BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig1738
         (1065 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:ATAC009400_1542971 Arabidopsis thaliana chromosome III BAC F1...   177   2e-43   
gb:AY084696_1569783 Arabidopsis thaliana clone 11537 mRNA, compl...   174   3e-42   
sp|P30188|CALL_ARATH|CALL_ARATH Calmodulin-like protein.>pir|D84841|D84841 ...   174   3e-42   Arabidopsis thaliana [mouse-ear cress]
pir|S29595|S29595 calmodulin-related protein (clone PM129) - Ara...   170   5e-41   Arabidopsis thaliana [mouse-ear cress]
pir|F86379|F86379 protein F21J9.28 [imported] - Arabidopsis thal...   109   1e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AY088814_1573824 Arabidopsis thaliana clone 95959 mRNA, compl...   107   3e-22   
pir|D96689|D96689 calmodulin-related protein, 72976-72503 [impor...   107   4e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AC120985_1739980 Oryza sativa (japonica cultivar-group) chrom...   107   5e-22   
gb:AP003735_1832624 Oryza sativa (japonica cultivar-group) genom...   106   7e-22   
gb:SRO309072_1722429 Sesbania rostrata mRNA for calcium binding ...   102   1e-20   
pir|T49012|T49012 calmodulin-like protein - Arabidopsis thaliana...   102   1e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AC002335_1530396 Arabidopsis thaliana chromosome 2 clone T1O2...   102   2e-20   
pir|A86317|A86317 protein T10O22.19 [imported] - Arabidopsis tha...   102   2e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AC136222_1743097 Oryza sativa (japonica cultivar-group) chrom...   101   3e-20   
gb:ATAC009853_1543056 Arabidopsis thaliana chromosome III BAC F2...   101   3e-20   
gb:OSJN00061_1694128 Oryza sativa genomic DNA, chromosome 4, BAC...   100   5e-20   
gb:AP003214_1825346 Oryza sativa (japonica cultivar-group) genom...   100   6e-20   
gb:LJA251808_1684970 Lotus japonicus mRNA for calcium-binding pr...   100   8e-20   
pir|D84864|D84864 probable calcium binding protein [imported] - ...    99   1e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AF078680_1766262 Olea europaea calcium-binding protein (PCA23...    99   1e-19   
gb:AY484589_1608334 Musa acuminata clone MuH9, genomic sequence.       99   1e-19   
sp|Q9M7R0|ALL8_OLEEU|ALL8_OLEEU Calcium-binding allergen Ole e 8 (PCA18/PCA...    98   3e-19   Olea europaea
gb:MSA295608_1687026 Medicago sativa mRNA for putative calmoduli...    97   4e-19   
gb:LPU57550_1389019 Loligo pealei calmodulin-like myosin-light c...    97   4e-19   
sp|P14533|CABO_LOLPE|CABO_LOLPE Squidulin (Optic LOBE calcium-binding prote...    97   4e-19   Doryteuthis pealeii [longfin inshore squid]
gb:AB050849_1521040 Nicotiana tabacum mRNA for calmodulin NtCaM1...    97   5e-19   
sp|O64943|POC2_JUNOX|POC2_JUNOX Polcalcin Jun o 2 (Calcium-binding pollen a...    96   9e-19   Juniperus oxycedrus [prickly juniper]
sp|P62184|CALM_RENRE|CALM_RENRE Calmodulin (CaM).>pir|A90223|MCXAM calmodul...    96   9e-19   Renilla reniformis
gb:AB060552_1521820 Oryza sativa (japonica cultivar-group) OsCAM...    95   2e-18   
pir|A03023|MCSW calmodulin - scallop (Patinopecten sp.) (tentati...    95   2e-18   
pir|A90036|MCJZR calmodulin - sea pansy (Renilla reniformis) (te...    95   2e-18   
sp|P02595|CALM_PATSP|CALM_PATSP Calmodulin (CaM).                                 95   2e-18   Patinopecten sp.
