERFM N      QN  ++ +PFG GRR CPG    T + +  +A
Sbjct: 410  IGRDPDSWKDADMFYPERFMDNNIDAKGQN--FELLPFGSGRRICPGMYMGTTMVEFGLA 467

Query: 1448 RLFQGFNFSTVPN----EPLDMMEDVGIILPKLTPLEVLVTP 1561
             +   F++  VP+    E +DM E  G+ + K    E+L+ P
Sbjct: 468  NMLYQFDWE-VPDGMVVEDIDMEESPGLAVGKKN--ELLLVP 506



>gb:AP001298_1820969 Arabidopsis thaliana genomic DNA, chromosome 3,
            BAC clone:F20C19.
          Length = 510

 Score =  224 bits (571), Expect = 4e-57
 Identities = 160/525 (30%), Positives = 263/525 (50%), Gaps = 16/525 (3%)
 Frame = +2

Query: 38   VPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWAD 217
            +P    S L +AAL L     R+Q +R PP   G +PIIG+LH     +P  ++L   + 
Sbjct: 7    LPLLFLSCLLLAALRL---KKRRQHQRKPPSPPG-FPIIGNLHQLG-ELPH-QSLWSLSK 60

Query: 218  KYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGK-----YLG-----YD 367
            KYGPV  ++ G    +VVSS E  +     +D    +RP+    K     YLG     Y+
Sbjct: 61   KYGPVMLLKFGSIPTVVVSSSETAKQALKIHDLNCCSRPSLAGLKQKSYDYLGPRALSYN 120

Query: 368  YAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPS 547
            Y    FS  N YW+ +R++ V+E+ S +++  ++ +   E    +K+L    S   +   
Sbjct: 121  YLDIVFSPFNDYWKELRRMCVQELFSPKQVHLIQPIREEE----VKKLMN--SFSESAAQ 174

Query: 548  APKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGD 727
               VN+S     LT+ +I +   G  ++    GT+       K +    ++L G F + D
Sbjct: 175  KTPVNLSEKLASLTVGVICKAAFGVSFQ----GTVLNSDNFDKLIHDAFLFL-GSFSASD 229

Query: 728  AIFPL--WFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMI 901
              FP   W   WL   G     +R+ + +DA  +   D  ++  +   +  F+D++L + 
Sbjct: 230  -YFPNVGWIIDWLT--GLQGQRERSVRGLDAFYEQMFDLHKQGNKEGVED-FVDLLLKLE 285

Query: 902  DDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNI 1081
             ++   GY       IKA+++++L     T A  +TW +  L+++P  +K+VQ EI   I
Sbjct: 286  KEETVLGYGKLTRNHIKAVLMNVLLGGIGTSAITMTWAMTELMRNPRVMKKVQSEIRNQI 345

Query: 1082 GKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNV 1261
            G +      D+  L YL+ V+ ET R++P  P L P E + +  ++GY IP  T+LYVNV
Sbjct: 346  GGKSMICLDDIDQLHYLKMVINETWRLHPPAPLLVPREVMSEFEINGYTIPAKTRLYVNV 405

Query: 1262 WRLHRDPKIWPDPEKFLPERFM-TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV 1438
            W + RDP  W DPE+FLPERF+ +N++   A+ + ++ +PFG GRR CP     T + + 
Sbjct: 406  WGIGRDPDTWKDPEEFLPERFVNSNID---AKGQNFELLPFGSGRRMCPAMYMGTTMVEF 462

Query: 1439 AVARLFQGFNFSTVPN---EPLDMMEDVGIILPKLTPLEVLVTPR 1564
             +A L   F++        E +DM E  G+   K    E+++ PR
Sbjct: 463  GLANLLYHFDWKLPEGMVVEDIDMEESPGLNASKKN--ELVLVPR 505



>gb:AK118051_1816051 Arabidopsis thaliana At3g52970 mRNA for putative
            cytochrome P450, complete cds, clone: RAFL19-29-L10.
          Length = 516

 Score =  224 bits (571), Expect = 4e-57
 Identities = 156/520 (30%), Positives = 266/520 (51%), Gaps = 16/520 (3%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGP 229
            L + + +   V   F  ++   RLPP     WP+IG++      +P   +L++ + ++GP
Sbjct: 13   LFTSIAVLIYVTCLFYTKRCRTRLPP-GPNPWPVIGNIFQL-AGLPPHDSLTKLSRRHGP 70

Query: 230  VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWR 409
            + T+R+G    +V+SS E  R+ F  +D  LA R    A K           +   +YWR
Sbjct: 71   IMTLRIGSMLTVVISSSEVAREIFKKHDAALAGREIYEAMKGGKSSDGSLITAQYGAYWR 130

Query: 410  RVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLT 589
             +R+L   +   +RRL+ +  V        + ++  F+     N     +++ R+F  + 
Sbjct: 131  MLRRLCTTQFFVTRRLDAMSDV----RSRCVDQMLRFVEEGGQN-GTKTIDVGRYFFLMA 185

Query: 590  LNLIMQIVAGRRYEYRSDGTINEEAQRLKKVF---SQVMYLWGEFVSGDAIFPLWFFRWL 760
             NLI  ++  R         ++ +++R  + F    +VM   G+    D  FPL   R+L
Sbjct: 186  FNLIGNLMFSR-------DLLDPDSKRGSEFFYHTGKVMEFAGKPNVAD-FFPL--LRFL 235

Query: 761  DYEG-HVKT---MKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMID----DQFT 916
            D +G   KT   +++A +     +++  + R +E+   + + ++DV+L        D+  
Sbjct: 236  DPQGIRRKTQFHVEKAFEIAGEFIRERTEVREREKSDEKTKDYLDVLLEFRGGDGVDEEP 295

Query: 917  QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNI-GKER 1093
              +S SRD  I  IV  M    ++T  + L W LA LL +P +L ++Q E+ T      +
Sbjct: 296  SSFS-SRD--INVIVFEMFTAGTDTTTSTLEWALAELLHNPRTLTKLQTELRTYFKSSNQ 352

Query: 1094 WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDC-IVDGYHIPKGTQLYVNVWRL 1270
              ++ D+ NLPYL  V+ ETLR++P  P+L PH+A+  C I D Y IPK TQ+ VNVW +
Sbjct: 353  KLQEEDLPNLPYLSAVIMETLRLHPPLPFLVPHKAMSTCHIFDQYTIPKETQVLVNVWAI 412

Query: 1271 HRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVAR 1450
             RDPK W DP  F PERF+++ +    + + Y+F+PFG GRR CP    A+++  +A+  
Sbjct: 413  GRDPKTWVDPIMFKPERFISDPDARDFKGQDYEFLPFGSGRRMCPALPLASRVLPLAIGS 472

Query: 1451 LFQGFNFST---VPNEPLDMMEDVGIILPKLTPLEVLVTP 1561
            + + F+++    +  E +DM E +GI L K  PLE +  P
Sbjct: 473  MVRSFDWALENGLNAEEMDMGERIGITLKKAVPLEAIPIP 512



>sp|Q9LIP4|C72X_ARATH Cytochrome P450 71B36 (EC
            1.14.-.-).>gb:AP001298_1820968 Arabidopsis thaliana
            genomic DNA, chromosome 3, BAC clone:F20C19.
          Length = 500

 Score =  224 bits (571), Expect = 4e-57
 Identities = 150/511 (29%), Positives = 259/511 (50%), Gaps = 12/511 (2%)
 Frame = +2

Query: 56   SILGIAALVLLWFSWRK--QSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGP 229
            S+L ++ ++L  F+ +K  Q +R PP   G +PIIG+LH     +P  ++L   + KYG 
Sbjct: 8    SLLFLSCILLAAFTHKKRQQHQRKPPSPPG-FPIIGNLHQLG-ELPH-QSLWRLSKKYGH 64

Query: 230  VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWR 409
            V  ++ G    +VVSS E  +     +D    +RP+    + L Y+Y    FS  + YW+
Sbjct: 65   VMLLKFGSIPTVVVSSSETAKQVLKIHDLHCCSRPSLAGPRALSYNYLDIAFSPFDDYWK 124

Query: 410  RVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLT 589
             +R++ V+E+ S +R++  + +   E++  I       S+  +      VN+S  F  LT
Sbjct: 125  ELRRICVQELFSVKRVQSFQPIKEDEVKKLID------SVSESASQGTPVNLSEKFTSLT 178

Query: 590  LNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL--WFFRWLD 763
            + +  +   G  ++    GT+   + R +K+        G F + D  FP   W   WL 
Sbjct: 179  VRVTCKATFGVNFQ----GTVLN-SDRFEKLIHDTYLFLGSFSASD-YFPNGGWIIDWLT 232

Query: 764  YEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDT 943
              G     +R+ + +DA  +   D  ++  +   +  F+D++L +  ++   GY      
Sbjct: 233  --GLHGQRERSVRALDAFYEQMFDLHKQGNKEGVED-FVDLLLRLEKEETVIGYGKLTRN 289

Query: 944  VIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNL 1123
             IKAI++++L     T A  +TW +  L+++P  +K+VQ EI   IGK+      D+  L
Sbjct: 290  HIKAILMNVLIGGIGTSAITMTWAMTELMRNPRVMKKVQSEIRNQIGKKSMITLDDIDQL 349

Query: 1124 PYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPE 1303
             YL+ V+ ET R++P  P+L P + + +  ++ Y IP  T+LYVNVW + RDP  W DPE
Sbjct: 350  HYLKMVINETWRLHPPSPFLIPRQVMSEFELNDYVIPVKTRLYVNVWAIGRDPDTWKDPE 409

Query: 1304 KFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST-- 1477
            +FLPERF+ +     A+ + ++ +PFG GRR CP     T + +  +A +   F++    
Sbjct: 410  EFLPERFVNS--SIDAKGQHFELLPFGSGRRMCPAMYMGTTMVEFGLANMLYHFDWKIPV 467

Query: 1478 -VPNEPLDMMEDVGIILPK-----LTPLEVL 1552
             +  E +D+ E  G+   K     L PL+ L
Sbjct: 468  GMVAEDIDLEESPGLNASKKNELVLVPLKYL 498



>sp|Q9STL1|C71M_ARATH Cytochrome P450 71A22 (EC
            1.14.-.-).>pir|T06711|T06711 probable cytochrome P450
            T29H11.170 - Arabidopsis thaliana>gb:ATT29H11_1555643
            Arabidopsis thaliana DNA chromosome 3, BAC clone
            T29H11.>gb:AY096499_1576041 Arabidopsis thaliana unknown
            protein (At3g48310) mRNA, complete
            cds.>gb:AY133854_1581674 Arabidopsis thaliana clone
            U10369 unknown protein (At3g48270) mRNA, complete cds.
          Length = 490

 Score =  224 bits (570), Expect = 5e-57
 Identities = 140/498 (28%), Positives = 255/498 (51%), Gaps = 5/498 (1%)
 Frame = +2

Query: 80   VLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISR 259
            +L +   +K  K   P +    P+IG+LH         ++L   +++YGP+  +R G+  
Sbjct: 18   ILFFIKQKKGKKSNTPASPPRLPLIGNLHQLGRHPH--RSLCSLSNRYGPLMLLRFGLVP 75

Query: 260  ILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEI 439
            +LVVSS +  RD   T D++ A+RP +   + + Y+      +    YWR+++ + V  +
Sbjct: 76   VLVVSSADVARDILKTYDRVFASRPRSKIFEKIFYEARDVALAPYGEYWRQMKSVCVLHL 135

Query: 440  LSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAG 619
            L+++ +   ++V   E+   ++++           S+ +VN+S   G LT ++I ++  G
Sbjct: 136  LTNKMVRSFRNVRQEEISLMMEKI--------QKSSSLQVNLSELLGSLTNDVISRVALG 187

Query: 620  RRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAA 799
            R+Y   +D          K++  ++  L GEF  G  +  L +  W+   G    +K+  
Sbjct: 188  RKYSDETD---------FKELMKRLTKLLGEFCVGTYVPWLAWIDWIS--GLDGQLKKTG 236

Query: 800  KDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQD 979
             D+D  L+  V           D  F+DV+L  I  + + G+   R + IKAI+L ++  
Sbjct: 237  NDLDEFLEKVVQDHEDGDAQRTD--FVDVLLR-IQREKSVGFEIDRLS-IKAIILDVVVG 292

Query: 980  ASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLR 1159
             ++T    + W +  LL  PE L R+Q+E+ T         + D+K++ YL+ V+KET+R
Sbjct: 293  GTDTSYALMEWAMTELLHRPECLNRLQEEVRTICKGNSSVSEDDIKDMNYLKAVIKETMR 352

Query: 1160 MYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIW-PDPEKFLPERFMTNL 1336
            ++P  P + PHE+ +D  +  YHIP GTQ+ +N W + R+   W PD EKF PER + + 
Sbjct: 353  LHPPLPLMVPHESTQDVRLGDYHIPAGTQVMINAWAIGREAATWGPDAEKFRPERHLNSS 412

Query: 1337 EGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLD----MM 1504
                  N  ++ +PFG GRR CP   +A  + +V +A L   +++  +P E ++    + 
Sbjct: 413  VDFRGHN--FELIPFGAGRRICPAISFAVILIEVTLANLVHRYDW-RLPEEYIEDQTNVA 469

Query: 1505 EDVGIILPKLTPLEVLVT 1558
            E  G+++ +L PL  +V+
Sbjct: 470  ESTGMVIHRLFPLYAIVS 487



>sp|O81970|C719_SOYBN Cytochrome P450 71A9 (EC 1.14.-.-) (P450
            CP1).>pir|T07113|T07113 probable cytochrome P450 -
            soybean>gb:GMC450CP1_1680413 G.max mRNA for putative
            cytochrome P450, clone CP1.
          Length = 499

 Score =  224 bits (570), Expect = 5e-57
 Identities = 144/491 (29%), Positives = 258/491 (52%), Gaps = 6/491 (1%)
 Frame = +2

Query: 107  QSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEA 286
            + +RL P      P IG+LH   T     ++L   ++K+GP+  ++LG    LVVSS E 
Sbjct: 28   EKRRLLPPGPRKLPFIGNLHQLGTLPH--QSLQYLSNKHGPLMFLQLGSIPTLVVSSAEM 85

Query: 287  VRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKL 466
             R+ F  +D + + RP+  A   LGY   V +F+    YWR +RK+++ E+LS +R++  
Sbjct: 86   AREIFKNHDSVFSGRPSLYAANRLGYGSTV-SFAPYGEYWREMRKIMILELLSPKRVQSF 144

Query: 467  KHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDG 646
            + V   E    +K L   I++ +       VN+S     LT N++ +I  G+R    +D 
Sbjct: 145  EAVRFEE----VKLLLQTIALSHG-----PVNLSELTLSLTNNIVCRIALGKRNRSGAD- 194

Query: 647  TINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL--WFFRWLDYEGHVKTMKRAAKDV-DAI 817
                +A ++ ++  +   + G F   D  FP   W  ++   E  ++ + R   +  D +
Sbjct: 195  ----DANKVSEMLKETQAMLGGFFPVD-FFPRLGWLNKFSGLENRLEKIFREMDNFYDQV 249

Query: 818  LQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFA 997
            +++ +     ER   E +  +DV+L +  D   Q  + + D  IK +++ +    ++T +
Sbjct: 250  IKEHIADNSSERSGAEHEDVVDVLLRVQKDP-NQAIAITDDQ-IKGVLVDIFVAGTDTAS 307

Query: 998  THLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGP 1177
              + WI++ L+++P+++KR Q+E+   +  +   E+ D+  L Y++ VVKE LR++P  P
Sbjct: 308  ATIIWIMSELIRNPKAMKRAQEEVRDLVTGKEMVEEIDLSKLLYIKSVVKEVLRLHPPAP 367

Query: 1178 YLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQN 1357
             L P E  E+C + G+ IP  T++ VN   +  DP  W +P +FLPERF+ +      Q+
Sbjct: 368  LLVPREITENCTIKGFEIPAKTRVLVNAKSIAMDPCCWENPNEFLPERFLVSPIDFKGQH 427

Query: 1358 RQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST---VPNEPLDMMEDVGIILP 1528
              ++ +PFG+GRR CPG  +A  + ++A+A L   F++     +  + LDM E +GI + 
Sbjct: 428  --FEMLPFGVGRRGCPGVNFAMPVVELALANLLFRFDWELPLGLGIQDLDMEEAIGITIH 485

Query: 1529 KLTPLEVLVTP 1561
            K   L +  TP
Sbjct: 486  KKAHLWLKATP 496



>sp|P47195|CP80_BERST Berbamunine synthase (EC 1.14.21.3) (Cytochrome
            P450 80) (CYPLXXX) ((S)-N-methylcoclaurine oxidase [C-O
            phenol-coupling]).>gb:U09610_1726239 Berberis stolonifera
            cytochrome P-450 CYP80 mRNA, complete cds.
          Length = 487

 Score =  223 bits (569), Expect = 7e-57
 Identities = 160/509 (31%), Positives = 250/509 (49%), Gaps = 7/509 (1%)
 Frame = +2

Query: 62   LGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHF--RTSVPLVKTLSEWADKYGPVF 235
            + I+ + LL+F   K      P +  AWPI+GHL     + S P +  +S  A KYGP+ 
Sbjct: 8    VSISLVALLYFLLFKPKHTNLPPSPPAWPIVGHLPDLISKNSPPFLDYMSNIAQKYGPLI 67

Query: 236  TIRLGISRILVVSSWEAVRDCFATNDKLLAAR-PTTCAGKYLGYDYAVFTFSTNNSYWRR 412
             ++ G+   +  S+ EA  +   TNDK+L+ R P  C       DY++  +S +NSYW++
Sbjct: 68   HLKFGLHSSIFASTKEAAMEVLQTNDKVLSGRQPLPCFRIKPHIDYSIL-WSDSNSYWKK 126

Query: 413  VRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTL 592
             RK++  EI S + L+  +       +     L  FI     +     V +  W     L
Sbjct: 127  GRKILHTEIFSQKMLQAQE----KNRERVAGNLVNFIMTKVGDV----VELRSWLFGCAL 178

Query: 593  NLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEG 772
            N++  +V  +     SD     +   + K+   ++   G+F    + FP+      D  G
Sbjct: 179  NVLGHVVFSKDVFEYSD---QSDEVGMDKLIHGMLMTGGDFDVA-SYFPV--LARFDLHG 232

Query: 773  HVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIK 952
              + M    K +  I +  V ARR  R   E +  +DV+++   + F +         I 
Sbjct: 233  LKRKMDEQFKLLIKIWEGEVLARRANRNP-EPKDMLDVLIA---NDFNEHQ-------IN 281

Query: 953  AIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYL 1132
            A+ +      S+T +  + W LA L+K+P+ L ++++E+D  +G+    ++S    LPYL
Sbjct: 282  AMFMETFGPGSDTNSNIIEWALAQLIKNPDKLAKLREELDRVVGRSSTVKESHFSELPYL 341

Query: 1133 QGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFL 1312
            Q  VKET+R+YP    + PH  +E C V GY IPKG  ++VN   + RDPK W DP KF 
Sbjct: 342  QACVKETMRLYPPISIMIPHRCMETCQVMGYTIPKGMDVHVNAHAIGRDPKDWKDPLKFQ 401

Query: 1313 PERFMTNLEGEAAQN-RQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST---V 1480
            PERF   L+ +   N +Q+QF+PFG GRR CPG   A +I  + +A L   F +     V
Sbjct: 402  PERF---LDSDIEYNGKQFQFIPFGSGRRICPGRPLAVRIIPLVLASLVHAFGWELPDGV 458

Query: 1481 PNEPLDMMEDVGIILPKLTPLEVLVTPRL 1567
            PNE LDM E   + L    PL V+   R+
Sbjct: 459  PNEKLDMEELFTLSLCMAKPLRVIPKVRI 487



>sp|Q96581|C754_GENTR Flavonoid 3',5'-hydroxylase (EC 1.14.-.-)
            (F3'5'H) (Cytochrome P450 75A4).>gb:D85184_1674874
            Gentiana triflora mRNA for flavonoid 3',5'-hydroxylase,
            complete cds.
          Length = 516

 Score =  223 bits (569), Expect = 7e-57
 Identities = 157/492 (31%), Positives = 247/492 (50%), Gaps = 7/492 (1%)
 Frame = +2

Query: 113  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVR 292
            +RLPP   G WPI+G L     ++P V T +  A KYG V  +++G   + + S+ +A +
Sbjct: 39   RRLPPGPTG-WPILGALP-LLGNMPHV-TFANMAKKYGSVMYLKVGSHGLAIASTPDAAK 95

Query: 293  DCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKH 472
                T D   + RP      +L Y+     F+     W+ +RKL    +L  + LE    
Sbjct: 96   AFLKTLDLNFSNRPPNAGATHLAYNAQDMVFAHYGPKWKLLRKLSNLHMLGGKALENWAD 155

Query: 473  VWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTI 652
            V  +EL   +K +  F S  NN P    V +S    +   N++ Q++  RR   +     
Sbjct: 156  VRKTELGYMLKAM--FESSQNNEP----VMISEMLTYAMANMLSQVILSRRVFNKKGAKS 209

Query: 653  NEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWV 832
            NE     K +  ++M   G F  GD I  +    W+D +G    MKR  K  D +L   +
Sbjct: 210  NE----FKDMVVELMTSAGYFNIGDFIPSIG---WMDLQGIEGGMKRLHKKFDVLLTRLL 262

Query: 833  DARRK---ERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATH 1003
            D  ++   ER+   D  F+D +++  D+  + G   + D  IKA++L++    ++T ++ 
Sbjct: 263  DDHKRTSQERKQKPD--FLDFVIANGDN--SDGERLNTDN-IKALLLNLFTAGTDTSSSI 317

Query: 1004 LTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYL 1183
            + W LA LLK+   L R QDE+D  IG++R   +SD+ NLPYLQ + KET R +P  P  
Sbjct: 318  IEWALAELLKNRTLLTRAQDEMDRVIGRDRRLLESDIPNLPYLQAICKETFRKHPSTPLN 377

Query: 1184 APHEAVEDCI-VDGYHIPKGTQLYVNVWRLHRDPKIWPD-PEKFLPERFMTNLEGEA-AQ 1354
             P   +   + V+GY+IPKGT+L VN+W + RDP +W D P +F PERF+     +   +
Sbjct: 378  LPRNCIRGHVDVNGYYIPKGTRLNVNIWAIGRDPSVWGDNPNEFDPERFLYGRNAKIDPR 437

Query: 1355 NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST-VPNEPLDMMEDVGIILPK 1531
               ++ +PFG GRR C G      + +  +  L   F++      + L+M E  G+ L K
Sbjct: 438  GNHFELIPFGAGRRICAGTRMGILLVEYILGTLVHSFDWKLGFSEDELNMDETFGLALQK 497

Query: 1532 LTPLEVLVTPRL 1567
              PL  +V PRL
Sbjct: 498  AVPLAAMVIPRL 509



>gb:AP002842_1823064 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, BAC clone:OSJNBa0075G19.
          Length = 518

 Score =  223 bits (568), Expect = 9e-57
 Identities = 166/523 (31%), Positives = 257/523 (49%), Gaps = 15/523 (2%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFSWRKQSKR--LPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY 223
            L ++L    L ++  +  + SKR  LPP    A PIIGHLH  R   P  +       ++
Sbjct: 14   LVALLVTVVLAVMRSAGSRSSKRGRLPPSPM-ALPIIGHLHLIRP--PPHRAFDRILARH 70

Query: 224  GPVFTIRLGIS-RILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNS 400
            GP+  +RLG S   +V+ S +  RD F   +  +  RP T   + L Y  A F F+   +
Sbjct: 71   GPLVYLRLGPSTHCVVIGSADVARD-FLKFEASIPERPPTAVTRQLAYGKAGFAFAPYGA 129

Query: 401  YWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFG 580
            YWR V++L + E+L  R +E L+ V  +EL   ++   +             V+MS    
Sbjct: 130  YWRFVKRLCMSELLGPRTVELLRPVRAAELADVLRAAQSAAERGEG------VDMSHELV 183

Query: 581  HLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWL 760
             +  N IM++VA             E A+  +    QV  L G F + D +      R  
Sbjct: 184  RMANNSIMRMVAS--------ALPGEMAEAARDCAKQVAELVGAFNAEDFVAVC---RGW 232

Query: 761  DYEGHVKTMKRAAKDVDAILQDWVDAR--------RKERRSNEDQKFIDVMLSMIDDQFT 916
            D +G  +         DA+L+  ++A+        R  RR +  +  +D+++   +D  T
Sbjct: 233  DLQGIGRRTNEVHARFDALLETIIEAKEEARRRSLRLGRRESSSKDLLDMLMDAAEDD-T 291

Query: 917  QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW 1096
                 +RD  IKA VL +    S+T AT + W+LA L+ HPE + +++ E+D  +G+ R 
Sbjct: 292  AEVKLTRDN-IKAFVLDIFTAGSDTTATTVEWMLAELVNHPECMAKLRGELDAVVGRSRL 350