gb:CR382131_1664883 Yarrowia lipolytica chromosome E of strain C...    95   3e-18   
pir|T08585|T08585 calmodulin - soybean>gb:SOYSCAM4X_1716101 Soyb...    95   3e-18   Glycine max [soybeans]
gb:AY088760_1573773 Arabidopsis thaliana clone 94584 mRNA, compl...    94   5e-18   
sp|Q12798|CET1_HUMAN|CET1_HUMAN Centrin 1 (Caltractin isoform 2).>pir|I3842...    94   5e-18   Homo sapiens [man]
pir|S28956|MCTE calmodulin - Tetrahymena pyriformis>pir|S28954|S...    94   6e-18   
sp|P02598|CALM_TETPY|CALM_TETPY Calmodulin (CaM).                                 94   6e-18   Tetrahymena pyriformis
gb:AF510075_1807163 Ceratopteris richardii calmodulin 1 mRNA, co...    93   8e-18   
gb:PPCAMPROT_1701294 Physcomitrella patens mRNA for calmodulin.        93   8e-18   
pir|A84532|A84532 probable calmodulin-like protein [imported] - ...    93   8e-18   Arabidopsis thaliana [mouse-ear cress]
pir|T06437|T06437 calmodulin - garden pea>gb:PSU13736_1702465 Pi...    93   8e-18   Pisum sativum [garden pea]
pir|JC1309|JC1309 calmodulin - Stylonychia lemnae>gb:SLECALMODU_...    93   8e-18   Stylonychia lemnae
sp|P27166|CALM_STYLE|CALM_STYLE Calmodulin (CaM).                                 93   8e-18   Stylonychia lemnae
sp|P05933|CALM_SCHPO|CALM_SCHPO Calmodulin (CaM).>pir|A26614|MCZP calmoduli...    93   8e-18   Schizosaccharomyces pombe
sp|P11121|CALM_PYUSP|CALM_PYUSP Calmodulin (CaM).>pir|JK0015|MCAZS calmodul...    93   8e-18   Pyuridae gen. sp.
gb:AB178711_2140839 Synthetic construct YC2.60 gene for yellow c...    93   1e-17   
gb:BC008437_1971379 Homo sapiens calmodulin 2 (phosphorylase kin...    93   1e-17   
gb:AF089808_1767313 Pyricularia grisea calmodulin gene, complete...    93   1e-17   
pir|T06644|T06644 calmodulin homolog T20K18.210 - Arabidopsis th...    93   1e-17   Arabidopsis thaliana [mouse-ear cress]
pir|B45594|MCZQF calmodulin - malaria parasite (Plasmodium falci...    93   1e-17   
pir|A32005|MCKM calmodulin - Chlamydomonas reinhardtii>gb:CRECAM...    93   1e-17   
pir|A03022|MCEE calmodulin - electric eel>gb:ELCCALMA_2571685 E....    93   1e-17   
sp|P25070|TCH2_ARATH|TCH2_ARATH Calmodulin-related protein 2, touch-induced...    93   1e-17   Arabidopsis thaliana [mouse-ear cress]
sp|P62203|CALM_PLAF7|CALM_PLAF7 Calmodulin (CaM).>sp|P24044|CALM_PLAFA Calm...    93   1e-17   Plasmodium falciparum
sp|Q9UWF0|CALM_MAGGR|CALM_MAGGR Calmodulin (CaM).                                 93   1e-17   Magnaporthe grisea
sp|P02594|CALM_ELEEL|CALM_ELEEL Calmodulin (CaM).                                 93   1e-17   Electrophorus electricus [electric knifefish]
sp|P04352|CALM_CHLRE|CALM_CHLRE Calmodulin (CaM).                                 93   1e-17   Chlamydomonas reinhardtii
gb:BT007488_2150420 Synthetic construct Homo sapiens calmodulin ...    92   1e-17   
gb:AX441273_1468394 Sequence 4 from Patent EP1209167.>gb:RNO5507...    92   1e-17   
gb:AY341376_1321182 Pinctada fucata calmodulin mRNA, complete cds.     92   1e-17   
gb:AB063181_1197051 Metridium senile CaM mRNA for calmodulin, co...    92   1e-17   
gb:CR859751_1183854 Pongo pygmaeus mRNA; cDNA DKFZp469L1534 (fro...    92   1e-17   
gb:AK013695_1157606 Mus musculus adult male hippocampus cDNA, RI...    92   1e-17   
pir|A03029|MCDO calmodulin - slime mold (Dictyostelium discoideu...    92   1e-17   
pir|A03026|MCCHM calmodulin, striated muscle - chicken>gb:CHKCM1...    92   1e-17   