Query: 1097 AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR 1276
              + DV  LPYLQ V+KETLR+ P   + A    VE   V GY IP  TQ++ N++ + R
Sbjct: 351  VGEQDVARLPYLQAVLKETLRLRPPAVF-AQRVTVEPVQVRGYTIPTDTQVFFNIFSIGR 409

Query: 1277 DPKIWPDPEKFLPERFMTNLEGEAA--QNRQYQFVPFGLGRRSCPGNLYATQITQVAVAR 1450
            D   W  P  F P+RF+ +  G     + +  Q +PFG GRR+CPG   A Q     +A 
Sbjct: 410  DATYWDQPLHFRPDRFLPDGAGATVDPKGQHPQLMPFGSGRRACPGMGLAMQAVPAFLAA 469

Query: 1451 LFQGFNFSTVPNE--PLDMMEDVGIILPKLTPLEVLVTPRLSP 1573
            L Q F+++  P++  PLDM E  G++  +  PL +L TPR+ P
Sbjct: 470  LVQCFDWAPPPSQPLPLDMEEAAGLVSARKHPLLLLPTPRIQP 512



>sp|O65782|C831_ARATH Cytochrome P450 83B1 (EC
            1.14.-.-).>pir|T10680|T10680 cytochrome P450
            monooxygenase [imported] - Arabidopsis
            thaliana>gb:ATCHRIV75_1547071 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 75.>gb:ATF3L17_1550606
            Arabidopsis thaliana DNA chromosome 4, BAC clone F3L17
            (ESSA project).>gb:AY085195_1570274 Arabidopsis thaliana
            clone 13745 mRNA, complete sequence.>gb:BT002333_1635936
            Arabidopsis thaliana clone C104933 putative cytochrome
            P450 monooxygenase (At4g31500) mRNA, complete
            cds.>gb:D78598_1674780 Arabidopsis thaliana mRNA for
            cytochrome P450 monooxygenase, complete cds, clone
            P450-2.
          Length = 499

 Score =  223 bits (568), Expect = 9e-57
 Identities = 152/493 (30%), Positives = 248/493 (50%), Gaps = 8/493 (1%)
 Frame = +2

Query: 59   ILGIAALVLLWF--SWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPV 232
            I G+ A    +F  S  K+S RLPP   G  PIIG+LH      P    L   +  YGP+
Sbjct: 7    IAGLVAAAAFFFLRSTTKKSLRLPPGPKGL-PIIGNLHQMEKFNPQ-HFLFRLSKLYGPI 64

Query: 233  FTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRR 412
            FT+++G  R+ V+SS E  ++   T D    ARP     + + Y      F    +Y+R 
Sbjct: 65   FTMKIGGRRLAVISSAELAKELLKTQDLNFTARPLLKGQQTMSYQGRELGFGQYTAYYRE 124

Query: 413  VRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTL 592
            +RK+ +  + S  R+   + V   E Q  + ++Y              V++S      T 
Sbjct: 125  MRKMCMVNLFSPNRVASFRPVREEECQRMMDKIYKAADQSGT------VDLSELLLSFTN 178

Query: 593  NLIMQIVAGRRY-EYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD-Y 766
             ++ +   G+RY EY   GT   E +R   +  +   L G     D +FP  +F +LD  
Sbjct: 179  CVVCRQAFGKRYNEY---GT---EMKRFIDILYETQALLGTLFFSD-LFP--YFGFLDNL 229

Query: 767  EGHVKTMKRAAKDVDAILQDWVDARRKERR-SNEDQKFIDVMLSMIDDQ-FTQGYSYSRD 940
             G    +K+A K++D  LQ+ +D      R   E + FID+++ +  DQ F+  +++   
Sbjct: 230  TGLSARLKKAFKELDTYLQELLDETLDPNRPKQETESFIDLLMQIYKDQPFSIKFTHEN- 288

Query: 941  TVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKN 1120
              +KA++L ++   ++T A  + W +  L+K+PE++K+ QDE+ + IG + +  + D+ N
Sbjct: 289  --VKAMILDIVVPGTDTAAAVVVWAMTYLIKYPEAMKKAQDEVRSVIGDKGYVSEEDIPN 346

Query: 1121 LPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPD- 1297
            LPYL+ V+KE+LR+ P  P L   E + D  + GY IP  T + VN W + RD   W D 
Sbjct: 347  LPYLKAVIKESLRLEPVIPILLHRETIADAKIGGYDIPAKTIIQVNAWAVSRDTAAWGDN 406

Query: 1298 PEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST 1477
            P +F+PERFM   +G   + + ++ +PFG GRR CP       + ++  A L   F++S 
Sbjct: 407  PNEFIPERFMNEHKGVDFKGQDFELLPFGSGRRMCPAMHLGIAMVEIPFANLLYKFDWSL 466

Query: 1478 VPN-EPLDMMEDV 1513
                +P D+  DV
Sbjct: 467  PKGIKPEDIKMDV 479



>gb:AB022733_1515266 Glycyrrhiza echinata CYP Ge-51 mRNA for
            cytochrome P450, complete cds.
          Length = 523

 Score =  223 bits (567), Expect = 1e-56
 Identities = 148/493 (30%), Positives = 248/493 (50%), Gaps = 22/493 (4%)
 Frame = +2

Query: 68   IAALVLLWFS---WRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVF 235
            ++AL+  +F    + +  K LPP      PIIGH+H      PL+ ++    + +YGP+F
Sbjct: 12   VSALICYFFFRPYFHRYGKNLPPSPFFRLPIIGHMHMLG---PLLHQSFHNLSHRYGPLF 68

Query: 236  TIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRV 415
            ++  G    +V S+    +    TN+     R  + A K L Y+ ++  F+    YWR +
Sbjct: 69   SLNFGSVLCVVASTPHFAKQLLQTNELAFNCRIESTAVKKLTYESSL-AFAPYGDYWRFI 127

Query: 416  RKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLN 595
            +KL + E+L SR +   +H+   E    ++ L       N   +   VN++     LT N
Sbjct: 128  KKLSMNELLGSRSINNFQHLRAQETHQLLRLL------SNRARAFEAVNITEELLKLTNN 181

Query: 596  LIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGH 775
            +I  ++ G             EA+  + V   V  ++GEF   D I   W F+ +D +G 
Sbjct: 182  VISIMMVG-------------EAEEARDVVRDVTEIFGEFNVSDFI---WLFKKMDLQGF 225

Query: 776  VKTMKRAAKDVDAILQDWVDAR---RKERRSNEDQ----------KFIDVMLSMIDDQFT 916
             K ++   +  D +++  +  R   RK+RR N  +           F+D++L   +D+ +
Sbjct: 226  GKRIEDLFQRFDTLVERIISKREQTRKDRRRNGKKGEQESGDGIRDFLDILLDCTEDENS 285

Query: 917  QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW 1096
            +     +   IKA+++      ++T A    W L  L+K P  L++V++EID  +GK+R 
Sbjct: 286  E--IKIQRVHIKALIMDFFTAGTDTTAISTEWALVELVKKPSVLQKVREEIDNVVGKDRL 343

Query: 1097 AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR 1276
             E+SD  NLPYLQ ++KET R++P  P +     V +C V+ Y IP+ + L+VNVW + R
Sbjct: 344  VEESDCPNLPYLQAILKETFRLHPPVP-MVTRRCVAECTVENYVIPEDSLLFVNVWSIGR 402

Query: 1277 DPKIWPDPEKFLPERFMTNLEGEAA-----QNRQYQFVPFGLGRRSCPGNLYATQITQVA 1441
            +PK W +P +F PERF+  LEG+++     +   +Q +PFG GRR CPG   A Q     
Sbjct: 403  NPKFWDNPLEFCPERFL-KLEGDSSGVVDVRGSHFQLLPFGSGRRMCPGVSLAMQEVPAL 461

Query: 1442 VARLFQGFNFSTV 1480
            +  + Q F+F  V
Sbjct: 462  LGAIIQCFDFQVV 474



>gb:AB127340_1528330 Muscari armeniacum MaP450 mRNA for cytochrome
            P450, complete cds.>gb:AB127341_1528331 Muscari
            armeniacum MaP450 gene for cytochrome P450, complete cds.
          Length = 503

 Score =  222 bits (565), Expect = 2e-56
 Identities = 143/492 (29%), Positives = 255/492 (51%), Gaps = 8/492 (1%)
 Frame = +2

Query: 116  RLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRD 295
            +LPP      P+IG+LH   T     ++L   + KYGP+  ++LG    L+VSS +  R+
Sbjct: 33   KLPP-CPPKLPLIGNLHQMGTLPH--QSLHALSVKYGPLMLLKLGQIPTLIVSSADMARE 89

Query: 296  CFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHV 475
               T+D + A+RP+      + Y      F+    +WR++RKL V  +LS + ++  + +
Sbjct: 90   IMKTHDHIFASRPSLMTAGIILYGSMDVVFAPYGEHWRQMRKLCVNHLLSPKAVQSFRRM 149

Query: 476  WVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTIN 655
               E+ T + ++    S      S+  VNMS        N +++ ++ + +        +
Sbjct: 150  HEEEVATMVAKISEVSS------SSGVVNMSETLNLFASNAMLKAISRKLFR-------D 196

Query: 656  EEAQR-LKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYE-GHVKTMKRAAKDVDAILQDW 829
            E   R + ++  +   + G+F   D   PL    W D   G     K+ A+  D +L + 
Sbjct: 197  ERRSRVICELNEETAAILGQFSVSD-FMPL--LAWFDMVFGVGARAKKTARLWDRVLHEI 253

Query: 830  VDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLT 1009
            ++  R  R S  +  F++V+L++++D     +S ++D +IKA++  M+   +ET +T + 
Sbjct: 254  IEDCRNRRDSEVNTDFVNVLLALLEDN-DMDFSLNKD-IIKAVLQDMIAAGTETSSTAMD 311

Query: 1010 WILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAP 1189
            W +A L+++PE++K++QDE+      +    D D+  + YL+ V+KE LR++P  P L P
Sbjct: 312  WCMAELVRNPEAMKKLQDEVRGIANTKPMITDDDLSKMGYLKAVIKELLRLHPPVPLLIP 371

Query: 1190 HEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFM---TNLEGEAAQNR 1360
             E+++ C V G+ IPK T++ VN W + RDP +W  PE+F PERF+    N  G      
Sbjct: 372  RESMDHCEVQGFDIPKQTRVIVNAWSIGRDPNVWEAPEEFRPERFLDCAINFRG-----H 426

Query: 1361 QYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST---VPNEPLDMMEDVGIILPK 1531
             ++ +PFG GRR CPG  +A    ++A+A L + F++     + NE L M +  G+   +
Sbjct: 427  DFELIPFGAGRRICPGMQFAVSTLELALANLVRSFDWELPDGMNNEDLGMGDGPGLSARR 486

Query: 1532 LTPLEVLVTPRL 1567
               L ++  P L
Sbjct: 487  RQSLLLVAKPFL 498



>sp|P93149|C9B1_GLYEC Cytochrome P450 93B1 (EC 1.14.-.-)
            ((2S)-flavanone 2-hydroxylase) (Licodione synthase)
            (Flavone synthase II) (CYP GE-5).>gb:AB001380_1508465
            Glycyrrhiza echinata CYP93B1 mRNA for cytochrome P450,
            complete cds, clone:CYP Ge-5.
          Length = 523

 Score =  222 bits (565), Expect = 2e-56
 Identities = 148/493 (30%), Positives = 248/493 (50%), Gaps = 22/493 (4%)
 Frame = +2

Query: 68   IAALVLLWFS---WRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVF 235
            ++AL+  +F    + +  K LPP      PIIGH+H      PL+ ++    + +YGP+F
Sbjct: 12   VSALICYFFFRPYFHRYGKNLPPSPFFRLPIIGHMHMLG---PLLHQSFHNLSHRYGPLF 68

Query: 236  TIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRV 415
            ++  G    +V S+    +    TN+     R  + A K L Y+ ++  F+    YWR +
Sbjct: 69   SLNFGSVLCVVASTPHFAKQLLQTNELAFNCRIESTAVKKLTYESSL-AFAPYGDYWRFI 127

Query: 416  RKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLN 595
            +KL + E+L SR +   +H+   E    ++ L       N   +   VN++     LT N
Sbjct: 128  KKLSMNELLGSRSINNFQHLRAQETHQLLRLL------SNRARAFEAVNITEELLKLTNN 181

Query: 596  LIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGH 775
            +I  ++ G             EA+  + V   V  ++GEF   D I   W F+ +D +G 
Sbjct: 182  VISIMMVG-------------EAEEARDVVRDVTEIFGEFNVSDFI---WLFKKMDLQGF 225

Query: 776  VKTMKRAAKDVDAILQDWVDAR---RKERRSNEDQ----------KFIDVMLSMIDDQFT 916
             K ++   +  D +++  +  R   RK+RR N  +           F+D++L   +D+ +
Sbjct: 226  GKRIEDLFQRFDTLVERIISKREQTRKDRRRNGKKGEQGSGDGIRDFLDILLDCTEDENS 285

Query: 917  QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW 1096
            +     +   IKA+++      ++T A    W L  L+K P  L++V++EID  +GK+R 
Sbjct: 286  E--IKIQRVHIKALIMDFFTAGTDTTAISTEWALVELVKKPSVLQKVREEIDNVVGKDRL 343

Query: 1097 AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR 1276
             E+SD  NLPYLQ ++KET R++P  P +     V +C V+ Y IP+ + L+VNVW + R
Sbjct: 344  VEESDCPNLPYLQAILKETFRLHPPVP-MVTRRCVAECTVENYVIPEDSLLFVNVWSIGR 402

Query: 1277 DPKIWPDPEKFLPERFMTNLEGEAA-----QNRQYQFVPFGLGRRSCPGNLYATQITQVA 1441
            +PK W +P +F PERF+  LEG+++     +   +Q +PFG GRR CPG   A Q     
Sbjct: 403  NPKFWDNPLEFRPERFL-KLEGDSSGVVDVRGSHFQLLPFGSGRRMCPGVSLAMQEVPAL 461

Query: 1442 VARLFQGFNFSTV 1480
            +  + Q F+F  V
Sbjct: 462  LGAIIQCFDFHVV 474



>pir|T48140|T48140 flavonoid 3',5'-hydroxylase homolog T4C9.140
            [similarity] - Arabidopsis thaliana>gb:ATCHRIV33_1544995
            Arabidopsis thaliana DNA chromosome 4, contig fragment
            No. 33.>gb:ATT4C9_1555997 Arabidopsis thaliana DNA
            chromosome 4, BAC clone T4C9 (ESSA
            project).>gb:BT005454_1638394 Arabidopsis thaliana clone
            U51208 putative cytochrome p450 (At4g12300) mRNA,
            complete cds.>gb:AK118782_1816744 Arabidopsis thaliana
            At4g12300 mRNA for putative flavonoid 3',5'-hydroxylase,
            complete cds, clone: RAFL21-11-N07.
          Length = 516

 Score =  221 bits (563), Expect = 4e-56
 Identities = 145/501 (28%), Positives = 243/501 (48%), Gaps = 5/501 (0%)
 Frame = +2

Query: 83   LLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRI 262
            +LW+ +++  +   P      PI+G+L        L    +  A  +GP+F + LG    
Sbjct: 29   ILWYIFKRSPQPSLPPGPRGLPIVGNLPFLDPD--LHTYFANLAQSHGPIFKLNLGSKLT 86

Query: 263  LVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEIL 442
            +VV+S    R+     D   + R     G+   Y      ++   + WR++RK+ V ++L
Sbjct: 87   IVVNSPSLAREILKDQDINFSNRDVPLTGRAATYGGIDIVWTPYGAEWRQLRKICVLKLL 146

Query: 443  SSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGR 622
            S + L+    +   E++   + LY          S  KV    +     +NL M ++ G 
Sbjct: 147  SRKTLDSFYELRRKEVRERTRYLYE----QGRKQSPVKVGDQLFL--TMMNLTMNMLWGG 200

Query: 623  RYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWL---DYEGHVKTMKR 793
              +     ++  E    K V S++  L  E    D      FF WL   D +G VK M  
Sbjct: 201  SVKAEEMESVGTE---FKGVISEITRLLSEPNVSD------FFPWLARFDLQGLVKRMGV 251

Query: 794  AAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTV--IKAIVLS 967
             A+++DA+L   ++ + K  R  +D +  D +  ++  +  +G S    T+  +KA++  
Sbjct: 252  CARELDAVLDRAIE-QMKPLRGRDDDEVKDFLQYLMKLKDQEGDSEVPITINHVKALLTD 310

Query: 968  MLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVK 1147
            M+   ++T    + + +A L+ +PE +KR Q+E+D  +GK+   E+S +  LPY+  ++K
Sbjct: 311  MVVGGTDTSTNTIEFAMAELMSNPELIKRAQEELDEVVGKDNIVEESHITRLPYILAIMK 370

Query: 1148 ETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFM 1327
            ETLR++P  P L PH   E+ +V GY IPK T+++VNVW + RDP +W +P +F PERF+
Sbjct: 371  ETLRLHPTLPLLVPHRPAENTVVGGYTIPKDTKIFVNVWSIQRDPNVWENPTEFRPERFL 430

Query: 1328 TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMME 1507
             N   +      Y + PFG GRR C G   A ++    +A L   F++       LD+ E
Sbjct: 431  DNNSCDFT-GANYSYFPFGSGRRICAGVALAERMVLYTLATLLHSFDWKIPEGHVLDLKE 489

Query: 1508 DVGIILPKLTPLEVLVTPRLS 1570
              GI+L    PL  L  PR S
Sbjct: 490  KFGIVLKLKIPLVALPIPRFS 510



>sp|O64637|C7C2_ARATH Cytochrome P450 76C2 (EC
            1.14.-.-).>pir|T00870|T00870 probable cytochrome P450
            At2g45570 [imported] - Arabidopsis
            thaliana>gb:AC003680_1531189 Arabidopsis thaliana
            chromosome 2 BAC F17K2 genomic sequence, complete
            sequence.>gb:AY062600_1565256 Arabidopsis thaliana
            putative cytochrome P450 (At2g45570; F17K2.10) mRNA,
            complete cds.>gb:AY114660_1578702 Arabidopsis thaliana
            putative cytochrome P450 (At2g45570) mRNA, complete cds.
          Length = 512

 Score =  221 bits (562), Expect = 5e-56
 Identities = 145/499 (29%), Positives = 261/499 (52%), Gaps = 16/499 (3%)
 Frame = +2

Query: 104  KQSKRLPPEAGGA--WPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSS 277
            + S+++ P   G    PIIG++H    +     + ++ +  YGP+ +++ G    +VV+S
Sbjct: 30   RSSRKVVPSPPGPPRLPIIGNIHLVGRNPH--HSFADLSKTYGPIMSLKFGSLNTVVVTS 87

Query: 278  WEAVRDCFATNDKLLAARPTTCAGKYLGYD-YAVFTFSTNNSYWRRVRKLVVEEILSSRR 454
             EA R+   T D++L++R  T + + + +D  +V     ++S WR +RKL   ++ S +R
Sbjct: 88   PEAAREVLRTYDQILSSRTPTNSIRSINHDKVSVVWLPPSSSRWRLLRKLSATQLFSPQR 147

Query: 455  LEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTL--NLIMQIVAGRRY 628
            +E  K +     +  +KEL +F+S  +    A  ++ + +   L +  N++  +  G  Y
Sbjct: 148  IEATKTL----RENKVKELVSFMSESSEREEAVDISRATFITALNIISNILFSVDLGN-Y 202

Query: 629  EYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDV 808
            +    G   +    + +             + DA     F  +LD +G+ KT+K  ++ +
Sbjct: 203  DSNKSGVFQDTVIGVMEAVG----------NPDAANFFPFLGFLDLQGNRKTLKACSERL 252

Query: 809  DAILQDWVDARRKERRSNE-------DQKFIDVMLSMIDDQFTQGYSYSRDTV-IKAIVL 964
              + + ++DA+  E+   +       ++ F+DV+L +     T+G     +T  I  ++L
Sbjct: 253  FKVFRGFIDAKLAEKSLRDTNSKDVRERDFVDVLLDL-----TEGDEAELNTNDIVHLLL 307

Query: 965  SMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVV 1144
             +    ++T ++ + W +A LL++PE++ + Q EID  IG++   E+SD+  LPYLQ VV
Sbjct: 308  DLFGAGTDTNSSTVEWAMAELLRNPETMVKAQAEIDCVIGQKGVVEESDISALPYLQAVV 367

Query: 1145 KETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERF 1324
            KET R++P  P L P +A  D  V G+ +PK TQ++VNVW + RDP +W +  +F PERF
Sbjct: 368  KETFRLHPAAPLLVPRKAESDVEVLGFMVPKDTQVFVNVWAIGRDPNVWENSSRFKPERF 427

Query: 1325 MTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF---STVPNEPL 1495
            +   +    + R Y+  PFG GRR CPG   A +   + +A L   F++   + V +E L
Sbjct: 428  LG--KDIDLRGRDYELTPFGAGRRICPGLPLAVKTVPLMLASLLYSFDWKLPNGVGSEDL 485

Query: 1496 DMMEDVGIILPKLTPLEVL 1552
            DM E  G+ L K  PL  +
Sbjct: 486  DMDETFGLTLHKTNPLHAV 504



>sp|Q9LTL0|C72Q_ARATH Cytochrome P450 71B26 (EC
            1.14.-.-).>gb:AB024038_1515909 Arabidopsis thaliana
            genomic DNA, chromosome 3, P1 clone:
            MTC11.>gb:AY128393_1580692 Arabidopsis thaliana
            cytochrome P450, putative (At3g26290) mRNA, complete
            cds.>gb:BT008871_1640067 Arabidopsis thaliana At3g26290
            mRNA, complete cds.
          Length = 500

 Score =  221 bits (562), Expect = 5e-56
 Identities = 149/505 (29%), Positives = 251/505 (49%), Gaps = 7/505 (1%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFSWRKQSK--RLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY 223
            LS +  I  L+L  F  +   K  R+P   G  +PIIG+LH         ++L + + KY
Sbjct: 7    LSLLFFIIFLLLAAFKRKNHGKHRRIPSPPG--FPIIGNLHQLGELQH--QSLWKLSKKY 62

Query: 224  GPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSY 403
            GPV  ++LG    L++SS E  +      D    +RP+   G+ L Y+    + S  N Y
Sbjct: 63   GPVMLLKLGKVPTLILSSSETAKQALRDYDLHCCSRPSLAGGRELSYNNLDMSSSPYNEY 122

Query: 404  WRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGH 583
            W+ +RKL  +E+ S+ +++ ++ +   E++  I  +    S+ N       VN+S+ F  
Sbjct: 123  WKELRKLCSQELFSANKIQSIQPIKDEEVKKVIDSIAESSSLKN------PVNLSKTFLA 176

Query: 584  LTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWL- 760
            LT +++ +   G  +E      +N +  R  K+      + G F + D I    +  W+ 
Sbjct: 177  LTTSVVCKAAFGVSFE---GSVLNSD--RFNKLVRDTFEMLGSFSASDFIP---YVGWII 228

Query: 761  -DYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSR 937
              + G     K++ +D+DA  +   D  ++E+    +   +DV+L +  ++   G     
Sbjct: 229  DKFNGLQGWRKKSFRDLDAFYEQIFDLHKEEKEVGSED-LVDVLLRLEKEEIVVGNGKLT 287

Query: 938  DTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVK 1117
               IKAI++++L    +T A  +TW +A L K+P  +K+VQ EI   I  +      D  
Sbjct: 288  RNHIKAILMNILLGGIDTSAITMTWAMAELAKNPRVMKKVQAEIRNQIKNKERISFDDTD 347

Query: 1118 NLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPD 1297
             L YL+ V+KET R++P  P L P + + +  ++GY IP  T+L+VNVW + RDP  W D
Sbjct: 348  KLEYLKMVIKETWRLHPPTPLLLPRDVITEFEINGYTIPAKTRLHVNVWAIGRDPDTWKD 407

Query: 1298 PEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST 1477
            PE FLPERF  N     A+ + ++ + FG GRR CPG    T + +  +A +   F++  
Sbjct: 408  PEMFLPERF--NDSNIDAKGQNFELLSFGSGRRICPGLYMGTTMVEFGLANMLYHFDWKL 465

Query: 1478 VPN---EPLDMMEDVGIILPKLTPL 1543
                  E +DM E  G+ + K + L
Sbjct: 466  PEGMVVEDIDMEEAPGLTVSKKSEL 490



>gb:AB010697_1511191 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MOJ9.
          Length = 507

 Score =  220 bits (561), Expect = 6e-56
 Identities = 154/496 (31%), Positives = 254/496 (51%), Gaps = 2/496 (0%)
 Frame = +2

Query: 62   LGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFT 238
            LGI  L+    +  +    LPP    A PIIGH+H      P+  + L + + +YGP+  
Sbjct: 15   LGITVLIQAITNRLRDRLPLPPSPT-ALPIIGHIHLLG---PIAHQALHKLSIRYGPLMY 70

Query: 239  IRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVR 418
            + +G    L+VSS E   +   +N+     RPT     YL Y  A F  +    +W+ ++
Sbjct: 71   LFIGSIPNLIVSSAEMANEILKSNELNFLNRPTMQNVDYLTYGSADFFSAPYGLHWKFMK 130

Query: 419  KLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNL 598
            ++ + E+ SSR L+     +VS     +K+L   I +     +   VN+      LT N+
Sbjct: 131  RICMVELFSSRALDS----FVSVRSEELKKL--LIRVLKKAEAEESVNLGEQLKELTSNI 184

Query: 599  IMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHV 778
            I +++  R+ +  SDG   E+++ + K+  ++  L G F   +     WF + LD +G  
Sbjct: 185  ITRMMF-RKMQSDSDG--GEKSEEVIKMVVELNELAGFFNVSETF---WFLKRLDLQGLK 238

Query: 779  KTMKRAAKDVDAILQDWVDARRKERRS-NEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKA 955
            K +K A    D I++  ++     +++   ++  +DV+L + +D+  +    +R+  IKA
Sbjct: 239  KRLKNARDKYDVIIERIMEEHESSKKNATGERNMLDVLLDIYEDKNAE-MKLTREN-IKA 296

Query: 956  IVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQ 1135
             ++++    ++T A  + W LA L+ HPE +K+ Q EI+  +G +R  E+SD+ NL Y Q
Sbjct: 297  FIMNIYGGGTDTSAITVEWALAELINHPEIMKKAQQEIEQVVGNKRVVEESDLCNLSYTQ 356

Query: 1136 GVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLP 1315
             VVKET+R++P GP     E+ E+C V G+ IP  T++ VNVW + RD   W DP +F P
Sbjct: 357  AVVKETMRLHPGGPIFV-RESDEECAVAGFRIPAKTRVIVNVWAIGRDSNQWEDPLEFRP 415

Query: 1316 ERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPL 1495
            ERF    EG   +    + + FG GRRSCPG     +   + +A + Q F         +
Sbjct: 416  ERF----EGSEWKVMSEKMMSFGAGRRSCPGEKMVFRFVPIILAAIIQCFELKV--KGSV 469

Query: 1496 DMMEDVGIILPKLTPL 1543
            DM E  G  LP+ TPL
Sbjct: 470  DMDEGTGSSLPRATPL 485



>sp|Q9STK7|C71Q_ARATH Cytochrome P450 71A26 (EC
            1.14.-.-).>pir|T06715|T06715 probable cytochrome P450
            T29H11.210 - Arabidopsis thaliana>gb:ATT29H11_1555639
            Arabidopsis thaliana DNA chromosome 3, BAC clone T29H11.
          Length = 489

 Score =  220 bits (561), Expect = 6e-56
 Identities = 147/511 (28%), Positives = 263/511 (51%), Gaps = 8/511 (1%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGP 229
            L SI+ +  +++     R + +   P   G  P+IG+LH         ++L   + +YGP
Sbjct: 8    LCSIIFVVTIIIFRKQKRGKKRNTLPSPPGL-PLIGNLHQLGRHPH--RSLCSLSHRYGP 64

Query: 230  VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWR 409
            +  +  G   +LVVSS E  RD   T+D++ A+RP +   + L YD      +    YWR
Sbjct: 65   LMLLHFGRVPVLVVSSAELARDVLKTHDRVFASRPRSKIFEKLLYDKHDVASAPYGEYWR 124

Query: 410  RVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLT 589
            +++ + V  + S++ +   + V   E+   ++++   IS+         VN+S+    LT
Sbjct: 125  QMKSVCVLHLFSNKMVRSFREVREEEISLMMEKIRKSISLP--------VNLSKILVSLT 176

Query: 590  LNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYE 769
             ++I ++  GR+Y   +D    E  +RL K       L G F  G  +  L +  W+   
Sbjct: 177  NDVICKVALGRKYGGETD--FKELMERLNK-------LLGTFSVGSYVPWLAWIDWI--R 225

Query: 770  GHVKTMKRAAKDVDA----ILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSR 937
            G    +++ A DVD     ++QD VD  R      +   F+DV+L++  D+ T G+  +R
Sbjct: 226  GLDCQLEKTANDVDKFFERVVQDHVDGNR------DMTDFVDVLLAIQRDK-TVGFEINR 278

Query: 938  DTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVK 1117
             + IKAIV+++    ++T +T + W +  LL+HP+ LKR+Q+E+ T    +    + +++
Sbjct: 279  VS-IKAIVMNVFVGGTDTSSTLMEWAMTELLRHPKCLKRLQEEVRTICKDKSSVSEEEIQ 337

Query: 1118 NLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIW-P 1294
            N+ YL+ V+KE LR++P  P + PHE+ +D  +  +HIP GTQ+ +N W + R+   W P
Sbjct: 338  NMSYLKAVIKEALRLHPPLPLMVPHESTQDVRLGDHHIPAGTQVLINAWAIGREAATWGP 397

Query: 1295 DPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFS 1474
            D E+F PER + +      Q   ++ +PFG GRR CP   +A  + +V +A L   F++ 
Sbjct: 398  DVEEFRPERHLDSSVDYRGQ--AFELIPFGSGRRICPAISFAVVLNEVVLANLVHRFDWR 455

Query: 1475 ---TVPNEPLDMMEDVGIILPKLTPLEVLVT 1558
                   +  ++ E  GI + ++ PL  + +
Sbjct: 456  LSVESTEDQTEVAESTGIAIHRMFPLYAIAS 486



>gb:AY566988_1615411 Verbena x hybrida flavonoid 3',5'-hydroxylase
            gene, complete cds.>gb:AY604727_1617490 Verbena x hybrida
            flavonoid 3',5'-hydroxylase mRNA, complete cds.
          Length = 514

 Score =  220 bits (560), Expect = 8e-56
 Identities = 155/513 (30%), Positives = 260/513 (50%), Gaps = 6/513 (1%)
 Frame = +2

Query: 53   SSILGIAALVLLWFSWRKQS---KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY 223
            ++IL   AL+L+   + K S   + LPP   G +P++G L    T   +   L++ A  Y
Sbjct: 16   AAILLYVALILVCSLYSKPSTVSRNLPPGPKG-FPVVGALPLLGTMPHIA--LAKMAKTY 72

Query: 224  GPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSY 403
            GPV  +++G   + V S+ +A R    T D   + RP       L Y+     F+     
Sbjct: 73   GPVMYLKVGTWGMAVASTPDAARAFLKTLDTTFSDRPPNAGATLLAYNAQDMVFAHYGPR 132

Query: 404  WRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGH 583
            WR +RKL    +L ++ LE    V  SE+   ++ + T  S+ +   + P++ +     +
Sbjct: 133  WRLLRKLSNLHMLGAKALEDWADVRSSEVGHMLQAMLTS-SLRHEAVALPEMLI-----Y 186

Query: 584  LTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD 763
               N+I Q++  RR        +NE     K +  ++M   G F  GD I  L    W+D
Sbjct: 187  SMANMIGQVILSRRVFETKGKEVNE----FKDMVVELMTSAGYFNIGDFIPAL---AWMD 239

Query: 764  YEGHVKTMKRAAKDVDAILQDWVDARRKE-RRSNEDQKFIDVMLSMIDDQFTQGYSYSRD 940
             +G  K MK   K  D ++   +D   +   + N    F+DV+L+  +   ++G S +  
Sbjct: 240  LQGIEKGMKSLHKKFDDLIGRMLDKHLESAHKRNAKPDFLDVILA--NRHNSEGESLTT- 296

Query: 941  TVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKN 1120
            T IKA++L++    ++T ++ + W LA ++K+P  LK   +E+D  IG++R   +SD+  
Sbjct: 297  TNIKALLLNLFTAGTDTSSSTIEWALAEMIKNPTILKTAHNEMDRVIGRDRRLLESDLPK 356

Query: 1121 LPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDP 1300
            LPYLQ + KE  R +P  P   P  + + CIV+GY+IP+ T+L VN+W + RDP +W +P
Sbjct: 357  LPYLQAICKEAYRKHPSTPLNLPRISSQPCIVNGYYIPENTRLSVNIWAIGRDPDVWENP 416

Query: 1301 EKFLPERFMTNLEGEA-AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFS- 1474
              F P+RF++    +   +   ++ +PFG GRR C G   A  + +  +  L   F++  
Sbjct: 417  LDFNPDRFLSGKNAKIDPRGNNFELIPFGAGRRICAGARMAMVLVEYILGTLVHSFDWEL 476

Query: 1475 TVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSP 1573
             V  + +DM E  G+ L K  PL  +V+PRL P
Sbjct: 477  PVGVDEMDMEEAFGLALQKAVPLAAMVSPRLPP 509



>gb:AF214007_1777813 Brassica napus cytochrome p450-dependent
            monooxygenase (BNF5H1) mRNA, complete cds.
          Length = 520

 Score =  219 bits (559), Expect = 1e-55
 Identities = 155/524 (29%), Positives = 254/524 (48%), Gaps = 21/524 (4%)
 Frame = +2

Query: 59   ILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFT 238
            ++ ++  + +    R++    PP   G WPIIG++          + L+  A KYG +  
Sbjct: 20   LIVVSLFIFIGLITRRRRPPYPPGPRG-WPIIGNMSMMDQLTH--RGLANLAKKYGGLCH 76

Query: 239  IRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVR 418
            +R+G   +  VSS +  +      D + + RP T A  YL YD A   F+    +WR++R
Sbjct: 77   LRMGFLHMYAVSSPDVAKQVLQVQDSVFSNRPATIAISYLTYDRADMAFAHYGPFWRQMR 136

Query: 419  KLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNL 598
            K+ V ++ S +R E     W S ++  + ++   +S +        +N+      LT N+
Sbjct: 137  KVCVMKVFSRKRAES----WAS-VRDEVDKMIRSVSSNVGK----SINVGEQIFALTRNI 187

Query: 599  IMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHV 778
              +   G   E   D  I     R+ + FS+   L+G F   D I    +F W+D +G  
Sbjct: 188  TYRAAFGSACEKGQDEFI-----RILQEFSK---LFGAFNVADFIP---YFGWIDPQGIN 236

Query: 779  KTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVM-LSMIDD---------------- 907
            K + +A  D+D  + D +D   K++ +       DV+   M+DD                
Sbjct: 237  KRLVKARNDLDGFIDDIIDEHMKKKENQNSVDAGDVVDTDMVDDLLAFYSEEAKLVSETA 296

Query: 908  QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK 1087
                    +RD  IKAI++ ++   +ET A+ + W L  LL+ PE L RVQ E+   +G 
Sbjct: 297  DLQNSIKLTRDN-IKAIIMDVMFGGTETVASAIEWALTELLRSPEDLNRVQQELAEVVGL 355

Query: 1088 ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR 1267
            +R  E+SD++ L +L+  +KETLR++P  P L  HE  ED  +DGY +PK +++ +N + 
Sbjct: 356  DRRVEESDIEKLTFLKCTLKETLRLHPPIPLLL-HETAEDTEIDGYFVPKKSRVMINAFA 414

Query: 1268 LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA 1447
            + RD   W DPE F P RF+     +  +   ++F+PFG GRRSCPG        ++AVA
Sbjct: 415  IGRDKNSWVDPETFRPSRFLEPGVPD-FKGSNFEFIPFGSGRRSCPGMQLGLYALELAVA 473

Query: 1448 RLFQGFNF----STVPNEPLDMMEDVGIILPKLTPLEVLVTPRL 1567
             +   F +       P+E LDM +  G+  PK T L  + + RL
Sbjct: 474  HILHCFTWKLPDGMKPSE-LDMSDVFGLTAPKATRLYAVPSTRL 516



>gb:AB037245_1519120 Asparagus officinalis ASPI-2 mRNA for cytochrome
            P450, complete cds.
          Length = 501

 Score =  219 bits (559), Expect = 1e-55
 Identities = 145/506 (28%), Positives = 257/506 (50%), Gaps = 6/506 (1%)
 Frame = +2

Query: 59   ILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFT 238
            +L +  L+ +    + ++K   P      P+IG+LH    S+ L ++L   +  +GP+F 
Sbjct: 15   LLLLLQLLFVHHKTKPKTKCRSPPGPPPLPVIGNLHQL--SLLLHQSLYRLSKIHGPIFK 72

Query: 239  IRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVR 418
            + LG   +LV+SS    +    T+D    +R +T + K   YD      +     WR +R
Sbjct: 73   LSLGRVPVLVISSPSLAKQVLKTHDLAFCSRASTVSFKEYTYDGCDVAGAPYGDSWRNLR 132

Query: 419  KLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNL 598
            K+ V  +LSS++L   + V   E++  I  + T       + +   VN++ +   L  N+
Sbjct: 133  KIFVLNLLSSKKLTSFRLVQEEEIEGMISSIRT------RSDTNATVNITEFVVRLANNI 186

Query: 599  IMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD-YEGH 775
              ++  G    YRS+G   E++ R +++          F  GD  FP     WLD   G 
Sbjct: 187  TFRVAFG----YRSEGEYGEKS-RFQRLLESGNDTVASFYVGD-YFP--GLGWLDKITGK 238

Query: 776  VKTMKRAAKDVDAILQDWVDARRKERRSNEDQK-FIDVMLSMIDD-QFTQGYSYSRDTVI 949
            +  MKR A+D+D   Q+ +DA  K+ R  + ++  +DV+L + ++ Q T  +       I
Sbjct: 239  LGKMKRNARDLDEFYQEVIDAHMKDGRKEDGKEDIVDVLLRLREEGQLTMDH-------I 291

Query: 950  KAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPY 1129
            K  ++++    ++T A  + W +A L + P+ +K+ Q+E+     K+   E++D+  L Y
Sbjct: 292  KGALMNIFVGGTDTSAASIAWAMAELARKPKVMKKAQEEVRKAASKKGKVEENDLAQLQY 351

Query: 1130 LQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKF 1309
            ++ VV ETLR++   P L P E ++ C ++GY +   T++ VN W + RD   W +PE+F
Sbjct: 352  IKCVVNETLRLHLPLPLLVPRETIQHCEINGYDVSAKTRVLVNAWAIGRDEDAWENPEEF 411

Query: 1310 LPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVP-- 1483
             P+RF+ +      Q+  +QF+PFG GRR CPG  +  +  ++A+A L   FN+   P  
Sbjct: 412  NPDRFVGSSLDYKGQD--FQFIPFGAGRRICPGIQFGVETVELALANLLYAFNWELPPGV 469

Query: 1484 -NEPLDMMEDVGIILPKLTPLEVLVT 1558
              E +DM E  G++  + T L ++ T
Sbjct: 470  ERENIDMHEAPGLVTRRATDLRLVAT 495



>gb:AB037244_1519119 Asparagus officinalis ASPI-1 mRNA for cytochrome
            P450, complete cds.
          Length = 501

 Score =  219 bits (559), Expect = 1e-55
 Identities = 145/506 (28%), Positives = 258/506 (50%), Gaps = 6/506 (1%)
 Frame = +2

Query: 59   ILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFT 238
            +L +  L+ +    + ++K   P      P+IG+LH    S+ L ++L   +  +GP+F 
Sbjct: 15   LLLLLPLLFVHHKTKPKTKCRSPPGPPPLPVIGNLHQL--SLLLHQSLYRLSKIHGPIFK 72

Query: 239  IRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVR 418
            + LG   +LV+SS    +    T+D    +R +T + K   YD      +     WR +R
Sbjct: 73   LSLGRVPVLVISSPSLAKQVLKTHDLACCSRASTVSFKEYTYDGCDVAGAPYGDSWRNLR 132

Query: 419  KLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNL 598
            K+ V ++LSS++L   + V   E++  I  + T       + +   VN++ +   L  N+
Sbjct: 133  KIFVLKLLSSKKLTSFRLVQEEEIEGMISSIRT------RSDTNATVNITEFVVRLANNI 186

Query: 599  IMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD-YEGH 775
              ++  G    YRS+G   E++ R +++          F  GD  FP     WLD   G 
Sbjct: 187  TFRVAFG----YRSEGEYGEKS-RFQRLLESGNDTVASFYVGD-YFP--GLGWLDKMTGK 238

Query: 776  VKTMKRAAKDVDAILQDWVDARRKERRSNEDQK-FIDVMLSMIDD-QFTQGYSYSRDTVI 949
            +  MKR A+D+D   Q+ +DA  K+ R  + ++  +DV+L + ++ Q T  +       I
Sbjct: 239  LGKMKRNARDLDEFYQEVIDAHMKDGRKEDGKEDIVDVLLRLREEGQLTMDH-------I 291

Query: 950  KAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPY 1129
            K  ++++    ++T A  + W +A L + P+ +K+ Q+E+     K+   E++D+  L Y
Sbjct: 292  KGALMNIFVGGTDTSAASIAWAMAELARKPKVMKKAQEEVRKAASKKGKVEENDLAQLQY 351

Query: 1130 LQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKF 1309
            ++ VV ETLR++   P L P E ++ C ++GY +   T++ VN W + RD   W +PE+F
Sbjct: 352  IKCVVNETLRLHLPLPLLVPRETIQHCEINGYDVSAKTRVLVNAWAIGRDEDAWENPEEF 411

Query: 1310 LPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVP-- 1483
             P+RF+ +      Q+  +QF+PFG GRR CPG  +  +  ++A+A L   FN+   P  
Sbjct: 412  NPDRFVGSSLDYKGQD--FQFIPFGAGRRICPGIQFGVETVELALANLLYAFNWELPPGV 469

Query: 1484 -NEPLDMMEDVGIILPKLTPLEVLVT 1558
              E +DM E  G++  + T L ++ T
Sbjct: 470  ERENIDMHEAPGLVTRRATDLRLVAT 495



>sp|O22203|C983_ARATH Cytochrome P450 98A3 (EC
            1.14.-.-).>pir|T00753|T00753 probable cytochrome P450
            T20B5.9 - Arabidopsis thaliana
          Length = 508

 Score =  219 bits (559), Expect = 1e-55
 Identities = 145/519 (27%), Positives = 262/519 (50%), Gaps = 7/519 (1%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGP 229
            L ++  IAA+V      R + K   P      PI+G+L+  +      +   EWA  YGP
Sbjct: 5    LIAVATIAAVVSYKLIQRLRYKF--PPGPSPKPIVGNLYDIKPV--RFRCYYEWAQSYGP 60

Query: 230  VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWR 409
            + ++ +G    +VVSS E  ++    +D+ LA R    + +    +     ++    ++ 
Sbjct: 61   IISVWIGSILNVVVSSAELAKEVLKEHDQKLADRHRNRSTEAFSRNGQDLIWADYGPHYV 120

Query: 410  RVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLT 589
            +VRK+   E+ + +RLE L+ +   E+   ++ ++   ++  N   A  + + ++ G + 
Sbjct: 121  KVRKVCTLELFTPKRLESLRPIREDEVTAMVESVFRDCNLPENR--AKGLQLRKYLGAVA 178

Query: 590  LNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWL--- 760
             N I ++  G+R+   ++G ++E+    K + S  + L       + I    + RW+   
Sbjct: 179  FNNITRLAFGKRF-MNAEGVVDEQGLEFKAIVSNGLKLGASLSIAEHIP---WLRWMFPA 234

Query: 761  DYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRD 940
            D +   +   R  +   AI+++   AR+K   S   Q F+D +L++ D      Y  S D
Sbjct: 235  DEKAFAEHGARRDRLTRAIMEEHTLARQKS--SGAKQHFVDALLTLKDQ-----YDLSED 287

Query: 941  TVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKN 1120
            T+I  ++  M+    +T A    W +A ++K+P   ++VQ+E D  +G +R   ++D   
Sbjct: 288  TII-GLLWDMITAGMDTTAITAEWAMAEMIKNPRVQQKVQEEFDRVVGLDRILTEADFSR 346

Query: 1121 LPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDP 1300
            LPYLQ VVKE+ R++P  P + PH +  D  + GY IPKG+ ++VNVW + RDP +W +P
Sbjct: 347  LPYLQCVVKESFRLHPPTPLMLPHRSNADVKIGGYDIPKGSNVHVNVWAVARDPAVWKNP 406

Query: 1301 EKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFS-- 1474
             +F PERF+   E    +   ++ +PFG GRR CPG      +    ++ L   F ++  
Sbjct: 407  FEFRPERFLE--EDVDMKGHDFRLLPFGAGRRVCPGAQLGINLVTSMMSHLLHHFVWTPP 464

Query: 1475 --TVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR 1585
              T P E +DM E+ G++    TP++ + TPRL   L++
Sbjct: 465  QGTKPEE-IDMSENPGLVTYMRTPVQAVATPRLPSDLYK 502



>pir|T00934|T00934 probable cytochrome P450 [imported] - Arabidopsis
            thaliana>gb:AC002561_1530898 Arabidopsis thaliana
            chromosome 2 BAC T24P15 genomic sequence, complete
            sequence.
          Length = 514

 Score =  219 bits (558), Expect = 1e-55
 Identities = 135/481 (28%), Positives = 248/481 (51%), Gaps = 8/481 (1%)
 Frame = +2

Query: 125  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFA 304
            P++  A P IGHLH     +P+  +    A KYGP+  IRLG S+ +VVSS    R+ F 
Sbjct: 42   PQSPPALPFIGHLHLIGKVLPV--SFQSLAHKYGPLMEIRLGASKCVVVSSSSVAREIFK 99

Query: 305  TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVS 484
              +   ++RP   + +Y  Y  + F  +    YWR ++KL + ++L+  +LEK   +   
Sbjct: 100  EQELNFSSRPEFGSAEYFKYRGSRFVLAQYGDYWRFMKKLCMTKLLAVPQLEKFADIREE 159

Query: 485  ELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEA 664
            E      +L    S+          ++S  F   T N+I ++    R      GT NE A
Sbjct: 160  E------KLKLVDSVAKCCREGLPCDLSSQFIKYTNNVICRMAMSTR----CSGTDNE-A 208

Query: 665  QRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARR 844
            + ++++  + + L G+   GD + PL   + +D+ G+ K +    +  D +++  +  R 
Sbjct: 209  EEIRELVKKSLELAGKISVGDVLGPL---KVMDFSGNGKKLVAVMEKYDLLVERIMKERE 265

Query: 845  KERRSNEDQK--FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWIL 1018
             + +  +  +   +D++L    D   +      D  +K+ +L +    ++T A  + W +
Sbjct: 266  AKAKKKDGTRKDILDILLETYRDPTAEMKITRND--MKSFLLDVFMAGTDTSAAAMQWAM 323

Query: 1019 AVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEA 1198
              L+ HP++  ++++EI+  +G +R  ++SDV NLPYL+ V++ETLR++P  P L   E 
Sbjct: 324  GQLINHPQAFNKLREEINNVVGSKRLVKESDVPNLPYLRAVLRETLRLHPSAP-LIIREC 382

Query: 1199 VEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQN------R 1360
             EDC V+G  +   T++ VNV+ + RD ++W D ++F+PERF+ + E +  ++      +
Sbjct: 383  AEDCQVNGCLVKSKTRVLVNVYAIMRDSELWADADRFIPERFLESSEEKIGEHQMQFKGQ 442

Query: 1361 QYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTP 1540
             ++++PFG GRR CPG   A  +  + V  L Q F++ +V  + +D+ +  G       P
Sbjct: 443  NFRYLPFGSGRRGCPGASLAMNVMHIGVGSLVQRFDWKSVDGQKVDLSQGSGFSAEMARP 502

Query: 1541 L 1543
            L
Sbjct: 503  L 503



>gb:AP005285_1849832 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1003_F04.
          Length = 475

 Score =  219 bits (557), Expect = 2e-55
 Identities = 156/518 (30%), Positives = 248/518 (47%), Gaps = 13/518 (2%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGP 229
            L  +L +AA  LL    R + +R PP    A P++GHLH  R   PL +TL+  A ++G 
Sbjct: 9    LMVLLLVAAPALLS---RLERRRRPPPGPVALPVVGHLHLLRR--PLHRTLARLAARHGA 63

Query: 230  --VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSY 403
              V  +R G  R+ VVSS  A  +C   +D   A +P   +G+ L Y+++    ++   Y
Sbjct: 64   AAVMGLRFGSRRVAVVSSAPAAEECLGPHDLAFADKPRLPSGEILSYEWSTMGTASYGPY 123

Query: 404  WRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGH 583
            WR +R++ V E+LS+ R++    V   EL++ + EL+                       
Sbjct: 124  WRHIRRITVTELLSAHRVQHFAGVNARELKSRLFELF----------------------- 160

Query: 584  LTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD 763
              +N++M ++  R +    D  ++EEA+  + V  + M L G   + D  F     RWL 
Sbjct: 161  --MNIMMAMICDRTFYGDGDDEVSEEARWFRSVVKETMELSGASTAWD--FLPAAARWLF 216