pir|I51202|I51202 calmodulin - duck>pir|A92394|MCCH calmodulin -...    92   1e-17   Anas platyrhynchos [duck]
sp|P02597|CALS_CHICK|CALS_CHICK Calmodulin, striated muscle.                      92   1e-17   Gallus gallus [bantam]
sp|Q95NR9|CALM_METSE|CALM_METSE Calmodulin (CaM).                                 92   1e-17   Metridium senile [frilled sea anemone]
sp|P62144|CALM_ANAPL|CALM_ANAPL Calmodulin (CaM).>sp|P62157|CALM_BOVIN Calm...    92   1e-17   Anas platyrhynchos [duck]
gb:AF084411_2141371 Synthetic construct calmodulin mutant SYNCAM...    92   2e-17   
gb:AY656690_1620260 Daucus carota caomodulin cam-207 mRNA, compl...    92   2e-17   
gb:AB041711_1519702 Chara corallina cccam1 mRNA for calmodulin, ...    92   2e-17   
gb:TVU38786_1401278 Trichomonas vaginalis calmodulin (CAM) and E...    92   2e-17   
gb:SDO18166_1397395 Suberites domuncula mRNA for calmodulin.           92   2e-17   
gb:DDICALA_1377025 Dictyostelium discoideum calmodulin (calA) ge...    92   2e-17   
gb:AB063182_1197052 Halichondria okadai CaM mRNA for calmodulin,...    92   2e-17   
gb:AB022702_1194077 Physarum polycephalum CaM mRNA for calmoduli...    92   2e-17   
gb:AK010118_1155547 Mus musculus adult male tongue cDNA, RIKEN f...    92   2e-17   
pir|S58311|S58311 calmodulin - Bidens pilosa>gb:BPCALMGEN_163398...    92   2e-17   Bidens pilosa [beggar-ticks]
pir|S10995|MCUTC calmodulin - Trypanosoma cruzi>gb:TCCALB2_13996...    92   2e-17   
sp|P04464|CALM_WHEAT|CALM_WHEAT Calmodulin (CaM).                                 92   2e-17   Triticum aestivum [Canadian hard winter wheat]
sp|P18061|CALM_TRYCR|CALM_TRYCR Calmodulin (CaM).                                 92   2e-17   Trypanosoma cruzi
sp|O97341|CALM_SUBDO|CALM_SUBDO Calmodulin (CaM).                                 92   2e-17   Suberites domuncula
sp|O96102|CALM_PHYPO|CALM_PHYPO Calmodulin (CaM).                                 92   2e-17   Physarum polycephalum
sp|P02599|CALM_DICDI|CALM_DICDI Calmodulin (CaM).                                 92   2e-17   Dictyostelium discoideum
gb:AF084453_2141412 Synthetic construct calmodulin mutant SYNCAM...    92   2e-17   
gb:AB178714_2140842 Synthetic construct YC3.60pm gene for yellow...    92   2e-17   
gb:AB178712_2140840 Synthetic construct YC3.60 gene for yellow c...    92   2e-17   
gb:AF150059_1772546 Brassica napus calmodulin (CaM1) mRNA, compl...    92   2e-17   
gb:SCO318521_1708917 Solanum commersonii mRNA for putative calmo...    92   2e-17   
gb:PETCALPRO_1699839 Petunia hybrida CAM53 mRNA, complete cds.         92   2e-17   
gb:HAU79736_1681549 Helianthus annuus calmodulin (HaCaM) mRNA, c...    92   2e-17   
gb:CACAM1_1644848 C.annuum mRNA for calmodulin-1.                      92   2e-17   
gb:AY656688_1620258 Daucus carota calmodulin cam-205 mRNA, compl...    92   2e-17   
gb:AY656686_1620256 Daucus carota calmodulin cam-203 mRNA, compl...    92   2e-17   
gb:AY364011_1602813 Daucus carota calmodulin 4 mRNA, partial cds...    92   2e-17   
gb:AY116967_1579127 Arabidopsis thaliana AT3g22930/F5N5_10 mRNA,...    92   2e-17   
gb:AB076905_1197653 Ciona intestinalis Ci-CaM mRNA for calmoduli...    92   2e-17   
pir|G85041|G85041 probable calmodulin [imported] - Arabidopsis t...    92   2e-17   Arabidopsis thaliana [mouse-ear cress]
pir|A03025|MCWT calmodulin - wheat                                     92   2e-17   