Query: 764  YEGHVKTMKRAAKDVDAILQDWV-DARRKERRSNEDQKFID--------VMLSMIDDQFT 916
                 + M+  +       Q  + D R KE+  +++    D         M+ ++    +
Sbjct: 217  ARRLTRRMRELSDSRTRFYQRLITDHRTKEKTDDDNAAAGDHSPAPRRRTMIGVLLSLQS 276

Query: 917  QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK--E 1090
            +      D +I+A+ +  LQ  +ET A  + W +++LL +P ++ R + EID  +G+   
Sbjct: 277  KDPDACPDQLIRALCIGSLQAGTETSAAVVEWAMSLLLNNPGAMARARGEIDACVGQPAA 336

Query: 1091 RWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRL 1270
            R  E +D+  L YL+ VV ETLR+YP  P LA HE+  DC V G+H+ KGT L VN + +
Sbjct: 337  RLLEAADLPKLHYLRCVVMETLRLYPPVPLLA-HESSADCDVAGFHVRKGTMLLVNTFAI 395

Query: 1271 HRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVAR 1450
            HRDP++                            +PFG+GRR CPG   A Q+  + +  
Sbjct: 396  HRDPQM---------------------------VIPFGMGRRGCPGENLAMQMVGLTLGT 428

Query: 1451 LFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPR 1564
            L Q F++  V  E  DM E  GI +PK  PLE    PR
Sbjct: 429  LIQCFDWERVGEELEDMGESSGITMPKKLPLEAFYQPR 466



>gb:AF313492_1785225 Matthiola incana putative cytochrome P450 mRNA,
            complete cds.
          Length = 504

 Score =  219 bits (557), Expect = 2e-55
 Identities = 147/505 (29%), Positives = 240/505 (47%), Gaps = 5/505 (0%)
 Frame = +2

Query: 71   AALVLLWFSWRKQSKR--LPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIR 244
            A L + W+  ++  +R  LPP   G  PI+G+L      +    T    A  +G +F + 
Sbjct: 12   AILSIFWYLLKRVQRRPPLPPGPRGL-PIVGNLPFLDPDLHTYFT--SLAQTHGSIFKLN 68

Query: 245  LGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKL 424
            LG    +V+SS    R+     D   A       G+   Y      +S   + WR +RK+
Sbjct: 69   LGSKLTVVISSPSLAREILKDQDINFANHDVPLTGRAATYGGLDILWSPYGAEWRMLRKV 128

Query: 425  VVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIM 604
             + ++LS + L+    +   E++   + LY       +   AP VN+        +NL M
Sbjct: 129  CLLKLLSRKTLDSFYELRRKEIRERTRFLYK-----QSRGEAP-VNVGDQLFLTMMNLTM 182

Query: 605  QIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWL---DYEGH 775
             ++ G   +     ++  E    K V S++  L GE    D      FF WL   D +G 
Sbjct: 183  NMLWGGSVKAEEMASVGTE---FKGVISEITRLIGEPNVSD------FFPWLARFDIQGL 233

Query: 776  VKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKA 955
            VK+M+ +A+ +DA+    +   ++   S+ + K     L  + DQ +          +KA
Sbjct: 234  VKSMRVSARQLDAVFDRAIKQMQQITSSDGECKDFLQYLMKLKDQESDSEVPITLNHVKA 293

Query: 956  IVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQ 1135
            ++  M+   ++T    + + +A L+  PE +K+ Q E+D  +GK+   E+S +  LPY+ 
Sbjct: 294  VLTDMVVGGTDTSMNTVEFAMAELINKPELMKKAQQELDQVVGKDNIVEESHITKLPYIV 353

Query: 1136 GVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLP 1315
             ++KETLR++P  P L P    E  +V GY IPK T++++NVW + RDP +W  P +F P
Sbjct: 354  AIMKETLRLHPTLPLLVPRRPAEAAVVGGYTIPKDTKIFINVWCIQRDPNVWEKPTEFRP 413

Query: 1316 ERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPL 1495
            ERF+ N +        Y + PFG GRR C G   A ++    +A L   F++       L
Sbjct: 414  ERFLDNNKPRDFTGTDYSYFPFGSGRRICAGVALAERMVLYTLATLLHSFDWKIPQGHVL 473

Query: 1496 DMMEDVGIILPKLTPLEVLVTPRLS 1570
            D+ E +GI+L   TPL  L  PRLS
Sbjct: 474  DLEEKIGIVLKLKTPLVALPVPRLS 498



>gb:AY064170_1566041 Pinus taeda p-coumarate 3-hydroxylase mRNA,
            complete cds.
          Length = 512

 Score =  219 bits (557), Expect = 2e-55
 Identities = 135/513 (26%), Positives = 257/513 (50%), Gaps = 4/513 (0%)
 Frame = +2

Query: 59   ILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFT 238
            + GI A+ +++   ++   +LPP     WP++G+L   +      +   +W+ KYGP+ +
Sbjct: 13   VTGIVAIAIVYKLVQRWRFKLPP-GPRPWPVVGNL--LQIEPVRFRCFWDWSKKYGPIMS 69

Query: 239  IRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVR 418
            +  G +  +VVS+ E  ++    +D+ LA RP + + +    +     ++    ++ +VR
Sbjct: 70   VWFGSTLNVVVSNTELAKEVLKEHDQQLADRPRSRSAEKFSRNGQDLIWADYGPHYVKVR 129

Query: 419  KLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNL 598
            K+   E+ S +RLE L+ +   E+   ++ ++              + + R+   +  N 
Sbjct: 130  KVCTLELFSPKRLEALRPIREDEVAAMVESIFN--DCGKQEGIGKPLVVKRYLSGVAFNN 187

Query: 599  IMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI-FPLWFFRWLDYEGH 775
            I +   G+R+    +G ++ +    K++ +  + L       + I +  W F  L+    
Sbjct: 188  ITRPAFGKRF-VNEEGKMDPQGVEFKEIVATGLKLGASLTMAEHIPYLRWMFP-LEEGAF 245

Query: 776  VKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKA 955
             K   R      AI+++   AR+    S   Q F+D +L++      + Y  S DT+I  
Sbjct: 246  AKHGARRDNVTKAIMEEHTLARQT---SGAKQHFVDALLTL-----QEKYDLSEDTII-G 296

Query: 956  IVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQ 1135
            ++  M+    +T A  + W +A L+++P   ++ Q+EID  +G++R   ++D  +LPYLQ
Sbjct: 297  LLWDMITAGMDTTAITVEWAMAELVRNPRIQQKAQEEIDRVVGRDRVMNETDFPHLPYLQ 356

Query: 1136 GVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLP 1315
             + KE LR++P  P + PH+A ++  + GY IPKG+ ++VNVW + RDP +W DP  F P
Sbjct: 357  CITKEALRLHPPTPLMLPHKATQNVKIGGYDIPKGSNVHVNVWAIARDPAVWKDPVTFRP 416

Query: 1316 ERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST---VPN 1486
            ERF+   E    +   Y+ +PFG GRR CPG      + Q  +  L   F ++    +  
Sbjct: 417  ERFLE--EDVDIKGHDYRLLPFGAGRRICPGAQLGINLVQSMLGHLLHHFVWAPPEGMQA 474

Query: 1487 EPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR 1585
            E +D+ E+ G++     P++ +  PRL   L++
Sbjct: 475  EDIDLTENPGLVTFMAKPVQAIAIPRLPDHLYK 507



>sp|O49342|C71D_ARATH Cytochrome P450 71A13 (EC
            1.14.-.-).>pir|E84712|E84712 probable cytochrome P450
            [imported] - Arabidopsis thaliana>gb:AC002340_1530535
            Arabidopsis thaliana chromosome 2 BAC T11J7 genomic
            sequence, complete sequence.
          Length = 497

 Score =  219 bits (557), Expect = 2e-55
 Identities = 156/513 (30%), Positives = 269/513 (52%), Gaps = 10/513 (1%)
 Frame = +2

Query: 35   AVPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWA 214
            ++  CL+++  I  L+L  F  R  +K   P +    P+IG+LH    S+   ++L   +
Sbjct: 6    SISLCLTTL--ITLLLLRRFLKRTATKVNLPPSPWRLPVIGNLHQL--SLHPHRSLRSLS 61

Query: 215  DKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTN 394
             +YGP+  +  G   ILVVSS EA ++   T+D   A RP + A   L        F+  
Sbjct: 62   LRYGPLMLLHFGRVPILVVSSGEAAQEVLKTHDHKFANRPRSKAVHGLMNGGRDVVFAPY 121

Query: 395  NSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRW 574
              YWR+++ + +  +L+++ +E  + V   E+   I++L      +  + S+   N+S  
Sbjct: 122  GEYWRQMKSVCILNLLTNKMVESFEKVREDEVNAMIEKL------EKASSSSSSENLSEL 175

Query: 575  FGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR 754
            F  L  ++  ++  GR++        +E A+ LKK   Q+M L GEF  G+ + P+    
Sbjct: 176  FITLPSDVTSRVALGRKHSE------DETARDLKKRVRQIMELLGEFPIGEYV-PI--LA 226

Query: 755  WLD----YEGHVKTMKRAAKDV-DAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQ 919
            W+D    +   +K + R   D+ D ++Q+ ++A      SN+   F+D++LS+  D+   
Sbjct: 227  WIDGIRGFNNKIKEVSRGFSDLMDKVVQEHLEA------SNDKADFVDILLSIEKDK-NS 279

Query: 920  GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE-RW 1096
            G+   R+  IK ++L M    + T +T L W +  L++ P+S+K++QDEI + I     +
Sbjct: 280  GFQVQRND-IKFMILDMFIGGTSTTSTLLEWTMTELIRSPKSMKKLQDEIRSTIRPHGSY 338

Query: 1097 AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR 1276
             ++ +V+N+ YL+ V+KE LR++P  P + P    ED  V GY+I  GT++ +N W + R
Sbjct: 339  IKEKEVENMKYLKAVIKEVLRLHPSLPMILPRLLSEDVKVKGYNIAAGTEVIINAWAIQR 398

Query: 1277 DPKIW-PDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL 1453
            D  IW PD E+F PER + +  G     +   ++PFG GRR CPG   A  + +V VA L
Sbjct: 399  DTAIWGPDAEEFKPERHLDS--GLDYHGKNLNYIPFGSGRRICPGINLALGLAEVTVANL 456

Query: 1454 FQGFNF--STVPN-EPLDMMEDVGIILPKLTPL 1543
               F++     PN +  D+ E +GI + +  PL
Sbjct: 457  VGRFDWRVEAGPNGDQPDLTEAIGIDVCRKFPL 489



>gb:AF346833_1789996 Mentha x piperita menthofuran synthase mRNA,
            complete cds.
          Length = 493

 Score =  218 bits (556), Expect = 2e-55
 Identities = 143/509 (28%), Positives = 251/509 (49%), Gaps = 11/509 (2%)
 Frame = +2

Query: 77   LVLLWFSWRKQS---KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRL 247
            L+ + F  RK S   ++ PP +    P+IGH H         ++ +  + +YG V  +  
Sbjct: 14   LLAVLFHKRKSSLSSRKRPPPSPLRLPVIGHFHLIGALSH--RSFTSLSKRYGEVMLLHF 71

Query: 248  GISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLV 427
            G + +LV SS  A R+     D + A+RP       L Y      F+    +WR  R + 
Sbjct: 72   GSAPVLVASSAAAAREIMKNQDVIFASRPRLSIFDRLMYSGKGVAFAPYGEHWRNARSMC 131

Query: 428  VEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQ 607
            + ++LS++R++    +   E    I+++         +     VN+S  F  LT  +I +
Sbjct: 132  MLQLLSAKRVQSFGGIREEETSAMIEKI-------RRSKPTTVVNLSEMFMALTNGVIHR 184

Query: 608  IVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVK-- 781
             V GR+ +   D           ++  +V+ L G F  GD      +  WL +   +   
Sbjct: 185  AVLGRKGDGGDD---------FNRILIKVIKLLGSFNVGD------YVPWLSWINRINGV 229

Query: 782  --TMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKA 955
               +++    +D  ++  +   R+++  +++  F+D +L     + ++      D VIKA
Sbjct: 230  DAEVEKVGTKLDGSMEGILRKYRRKKVGDDETNFVDTLLQF--QRESKDTDPVEDDVIKA 287

Query: 956  IVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQ 1135
            ++  M+   ++T    L W +A L+K+P +LK +Q+E+      +    + DV  +PYL+
Sbjct: 288  LIFDMVSAGTDTTFAALEWTMAELIKNPRTLKTLQNEVREVSRNKGGITEDDVDKMPYLK 347

Query: 1136 GVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLP 1315
             V KE LR++P    L P E  +D  + GY IP+GT + VN W + RDP +W +PE+F P
Sbjct: 348  AVSKEILRLHPPFAILLPRELTQDANMLGYDIPRGTVVLVNNWAISRDPSLWENPEEFRP 407

Query: 1316 ERFM-TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN-- 1486
            ERF+ T+++    +   ++ +PFG GRR CPG+ +A  + ++A+++L   F+F       
Sbjct: 408  ERFLETSID---YKGLHFEMLPFGSGRRGCPGSTFAMALYELALSKLVNEFDFRLGNGDR 464

Query: 1487 -EPLDMMEDVGIILPKLTPLEVLVTPRLS 1570
             E LDM E  G ++ K +PL VL TPR S
Sbjct: 465  AEDLDMTEAPGFVVHKKSPLLVLATPRQS 493



>gb:CBL427452_1645668 Solenostemon scutellarioides mRNA for putative
            cytochrome P450 (cyp98A14 gene).
          Length = 507

 Score =  218 bits (556), Expect = 2e-55
 Identities = 138/467 (29%), Positives = 237/467 (50%), Gaps = 3/467 (0%)
 Frame = +2

Query: 194  KTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYA 373
            +  +EWA  +GP F++  G +  ++VSS E  ++     D  LA  P + +   L  D  
Sbjct: 50   RCFAEWAQLFGPTFSVWFGSTLNVIVSSSELAKEVLKEKDGQLADPPRSRSAVKLSRDGK 109

Query: 374  VFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAP 553
               ++    ++ +VRK+    + S +RLE L+ +   E+   ++ +Y      ++  S  
Sbjct: 110  DLIWADYGPHYVKVRKVCTVVLFSPKRLELLRPIREDEITVMVESIY-----QDSAASGK 164

Query: 554  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI 733
             V + ++   +  + I ++V G+R+   S+G ++++ Q  K +    + L       + I
Sbjct: 165  SVVIKKYLASMAFHNITRLVFGKRF-VNSEGEVDKQGQEFKAIAINGLKLGASLAVSEHI 223

Query: 734  FPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQF 913
              L +   LD +   +   R  +    I+Q+   AR+K       Q F D +L++ D+  
Sbjct: 224  PWLRWMFPLDEDAFTQHGVRMERLTREIMQEHTLARQKT--GGAKQHFFDALLTLKDE-- 279

Query: 914  TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER 1093
               Y  S DT+I A++  M+    +T A  + W +A L+++P   ++VQ+E+D  IG ER
Sbjct: 280  ---YDLSEDTII-ALLWDMIAAGMDTPAISVEWAMAELVRNPRVQEKVQEELDRVIGHER 335

Query: 1094 WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH 1273
               + D+ NLPYLQ VVKE+LR++P  P + PH +  D  + GY IPKG+ ++VNVW + 
Sbjct: 336  IMTELDIPNLPYLQCVVKESLRLHPPTPVMLPHRSNADVKIGGYDIPKGSNVHVNVWAIA 395

Query: 1274 RDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL 1453
            RDPK W  P +F PERF+   E    +   ++ + FG GRR CPG      +    +  L
Sbjct: 396  RDPKSWKVPLEFRPERFLE--EDVDIKGHDFRLLRFGAGRRVCPGAQLGIDLATSMIGHL 453

Query: 1454 FQGFNFST---VPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR 1585
               F ++    V  E +DM E+ G +    TP+E + TPRL   L++
Sbjct: 454  LHHFRWTPPTGVRAEDIDMGENPGTVTYMRTPVEAVPTPRLPANLYK 500



>gb:AY466856_1608088 Camptotheca acuminata hydroxylase-like cytochrome
            P450 CASS mRNA, complete cds.
          Length = 509

 Score =  218 bits (556), Expect = 2e-55
 Identities = 147/517 (28%), Positives = 260/517 (50%), Gaps = 9/517 (1%)
 Frame = +2

Query: 62   LGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVK--TLSEWADKYGPVF 235
            L +  + L +  +++   +LPP      P +G+L+    SV  VK    +EWA  YGP+ 
Sbjct: 8    LPLIFIFLAYKLYQRLRFKLPP-GPRPLPFVGNLY----SVKPVKFRCFAEWAQVYGPIM 62

Query: 236  TIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRV 415
            ++  G +  +V+S+ E  ++    ND+ LA R    +            ++    ++ +V
Sbjct: 63   SVWFGSTLNVVISNSELAKEVLKENDQHLADRERNRSSNSFSRGGKDLIWADYGPHYVKV 122

Query: 416  RKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPS--APKVNMSRWFGHLT 589
            RKL   E+ + +RLE L+ +   E+   +  ++     D+ NP      + + ++ G + 
Sbjct: 123  RKLCTVELFTPKRLEALRPIREDEVTAMVDSIFK----DSANPDNYGKSLLVKQYIGAVA 178

Query: 590  LNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYE 769
             N I ++V G+R+   S+G ++E+ +  + + +  + + G    G+ I   W       E
Sbjct: 179  FNNITRLVFGKRF-MNSEGVMDEQGKEFRGIVANGVKIGGLRFIGEHI--PWLRCMFPQE 235

Query: 770  GHVKTMKRAAKD--VDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDT 943
              +     A +D    AI+++   AR+        Q F+D +L++  +     Y  S DT
Sbjct: 236  EEILVKHEARRDRLTRAIMEEHTLARKHS--GGAKQHFVDALLTLQKE-----YELSDDT 288

Query: 944  VIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNL 1123
            VI  ++  M+    +T +  + W +A L+K+P   ++ Q+E+D  IG ER   ++D  NL
Sbjct: 289  VI-GLLWDMITAGMDTTSISVEWAMAELIKNPRVQQKAQEELDRVIGYERIMSETDFPNL 347

Query: 1124 PYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPE 1303
            PYLQ V KE LR++P  P + PH+A  +  + GY IPKG+ ++VNVW + RDP  W DP 
Sbjct: 348  PYLQCVAKEALRLHPPTPLMLPHKANSNVKIGGYDIPKGSIVHVNVWAIARDPATWKDPH 407

Query: 1304 KFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST-- 1477
            +F PERF+   E    +   ++ +PFG GRR CPG   A  +    +  L   F+++   
Sbjct: 408  EFRPERFLE--EDVDMKGHDFRLLPFGAGRRICPGAQIAINLITSMLGHLLHHFSWAPPE 465

Query: 1478 -VPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR 1585
             V  E +DM E+ G++    TP++ +  PRL   L++
Sbjct: 466  GVKPEEIDMTENPGLVTFMKTPVQAVAKPRLPSHLYK 502



>gb:AY094484_1575777 Arabidopsis thaliana At2g30750/T11J7.14 mRNA,
            complete cds.>gb:BT001046_1635301 Arabidopsis thaliana
            At2g30750/T11J7.14 mRNA, complete cds.
          Length = 503

 Score =  218 bits (556), Expect = 2e-55
 Identities = 157/509 (30%), Positives = 261/509 (51%), Gaps = 7/509 (1%)
 Frame = +2

Query: 38   VPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWAD 217
            V  CL+++  I   +L  F  R  +K   P +    P+IG+LH    S+   ++L   + 
Sbjct: 13   VSLCLTTL--ITLFLLKQFLKRTANKVNLPPSPWRLPLIGNLHQL--SLHPHRSLHSLSL 68

Query: 218  KYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNN 397
            +YGP+  +  G   ILVVSS EA ++   T+D   A RP + A   L        F    
Sbjct: 69   RYGPLMLLHFGRVPILVVSSGEAAQEVLKTHDLKFANRPRSKAVHGLMNGGRDVVFGPYG 128

Query: 398  SYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWF 577
             YWR+++ + +  +L+++ +   + +   EL   IK+L      +  + S+   N+S  F
Sbjct: 129  EYWRQMKSVCILNLLTNKMVASFEKIREEELNEMIKKL------EKASSSSSSENLSELF 182

Query: 578  GHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL-WFFR 754
              L  ++  +I  GR++        +E A+ LKK   Q+M L GEF  GD +  L W  R
Sbjct: 183  VTLPSDVTSRIALGRKHSE------DETARDLKKRVRQIMELLGEFPIGDYVPALAWIDR 236

Query: 755  WLDYEGHVKTMKRAAKDV-DAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSY 931
               +   +K + +   D+ D ++Q+ ++A       N  + F+D++LS I+ + + G+  
Sbjct: 237  INGFNARIKEVSQGFSDLMDKVVQEHLEA------GNHKEDFVDILLS-IESEKSIGFQA 289

Query: 932  SRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE-RWAEDS 1108
             RD  IK ++L M    + T +T L WI+  L+++P  +K++QDEI + I     + ++ 
Sbjct: 290  QRDD-IKFMILDMFIGGTSTSSTLLEWIMTELIRNPNVMKKLQDEIRSTIRPHGSYIKEK 348

Query: 1109 DVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKI 1288
            DV+N+ YL+ V+KE  R++P  P + P    ED  V GY+I  GT++ +N W + RDP I
Sbjct: 349  DVENMKYLKAVIKEVFRVHPPLPLILPRLLSEDVKVKGYNIAAGTEVIINAWAIQRDPAI 408

Query: 1289 W-PDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF 1465
            W PD E+F PER + +        +   F+PFG GRR CPG   A  + +V VA L   F
Sbjct: 409  WGPDAEEFKPERHLDSTLD--YHGKDLNFIPFGSGRRICPGINLALGLVEVTVANLVGRF 466

Query: 1466 NF--STVPN-EPLDMMEDVGIILPKLTPL 1543
            ++     PN +  D+ E  G+ + +  PL
Sbjct: 467  DWRAEAGPNGDQPDLTEAFGLDVCRKFPL 495



>gb:AB017418_1513629 Lithospermum erythrorhizon CYP98A6 mRNA for
            cytochrome P-450, complete cds.
          Length = 506

 Score =  218 bits (556), Expect = 2e-55
 Identities = 143/506 (28%), Positives = 254/506 (50%), Gaps = 5/506 (0%)
 Frame = +2

Query: 68   IAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRL 247
            I  L++ +  ++K   +LPP      PIIG+++  +      +    W+  YGP+F+I  
Sbjct: 11   IIFLIISYKLYQKLRLKLPP-GPRPLPIIGNIYQVKPVK--FRCFYNWSKTYGPIFSIYY 67

Query: 248  GISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLV 427
            G    ++VS+ E  ++    ND+ LA R  T +   +        ++    ++ +VRKL 
Sbjct: 68   GSQMNVIVSTTELAKEVLKENDQHLADRFRTRSSASMSRGGKDLIWADYGPHYVKVRKLC 127

Query: 428  VEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPS--APKVNMSRWFGHLTLNLI 601
              E+ S +RLE ++ +   E    ++ +Y     D   P      + +  +   +  N I
Sbjct: 128  NVELFSPKRLEAIRPMREDEYTALVESIYK----DCTKPELKGKSLLVREYLSSVAFNNI 183

Query: 602  MQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVK 781
             ++  G+R+   S+G +NE+ Q  KK+    + +  +    + I    + RW+ ++    
Sbjct: 184  TRLAFGKRF-MDSNGVVNEQGQEFKKITHDGIKITAKLSIAEYIP---WIRWM-FKVEQD 238

Query: 782  TMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIV 961
             + + A D D + +  ++   K    N  Q F+D +L++      + Y  S DT+I  ++
Sbjct: 239  ALDKFAADRDHLTRVIMEEHIKS--GNTKQHFVDALLTL-----QKQYDISEDTII-GLL 290

Query: 962  LSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGV 1141
              M+    +T      W +A L+++P   ++ Q+E+D  +G +R   ++DV  LPYLQ +
Sbjct: 291  WDMIAAGMDTATISTEWAMAELVRNPRVQRKAQEELDRVVGPDRIMTEADVPKLPYLQCI 350

Query: 1142 VKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPER 1321
            VKE+LR++P  P + PH A  +  + GY IPKG+ ++VNVW + RDP  W +PE+F PER
Sbjct: 351  VKESLRLHPPTPLMLPHRASANVKIGGYDIPKGSIVHVNVWAIARDPAYWKNPEEFRPER 410

Query: 1322 FMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN---EP 1492
            FM   E    +   Y+ +PFG GRR CPG   A  +   ++  L   F +S  P    E 
Sbjct: 411  FME--EDIDMKGTDYRLLPFGAGRRICPGAQLAINLITSSLGHLLHQFTWSPQPGVKPEE 468

Query: 1493 LDMMEDVGIILPKLTPLEVLVTPRLS 1570
            +D+ E+ G +     P++ +V+PRLS
Sbjct: 469  IDLSENPGTVTYMRNPVKAVVSPRLS 494



>sp|O49340|C71C_ARATH Cytochrome P450 71A12 (EC
            1.14.-.-).>pir|C84712|C84712 probable cytochrome P450
            [imported] - Arabidopsis thaliana>gb:AC002340_1530533
            Arabidopsis thaliana chromosome 2 BAC T11J7 genomic
            sequence, complete sequence.
          Length = 497

 Score =  218 bits (556), Expect = 2e-55
 Identities = 157/509 (30%), Positives = 261/509 (51%), Gaps = 7/509 (1%)
 Frame = +2

Query: 38   VPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWAD 217
            V  CL+++  I   +L  F  R  +K   P +    P+IG+LH    S+   ++L   + 
Sbjct: 7    VSLCLTTL--ITLFLLKQFLKRTANKVNLPPSPWRLPLIGNLHQL--SLHPHRSLHSLSL 62

Query: 218  KYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNN 397
            +YGP+  +  G   ILVVSS EA ++   T+D   A RP + A   L        F    
Sbjct: 63   RYGPLMLLHFGRVPILVVSSGEAAQEVLKTHDLKFANRPRSKAVHGLMNGGRDVVFGPYG 122

Query: 398  SYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWF 577
             YWR+++ + +  +L+++ +   + +   EL   IK+L      +  + S+   N+S  F
Sbjct: 123  EYWRQMKSVCILNLLTNKMVASFEKIREEELNEMIKKL------EKASSSSSSENLSELF 176

Query: 578  GHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL-WFFR 754
              L  ++  +I  GR++        +E A+ LKK   Q+M L GEF  GD +  L W  R
Sbjct: 177  VTLPSDVTSRIALGRKHSE------DETARDLKKRVRQIMELLGEFPIGDYVPALAWIDR 230

Query: 755  WLDYEGHVKTMKRAAKDV-DAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSY 931
               +   +K + +   D+ D ++Q+ ++A       N  + F+D++LS I+ + + G+  
Sbjct: 231  INGFNARIKEVSQGFSDLMDKVVQEHLEA------GNHKEDFVDILLS-IESEKSIGFQA 283

Query: 932  SRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE-RWAEDS 1108
             RD  IK ++L M    + T +T L WI+  L+++P  +K++QDEI + I     + ++ 
Sbjct: 284  QRDD-IKFMILDMFIGGTSTSSTLLEWIMTELIRNPNVMKKLQDEIRSTIRPHGSYIKEK 342

Query: 1109 DVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKI 1288
            DV+N+ YL+ V+KE  R++P  P + P    ED  V GY+I  GT++ +N W + RDP I
Sbjct: 343  DVENMKYLKAVIKEVFRVHPPLPLILPRLLSEDVKVKGYNIAAGTEVIINAWAIQRDPAI 402

Query: 1289 W-PDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF 1465
            W PD E+F PER + +        +   F+PFG GRR CPG   A  + +V VA L   F
Sbjct: 403  WGPDAEEFKPERHLDSTLD--YHGKDLNFIPFGSGRRICPGINLALGLVEVTVANLVGRF 460

Query: 1466 NF--STVPN-EPLDMMEDVGIILPKLTPL 1543
            ++     PN +  D+ E  G+ + +  PL
Sbjct: 461  DWRAEAGPNGDQPDLTEAFGLDVCRKFPL 489



>gb:AF214008_1777814 Brassica napus cytochrome p450-dependent
            monooxygenase (BNF5H2) mRNA, complete cds.
          Length = 520

 Score =  218 bits (555), Expect = 3e-55
 Identities = 155/524 (29%), Positives = 253/524 (48%), Gaps = 21/524 (4%)
 Frame = +2

Query: 59   ILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFT 238
            ++ ++  + +    R++    PP   G WPIIG++          + L+  A KYG +  
Sbjct: 20   LIVVSLFIFIGLITRRRRPPYPPGPRG-WPIIGNMSMMDQLTH--RGLANLAKKYGGLCH 76

Query: 239  IRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVR 418
            +R+G   +  VSS +  +      D + + RP T A  YL YD A   F+    +WR++R
Sbjct: 77   LRMGFLHMYAVSSPDVAKQVLQVQDSVFSNRPATIAISYLTYDRADMAFAHYGPFWRQMR 136

Query: 419  KLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNL 598
            K+ V ++ S +R E     W S ++  + ++   +S +        +N+      LT N+
Sbjct: 137  KVCVMKVFSRKRAES----WAS-VRDEVDKMIRSVSSNVGK----SINVGEQIFALTRNI 187

Query: 599  IMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHV 778
              +   G   E   D  I     R+ + FS+   L+G F   D I    +F W+D +G  
Sbjct: 188  TYRAAFGSACEKGQDEFI-----RILQEFSK---LFGAFNVADFIP---YFGWIDPQGIN 236

Query: 779  KTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVM-LSMIDD---------------- 907
            K + +A  D+D  + D +D   K++ +       DV+   M+DD                
Sbjct: 237  KRLVKARNDLDGFIDDIIDEHIKKKENQNSVDAGDVVDTDMVDDLLAFYSEEAKLVSETA 296

Query: 908  QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK 1087
                    +RD  IKAI++ ++   +ET A+ + W L  LL+ PE LKRVQ E+   +G 
Sbjct: 297  DLQNSIKLTRDN-IKAIIMDVMFGGTETVASAIEWALTELLRSPEDLKRVQQELAEVVGL 355

Query: 1088 ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR 1267
            +R  E+SD++ L +L+  + ETLR++P  P L  HE  ED  +DGY +PK +++ +N + 
Sbjct: 356  DRRVEESDIEKLTFLKCTLNETLRLHPPIPLLL-HETAEDTEIDGYFVPKKSRVMINAFA 414

Query: 1268 LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA 1447
            + RD   W DPE F P RF+     +  +   ++F+PFG GRRSCPG        ++AVA
Sbjct: 415  IGRDKNSWVDPETFRPSRFLEPGVPD-FKGSNFEFIPFGSGRRSCPGMQLGLYALELAVA 473

Query: 1448 RLFQGFNF----STVPNEPLDMMEDVGIILPKLTPLEVLVTPRL 1567
             +   F +       P+E LDM +  G+  PK T L  +   RL
Sbjct: 474  HILHCFTWKLPDGMKPSE-LDMSDVFGLTAPKATRLYAVPCTRL 516



>gb:AB028462_1517854 Petunia x hybrida imt-5 mRNA for cytochrome P450,
            complete cds.
          Length = 502

 Score =  218 bits (555), Expect = 3e-55
 Identities = 153/515 (29%), Positives = 254/515 (49%), Gaps = 14/515 (2%)
 Frame = +2

Query: 59   ILGIAALVLLWFSWRKQSKRLPPEAGGAW--PIIGHLHHFRTSVPLVKT-LSEWADKYGP 229
            +L ++++ LL   W+ Q   LPP   G W  P IG LHH   + PL    L+  A +YGP
Sbjct: 12   LLFLSSIFLLLRKWKTQELNLPP---GPWKLPFIGSLHHLVFAGPLPHHGLTNLAKRYGP 68

Query: 230  VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWR 409
            +  ++LG    + +SS +  ++   T+D   A RP     + + Y      FS    YWR
Sbjct: 69   LMLLQLGEQPTVFISSPQMAKEVLKTHDLAFATRPKLTFAEIIKYGSTDIAFSPYGEYWR 128

Query: 410  RVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLT 589
            ++RK+ V E+LS++ +     +   EL   I    ++I +  N P    VN++      T
Sbjct: 129  QIRKICVMELLSAKMVNSFSSIREDELSNMI----SWIRLRPNIP----VNLTEKVKWFT 180

Query: 590  LNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYE 769
             +++ +   G+         I ++  +L  +  +++ L       D  FP W F   D  
Sbjct: 181  SSVVCRSALGK---------ICKDQNKLIILMREILSLAISVNFAD-FFPRWKFLH-DLG 229

Query: 770  GHVKTMKRAAKDVDAILQDWVDARRKERRSNE-------DQKFIDVMLSMIDDQFTQGYS 928
            G    + +    +D ILQD V+  ++ R + +        +  IDV+L + +    Q   
Sbjct: 230  GSKTRLLKEHHKIDEILQDIVNEHKQNRVNGKMGNGEFGGEDLIDVLLRVRESG--QHQL 287

Query: 929  YSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDS 1108
               D  IKA+++ M    +ET +T + W LA ++K P  L + Q E+   +  ++  +  
Sbjct: 288  PITDDNIKAVIVDMFSAGTETSSTTIIWALAEMMKKPSVLAKAQAEVRQAMKGKKGFQLI 347

Query: 1109 DVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKI 1288
            D+  L YL+ V+KETLRM+P  P L P E +E+  ++G++IP  T++ VN+W + R+P+ 
Sbjct: 348  DLDELKYLKLVIKETLRMHPPIPLLIPRECMEETKINGFNIPLKTRVIVNIWAIGRNPES 407

Query: 1289 WPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFN 1468
            W DPE F+PERF  N       +  +QF+PFG GRR CPG L+        +A+L   F+
Sbjct: 408  WEDPESFMPERFENNPIDFTGNH--HQFIPFGAGRRMCPGMLFGLTNVAQLLAQLLHHFD 465

Query: 1469 FSTVPN----EPLDMMEDVGIILPKLTPLEVLVTP 1561
            +  +PN    + LDM E  G+   +   L  + TP
Sbjct: 466  WK-LPNGQSPQDLDMTESPGVSATRKDDLVFVATP 499



>pir|T52168|T52168 cytochrome P450 monooxygenase [imported] -
            Arabidopsis thaliana>gb:D78600_1674782 Arabidopsis
            thaliana mRNA for cytochrome P450 monooxygenase, complete
            cds, clone P450-4.
          Length = 495

 Score =  218 bits (555), Expect = 3e-55
 Identities = 144/450 (32%), Positives = 247/450 (54%), Gaps = 8/450 (1%)
 Frame = +2

Query: 146  PIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLA 325
            PIIG++H         ++ +E +  YGPV +++LG    +V++S EA R+   T+D++L+
Sbjct: 46   PIIGNIHLVGKHPH--RSFAELSKTYGPVMSLKLGSLNTVVIASPEAAREVLRTHDQILS 103

Query: 326  ARPTTCAGKYLGY-DYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNI 502
            AR  T A + + + D ++    ++++ WR +R+L V ++LS +R+E  K + +++    +
Sbjct: 104  ARSPTNAVRSINHQDASLVWLPSSSARWRLLRRLSVTQLLSPQRIEATKALRMNK----V 159

Query: 503  KELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSD-GTINEEAQRLKK 679
            KEL +FIS  ++   +  V++SR     TLN+I  I+      +  D G+ N +A  +  
Sbjct: 160  KELVSFISESSDREES--VDISRVAFITTLNIISNIL------FSVDLGSYNAKAS-ING 210

Query: 680  VFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRS 859
            V   V+ +     + DA     F R+LD +G+VKT K   + +  + + ++DA+  E+ S
Sbjct: 211  VQDTVISVMDAAGTPDAANYFPFLRFLDLQGNVKTFKVCTERLVRVFRGFIDAKIAEKSS 270

Query: 860  NEDQK------FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILA 1021
              + K      F+D +L    D+     S      I+ ++L M    ++T ++ L W + 
Sbjct: 271  QNNPKDVSKNDFVDNLLDYKGDESELSISD-----IEHLLLDMFTAGTDTSSSTLEWPMT 325

Query: 1022 VLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAV 1201
             LLK+P+++ + Q EID  IG+    E+SD+  LPYLQ VVKET R++   P L P +A 
Sbjct: 326  ELLKNPKTMAKAQAEIDCVIGQNGIVEESDISKLPYLQAVVKETFRLHTPVPLLIPRKAE 385

Query: 1202 EDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPF 1381
             D  + G+ + K TQ+ VNVW + RDP +W +P +F PERF+   +    + R Y+  PF
Sbjct: 386  SDAEILGFMVLKDTQVLVNVWAIGRDPSVWDNPSQFEPERFLG--KDMDVRGRDYELTPF 443

Query: 1382 GLGRRSCPGNLYATQITQVAVARLFQGFNF 1471
            G GRR CPG   A +   + +A L   F++
Sbjct: 444  GAGRRICPGMPLAMKTVSLMLASLLYSFDW 473



>sp|O81971|C7D9_SOYBN Cytochrome P450 71D9 (EC 1.14.-.-) (P450
            CP3).>pir|T07117|T07117 probable cytochrome P450 CP3 -
            soybean>gb:GMC450CP3_1680414 G.max mRNA for putative
            cytochrome P450, clone CP3.
          Length = 496

 Score =  218 bits (555), Expect = 3e-55
 Identities = 141/493 (28%), Positives = 246/493 (49%), Gaps = 10/493 (2%)
 Frame = +2

Query: 104  KQSKRLPPEAGGAW--PIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSS 277
            K+S   P    G W  PIIG++H+   S      L + + KYG +  ++LG    +VVSS
Sbjct: 27   KKSNSTPSLPPGPWKLPIIGNMHNLVGSPLPHHRLRDLSAKYGSLMHLKLGEVSTIVVSS 86

Query: 278  WEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRL 457
             E  ++   T+D + A+RP   A + + YD+    F+    YWR++RK+   E+LSS+R+
Sbjct: 87   PEYAKEVMKTHDHIFASRPYVLAAEIMDYDFKGVAFTPYGDYWRQLRKIFALELLSSKRV 146

Query: 458  EKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYR 637
            +  + +    L + IK + T            +VN+++        +  +   G +  + 
Sbjct: 147  QSFQPIREEVLTSFIKRMATI--------EGSQVNVTKEVISTVFTITARTALGSKSRHH 198

Query: 638  SDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAI 817
                     Q+L  V ++   + G F  GD    + F + +   G    +++  +  D I
Sbjct: 199  ---------QKLISVVTEAAKISGGFDLGDLYPSVKFLQHMS--GLKPKLEKLHQQADQI 247

Query: 818  LQDWVDARRKERRS-----NEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDA 982
            +Q+ ++  R+ + S      E++  +DV+L     +F  G S   D  IKA++  +    
Sbjct: 248  MQNIINEHREAKSSATGDQGEEEVLLDVLLKK---EF--GLS---DESIKAVIWDIFGGG 299

Query: 983  SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM 1162
            S+T +  +TW +A ++K+P ++++VQ E+     KE     S  +NL YL+ VV ETLR+
Sbjct: 300  SDTSSATITWAMAEMIKNPRTMEKVQTEVRRVFDKEGRPNGSGTENLKYLKSVVSETLRL 359

Query: 1163 YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG 1342
            +P  P L P E  + C ++GYHIP  +++ VN W + RDP++W + E+F PERF+     
Sbjct: 360  HPPAPLLLPRECGQACEINGYHIPAKSRVIVNAWAIGRDPRLWTEAERFYPERFIE--RS 417

Query: 1343 EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST---VPNEPLDMMEDV 1513
               ++  ++F+PFG GRR CPG  +     +  +A L   F++       NE L M E  
Sbjct: 418  IEYKSNSFEFIPFGAGRRMCPGLTFGLSNVEYVLAMLMYHFDWKLPKGTKNEDLGMTEIF 477

Query: 1514 GIILPKLTPLEVL 1552
            GI + +   L ++
Sbjct: 478  GITVARKDDLYLI 490



>gb:AF321860_1786040 Lolium rigidum clone Lol-20-f putative cytochrome
            P450 mRNA, complete cds.
          Length = 507

 Score =  218 bits (554), Expect = 4e-55
 Identities = 153/521 (29%), Positives = 260/521 (49%), Gaps = 17/521 (3%)
 Frame = +2

Query: 50   LSSILGIAALVLLWF---SWRKQSKRLPPEAGGAW--PIIGHLHHFRTSVPLVKTLSEWA 214
            LS +L  AA+ LL     +    S R PP   G W  P+IG +HH    +P  + L + A
Sbjct: 7    LSVLLAAAAVALLQVLKVALNPVSDRAPP---GPWKLPVIGSMHHLVNVLPH-RALKDLA 62

Query: 215  DKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTN 394
            D +GP+  +++G + ++V SS E  R    T+D   A RP   AG+ +GY+++   FS +
Sbjct: 63   DVHGPLMMLQMGQTPLVVASSKETARLVLKTHDTNFATRPKLLAGEIVGYEWSDIVFSPS 122

Query: 395  NSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRW 574
              YWR++R+L V EILS +R+    H+   E+   ++++           S P VN+S  
Sbjct: 123  GDYWRKLRQLCVAEILSPKRVLSFCHIREEEVGIRVEQIRAA------GLSTP-VNLSVM 175

Query: 575  FGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR 754
            F  +T +++ +   G++          + A          + L   F   D +FP     
Sbjct: 176  FHSITNSIVARATFGKK---------RKNAAEFMAAIKSGVGLASGFNIPD-LFPTLTTV 225

Query: 755  WLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRS--------NEDQKFIDVMLSMIDDQ 910
                 G  +++      VD IL++ ++ R   R          N D+   DV++ +   Q
Sbjct: 226  LATITGMKRSLHGIHTTVDTILEEIINERNIARAEKIKAGATENVDENLTDVLIGL---Q 282

Query: 911  FTQGYSYSRD-TVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK 1087
               G+ +  D + IKAI+L M    + T A+ + W ++ L+++P  ++++Q +I      
Sbjct: 283  GKGGFGFHLDNSKIKAIILDMFAGGTGTSASAMEWGMSELMRNPAVMEKLQGQIREAFKG 342

Query: 1088 ERWAEDSDVK--NLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNV 1261
            +    +++++   L YL+ V+KE LR++P  P L P E+++ C ++GY IP  +++ +N 
Sbjct: 343  KTVVTEANLQASELRYLKLVIKEALRLHPPAPLLVPRESIDMCELEGYTIPAKSRVVINA 402

Query: 1262 WRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVA 1441
            W + RDP+ W D E+F PERF          N  Y+F+PFG GRR CPG  Y     ++A
Sbjct: 403  WAIGRDPRYWDDAEEFQPERFEDGTVDFTGSN--YEFLPFGAGRRMCPGFNYGLASMELA 460

Query: 1442 VARLFQGFNFSTVPN-EPLDMMEDVGIILPKLTPLEVLVTP 1561
            +  L   F++S       +DM E  G+ + + TPL +L TP
Sbjct: 461  LVTLLYHFDWSLPEGVAEVDMEEAPGLGVRRRTPLMLLATP 501



>pir|T47554|T47554 cytochrome P450 homolog F8J2.140 [similarity] -
            Arabidopsis thaliana>gb:ATF8J2_1551204 Arabidopsis
            thaliana DNA chromosome 3, BAC clone F8J2.
          Length = 512

 Score =  218 bits (554), Expect = 4e-55
 Identities = 153/520 (29%), Positives = 264/520 (50%), Gaps = 16/520 (3%)
 Frame = +2

Query: 50   LSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGP 229
            L + + +   V   F  ++   RLPP     WP+IG++      +P   +L++ + ++GP
Sbjct: 13   LFTSIAVLIYVTCLFYTKRCRTRLPP-GPNPWPVIGNIFQL-AGLPPHDSLTKLSRRHGP 70

Query: 230  VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWR 409
            + T+R+G    +V+SS E  R+ F  +D  LA R    A K           +   +YWR
Sbjct: 71   IMTLRIGSMLTVVISSSEVAREIFKKHDAALAGRKIYEAMKGGKSSDGSLITAQYGAYWR 130

Query: 410  RVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLT 589
             +R+L   +   +RRL+ +  V        + ++  F+     N     +++ R+F  + 
Sbjct: 131  MLRRLCTTQFFVTRRLDAMSDV----RSRCVDQMLRFVEEGGQN-GTKTIDVGRYFFLMA 185

Query: 590  LNLIMQIVAGRRYEYRSDGTINEEAQRLKKVF---SQVMYLWGEFVSGDAIFPLWFFRWL 760
             NLI  ++  R         ++ +++R  + F    +VM   G+    D  FPL   R+L
Sbjct: 186  FNLIGNLMFSR-------DLLDPDSKRGSEFFYHTGKVMEFAGKPNVAD-FFPL--LRFL 235

Query: 761  DYEG-HVKT---MKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMID----DQFT 916
            D +G   KT   +++A +     +++  + R +E+   + + ++DV+L        D+  
Sbjct: 236  DPQGIRRKTQFHVEKAFEIAGEFIRERTEVREREKSDEKTKDYLDVLLEFRGGDGVDEEP 295

Query: 917  QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNI-GKER 1093
              +S SRD      +  M    ++T  + L W LA LL +P +L ++Q E+ T      +
Sbjct: 296  SSFS-SRD------INEMFTAGTDTTTSTLEWALAELLHNPRTLTKLQTELRTYFKSSNQ 348

Query: 1094 WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDC-IVDGYHIPKGTQLYVNVWRL 1270
              ++ D+ NLPYL  V+ ETLR++P  P+L PH+A+  C I D Y IPK TQ+ VNVW +
Sbjct: 349  KLQEEDLPNLPYLSAVIMETLRLHPPLPFLVPHKAMSTCHIFDQYTIPKETQVLVNVWAI 408

Query: 1271 HRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVAR 1450
             RDPK W DP  F PERF+++ +    + + Y+F+PFG GRR CP    A+++  +A+  
Sbjct: 409  GRDPKTWIDPIMFKPERFISDPDARDFKGQDYEFLPFGSGRRMCPALPLASRVLPLAIGS 468

Query: 1451 LFQGFNFST---VPNEPLDMMEDVGIILPKLTPLEVLVTP 1561
            + + F+++    +  E +DM E +GI L K  PLE +  P
Sbjct: 469  MVRSFDWALENGLNAEEMDMGERIGITLKKAVPLEAIPIP 508



>gb:BT015411_1642239 Arabidopsis thaliana At4g12320 gene, complete
            cds.
          Length = 518

 Score =  217 bits (553), Expect = 5e-55
 Identities = 151/513 (29%), Positives = 248/513 (48%), Gaps = 12/513 (2%)
 Frame = +2

Query: 68   IAALVLLWFSWRKQSK-RLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIR 244
            IA   +LW+ +++  +  LPP   G  PI+G+L      +    T  + A+ YGP+F + 
Sbjct: 24   IAIFSILWYLFKRSPQPHLPPGPRGL-PIVGNLPFLDPDLHTYFT--KLAESYGPIFKLN 80

Query: 245  LGISRILVVSSWEAVRDC-------FATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSY 403
            LG    +VV++    R+        F+ +D  L AR  T    Y G D     +      
Sbjct: 81   LGSKLTVVVNTPSLAREILKDQDINFSNHDVPLTARAVT----YGGLDLVWLPYGAE--- 133

Query: 404  WRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGH 583
            WR +RK+ V ++LS R L     +   E++   + LY              VN+      
Sbjct: 134  WRMLRKVCVLKLLSHRTLNSFYELRRKEIRERTRYLY------QKGQEESPVNVGEQVFL 187

Query: 584  LTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD 763
              +NL M ++ G   +     ++  E    K+V S++  L GE    D    L  F   D
Sbjct: 188  TMMNLTMNMLWGGSVKAEEMESVGTE---FKEVISEITRLLGEPNVSDFFPRLARF---D 241

Query: 764  YEGHVKTMKRAAKDVDAILQDWVDA----RRKERRSNEDQKFIDVMLSMIDDQFTQGYSY 931
             +G VK M   A+++DAIL   ++     R ++    E + F+  ++ + D +       
Sbjct: 242  LQGLVKKMHVCARELDAILDRAIEQMQLLRTRDGDDGECKDFLQHLMKLKDQEADSEVPI 301

Query: 932  SRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSD 1111
            + + V KA+++ ++   ++T    + + +A L++ PE +KR Q E+D  +GK+   E+S 
Sbjct: 302  TVNHV-KAVLVDLVVGGTDTSTNTIEFAMAELIRKPELMKRAQQELDEVVGKDNIIEESH 360

Query: 1112 VKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIW 1291
            +  LP++  ++KETLR+YP  P L PH   E  +V GY IPK T++++NVW + RDP +W
Sbjct: 361  ITRLPFISAIMKETLRLYPTIPLLVPHRPSETALVGGYTIPKNTKIFINVWSIQRDPNVW 420

Query: 1292 PDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF 1471
              P +F PERF+     +      Y ++PFG GRR C G   A ++    +A L   F++
Sbjct: 421  EYPTEFRPERFLDKKSCDFT-GTDYSYLPFGSGRRICAGIALAERMILYTLATLLHSFDW 479

Query: 1472 STVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS 1570
                   LD+ E  GI+L   +PL  L  PRLS
Sbjct: 480  KIPEGHILDLKEKFGIVLKLKSPLVALPVPRLS 512



>gb:AP004000_1836151 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1115_B01.
          Length = 514

 Score =  217 bits (552), Expect = 7e-55
 Identities = 164/523 (31%), Positives = 259/523 (49%), Gaps = 16/523 (3%)
 Frame = +2