pir|A03028|MCUTG calmodulin - Trypanosoma brucei gambiense>pir|A...    92   2e-17   
pir|S16138|MCPZDC calmodulin - carrot>pir|S22971|S22971 calmodul...    92   2e-17   
pir|A35603|MCPP calmodulin - Paramecium tetraurelia>gb:PARCAM_13...    92   2e-17   
pir|A30900|MCBH calmodulin - barley>pir|S24952|S24952 calmodulin...    92   2e-17   
pir|S53006|S53006 calmodulin - leaf mustard>pir|S22503|S22503 ca...    92   2e-17   Brassica juncea [brown mustard]
sp|P04465|CALM_TRYBB|CALM_TRYBB Calmodulin (CaM).                                 92   2e-17   Trypanosoma brucei brucei
sp|P21251|CALM_STIJA|CALM_STIJA Calmodulin (CaM).>pir|JK0011|MCSFCU calmodu...    92   2e-17   Apostichopus japonicus
sp|P07463|CALM_PARTE|CALM_PARTE Calmodulin (CaM).                                 92   2e-17   Paramecium tetraurelia
sp|P93171|CALM_HELAN|CALM_HELAN Calmodulin (CaM).                                 92   2e-17   Helianthus annuus
sp|P11118|CALM_EUGGR|CALM_EUGGR Calmodulin (CaM).>pir|S21212|MCEG calmoduli...    92   2e-17   Euglena gracilis
sp|O02367|CALM_CIOIN|CALM_CIOIN Calmodulin (CaM) (Ci-CaM).                        92   2e-17   Ciona intestinalis [sea vase]
sp|P27164|CAL3_PETHY|CAL3_PETHY Calmodulin-related protein.                       92   2e-17   Petunia x hybrida [garden petunia]
sp|P62163|CAL2_SOYBN|CAL2_SOYBN Calmodulin 2 (CaM-2).>sp|P62162|CALM_HORVU ...    92   2e-17   Glycine max [soybeans]
sp|P25069|CAL2_ARATH|CAL2_ARATH Calmodulin 2/3/5.                                 92   2e-17   Arabidopsis thaliana [mouse-ear cress]
sp|P62200|CAL1_DAUCA|CAL1_DAUCA Calmodulin 1/11/16 (CaM 1/11/16).>sp|P62199...    92   2e-17   Daucus carota [carrots]
gb:AF084424_2141383 Synthetic construct calmodulin mutant SYNCAM...    91   3e-17   
gb:AF084419_2141379 Synthetic construct calmodulin mutant SYNCAM...    91   3e-17   
gb:AP000815_1820615 Oryza sativa (japonica cultivar-group) genom...    91   3e-17   
gb:AF030033_1762454 Phaseolus vulgaris calmodulin (CaM) mRNA, Pv...    91   3e-17   
gb:AY656693_1620263 Daucus carota calmodulin cam-210 mRNA, compl...    91   3e-17   
gb:AB050837_1521028 Nicotiana tabacum mRNA for calmodulin NtCaM1...    91   3e-17   
gb:LRU291615_1389057 Lumbricus rubellus mRNA for calmodulin (cal...    91   3e-17   
gb:BLA133486_1355331 Branchiostoma lanceolatum mRNA for calmodul...    91   3e-17   
gb:AY542983_1334439 Bigelowiella natans calmodulin mRNA, complet...    91   3e-17   
gb:AB081567_1198121 Strongylocentrotus intermedius exCaM mRNA fo...    91   3e-17   
gb:AB018797_1193809 Halocynthia roretzi gene for calmodulin B, c...    91   3e-17   
gb:AY232217_1177510 Drosophila yakuba clone yak-ad_Cam mRNA sequ...    91   3e-17   
pir|E96689|E96689 calmodulin [imported] - Arabidopsis thaliana>g...    91   3e-17   Arabidopsis thaliana [mouse-ear cress]
pir|C96763|C96763 protein calmodulin F25P22.4 [imported] - Arabi...    91   3e-17   Arabidopsis thaliana [mouse-ear cress]
pir|T31737|T31737 hypothetical protein T21H3.3 - Caenorhabditis ...    91   3e-17   Caenorhabditis elegans [roundworm]
pir|S01173|MCFF calmodulin [validated] - fruit fly (Drosophila m...    91   3e-17   
sp|Q8STF0|CALM_STRIE|CALM_STRIE Calmodulin (CaM).                                 91   3e-17   Strongylocentrotus intermedius