Query: 47   CLSSILGIAALVLLWFSWRKQSK-----RLPPEAGGAW--PIIGHLHHFRTSVPLV-KTL 202
            CLS  L +  LVL   + +         RLPP   G W  P+IG+LH      PLV +T+
Sbjct: 12   CLSLALLLLTLVLHKVARKATGNGAGKPRLPP---GPWRLPVIGNLHQVAMGGPLVHRTM 68

Query: 203  SEWADKY-GPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVF 379
            ++ A +   P+ ++RLG  R++V SS  A R+   T+D   A RP T   + L  D    
Sbjct: 69   ADLARRLDAPLMSLRLGELRVVVASSANAAREITKTHDVAFATRPWTSTIRVLMSDGVGL 128

Query: 380  TFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKV 559
             F+   + WR++RK+ V E+LS+RR++  + +   E+   +  +          P+A  V
Sbjct: 129  VFAPYGALWRQLRKIAVVELLSARRVQSFRRIREDEVGRLVAAVAAA-------PAAQPV 181

Query: 560  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFP 739
            N+S     L  +  ++ + G R+E R D  +   A+ +K        +   F  GD +FP
Sbjct: 182  NVSERIAALISDSAVRTIIGDRFE-RRDEFLEGLAEAIK--------ITSGFSLGD-LFP 231

Query: 740  LWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRS----NEDQKFIDVMLSMIDD 907
                R   + G       A    +  L +    + +ERR+    ++D+  +DV+L +  D
Sbjct: 232  S--SRLASFVGGTTRRAEANHRKNFELIECALRQHEERRAAGAVDDDEDLVDVLLRVQKD 289

Query: 908  QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK 1087
               Q      +  IKA+VL +    SET A  L W +  L+ +P  + + Q E+   I  
Sbjct: 290  GSLQMPLTMGN--IKAVVLELFGAGSETSANTLQWAMTELIMNPRVMLKAQAELSNVIKG 347

Query: 1088 ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR 1267
            ++   + D+  L YL+ ++KETLR++P  P L P E  E C V GY IP GT + VNVW 
Sbjct: 348  KQTISEDDLVELKYLKLIIKETLRLHPVVPLLLPRECRETCEVMGYDIPIGTTVLVNVWA 407

Query: 1268 LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA 1447
            + RDPK W D E F+PERF          N  ++F+PFG GRR CPG  +A  I ++A+A
Sbjct: 408  IGRDPKYWEDAETFIPERFEDGHIDFKGTN--FEFIPFGAGRRMCPGMAFAEVIMELALA 465

Query: 1448 RLFQGFNFST---VPNEPLDMMEDVGIILPKLTPLEVLVTPRL 1567
             L   F++     +    +DMME++G  + +   L ++ T R+
Sbjct: 466  SLLYHFDWELPDGISPTKVDMMEELGATIRRKNDLYLIPTVRV 508



>gb:AC112160_1738853 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OJ1579_G03, complete sequence.
          Length = 473

 Score =  217 bits (552), Expect = 7e-55
 Identities = 134/472 (28%), Positives = 244/472 (51%), Gaps = 12/472 (2%)
 Frame = +2

Query: 206  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF 385
            EWA++YGP+ ++  G S  +VVS+ E  ++    ND+LLA RP   + +    +     +
Sbjct: 18   EWAERYGPIVSVWFGSSLNVVVSTSELAKEVLKENDQLLADRPRNRSTQRFSRNGMDLIW 77

Query: 386  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM 565
            +    ++ +VRKL   E+ + +RLE L+ +   E+   ++ ++  ++   +      + +
Sbjct: 78   ADYGPHYIKVRKLCNLELFTPKRLEALRPIREDEVTAMVESVHRAVTQPGSEHKP--IVV 135

Query: 566  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW 745
                  +  N I ++  G+R+   ++G I+E+ +  K + +  + +       + I   W
Sbjct: 136  RNHLAMVAFNNITRLAFGKRF-MNANGDIDEQGREFKTIVNNGIKIGASLSVAEYI---W 191

Query: 746  FFRWLD------YEGHVKTMKRAAKDVDAILQDWVDARRKE-RRSNEDQKFIDVMLSMID 904
            + RWL       Y+ H +   R  K +       +D   K  + S   Q F+D + ++ +
Sbjct: 192  YLRWLCPLNEELYKTHNERRDRLTKKI-------IDEHAKALKESGAKQHFVDALFTLRE 244

Query: 905  DQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG 1084
                  Y  S DTVI  ++  M+    +T    + W +A L+++P   K++Q+E+D  +G
Sbjct: 245  Q-----YDLSDDTVI-GLLWDMITAGMDTTVISVEWAMAELVRNPRVQKKLQEELDRVVG 298

Query: 1085 KERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW 1264
            ++R   ++D ++LPYL  VVKE+LR++P  P + PH+A  +  + GY+IPKG  + VNVW
Sbjct: 299  RDRVMSETDFQSLPYLNAVVKESLRLHPPTPLMLPHKASTNVKIGGYNIPKGANVMVNVW 358

Query: 1265 RLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAV 1444
             + RDPK+W +P ++ PERF+   E    +   ++ +PFG GRR CPG      +    +
Sbjct: 359  AIARDPKVWSNPLEYRPERFIE--ENIDIKGSDFRVLPFGAGRRVCPGAQLGINLVASMI 416

Query: 1445 ARLFQGFNFS----TVPNEPLDMMEDVGIILPKLTPLEVLVTPRL-SPTLFR 1585
              L   F +S    T P E ++MME  G++    T L+V+  PRL +P L++
Sbjct: 417  GHLLHQFEWSLPEGTRP-EDVNMMESNGVVTFMSTSLQVIAKPRLDNPDLYK 467



>gb:AY850933_1630830 Broussonetia papyrifera ferulate-5-hydroxylase
            (F5H) mRNA, complete cds.>gb:AY850934_1630831
            Broussonetia papyrifera ferulate-5-hydroxylase (F5H)
            gene, complete cds.
          Length = 514

 Score =  217 bits (552), Expect = 7e-55
 Identities = 160/531 (30%), Positives = 261/531 (49%), Gaps = 18/531 (3%)
 Frame = +2

Query: 41   PCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADK 220
            P  ++  L I  L LL    R + +   P      PIIG +          + L+  A +
Sbjct: 15   PLPMAIFLVIPLLFLLGHILRSRGRLPYPPGPKGLPIIGSMSMMDQLTH--RGLAALAKQ 72

Query: 221  YGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNS 400
            YG +F +++G   ++ +SS E  R      D + + RP   A +YL YD A   F+    
Sbjct: 73   YGGIFHLKMGYLHMVAISSPETARQVLQLQDNIFSNRPANIAIRYLTYDRADMAFAHYGP 132

Query: 401  YWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFG 580
            +WR++RKL V ++ S +R       W S ++  +++  T +S+  +  +A  V      G
Sbjct: 133  FWRQMRKLCVMKLFSRKRAAS----WES-VRGEVEK--TVLSVAGSTGTAVNV------G 179

Query: 581  HLTLNLIMQIVAGRRYEYRSD-GTINEEAQ-RLKKVFSQVMYLWGEFVSGDAIFPLWFFR 754
             L     M I+      YR+  G  N+E Q     +  +   L+G F   D  F  W   
Sbjct: 180  ELVFKTTMDII------YRAAFGASNKEGQDEFISILQEFSKLFGAFNMAD--FIPWL-T 230

Query: 755  WLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQ----- 919
            W+D +G    +KRA K +DA +   +D    ++    +   +D +L+   ++  +     
Sbjct: 231  WVDPQGLNGRLKRARKALDAFIDKIIDEHVVKKNEAAETDMVDDLLAFYSNEEAKVNDAE 290

Query: 920  ----GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK 1087
                    +RD  IKAI++ ++   +ET A+ + W +  +++ PE LK+VQ E+   +G 
Sbjct: 291  DLHNAIRLTRDN-IKAIIMDVMFGGTETVASAIEWAMTEMMRCPEDLKKVQQELADVVGL 349

Query: 1088 ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR 1267
            +R  E+SD + L YL+  +KETLR++P  P L  HE  ED  V GYHIPKG+++ +N W 
Sbjct: 350  DRRLEESDFEKLTYLRCAIKETLRLHPPIPLLL-HETAEDAAVAGYHIPKGSRVMINAWA 408

Query: 1268 LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPG---NLYATQITQV 1438
            + RD   W DP+ F P RF+ +   +  +   ++F+PFG GRRSCPG    LYA ++T  
Sbjct: 409  IGRDKNSWADPDSFKPARFLRDGVPD-FKGSNFEFIPFGSGRRSCPGMQLGLYALELT-- 465

Query: 1439 AVARLFQGFNFS----TVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTL 1579
             V  L   F ++      P+E LDM +  G+  P+ T L  + T R+  T+
Sbjct: 466  -VGHLLHCFTWNLPDGMKPSE-LDMNDVFGLTAPRATRLVAIPTKRVVCTI 514



>gb:AY621153_1618349 Camptotheca acuminata ferulate 5-hydroxylase
            (F5H) gene, complete cds.
          Length = 514

 Score =  216 bits (550), Expect = 1e-54
 Identities = 157/527 (29%), Positives = 254/527 (48%), Gaps = 17/527 (3%)
 Frame = +2

Query: 53   SSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPV 232
            +++  IA L  L+   R + K   P      P++G++          + L++ A +YG +
Sbjct: 15   TALFFIAPLFFLFILSRLRRKLPYPPGPNGLPLVGNMMMMDQLTH--RGLAKLAKQYGGI 72

Query: 233  FTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRR 412
            F +R+G   ++ VSS E  R      D + + RP T A  YL YD A   F+    +WR+
Sbjct: 73   FHLRMGFLHMVAVSSPEIARQVLQVQDNIFSNRPATIAISYLTYDRADMAFAHYGPFWRQ 132

Query: 413  VRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTL 592
            +RKL V ++ S +R E  + V   E+ + ++ + +      N             G L  
Sbjct: 133  MRKLCVMKLFSRKRAESWESVR-DEVDSMVRVVVSHTGKSVN------------IGELVF 179

Query: 593  NLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEG 772
            +L   I+    Y      + +E      K+  +   L+G F   D I  L    W+D +G
Sbjct: 180  SLTRDII----YRAAFGSSSHEGQDEFIKILQEFSKLFGAFNIADFIPGLG---WVDPQG 232

Query: 773  HVKTM--KRAAKD--VDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQ--------FT 916
                +   RA+ D  +D+I+ D ++  R+    + D   +D +L+   D+          
Sbjct: 233  LNARLVQARASLDGFIDSIIDDHIEKHRRRNVVDSDGDMVDDLLAFYSDEAKVTESDDLQ 292

Query: 917  QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW 1096
                 +RD  IKAI++ ++   +ET A+ + W +A L+K PE LKRVQ E+   +G +R 
Sbjct: 293  NAIRLTRDN-IKAIIMDVMFGGTETVASAIEWAMAELMKSPEDLKRVQQELAEVVGLDRR 351

Query: 1097 AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR 1276
             E+SD   L YL+  +KETLR++P  P L  HE  ED  V GY+IP  +++ +N W + R
Sbjct: 352  LEESDFDKLTYLKCALKETLRLHPPIPLLL-HETAEDTEVAGYYIPARSRVMINAWAIGR 410

Query: 1277 DPKIWPDPEKFLPERFMTNLEG-EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL 1453
            D   W +PE F P RF+   EG    +   ++F+PFG GRRSCPG        ++AVA L
Sbjct: 411  DKNSWDEPETFKPSRFLK--EGVPDFKGSNFEFIPFGSGRRSCPGMQLGLYALEMAVAHL 468

Query: 1454 FQGFNFSTVPN----EPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
               F + T+P+      LD  +  G+  P+ T    + +PRL   L+
Sbjct: 469  LHCFTW-TLPDGMKPSELDTDDVFGLTAPRATLFVAVPSPRLLCPLY 514



>gb:AP003990_1836015 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC
            clone:OJ1073_F05.>gb:AP004000_1836162 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, BAC
            clone:OJ1115_B01.
          Length = 518

 Score =  216 bits (549), Expect = 1e-54
 Identities = 156/529 (29%), Positives = 262/529 (49%), Gaps = 25/529 (4%)
 Frame = +2

Query: 59   ILGIAALVLLWFSWRKQSKRLPPEAGG---------AWPIIGHLHHFRTSVPLVKTLSEW 211
            +L +A + LL+F+ ++ ++R     GG         A P+IGHLHH    +P  + LS  
Sbjct: 10   VLLLATIPLLFFTIKRSAQRRGGGGGGEGRLPPGPWALPVIGHLHHLAGDLPH-RALSAL 68

Query: 212  ADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYL-GYDYAVFTFS 388
            A ++G +  +RLG  + +V SS +A RD   T+D   A+RP +   +   G D     F+
Sbjct: 69   ARRHGALMLLRLGEVQAVVASSPDAARDIMRTHDAAFASRPLSPMQQLAYGRDAEGVIFA 128

Query: 389  TNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMS 568
                 WR +RK+   E+LS+RR++  + V  +EL   ++ +    S   ++ SA  VN++
Sbjct: 129  PYGDGWRHLRKICTAELLSARRVQSFRPVREAELGRLLRSVAEATS---SSSSASLVNLT 185

Query: 569  RWFGHLTLNLIMQIVAGRRYEYRS-------DGTINEEAQRLKKVF-SQVMYLWGEFVSG 724
                    +  ++ + G R+E+R        DG        L  +F S  + L+   V G
Sbjct: 186  ELISAFVADSTVRAIIGSRFEHRDAYLRMLQDGLKIVPGMTLPDLFPSSRLALFLSRVPG 245

Query: 725  DAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSN---EDQKFIDVMLS 895
                          E H + M+R    +DAI+ +  + R     ++   ED+ F+DV+L 
Sbjct: 246  RI------------EHHRQGMQRF---IDAIIVEHQEKRAAAAANDDDDEDEDFLDVLLK 290

Query: 896  MIDDQFTQGYSYSRDTV-IKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEID 1072
            +   Q   G  +   T  IK ++L M    SE+ AT L W +A L+++P  +++ QDE+ 
Sbjct: 291  L---QKEMGSQHPLTTANIKTVMLDMFGAGSESSATVLQWTMAELMRNPRVMQKAQDEVR 347

Query: 1073 TNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLY 1252
              +       + ++ NLPYL+ V+KETLR++P  P L P +    C + G+ +P+G  + 
Sbjct: 348  RALAGHDKVTEPNLTNLPYLRLVIKETLRLHPPAPLLLPRKCGSTCKILGFDVPEGVMVI 407

Query: 1253 VNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQIT 1432
            VN W + RD   W  PE+F+PERF  N  G   +   ++F+PFG GRR CPG  +     
Sbjct: 408  VNAWAIGRDLTYWDKPEEFVPERFEHN--GRDFKGMDFEFIPFGAGRRICPGITFGMAHV 465

Query: 1433 QVAVARLFQGFNFST---VPNEPLDMMEDVGIILPKLTPLEVLVTPRLS 1570
            ++ ++ L   F++     +  + LDM ED G+   + + L V    R+S
Sbjct: 466  ELVLSALLYHFDWELPQGMAAKDLDMTEDFGVTTQRRSNLLVRPIHRVS 514



>gb:AY596978_1617029 Centaurium erythraea coniferylalcohol
            5-hydroxylase mRNA, complete cds.
          Length = 519

 Score =  216 bits (549), Expect = 1e-54
 Identities = 160/529 (30%), Positives = 262/529 (49%), Gaps = 21/529 (3%)
 Frame = +2

Query: 59   ILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFT 238
            +L I  L+ L+   R + K  PP   G WP+IG++          + L++ A KYG +  
Sbjct: 21   LLFITPLLFLFLLSRFRLKPYPPGPRG-WPLIGNMTMMDQLTH--RGLAKLAGKYGGILH 77

Query: 239  IRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVR 418
            +R+G    + VSS +  R      D + + RP T A  YL YD A   F+    +WR++R
Sbjct: 78   LRMGFVHTVAVSSPDIARQVLQVQDNIFSNRPATIAISYLTYDRADMAFADYGPFWRQMR 137

Query: 419  KLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNL 598
            KL V ++ S +R E     W S ++  ++ +   ++ +  +P    VN+      LT ++
Sbjct: 138  KLCVMKLFSRKRAES----WDS-VRDEVERMTHIVATNIGSP----VNIGEMVFGLTKDV 188

Query: 599  IMQIVAGRRYEYRSD-GTINEEAQ-RLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEG 772
            I          YR+  GT + E Q    K+  +   L+G F   D  F  W   W D +G
Sbjct: 189  I----------YRAAFGTSSHEGQDEFIKILQEFSKLFGAFNLAD--FIPWL-SWFDPQG 235

Query: 773  HVKTMKRAAKD----VDAILQDWVDARRKERRSNE--DQKFIDVMLSMIDDQ-------- 910
              K +++A       +D+I+ D ++ ++ +  SN+  +   +D +L    D+        
Sbjct: 236  LNKRLEKARASLDGFIDSIIDDHMNRKKIKSGSNDVVESDMVDELLVFFSDEAKVLESED 295

Query: 911  FTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE 1090
                   +RD  IKAI++ ++   +ET A+ + W +A L+++P+ LKRVQ E+   +G  
Sbjct: 296  LQNSIKLTRDN-IKAIIMDVMFGGTETVASAIEWAMAELMRNPDDLKRVQQELSDVVGLH 354

Query: 1091 RWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRL 1270
            R  ++SD + L Y +  +KETLR++P  P L  HE  E   + GY IP  +++ +N W +
Sbjct: 355  RKVQESDFEKLTYFKCCLKETLRLHPPIPLLL-HETAEASEIAGYRIPAKSRVMINAWAI 413

Query: 1271 HRDPKIWPDPEKFLPERFMTNLEG-EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA 1447
             RD   W DP+ F P RF+   EG    +   ++F+PFG GRRSCPG        +VAVA
Sbjct: 414  GRDKDSWKDPDTFRPARFLE--EGVPDFKGSNFEFIPFGSGRRSCPGMQLGLYALEVAVA 471

Query: 1448 RLFQGFNF----STVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
             L   F +       P+E LDM +  G+  P+ + L  + +PRL   L+
Sbjct: 472  HLLHCFTWELPDGMKPSE-LDMGDVFGLTAPRASRLVAVPSPRLLCPLY 519



>pir|T48141|T48141 flavonoid 3',5'-hydroxylase homolog T4C9.150
            [similarity] - Arabidopsis thaliana>gb:ATCHRIV33_1544996
            Arabidopsis thaliana DNA chromosome 4, contig fragment
            No. 33.>gb:ATT4C9_1555998 Arabidopsis thaliana DNA
            chromosome 4, BAC clone T4C9 (ESSA
            project).>gb:BT012289_1641495 Arabidopsis thaliana
            At4g12310 gene, complete cds.
          Length = 520

 Score =  216 bits (549), Expect = 1e-54
 Identities = 150/525 (28%), Positives = 254/525 (48%), Gaps = 11/525 (2%)
 Frame = +2

Query: 41   PCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADK 220
            P   + ++  A   +LW+ +++  +   P      PI+G+L      +    T  + A  
Sbjct: 17   PYAYAVLILTATFSILWYIFKRSPQPPLPPGPRGLPIVGNLPFLDPDLHTYFT--KLAQS 74

Query: 221  YGPVFTIRLGISRILVVSS----WEAVRDC---FATNDKLLAARPTTCAGKYLGYDYAVF 379
            +GP+F + LG    +VV+S     E ++D    F+ +D  L AR  T    Y G D    
Sbjct: 75   HGPIFKLNLGSKLTVVVNSPSLASEILKDQDINFSNHDVPLTARAVT----YGGLDLVWL 130

Query: 380  TFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKV 559
             +      WR +RK+   ++ S + L+    +   E++   + LY              V
Sbjct: 131  PYGAE---WRMLRKVCAAKLFSRKTLDSFYELRRKEIRERTRCLY------QKGLEKSPV 181

Query: 560  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFP 739
            N+        +NL+M ++ G   +     ++  E    K V S++  L G     D  FP
Sbjct: 182  NVGEQLFLTMMNLMMNMLWGGSVKAEDMESVGTE---FKGVISEITRLLGVPNVSD-FFP 237

Query: 740  LWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNED----QKFIDVMLSMIDD 907
            +      D +G VK M   A+D+DAIL   ++  ++ R  + D    + F+  ++ + D 
Sbjct: 238  M--LARFDLQGLVKKMHLYARDLDAILDRAIEQMQRLRSRDGDDGECKDFLQHLMKLRDQ 295

Query: 908  QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK 1087
            +       + + V KA+++ M+   +E+    + +++A L+ +PE ++R Q E+D  +GK
Sbjct: 296  EADSDVPITMNHV-KAVLMDMVVGGTESSTNTIEFVMAELISNPELMRRAQQELDEVVGK 354

Query: 1088 ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR 1267
            +   E+S + +LPY+  V+KETLR+YP  P L PH   E  +V GY IPK T++++NVW 
Sbjct: 355  DNIVEESHITSLPYILAVLKETLRLYPTIPLLVPHRPSETALVGGYTIPKNTKIFINVWS 414

Query: 1268 LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA 1447
            + RDP +W  P +F PERF+     +      Y ++PFG GRR C G   A ++    +A
Sbjct: 415  IQRDPNVWEYPTEFRPERFLDKKSCDFT-GTDYSYLPFGSGRRICAGIALAERMILYTLA 473

Query: 1448 RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF 1582
             L   F+++      LD+ E  GI+L   TPL  L  PRLS + F
Sbjct: 474  TLLHSFDWTIPDGHVLDLEEKFGIVLKLKTPLVALPIPRLSNSNF 518



>sp|O65786|C724_ARATH Cytochrome P450 71B4 (EC
            1.14.-.-).>gb:AB024038_1515908 Arabidopsis thaliana
            genomic DNA, chromosome 3, P1 clone:
            MTC11.>gb:AY090254_1574006 Arabidopsis thaliana
            AT3g26280/MTC11_19 mRNA, complete
            cds.>gb:AY149951_1584900 Arabidopsis thaliana
            At3g26280/MTC11_19 mRNA, complete cds.
          Length = 504

 Score =  216 bits (549), Expect = 1e-54
 Identities = 154/514 (29%), Positives = 258/514 (50%), Gaps = 10/514 (1%)
 Frame = +2

Query: 59   ILGIAALVLLWFSWR-KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVF 235
            +L +    LL F+ + K+SK+  P      PIIG+LH  +    L K L + + K+GPV 
Sbjct: 10   LLLVPIFFLLIFTKKIKESKQNLPPGPAKLPIIGNLHQLQGL--LHKCLHDLSKKHGPVM 67

Query: 236  TIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRV 415
             +RLG + ++V+SS EA  +   T+D    +RP T A +    +     F      WR +
Sbjct: 68   HLRLGFAPMVVISSSEAAEEALKTHDLECCSRPITMASRVFSRNGKDIGFGVYGDEWREL 127

Query: 416  RKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLN 595
            RKL V E  S ++++  K++   E    IK+L    S  +       V++S+    LT +
Sbjct: 128  RKLSVREFFSVKKVQSFKYIREEENDLMIKKLKELASKQS------PVDLSKILFGLTAS 181

Query: 596  LIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGH 775
            +I +   G+ +            + + +  S + + + +F     +   WF  ++   G 
Sbjct: 182  IIFRTAFGQSFFDNKHVDQESIKELMFESLSNMTFRFSDFFPTAGL--KWFIGFVS--GQ 237

Query: 776  VKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTV--I 949
             K +      VD      VD    ++ + +    +D +L MID++  Q Y+  + TV  +
Sbjct: 238  HKRLYNVFNRVDTFFNHIVDDHHSKKATQDRPDMVDAILDMIDNE--QQYASFKLTVDHL 295

Query: 950  KAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG--KERWAEDSDVKNL 1123
            K ++ ++     +T A  L W +A L+++P  +K+ QDEI T IG  +E    + D+  L
Sbjct: 296  KGVLSNIYHAGIDTSAITLIWAMAELVRNPRVMKKAQDEIRTCIGIKQEGRIMEEDLDKL 355

Query: 1124 PYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPE 1303
             YL+ VVKETLR++P  P L P E + D  + GY IP+   L VN W + RDP+ W +PE
Sbjct: 356  QYLKLVVKETLRLHPAAPLLLPRETMADIKIQGYDIPQKRALLVNAWSIGRDPESWKNPE 415

Query: 1304 KFLPERFM---TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFS 1474
            +F PERF+    + +G +     ++ +PFG GRR CPG   A    ++ +  L   F+++
Sbjct: 416  EFNPERFIDCPVDYKGHS-----FELLPFGSGRRICPGIAMAIATIELGLLNLLYFFDWN 470

Query: 1475 TVPNEPLDM-MEDVG-IILPKLTPLEVLVTPRLS 1570
             +P +  DM ME+ G + + K  PLE+L   R+S
Sbjct: 471  -MPEKKKDMDMEEAGDLTVDKKVPLELLPVIRIS 503