sp|P27161|CALM_LYCES|CALM_LYCES Calmodulin (CaM).                                 91   3e-17   Solanum lycopersicum
sp|Q9GRJ1|CALM_LUMRU|CALM_LUMRU Calmodulin (CaM).                                 91   3e-17   Lumbricus rubellus
sp|Q95NI4|CALM_HALOK|CALM_HALOK Calmodulin (CaM).                                 91   3e-17   Halichondria okadai
sp|O96081|CALB_HALRO|CALB_HALRO Calmodulin B (CaM B).                             91   3e-17   Halocynthia roretzi
sp|Q9UB37|CAL2_BRALA|CAL2_BRALA Calmodulin 2 (CaM 2).                             91   3e-17   Branchiostoma lanceolatum [common lancelet]
sp|P62147|CAL1_BRAFL|CAL1_BRAFL Calmodulin 1 (CaM 1).>sp|P62148|CAL1_BRALA ...    91   3e-17   Branchiostoma floridae
sp|P25854|CAL1_ARATH|CAL1_ARATH Calmodulin 1/4.                                   91   3e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AY281363_2524709 Epinephelus akaara calmodulin (CAL1) mRNA, c...    91   4e-17   
gb:AF081672_2472152 Gallus gallus calmodulin mRNA, complete cds.       91   4e-17   
gb:AF084394_2141354 Synthetic construct calmodulin mutant SYNCAM...    91   4e-17   
gb:AF264065_1781795 Blastocladiella emersonii calmodulin (CaM) g...    91   4e-17   
gb:AF064552_1765465 Apium graveolens calmodulin mRNA, complete cds.    91   4e-17   
gb:POU91642_1701176 Pleurotus ostreatus calmodulin mRNA, complet...    91   4e-17   
gb:FSCAMF1_1679267 F.sylvatica mRNA for CaMF-1 protein.                91   4e-17   
gb:CACAM2_1644849 C.annuum mRNA for calmodulin-2.                      91   4e-17   
pir|S58314|S58314 calmodulin - moss (Physcomitrella patens)            91   4e-17   Physcomitrella patens
pir|A38278|MCHUNB calmodulin-related protein NB-1 - human>gb:AL7...    91   4e-17   
sp|O94739|CLM_PLEOS|CLM_PLEOS Calmodulin (CaM).                                  91   4e-17   Pleurotus ostreatus [shimeji]
sp|P11120|CALM_PLECO|CALM_PLECO Calmodulin (CaM).>pir|JK0014|MCMRP calmodul...    91   4e-17   Pleurotus cornucopiae
sp|Q39752|CALM_FAGSY|CALM_FAGSY Calmodulin (CaM).                                 91   4e-17   Fagus sylvatica
sp|Q7T3T2|CALM_EPIAK|CALM_EPIAK Calmodulin (CaM).                                 91   4e-17   Epinephelus akaara
sp|Q9HFY6|CALM_BLAEM|CALM_BLAEM Calmodulin (CaM).                                 91   4e-17   Blastocladiella emersonii
sp|P27482|CALL_HUMAN|CALL_HUMAN Calmodulin-related protein NB-1 (Calmodulin...    91   4e-17   Homo sapiens [man]
gb:AF187305_2479191 Myxine glutinosa calmodulin (CaM) mRNA, comp...    91   5e-17   
gb:AF084420_2141380 Synthetic construct calmodulin mutant SYNCAM...    91   5e-17   
gb:AF084414_2141374 Synthetic construct calmodulin mutant SYNCAM...    91   5e-17   
gb:AF084413_2141373 Synthetic construct calmodulin mutant SYNCAM...    91   5e-17   
gb:AB178713_2140841 Synthetic construct YC4.60 gene for yellow c...    91   5e-17   
gb:BC086350_2109541 Rattus norvegicus calmodulin-like 3 (predict...    91   5e-17   
gb:BC005457_2089889 Mus musculus calmodulin-like 3, mRNA (cDNA c...    91   5e-17   
gb:AC129718_1740644 Oryza sativa (japonica cultivar-group) chrom...    91   5e-17   
gb:MSCALMODU_1687070 Mougeotia scalaris mRNA for calmodulin.           91   5e-17   
gb:BYNCALMOD_1644692 Bryonia dioica calmodulin (Bc329) mRNA, com...    91   5e-17   
gb:AY830128_1629335 Hevea brasiliensis calmodulin (CaM) mRNA, co...    91   5e-17   
gb:AY656689_1620259 Daucus carota calmodulin cam-206 mRNA, compl...    91   5e-17   