>sp|Q9STL0|C71N_ARATH Cytochrome P450 71A23 (EC
            1.14.-.-).>pir|T06712|T06712 probable cytochrome P450
            T29H11.180 - Arabidopsis thaliana>gb:ATT29H11_1555642
            Arabidopsis thaliana DNA chromosome 3, BAC clone T29H11.
          Length = 483

 Score =  216 bits (549), Expect = 1e-54
 Identities = 136/470 (28%), Positives = 246/470 (52%), Gaps = 1/470 (0%)
 Frame = +2

Query: 146  PIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLA 325
            P+IG+LH    S    ++L   + +YGP+  +  G   ++V S+ EA RD   T+D++ A
Sbjct: 37   PLIGNLHQL--SQHPHRSLCYLSHRYGPLMLLHFGSVPVIVASTAEAARDVLKTHDRVFA 94

Query: 326  ARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIK 505
            +RP +   + L Y       +    YWR+++ + V  +LS++ +   + V   E+   ++
Sbjct: 95   SRPRSKIFEKLLYKSRNMASAPYGEYWRQMKSVSVLHLLSNKMVRSFQDVRQEEITLMME 154

Query: 506  ELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVF 685
             +           S+  VN+S+    LT ++I ++  GR+Y   +D          K++ 
Sbjct: 155  TI--------RKSSSKPVNLSKILSSLTNDVICRVALGRKYGVGTD---------FKELI 197

Query: 686  SQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE 865
             ++M   G F  G  +  L +  W+   G    +++ A D D +L+  V     E    +
Sbjct: 198  DRLMRQLGTFTIGSYVPWLAWTDWVS--GLEARLEKTANDFDKLLERIVQDH--EDGDGD 253

Query: 866  DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPES 1045
               F+DV+L+   D+ + G+   R + IKAIVL      ++T +T + W +  LL+HP  
Sbjct: 254  KTDFVDVLLAAQRDK-SFGFDIDRLS-IKAIVLDAFVGGTDTSSTLVEWEMTELLRHPTC 311

Query: 1046 LKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGY 1225
            LK++Q+E+ T    +    + D++ + YL+ VVKE LR++P  P + PH++ +D  +   
Sbjct: 312  LKKLQEEVRTICKGKSSVSEDDIQGMEYLKAVVKEALRLHPPVPLMVPHQSTQDVRLRDN 371

Query: 1226 HIPKGTQLYVNVWRLHRDPKIW-PDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSC 1402
            HIP GTQ+ VN+W + R+   W PD  +F PER + +      Q+  ++ +PFG GRR C
Sbjct: 372  HIPAGTQVIVNLWAVGREAATWGPDANEFRPERHLESPSDFRGQD--FELIPFGAGRRMC 429

Query: 1403 PGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVL 1552
            PG  +A  + +V +A L  GF++ ++ +E  D+ E +G ++ ++ PL V+
Sbjct: 430  PGISFAVVLNEVVLANLVHGFDWQSIDDE-TDVAESIGSVIRRMHPLYVI 478



>gb:AJ583532_1811352 Triticum aestivum mRNA for cytochrome P450
            (CYP98A12 gene).
          Length = 509

 Score =  215 bits (548), Expect = 2e-54
 Identities = 147/495 (29%), Positives = 247/495 (49%), Gaps = 11/495 (2%)
 Frame = +2

Query: 116  RLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRD 295
            RLPP     WP++G+L  F+      +  +EWA +YGP+ T+  G + ++VVS+ E  ++
Sbjct: 30   RLPP-GPRPWPVLGNL--FQIQPVRCRCFAEWAARYGPIMTVWFGSTPMVVVSTPELAQE 86

Query: 296  CFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHV 475
               T+D+ LA R    + +          ++    ++ +VRKL   E+ + RRLE L+ V
Sbjct: 87   VLRTHDQHLADRSRNRSSERFSRGGMDLIWADYGPHYIKVRKLCNLELFTPRRLEALRPV 146

Query: 476  WVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTIN 655
               E+   ++ ++              V +  +   +  N I ++  G+R+   + G ++
Sbjct: 147  REDEVTAMVESVHAA------GKGGRPVAVREFLAMVGFNNITRLAFGKRF-LTAAGELD 199

Query: 656  EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD------YEGHVKTMKRAAKDVDAI 817
            E+ +  K++ +  + +       + I    + RWL       Y+ H     R       I
Sbjct: 200  EQGREFKEIVNNGIKIGASLSIAEHIR---WLRWLTPVDEVAYQAHGDRRDRLTVK---I 253

Query: 818  LQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFA 997
            +++   A   ER     Q F+D + ++ D      Y  S DTVI  ++  M+   ++T  
Sbjct: 254  MEEHASAL--ERSGASKQHFVDALFTLRDK-----YDLSDDTVI-GLLWDMITAGTDTTV 305

Query: 998  THLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGP 1177
              + W +A L+++P    +VQ+E+D  +G++R   ++D  NLPYLQ +VKE+LR++P  P
Sbjct: 306  ITVEWAVAELVRNPTVQHKVQEELDRVVGRDRVLSETDFPNLPYLQAIVKESLRLHPPTP 365

Query: 1178 YLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFM-TNLEGEAAQ 1354
             + PH A     V GY IPKG  + VNVW + RDP+ W  P +F PERF+  N++    +
Sbjct: 366  LMLPHRASAAVKVAGYDIPKGASVTVNVWAIARDPEAWDSPLEFRPERFLHDNID---IK 422

Query: 1355 NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFS----TVPNEPLDMMEDVGII 1522
               Y+ +PFG GRR CPG      +    +  L   F ++    T P E +DMME  G+I
Sbjct: 423  GCDYRVLPFGAGRRVCPGAQLGINLVASMIGHLLHHFTWALPDGTRP-EDIDMMESPGLI 481

Query: 1523 LPKLTPLEVLVTPRL 1567
                TPL+V+ TPRL
Sbjct: 482  TFMRTPLQVVATPRL 496



>gb:AY072298_1567116 Zea mays cytochrome P450 monooxygenase CYP71C3v2
            mRNA, complete cds.>gb:AY072299_1567117 Zea mays
            cytochrome P450 monooxygenase CYP71C3v2 gene, complete
            cds.
          Length = 534

 Score =  215 bits (548), Expect = 2e-54
 Identities = 158/535 (29%), Positives = 264/535 (49%), Gaps = 22/535 (4%)
 Frame = +2

Query: 5    SSERIKCVMDAVPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSV 184
            S++ +  ++ AVP  L   L +A+L     S  +    LPP   G  PI+GHLHH     
Sbjct: 21   STQTLTLLLIAVPTVL---LLLASLAKSTSSSGRGKPPLPPSPPGTLPIVGHLHHIGPQT 77

Query: 185  PLVKTLSEWADKYGP--VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYL 358
             +  +L E   KYG      +R G    L+VSS  A      T+D + A+RP + A   L
Sbjct: 78   HI--SLQELVAKYGHNGFLFLRAGAVPTLIVSSPSAAEAVMRTHDHIFASRPWSMASHIL 135

Query: 359  GYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNN 538
             Y+     FS    YW++ RKL+   +LS++++   +H          +E    + +DN 
Sbjct: 136  RYNTCDVAFSPLGEYWQQTRKLMNTHLLSNKKVYSFRHG---------REEEVCLVVDNL 186

Query: 539  NPSAPK-----VNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYL 703
              +A K     V+MS      T +++ + V G  +  +   T+  E        + V  L
Sbjct: 187  REAAAKSPSTAVDMSEVLAAYTNDVVSRSVLGSTHRKKGRNTLFREM-----TMTNVDLL 241

Query: 704  WGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQK--- 874
             G   + +   P W    L +      + R  K  DA+L++ +    + R+ + D++   
Sbjct: 242  VG--FNLEYYIPRWPLTDLLFRLVCWKVTRHLKRWDALLEEVIHEHVEMRKLSGDKEKES 299

Query: 875  --FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESL 1048
              FID+ LS  ++     Y ++ D V K++++++ + A ET    L   +A L+ H   +
Sbjct: 300  DDFIDIFLSRYEE-----YGFTMDNV-KSLLMNVFEAAIETSYLVLESAMAELMNHRRVM 353

Query: 1049 KRVQDEIDTNIGKER--WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDG 1222
            K++Q E+     +++     + D+ +LPYL+  +KE LR++P GP L PH +  DC +DG
Sbjct: 354  KKLQAEVRAYGAEKKLDMIREDDLSSLPYLKASMKEALRLHPPGPLLLPHYSTADCQIDG 413

Query: 1223 YHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTN--LEGEAAQNRQYQFVPFGLGRR 1396
            YHIP  T++ VN W + RDP +W  PE+F+PERFM +   +  +   + ++++PFG GRR
Sbjct: 414  YHIPANTRVLVNGWAIGRDPAVWEKPEEFMPERFMRDGWDKSNSYSGQDFRYLPFGSGRR 473

Query: 1397 SCPGNLYATQITQVAVARLFQGFNFSTVPNEPLD------MMEDVGIILPKLTPL 1543
             CPG  +A    ++ +A L   F++  VPNE  D      M E  G++L +  PL
Sbjct: 474  ICPGANFALATMEIMLANLMYHFDWE-VPNEKEDGGGKVSMDETFGLMLRRNEPL 527



>gb:AB052131_1521171 Asparagus officinalis Asp-3 mRNA for cytochrome
            P450, complete cds.
          Length = 498

 Score =  215 bits (548), Expect = 2e-54
 Identities = 156/524 (29%), Positives = 270/524 (51%), Gaps = 16/524 (3%)
 Frame = +2

Query: 38   VPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWAD 217
            +P  L  +L +  L+L+    +  S +LPP      P+IG+LH    S+P  ++L   + 
Sbjct: 1    MPLILVILLLLPILLLVIRREKSTSSKLPP-CPPKLPLIGNLHQLG-SLPH-QSLHALSV 57

Query: 218  KYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNN 397
            KYGP+  ++LG    L+VSS +  R+   T+D + A+RP+      L        F+   
Sbjct: 58   KYGPLMLLKLGEIPTLIVSSSDMAREIMRTHDHIFASRPSLLTSDILLNGATDVVFAPYG 117

Query: 398  SYWRRVRKLVVEEILSSRRLEK---LKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMS 568
             +WR++RKL V  +LS++ ++    ++   VS + T I  L               VNMS
Sbjct: 118  EHWRQMRKLCVNHLLSAKMVQSFRLMREEEVSSMLTRISGL---------------VNMS 162

Query: 569  RWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWF 748
                  T  ++   ++G+ +    +G IN   + +++  + +  L     S    FP   
Sbjct: 163  EVLNLFTSKILFNAISGKFF-VEEEGRINVFCKLIRENIAILAQL-----SVSDFFPS-- 214

Query: 749  FRWLDYEGHVKTMKRA-AKDVDAILQDWVDARRKERRSNE-----DQK----FIDVMLSM 898
              WLD    V    RA AK  D +L + ++   K  RSNE     DQ+    F+ V++++
Sbjct: 215  LGWLDLVFGVGARARATAKKWDDVLDEVIEDHVK--RSNETGDADDQEERADFVSVLMAL 272

Query: 899  IDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTN 1078
             +D  T G++ +R+ +IKAI+  M+   +ET    L W +  L+++P ++K+++DE+ + 
Sbjct: 273  QEDDNT-GFTLNRN-IIKAILQDMIAAGTETSFLVLDWGMTELVRNPGTMKKLKDEVRSV 330

Query: 1079 IGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVN 1258
             G E    + D+  + YL+ V+KE LR++P  P L P E+++ C V  Y +P  T++ +N
Sbjct: 331  AGSETVVREEDISKMFYLKAVIKEILRLHPPVPLLIPRESMDHCNVQQYEVPSKTRVLIN 390

Query: 1259 VWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV 1438
             W + RDPK+W DPE+F PERF+ +      + + ++FVPFG GRR CPG  +A    ++
Sbjct: 391  AWSMGRDPKVWEDPEEFRPERFLDS--DIDFRGQCFEFVPFGAGRRICPGMHFAAANLEL 448

Query: 1439 AVARLFQGFNFST---VPNEPLDMMEDVGIILPKLTPLEVLVTP 1561
            A+A L   F++     + +E LDM +  G+   +   L ++  P
Sbjct: 449  ALANLMYRFDWELPDGMKSEDLDMGDSPGLTTRRRQNLHLVARP 492



>gb:PAJ10324_1698705 Populus trichocarpa cv trichobel mRNA for
            ferulate-5-hydroxylase.
          Length = 513

 Score =  215 bits (547), Expect = 3e-54
 Identities = 157/517 (30%), Positives = 245/517 (47%), Gaps = 17/517 (3%)
 Frame = +2

Query: 68   IAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRL 247
            I+++  L    R + +   P     +P+IG +H         + L++ A +YG +F +R+
Sbjct: 20   ISSIFFLGLISRLRRRSPYPPGPKGFPLIGSMHLMDQLTD--RGLAKLAKQYGGLFHMRM 77

Query: 248  GISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLV 427
            G   ++  SS E  R      D + + RP   A  YL YD A   F+    +WR++RKL 
Sbjct: 78   GYLHMVAGSSPEVARQVLQVQDNMFSNRPANIAISYLTYDRADMAFAHYGPFWRQMRKLC 137

Query: 428  VEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQ 607
            V ++ S +R E  + V          E+ + +    +N   P VN+      LT+N+  +
Sbjct: 138  VMKLFSRKRAESWESVR--------DEVDSMVKTVESNIGKP-VNVGELIFTLTMNITYR 188

Query: 608  IVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGH---- 775
               G +         NE      K+  +   L+G F   D  F  W   W+D +G     
Sbjct: 189  AAFGAK---------NEGQDEFIKILQEFSKLFGAFNISD--FIPWL-GWIDPQGLTARL 236

Query: 776  VKTMKRAAKDVDAILQDWVDARRKERRSNE-DQKFIDVMLSMID--------DQFTQGYS 928
            VK  K   K +D I+ D +  R++   S E +   +D ML+           D       
Sbjct: 237  VKARKALDKFIDHIIDDHIQKRKQNNYSEEAETDMVDDMLTFYSEETKVNESDDLQNAIK 296

Query: 929  YSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDS 1108
             +RD  IKAI++ ++   +ET A+ + W +A LLK PE +KRVQ E+   +G ER  E+S
Sbjct: 297  LTRDN-IKAIIMDVMFGGTETVASAIEWAMAELLKSPEDIKRVQQELADVVGLERRVEES 355

Query: 1109 DVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKI 1288
            D   L + +  +KETLR++P  P L  HE  ED  V GY++PK T++ +N + + RD   
Sbjct: 356  DFDKLTFFKCTLKETLRLHPPIPLLL-HETSEDAEVAGYYVPKKTRVMINAYAIGRDKNS 414

Query: 1289 WPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFN 1468
            W DP+ F P RF+     +   N  ++F+PFG GRRSCPG         +AVA L   F 
Sbjct: 415  WEDPDSFKPSRFLEPGVPDFKGN-HFEFIPFGSGRRSCPGMQLGLYALDLAVAHLLHCFT 473

Query: 1469 F----STVPNEPLDMMEDVGIILPKLTPLEVLVTPRL 1567
            +       P+E LDM +  G+  P+ T L  +   R+
Sbjct: 474  WELPDGMKPSE-LDMTDMFGLTAPRATRLVAVPRKRV 509



>pir|T52171|T52171 cytochrome P450 monooxygenase [imported] -
            Arabidopsis thaliana>gb:D78603_1674785 Arabidopsis
            thaliana mRNA for cytochrome P450 monooxygenase, complete
            cds, clone P450-13-6.
          Length = 504

 Score =  214 bits (546), Expect = 3e-54
 Identities = 154/514 (29%), Positives = 257/514 (50%), Gaps = 10/514 (1%)
 Frame = +2

Query: 59   ILGIAALVLLWFSWR-KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVF 235
            +L +    LL F+ + K+SK+  P      PIIG+LH  +    L K L + + K+GPV 
Sbjct: 10   LLLVPIFFLLIFTKKIKESKQNLPPGPAKLPIIGNLHQLQGL--LHKCLHDLSKKHGPVM 67

Query: 236  TIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRV 415
             +RLG + ++V+SS EA  +   T+D    +RP T A +    +     F      WR +
Sbjct: 68   HLRLGFAPMVVISSSEAAEEALKTHDLECCSRPITMASRVFSRNGKDIGFGVYGDEWREL 127

Query: 416  RKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLN 595
            RKL V E  S ++++  K++   E    IK+L    S  +       V++S+    LT +
Sbjct: 128  RKLSVREFFSVKKVQSFKYIREEENDLMIKKLKELASKQS------PVDLSKILFGLTAS 181

Query: 596  LIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGH 775
            +I +   G+ +            + + +  S + + + +F     +   WF  ++   G 
Sbjct: 182  IIFRTAFGQSFFDNKHVDQESIKELMFESLSNMTFRFSDFFPTAGL--KWFIGFVS--GQ 237

Query: 776  VKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTV--I 949
             K +      VD      VD    ++ + +    +D +L MID++  Q Y+  + TV  +
Sbjct: 238  HKRLYNVFNRVDTFFNHIVDDHHSKKATQDRPDMVDAILDMIDNE--QQYASFKLTVDHL 295

Query: 950  KAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG--KERWAEDSDVKNL 1123
            K ++ ++     +T A  L W +A L+++P  +K+ QDEI T IG  +E    + D+  L
Sbjct: 296  KGVLSNIYHAGIDTSAITLIWAMAELVRNPRVMKKAQDEIRTCIGIKQEGRIMEEDLDKL 355

Query: 1124 PYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPE 1303
             YL+ VVKETLR++P  P L P E + D  + GY IP+   L VN W + RDP+ W +PE
Sbjct: 356  QYLKLVVKETLRLHPAAPLLLPRETMADIKIQGYDIPQKRALLVNAWSIGRDPESWKNPE 415

Query: 1304 KFLPERFM---TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFS 1474
            +F PERF+    + +G +      + +PFG GRR CPG   A    ++ +  L   F+++
Sbjct: 416  EFNPERFIDCPVDYKGHSC-----ELLPFGSGRRICPGIAMAIATIELGLLNLLYFFDWN 470

Query: 1475 TVPNEPLDM-MEDVG-IILPKLTPLEVLVTPRLS 1570
             +P +  DM ME+ G + + K  PLE+L   R+S
Sbjct: 471  -MPEKKKDMDMEEAGDLTVDKKVPLELLPVIRIS 503



>sp|Q42716|C718_MENPI Cytochrome P450 71A8 (EC
            1.14.-.-).>pir|S45039|S45039 cytochrome P450 - Mentha
            piperita (peppermint)>gb:CYMPCP450_1674445 M.piperita
            gene for cytochrome P-450 oxidase.
          Length = 502

 Score =  214 bits (546), Expect = 3e-54
 Identities = 148/517 (28%), Positives = 256/517 (49%), Gaps = 7/517 (1%)
 Frame = +2

Query: 29   MDAVPCCLSSILGIAALVLL-----WFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV 193
            MD +     +   + +L+LL     W S   ++K   P +    PI+G+L     S+P  
Sbjct: 13   MDEIISHTLAFQALVSLILLISITKWLSNSPKNKNSSPPSPRKLPILGNLLQLG-SLPH- 70

Query: 194  KTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYA 373
              L   A K+GP+  + LG  R   VSS    R     N +    RP       L     
Sbjct: 71   HNLRSMARKHGPIMLLHLGSVR--PVSSRRRPRGNHE-NSRSRLRRPRGSRSAALQLQGR 127

Query: 374  VFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAP 553
            V  +     YWR+++ + V ++LS++R++  + V   E +  +K++           S+ 
Sbjct: 128  VGGYG---EYWRQLKTICVVQLLSNKRVQSFRSVREEETELLMKKI---------GDSSG 175

Query: 554  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI 733
             VN+S  F  LT +++ +   GR+Y     G  +E  ++  ++  + + L G    GD +
Sbjct: 176  NVNLSHMFTQLTNDVVCRSAIGRKY-----GAGDENGEKFLEILREFLELLGAISIGDFV 230

Query: 734  FPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQF 913
              LW+   ++  G  + + R AK++D  L+  +  R +   +  ++ F+D++L +  +  
Sbjct: 231  PSLWWINRIN--GFDRRVDRIAKEMDEFLEKVIHERLENPAAKAEENFVDILLEIYRNN- 287

Query: 914  TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER 1093
            + G S  RD+ IKAI+L +    ++T A  L W +  LL+HPE +K++Q E+   +  + 
Sbjct: 288  SAGVSIDRDS-IKAIILDVFAAGTDTTAVVLEWAMTELLRHPEIMKKLQSEVRQVVKDKH 346

Query: 1094 WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH 1273
               D D++ + YL+ V+KET+R +   P L P  A  D  V GY +P GT + +N W + 
Sbjct: 347  NITDDDIEKMHYLKAVMKETMRFHTPIPLLVPRVARNDVEVMGYDVPVGTMVMINAWAIG 406

Query: 1274 RDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL 1453
            RDP  W +PEKF PERF+ +      +   ++ +PFG GRR CPG  +     +  +A L
Sbjct: 407  RDPTSWDEPEKFRPERFLNS--SVDFKGLDFELIPFGAGRRGCPGTTFPMATLEFTLANL 464

Query: 1454 FQGFNFSTVPNE--PLDMMEDVGIILPKLTPLEVLVT 1558
             Q F++  +P+E   LDM E  G+ + ++ PL  + T
Sbjct: 465  MQKFDWE-LPHECRELDMSERPGVAIRRVIPLLAIGT 500



>sp|O48923|C7DA_SOYBN Cytochrome P450 71D10 (EC
            1.14.-.-).>pir|T05939|T05939 cytochrome P450
            monooxygenase 71D10p - soybean>gb:AF022459_1761994
            Glycine max cytochrome P450 monooxygenase CYP71D10p
            (CYP71D10) mRNA, complete cds.
          Length = 510

 Score =  214 bits (545), Expect = 4e-54
 Identities = 134/517 (25%), Positives = 261/517 (50%), Gaps = 13/517 (2%)
 Frame = +2

Query: 56   SILGIAALVLLWFSW-----RKQSK-----RLPPEAGGAWPIIGHLHHFRTSVPLVKTLS 205
            SI  I +++ ++F +     R  SK     +LPP      P+IG++H    S+P+   L 
Sbjct: 12   SIYFITSILFIFFVFFKLVQRSDSKTSSTCKLPP-GPRTLPLIGNIHQIVGSLPVHYYLK 70

Query: 206  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF 385
              ADKYGP+  ++LG    ++V+S E  ++   T+D   + RP     + + Y+ +   F
Sbjct: 71   NLADKYGPLMHLKLGEVSNIIVTSPEMAQEIMKTHDLNFSDRPDFVLSRIVSYNGSGIVF 130

Query: 386  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM 565
            S +  YWR++RK+   E+L+++R++  + +   E+   +K++    S +  +      N+
Sbjct: 131  SQHGDYWRQLRKICTVELLTAKRVQSFRSIREEEVAELVKKIAATASEEGGSI----FNL 186

Query: 566  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW 745
            ++    +T  +  +   G++  Y+     N   Q         + L G F   D      
Sbjct: 187  TQSIYSMTFGIAARAAFGKKSRYQQVFISNMHKQ---------LMLLGGFSVADLYPSSR 237

Query: 746  FFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGY 925
             F+ +   G ++ + R     D +LQD +D  +   RS+E+++ ++ ++ ++     +  
Sbjct: 238  VFQMMGATGKLEKVHRVT---DRVLQDIIDEHKNRNRSSEEREAVEDLVDVLLKFQKESE 294

Query: 926  SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED 1105
                D  IKA++  +     ET ++ + W ++ L+++P  ++  Q E+      + + ++
Sbjct: 295  FRLTDDNIKAVIQDIFIGGGETSSSVVEWGMSELIRNPRVMEEAQAEVRRVYDSKGYVDE 354

Query: 1106 SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK 1285
            +++  L YL+ ++KET+R++P  P L P  + E C ++GY IP  T++ +N W + R+PK
Sbjct: 355  TELHQLIYLKSIIKETMRLHPPVPLLVPRVSRERCQINGYEIPSKTRIIINAWAIGRNPK 414

Query: 1286 IWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF 1465
             W + E F PERF+ +      +   ++F+PFG GRR CPG  +A    ++ +A+L   F
Sbjct: 415  YWGETESFKPERFLNS--SIDFRGTDFEFIPFGAGRRICPGITFAIPNIELPLAQLLYHF 472

Query: 1466 NF---STVPNEPLDMMEDVGIILPKLTPLEVLVTPRL 1567
            ++   + + NE LDM E  GI L +   L ++   RL
Sbjct: 473  DWKLPNKMKNEELDMTESNGITLRRQNDLCLIPITRL 509



>gb:AJ585989_1811750 Triticum aestivum partial mRNA for cytochrome
            P450-like protein.
          Length = 504

 Score =  214 bits (544), Expect = 6e-54
 Identities = 145/520 (27%), Positives = 258/520 (49%), Gaps = 7/520 (1%)
 Frame = +2

Query: 29   MDAVPCCLSSILGIAALVLLW--FSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTL 202
            MD     L  +L + A+ +L     W     RLPP     WP++G+L   +      +  
Sbjct: 1    MDVASLLLPFVLALVAIPILLALLDWL----RLPP-GPCPWPVVGNLRQIKPV--RCRCF 53

Query: 203  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT 382
             EWA++YGP+F++  G S  +VVS+ E  ++    +D+ LA R    + +    +     
Sbjct: 54   QEWAERYGPIFSVWFGSSLTVVVSTPELAKEVLKEHDQQLANRTRNRSTQRFSRNGQDLV 113

Query: 383  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVN 562
            ++    ++ +VRKL   E+ + +RLE L+ +   E+   +  ++   ++   N   P V 
Sbjct: 114  WADYGPHYIKVRKLCNLELFTQKRLEALRPIREDEVTAMVASVHR-AAIGPGNDGKPLVL 172

Query: 563  MSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL 742
             S     ++ N I ++V G+R+   ++G INEE    K + +  + +       + +   
Sbjct: 173  RSH-LAMVSFNNITRLVFGKRF-MNANGDINEEGHEFKSIVNNGIKIGASLSIAEYV--- 227

Query: 743  WFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKE-RRSNEDQKFIDVMLSMIDDQFTQ 919
            W+ RWL +  + +  K   +  D + +  ++   K    S     F+D +L++ +     
Sbjct: 228  WYLRWL-FPLNEELYKTHNERRDHLTKKIIEEHAKALEESGSKNHFVDALLTLREQ---- 282

Query: 920  GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWA 1099
             Y  S DTV   ++  ++    +T    + W +A L+++P   K++Q+E+D+ +      
Sbjct: 283  -YDLSDDTVF-GLLWDIITTGMDTTVISVEWAMAELVRYPRVQKKLQEELDSVMS----- 335

Query: 1100 EDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRD 1279
             ++D + LPYL  VVKE+LR++P  P + PH+A     V GY+IPKG  + VNVW + R+
Sbjct: 336  -EADFQKLPYLLAVVKESLRLHPATPLMLPHKASASVKVGGYNIPKGADVTVNVWAIARN 394

Query: 1280 PKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQ 1459
            P +W +P ++ PERF+   E    +   ++ +PFG GRR CPG      +    +  L  
Sbjct: 395  PDVWRNPLEYRPERFLE--ESIDIKGGDFRVLPFGAGRRVCPGAQLGINLVASMIGHLLH 452

Query: 1460 GFNFS----TVPNEPLDMMEDVGIILPKLTPLEVLVTPRL 1567
             F +S    T+P E +DMME  GI++   TPL+ +  PRL
Sbjct: 453  HFEWSLPEGTMP-EDVDMMESPGIVMFMSTPLQAVTKPRL 491



>sp|P58049|C72B_ARATH Cytochrome P450 71B11 (EC
            1.14.-.-).>gb:AK176623_1818611 Arabidopsis thaliana mRNA
            for cytochrome P450-like protein, complete cds, clone:
            RAFL25-16-C21.
          Length = 496

 Score =  214 bits (544), Expect = 6e-54
 Identities = 145/493 (29%), Positives = 246/493 (49%), Gaps = 9/493 (1%)
 Frame = +2

Query: 101  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW 280
            RK  K LPP      PIIG+LH   +      ++ + ++KYGP+  +R G    +V S+ 
Sbjct: 23   RKTKKNLPP-GPPRLPIIGNLHQLGSKPH--SSMFKLSEKYGPLMALRFGSVSTVVASTP 79

Query: 281  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE 460
            E V++   T D    +RP       L Y+     F     YWR VRK+ V E+ +++R++
Sbjct: 80   ETVKEVLKTFDAECCSRPYMTYPARLTYNLKDIGFCPYTKYWREVRKMTVVELYTAKRVQ 139

Query: 461  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS 640
              +H    E+ + +  +    S++        VN++     L+ ++I ++V G       
Sbjct: 140  SFQHTRKEEVASLVDFITQAASLEK------PVNLNTKLMKLSGSVICRVVFG------- 186

Query: 641  DGTINEEAQRLKKVFSQV----MYLWGEFVSGDAIFPLWFFRWLD-YEGHVKTMKRAAKD 805
               IN +  +L+ ++ +V    M + G F + D  FP+   R +D   G     ++  K 
Sbjct: 187  ---INLKGSKLENLYEEVIQGTMEVVGSFAAAD-YFPI-IGRIIDRITGLHSKCEKIFKA 241

Query: 806  VDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQG-YSYSRDTVIKAIVLSMLQDA 982
            +DA     +    ++    +D   ID++L M   +   G +  +RD   K I+ ++L   
Sbjct: 242  MDAFFDQSIKHHLEDESIKDD--IIDLLLKMERGEIELGEFQLTRDNT-KGILFNILNAG 298

Query: 983  SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM 1162
             +T A  +TW++  L+ +P  +K+ Q E+   I  +    + D++ L YL+ VVKET R+
Sbjct: 299  IDTSAQVMTWVMTYLISNPRVMKKAQAEVREVIKNKDDIIEEDIERLEYLKMVVKETFRV 358

Query: 1163 YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG 1342
             P  P L P EA +D  + GY IPK T ++VN+W +HR+P +W DPE F+PERFM N   
Sbjct: 359  LPLVPLLIPREASKDVKIGGYDIPKKTWIHVNIWAIHRNPNVWKDPEAFIPERFMDNQID 418

Query: 1343 EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST---VPNEPLDMMEDV 1513
                N  ++F+PFG GRR CPG      +  + +  L   F++     +  E +D+ E  
Sbjct: 419  YKGLN--FEFLPFGSGRRMCPGIGMGMALVHLTLINLLYRFDWKLPEGMEVEDVDLEESY 476

Query: 1514 GIILPKLTPLEVL 1552
            G++ PK  PL+++
Sbjct: 477  GLVCPKKVPLQLI 489



>gb:AF150881_1772612 Lycopersicon esculentum x Lycopersicon peruvianum
            ferulate-5-hydroxylase (CYP84) mRNA, complete cds.
          Length = 521

 Score =  213 bits (543), Expect = 7e-54
 Identities = 162/524 (30%), Positives = 254/524 (48%), Gaps = 24/524 (4%)
 Frame = +2

Query: 68   IAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRL 247
            I  L  L+     + KR PP   G WP+IG++          + L++ A KYG VF +++
Sbjct: 24   IIPLFFLYLFSTSRRKRYPPGPLG-WPLIGNMMIMDQLTH--RGLAKLAQKYGGVFHLKM 80

Query: 248  GISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLV 427
            G    +V+S  E  R      D + + RP T A  YL YD A   F+    +WR++RKL 
Sbjct: 81   GYVHKIVISGPEEARQVLQVQDNIYSNRPKTVAISYLTYDRADMAFADYGPFWRQMRKLC 140

Query: 428  VEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQ 607
            V ++ S +R E    V   E+ + +K + T         +   +N+      LT N+I +
Sbjct: 141  VMKLFSRKRAESWDSVR-DEVDSMVKIVTT--------NAGTSINLGELVFCLTRNIIYR 191

Query: 608  IVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEG----H 775
               G   +   D  I        K+  +   L+G F   D      F  WL + G    +
Sbjct: 192  AAFGTSSDEGQDDFI--------KILQEFSKLFGAFNMAD------FIPWLGWIGKQGLN 237

Query: 776  VKTMK-RAAKD--VDAILQDWVDARRKERRSNED----QKFIDVMLSMIDDQFTQGYS-- 928
            V+  K RA+ D  +D I+ D ++ ++     N+D       +D +L+   ++     S  
Sbjct: 238  VRLAKARASLDGFIDTIIDDHIERKKAIHVINDDGYRESDMVDELLAFYSEETKVNESED 297

Query: 929  ------YSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE 1090
                   +RD  IKAI++ ++   +ET A+ + W +A L+K PE LK+VQ E+   +G  
Sbjct: 298  LQNAIRLTRDN-IKAIIMDVMFGGTETVASAIEWAMAELMKSPEDLKKVQQELANVVGLN 356

Query: 1091 RWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRL 1270
            R  ++SD +NL YL+  +KETLR++P  P L  HE  E+  V GY+IP  + + +N + +
Sbjct: 357  RKVDESDFENLTYLKCCLKETLRLHPPIPLLL-HETAEESTVSGYYIPANSHVIINSFAI 415

Query: 1271 HRDPKIWPDPEKFLPERFMTNLEGEA-AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA 1447
             RD   W DP+ F P RF+   EG A  +   ++F+PFG GRRSCPG        ++AVA
Sbjct: 416  GRDKNSWEDPDSFKPSRFLK--EGVADFKGGNFEFLPFGSGRRSCPGMQLGLYALEMAVA 473

Query: 1448 RLFQGFNF----STVPNEPLDMMEDVGIILPKLTPLEVLVTPRL 1567
             L   F +       P+E L+M +  G+  P    L  + TPRL
Sbjct: 474  HLLHCFTWELPDGMKPSE-LNMDDMFGLTAPLANRLVAVPTPRL 516



>gb:AY192573_1588679 Catharanthus roseus cytochrome P450 71D1
            (CYP71D1) mRNA, partial cds.
          Length = 495

 Score =  213 bits (543), Expect = 7e-54
 Identities = 146/501 (29%), Positives = 245/501 (48%), Gaps = 13/501 (2%)
 Frame = +2

Query: 95   SWRKQSKRLPPEAGGAW--PIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILV 268
            S R ++  LPP   G W  PI+G+LH+        + L + A K+G +  ++LG    +V
Sbjct: 18   STRTKTINLPP---GPWKLPILGNLHNMMMGSVPHRLLRDLAKKHGDLMLLKLGEFNAIV 74

Query: 269  VSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSS 448
            VSS    ++   T+D     RP   A K L YD +   FS     WR +RK+ V E+LS+
Sbjct: 75   VSSPRMAKEVLKTHDLSFLNRPIIQAPKILCYDNSDLVFSQYGDSWREMRKIFVLELLST 134

Query: 449  RRLEKLKHVWVSE---LQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAG 619
            +R+   + +   E   L + IKE                +++S      T +++ +   G
Sbjct: 135  KRVRSFQPIRQDEGSRLVSLIKESV-----------GKSIDLSEKINSYTTSMVARAAFG 183

Query: 620  RRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAA 799
            +         +N+      K+  +   + G F   D IFP + F  + +    K +K   
Sbjct: 184  K---------VNDAGVTFLKLVKEASEVAGGFDPAD-IFPSYKFLNVFFNSRSKLLKIHG 233

Query: 800  KDVDAILQDWVDAR-------RKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAI 958
            K  D IL++ +D         +K    N  +  ID++LS+ D    Q + +  + V KA+
Sbjct: 234  K-TDMILEEMIDEHIKNHEMGKKANGENGKEDVIDILLSIKDSGELQ-FPFQMNNV-KAL 290

Query: 959  VLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQG 1138
            +  M    +ET ++ + W ++ L+++P+ + + Q+E+   +  ++  ++S ++ L YL+ 
Sbjct: 291  IFDMFAAGTETSSSTVEWAMSELIRNPDVMAKAQNEVRQVLKGKQIVDESVLQELEYLKL 350

Query: 1139 VVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPE 1318
            +VKE LR++P  P L P E  EDC +DGY IP  T+++VN+W + RD K W DPE F+PE
Sbjct: 351  IVKEVLRLHPSSPLLIPRECGEDCQIDGYDIPVKTRVFVNIWAIARDDKYWKDPESFIPE 410

Query: 1319 RFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN-EPL 1495
            RF          N  ++++PFG GRR CPG  +      + +A L   FN+   P    +
Sbjct: 411  RFENTCFDFTGNN--FEYLPFGSGRRMCPGMTFGLANVDLVLALLLYHFNWKLPPGVNDI 468

Query: 1496 DMMEDVGIILPKLTPLEVLVT 1558
            DM E VG+   K   L ++ T
Sbjct: 469  DMTERVGLGATKKHSLVLIPT 489



>sp|Q9STK8|C71P_ARATH Cytochrome P450 71A25 (EC
            1.14.-.-).>pir|T06714|T06714 probable cytochrome P450
            T29H11.200 - Arabidopsis thaliana>gb:ATT29H11_1555640
            Arabidopsis thaliana DNA chromosome 3, BAC clone T29H11.
          Length = 490

 Score =  213 bits (543), Expect = 7e-54
 Identities = 152/493 (30%), Positives = 251/493 (50%), Gaps = 8/493 (1%)
 Frame = +2

Query: 116  RLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRD 295
            + PP   G  P+IG+LH         ++L + + +YGP+  + LG   +L+VSS +  ++
Sbjct: 29   KTPPSPPGL-PLIGNLHQLGRHTH--RSLCDLSRRYGPLMLLHLGRVPVLIVSSADMAQE 85

Query: 296  CFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHV 475
               T+D+  A RP +   + L Y+      +    YWR+++ + V  +LS++ +   + V
Sbjct: 86   ILKTHDQAFANRPRSKLSQKLLYNNRDVASAPYGEYWRQMKSVCVIHLLSNKMVRSFRDV 145

Query: 476  WVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTIN 655
               E+        T +       S+   N+S+    LT ++I ++  GR+Y   +D    
Sbjct: 146  REEEI--------TLMMAKIRKSSSLPFNVSKVLECLTNDVICRVALGRKYGGETD---- 193

Query: 656  EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDY-EGHVKTMKRAAKDVDAILQDWV 832
                  KK+  ++  L G F  G   F  W   W+D+  G    + +  KD+D   +  V
Sbjct: 194  -----FKKLTDRLSELLGTFSIGS--FVPWL-AWVDWIRGWDAQLDKMGKDLDDFFEKVV 245

Query: 833  -DARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLT 1009
             D    +RR   D   ID +L +  ++ + G+   R + IKAI L +    S+T  T L 
Sbjct: 246  QDHEDGDRRDGTD--LIDALLRVKREK-SPGFEIERVS-IKAITLDVFVGGSDTSFTLLE 301

Query: 1010 WILAVLLKHPESLKRVQDEIDTNI-GKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLA 1186
            W +  LL+HP+SL R+Q+E+ T   GK R +ED D++ + YL+ V+KE LR++P  P +A
Sbjct: 302  WAMTELLRHPKSLNRLQEEVRTICKGKSRVSED-DIQGMKYLKAVIKEALRLHPPFPMMA 360

Query: 1187 PHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIW-PDPEKFLPERFMTNLEGEAAQNRQ 1363
            PHE+ ED  +  YHIP GTQ+ +N W + R+   W PD E+F PER +        QN  
Sbjct: 361  PHESTEDVKLRDYHIPAGTQVMMNAWAIGREVATWGPDAEEFKPERHLDTSVDFRGQN-- 418

Query: 1364 YQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNE----PLDMMEDVGIILPK 1531
            ++ +PFG GRR CP   +A  + +V +A L  GF++  +P E      D+ E  G  + +
Sbjct: 419  FELLPFGAGRRICPAVSFAVVLNEVVLANLVHGFDWK-LPEESKEDKTDVAESSGFSVHR 477

Query: 1532 LTPLEVLVTPRLS 1570
              PL  + +P L+
Sbjct: 478  EFPLYAVASPYLT 490



>gb:AB016061_1512754 Petunia x hybrida IMT-6 mRNA for cytochrome P450,
            complete cds.
          Length = 510

 Score =  212 bits (540), Expect = 2e-53
 Identities = 143/490 (29%), Positives = 245/490 (50%), Gaps = 9/490 (1%)
 Frame = +2

Query: 110  SKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAV 289
            S RLPP   G WPI G+L    T     +T++    +YGPV  +R+G  + + + S +  
Sbjct: 30   SHRLPPGPPG-WPIFGNLFDLGTLPH--QTIAGMKLRYGPVVLLRIGSVKTIAILSAKVA 86

Query: 290  RDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLK 469
             + F  +D   A R          Y+ +    +   +YWR +R++   E+ +++R+ +  
Sbjct: 87   TEFFKNHDACFADRKIIDTMLVHNYNKSSLVLAPYGTYWRVLRRICTVEMFTNKRINETA 146

Query: 470  HVWVSELQTNIKELYTFISMDNNN-PSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDG 646
            H+     Q  I  +  +I  +  +      + ++R+    + N++  ++  R        
Sbjct: 147  HL----RQKCIDSMLQWIDKEAKSMKKGSGIEVARFIFLASFNMMGNLMLSR-------D 195

Query: 647  TINEEAQRLKKVFSQVMYL--WGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAIL 820
             ++ E+++  + F+ +  L  W    +   IFP    RWLD +G  +   R       + 
Sbjct: 196  LVDPESKKASEFFTAMEGLMEWSGQPNISDIFPC--LRWLDIQGLRQKAGRDMGKAIEVA 253

Query: 821  QDWVDARRKERRSNEDQK-FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFA 997
              +V  R KE +  E +K F++V+L        +    S    I   +L M    SET +
Sbjct: 254  STFVKERLKEHKEGEYKKDFLEVLLEFEGSGKDEPAKLSEHQ-INIFILEMFIAGSETSS 312

Query: 998  THLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGP 1177
            + + W LA LL +PE++ RV+ EI+  +G  R  E+SD+ NL Y+Q VVKETLR++P  P
Sbjct: 313  SSVEWALAELLCNPEAMTRVKAEINEVVGSNRKFEESDIDNLHYMQAVVKETLRLHPPAP 372

Query: 1178 YLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA-- 1351
             L P  A++D    GY I + TQ++VN W + RDP+ W DP  F PERF+ NL  +    
Sbjct: 373  LLVPRRAIQDTSFMGYDISEDTQVFVNAWAIGRDPECWEDPWAFKPERFL-NLSSKTTDF 431

Query: 1352 QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF---STVPNEPLDMMEDVGII 1522
            + + ++F+PFG GRR C G     +++ + +  L   F++   S V  + +DM E +G+ 
Sbjct: 432  KGQNFEFIPFGAGRRMCAGLPLGNRMSHLLLGSLLHAFDWELPSNVTPKSMDMKERMGMT 491

Query: 1523 LPKLTPLEVL 1552
            + KL PL+V+
Sbjct: 492  VRKLQPLQVV 501



>sp|Q9LTM0|C72N_ARATH Cytochrome P450 71B23 (EC
            1.14.-.-).>gb:AB024038_1515899 Arabidopsis thaliana
            genomic DNA, chromosome 3, P1 clone:
            MTC11.>gb:BT015161_1642131 Arabidopsis thaliana At3g26210
            gene, complete cds.
          Length = 501

 Score =  211 bits (538), Expect = 3e-53
 Identities = 145/511 (28%), Positives = 253/511 (49%), Gaps = 9/511 (1%)
 Frame = +2

Query: 59   ILGIAALVLLWFSWRKQSKRLP-PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVF 235
            +L +  LV + F+ + QS +L  P      PIIG+LH+    +P    L+ W   +GPV 
Sbjct: 9    LLLLLLLVTIIFTRKSQSSKLKLPPGPPKLPIIGNLHYLN-GLPHKCLLNLWKI-HGPVM 66

Query: 236  TIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRV 415
             ++LG   ++V+SS +A  +   T+D    +RP T A K + Y++    F+     WR +
Sbjct: 67   QLQLGYVPLVVISSNQAAEEVLKTHDLDCCSRPETIASKTISYNFKDIGFAPYGEEWRAL 126

Query: 416  RKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLN 595
            RKL V E+ S ++    +++   E    +K+L    + +  +P    VN+ +    L+ +
Sbjct: 127  RKLAVIELFSLKKFNSFRYIREEENDLLVKKLSE--ASEKQSP----VNLKKALFTLSAS 180

Query: 596  LIMQIVAGRRY---EYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDY 766
            ++ ++  G+     E+  + ++ + A R +K+  Q  + +  F  G  I           
Sbjct: 181  IVCRLAFGQNLHESEFIDEDSMEDLASRSEKI--QAKFAFSNFFPGGWILD-------KI 231

Query: 767  EGHVKTMKRAAKDVDAILQDWVDARRKE-RRSNEDQKFIDVMLSMIDDQFTQGYSYSRDT 943
             G  K++     D+D      +D   K  R+  E    +DVM+ M++ Q   G       
Sbjct: 232  TGQSKSLNEIFADLDGFFNQVLDDHLKPGRKVLETPDVVDVMIDMMNKQSQDGSFKLTTD 291

Query: 944  VIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER-WAEDSDVKN 1120
             IK I+  +      T AT + W +  L+++P  +K+VQDE+ T +G++R    + D+  
Sbjct: 292  HIKGIISDIFLAGVNTSATTILWAMTELIRNPRVMKKVQDEVRTVLGEKRDRITEQDLNQ 351

Query: 1121 LPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDP 1300
            L Y + V+KET R++P  P L P EA+    + GY IP+ TQ+ VNV+ + RDP +W +P
Sbjct: 352  LNYFKLVIKETFRLHPAAPLLLPREAMAKIKIQGYDIPEKTQIMVNVYAIGRDPDLWENP 411

Query: 1301 EKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTV 1480
            E+F PERF+ +       N  ++ +PFG GRR CPG        ++ +  L   F++   
Sbjct: 412  EEFKPERFVDSSVDYRGLN--FELLPFGSGRRICPGMTMGIATVELGLLNLLYFFDWGLP 469

Query: 1481 PN---EPLDMMEDVGIILPKLTPLEVLVTPR 1564
                 + +D+ E+  II+ K   LE++ T R
Sbjct: 470  EGRTVKDIDLEEEGAIIIGKKVSLELVPTRR 500



>gb:AF321863_1786043 Lolium rigidum clone Lol-3-k putative cytochrome
            P450 mRNA, complete cds.
          Length = 506

 Score =  211 bits (537), Expect = 4e-53
 Identities = 152/516 (29%), Positives = 261/516 (50%), Gaps = 10/516 (1%)
 Frame = +2

Query: 56   SILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVF 235
            SIL IA + LL     K  +RLPP      P+IG  H    ++P  + + + A  +GP+ 
Sbjct: 15   SILAIAVVQLL-----KARQRLPPGPLNL-PVIGSAHRLVNALPH-RAMRDLAGVHGPLM 67

Query: 236  TIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF-STNNSYWRR 412
             +R+G   ++VV+S E  R+   T+D + A RP   AG  + Y      F ST   Y+R+
Sbjct: 68   YLRVGQVPLVVVTSKEVAREVLKTHDAIFATRPKLMAGDIVAYGSTDLLFCSTPGDYFRK 127

Query: 413  VRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTL 592
            +R+L V+EILS+ R+   + +   E+++ ++++          PSAP V++SR    LT 
Sbjct: 128  LRRLCVQEILSNDRIRSYQDIREDEVRSLVEDIRAA------GPSAP-VDLSRKIYKLTN 180

Query: 593  NLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEG 772
             ++ +   G +     D         +K  F   +Y  G  ++   +FP +        G
Sbjct: 181  GIVSRAAFGMKSSKAEDFVA-----AIKHSF---VYSTGFSIAD--LFPGFTGILSFLTG 230

Query: 773  HVKTMKRAAKDVDAILQDWVDARR---KERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDT 943
              +T++     +D IL++ ++ R    K  RS   +K +  +L  +      G+  +R T
Sbjct: 231  QRRTLEGVRDTIDGILEEIINEREQILKSGRSTASEKNLVEVLLGLQGNEDFGFPITRST 290

Query: 944  VIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKN- 1120
            V KA++L +    +ET  T + W ++ L+ +P+ + ++Q EI    G + +  ++D++  
Sbjct: 291  V-KAVILDIFAGGTETSGTSMEWAMSELMANPKVMGKLQGEIRAAFGDKEFISEADLRAS 349

Query: 1121 ---LPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIW 1291
               + YL  V+KET R++P  P L P E+ E C ++GY IP  T++ +N W + RDP+ W
Sbjct: 350  GGVMKYLGLVIKETFRLHPPAPILVPRESTEACEINGYVIPAKTRVVINSWAIMRDPRYW 409

Query: 1292 PDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF 1471
             D E+F PERF          N  +++ PFG GRR CPG  Y     ++ + +L   F++
Sbjct: 410  EDAEEFRPERFEGGRMDFLGGN--FEYTPFGSGRRMCPGYNYGMASMELTLVQLLHSFDW 467

Query: 1472 STVPN--EPLDMMEDVGIILPKLTPLEVLVTPRLSP 1573
            S +P+  + LDM E V + L + T L +   P  +P
Sbjct: 468  S-LPDGVDQLDMTEIVSLSLTRKTHLMLRAAPHRAP 502


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,901,108,540
Number of Sequences: 1806583
Number of extensions: 43418585
Number of successful extensions: 127597
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 111414
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 120816
length of database: 581,917,975
effective HSP length: 130
effective length of database: 347,062,185
effective search space used: 149236739550
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)