gb:AB050845_1521036 Nicotiana tabacum mRNA for calmodulin NtCaM9...    91   5e-17   
gb:DDICAL_1377024 D.discoideum calmodulin mRNA, partial cds.           91   5e-17   
gb:AY269783_1315013 Branchiostoma belcheri tsingtaunese calmodul...    91   5e-17   
pir|S22860|S22860 calmodulin 2 (clone lambda DASH) - rice>gb:OSC...    91   5e-17   Oryza sativa Indica Group [Indian rice]
pir|S60237|S60237 calmodulin PCM2/PCM4/PCM5/PCM6/PCM7/PCM8 - pot...    91   5e-17   Solanum commersonii
pir|A91104|MCRB calmodulin - rabbit (tentative sequence)               91   5e-17   
sp|Q9U6D3|CALM_MYXGL|CALM_MYXGL Calmodulin (CaM).                                 91   5e-17   Myxine glutinosa [common hagfish]
sp|O82018|CALM_MOUSC|CALM_MOUSC Calmodulin (CaM).                                 91   5e-17   Mougeotia scalaris
sp|P93087|CALM_CAPAN|CALM_CAPAN Calmodulin (CaM).                                 91   5e-17   Capsicum annuum
gb:AY513748_2535813 Oreochromis mossambicus calmodulin mRNA, com...    90   7e-17   
gb:AB110086_2465478 Trachemys scripta elegans TPCS mRNA for trop...    90   7e-17   
gb:AB055386_2462717 Clemmys japonica CaM-C III mRNA for calmodul...    90   7e-17   
gb:SYNCAM_2153134 Synthetic construct VU1 calmodulin gene, compl...    90   7e-17   
gb:AF084438_2141397 Synthetic construct calmodulin mutant SYNCAM...    90   7e-17   
gb:AF084436_2141395 Synthetic construct calmodulin mutant SYNCAM...    90   7e-17   
gb:AF084431_2141390 Synthetic construct calmodulin mutant SYNCAM...    90   7e-17   
gb:AF084425_2141384 Synthetic construct calmodulin mutant SYNCAM...    90   7e-17   
gb:AF084421_2141381 Synthetic construct calmodulin mutant SYNCAM...    90   7e-17   
gb:AF084412_2141372 Synthetic construct calmodulin mutant SYNCAM...    90   7e-17   
gb:AF084395_2141355 Synthetic construct calmodulin mutant SYNCAM...    90   7e-17   
gb:AF084393_2141353 Synthetic construct calmodulin mutant SYNCAM...    90   7e-17   
gb:AF084391_2141351 Synthetic construct calmodulin mutant SYNCAM...    90   7e-17   
gb:AY650306_1958253 Macaca fascicularis calmodulin 1 mRNA, parti...    90   7e-17   
gb:AP003260_1826564 Oryza sativa (japonica cultivar-group) genom...    90   7e-17   
gb:TAU48691_1724724 Triticum aestivum calmodulin TaCaM2-2 mRNA, ...    90   7e-17   
gb:OSCALM_1692811 O.sativa mRNA for calmodulin.>gb:ZMCALMODU_173...    90   7e-17   
gb:TGCM_1400127 T.gondii mRNA for calmodulin.                          90   7e-17   
pir|S35187|S35187 calmodulin 6 - Arabidopsis thaliana>gb:ATCMACA...    90   7e-17   Arabidopsis thaliana [mouse-ear cress]
pir|S58709|S58709 calmodulin - Neurospora crassa>gb:CTU15993_167...    90   7e-17   Neurospora crassa
pir|I49567|I49567 calmodulin - mouse>gb:MUSCALMDB_2125369 Mouse ...    90   7e-17   Mus musculus [mouse]
pir|T02887|T02887 probable calmodulin - rice>gb:OSU37936_1698442...    90   7e-17   Oryza sativa Indica Group [Indian rice]
pir|S10533|MCAA calmodulin - alfalfa>gb:MSCAL1_1687069 Alfalfa c...    90   7e-17   
sp|P17928|CALM_MEDSA|CALM_MEDSA Calmodulin (CaM).                                 90   7e-17   Medicago sativa [alfalfa]
sp|P61861|CALM_COLGL|CALM_COLGL Calmodulin (CaM).>sp|P61860|CALM_COLTR Calm...    90   7e-17   Colletotrichum gloeosporioides
sp|Q03509|CAL6_ARATH|CAL6_ARATH Calmodulin 6.                                     90   7e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AF084452_2141411 Synthetic construct calmodulin mutant SYNCAM...    90   9e-17   
gb:AF084450_2141409 Synthetic construct calmodulin mutant SYNCAM...    90   9e-17   
gb:AF084434_2141393 Synthetic construct calmodulin mutant SYNCAM...    90   9e-17   
gb:AF084416_2141376 Synthetic construct calmodulin mutant SYNCAM...    90   9e-17   
gb:AF084401_2141361 Synthetic construct calmodulin mutant SYNCAM...    90   9e-17   
gb:AF334833_1787485 Castanea sativa calmodulin mRNA, complete cds.     90   9e-17   
gb:AF104986_1768275 Magnaporthe grisea calmodulin (MgCaM) gene, ...    90   9e-17   
gb:NEUCLMDLN_1690793 Neurospora crassa calmodulin mRNA, complete...    90   9e-17   
gb:AY572856_1615749 Arachis hypogaea calmodulin (CaM-3) gene, co...    90   9e-17   
gb:LTCAMA_1389228 L.tarentolae CAM A gene for calmodulin.              90   9e-17   
pir|JC1094|JC1094 calmodulin - rice                                    90   9e-17   Oryza sativa Japonica Group [Japonica rice]
pir|H86194|H86194 hypothetical protein [imported] - Arabidopsis ...    90   9e-17   Arabidopsis thaliana [mouse-ear cress]
pir|S35185|S35185 calmodulin 4 - Arabidopsis thaliana>gb:ATCMACA...    90   9e-17   Arabidopsis thaliana [mouse-ear cress]
pir|T16039|T16039 hypothetical protein F12A10.5 - Caenorhabditis...    90   9e-17   Caenorhabditis elegans [roundworm]
pir|S70767|S70767 calmodulin CAM72 - garden petunia>gb:PETRCAM72...    90   9e-17   Petunia x hybrida [garden petunia]
pir|A03024|MCSP calmodulin - spinach (tentative sequence)              90   9e-17   
pir|A32556|MCPO calmodulin - potato>gb:POTCAM_1701077 Solanum tu...    90   9e-17   
pir|A37123|MCAS calmodulin - Emericella nidulans>pir|JC4216|JC42...    90   9e-17   
sp|P04353|CALM_SPIOL|CALM_SPIOL Calmodulin (CaM).                                 90   9e-17   Spinacia oleracea
sp|P13868|CALM_SOLTU|CALM_SOLTU Calmodulin (CaM).                                 90   9e-17   Solanum tuberosum [potatoes]
sp|P60206|CALM_AJECA|CALM_AJECA Calmodulin (CaM).>sp|P60205|CALM_ASPOR Calm...    90   9e-17   Histoplasma capsulatum
sp|P27163|CAL2_PETHY|CAL2_PETHY Calmodulin 2 (CaM 2).                             90   9e-17   Petunia x hybrida [garden petunia]
gb:AF084451_2141410 Synthetic construct calmodulin mutant SYNCAM...    89   1e-16   
gb:AF084418_2141378 Synthetic construct calmodulin mutant SYNCAM...    89   1e-16   
gb:AF084415_2141375 Synthetic construct calmodulin mutant SYNCAM...    89   1e-16   
gb:AF084396_2141356 Synthetic construct calmodulin mutant SYNCAM...    89   1e-16   
gb:AF007889_1760942 Symbiodinium microadriaticum calmodulin (SMC...    89   1e-16   
gb:PHTCALPIA_1700175 P.infestans calmodulin (calA) gene, complet...    89   1e-16   
gb:MDCAMG_1685920 M.domestica CaM gene for calmodulin.                 89   1e-16   
pir|JU0232|JU0232 calmodulin - fungus (Fusarium oxysporum) (frag...    89   1e-16   Fusarium oxysporum
pir|S02691|S02691 calmodulin B - sea urchin (Arbacia punctulata)...    89   1e-16   Arbacia punctulata [punctuate sea urchin]
sp|P27165|CALM_PHYIN|CALM_PHYIN Calmodulin (CaM).                                 89   1e-16   Phytophthora infestans [potato late blight]
sp|P48976|CALM_MALDO|CALM_MALDO Calmodulin (CaM).                                 89   1e-16   Malus domestica [apple tree]
sp|P05932|CALB_ARBPU|CALB_ARBPU Calmodulin beta (Cam B) (Fragment).               89   1e-16   Arbacia punctulata [punctuate sea urchin]
gb:AF084446_2141405 Synthetic construct calmodulin mutant SYNCAM...    89   1e-16   
gb:AF084435_2141394 Synthetic construct calmodulin mutant SYNCAM...    89   1e-16   
gb:AF084417_2141377 Synthetic construct calmodulin mutant SYNCAM...    89   1e-16   
gb:AF084410_2141370 Synthetic construct calmodulin mutant SYNCAM...    89   1e-16   
gb:AF084409_2141369 Synthetic construct calmodulin mutant SYNCAM...    89   1e-16   
gb:AF084398_2141358 Synthetic construct calmodulin mutant SYNCAM...    89   1e-16   
gb:AF083238_2141344 Synthetic calmodulin mutant SYNCAM29.              89   1e-16   
gb:CR382136_1669070 Debaryomyces hansenii chromosome D of strain...    89   1e-16   
gb:AY657030_1620290 Salvia miltiorrhiza calmodulin mRNA, complet...    89   1e-16   
gb:AY656684_1620254 Daucus carota calmodulin cam-201 mRNA, compl...    89   1e-16   
gb:AY585925_1616332 Paxillus involutus strain ATCC 200175 calmod...    89   1e-16   
gb:AY517931_1610777 Arachis hypogaea calmodulin (CaM2) mRNA, com...    89   1e-16   
gb:TRBCMRSG_1400621 Trypanosoma brucei gambiense calmodulin gene...    89   1e-16   
gb:BFL133836_1355237 Branchiostoma floridae mRNA for calmodulin ...    89   1e-16   
pir|S53019|S53019 calmodulin - Macrocystis pyrifera>gb:MPCAM_168...    89   1e-16   Macrocystis pyrifera
pir|S51933|S51933 calmodulin cam2 - maize>gb:ZMCAM2_1731789 Z.ma...    89   1e-16   Zea mays [maize]
sp|P41041|CALM_PNECA|CALM_PNECA Calmodulin (CaM).>pir|JN0722|JN0722 calmodu...    89   1e-16   Pneumocystis carinii
sp|Q8X187|CALM_PAXIN|CALM_PAXIN Calmodulin (CaM).                                 89   1e-16   Paxillus involutus
sp|Q40302|CALM_MACPY|CALM_MACPY Calmodulin (CaM).                                 89   1e-16   Macrocystis pyrifera
sp|Q9XZP2|CAL2_BRAFL|CAL2_BRAFL Calmodulin 2 (CaM 2).                             89   1e-16   Branchiostoma floridae
gb:AF084449_2141408 Synthetic construct calmodulin mutant SYNCAM...    89   2e-16   
gb:AF084447_2141406 Synthetic construct calmodulin mutant SYNCAM...    89   2e-16   
gb:AF084442_2141401 Synthetic construct calmodulin mutant SYNCAM...    89   2e-16   
gb:AF084437_2141396 Synthetic construct calmodulin mutant SYNCAM...    89   2e-16   
gb:AF084426_2141385 Synthetic construct calmodulin mutant SYNCAM...    89   2e-16   
gb:AF084400_2141360 Synthetic construct calmodulin mutant SYNCAM...    89   2e-16   
gb:AF084392_2141352 Synthetic construct calmodulin mutant SYNCAM...    89   2e-16   
gb:AF083237_2141343 Synthetic calmodulin mutant SYNCAM28.              89   2e-16   
gb:AE017343_1755873 Cryptococcus neoformans var. neoformans JEC2...    89   2e-16   
gb:ATHCAM3COL_1553091 Arabidopsis thaliana calmodulin-3 mRNA, 3'...    89   2e-16   
pir|S02690|S02690 calmodulin A - sea urchin (Arbacia punctulata)...    89   2e-16   Arbacia punctulata [punctuate sea urchin]
sp|P62146|CALA_ARBPU|CALA_ARBPU Calmodulin alpha (CaM A) (Fragment).              89   2e-16   Arbacia punctulata [punctuate sea urchin]
gb:AF084439_2141398 Synthetic construct calmodulin mutant SYNCAM...    88   3e-16   
gb:AF084427_2141386 Synthetic construct calmodulin mutant SYNCAM...    88   3e-16   
gb:AF291057_1783689 Fusarium proliferatum NRRL 31071 calmodulin ...    88   3e-16   
gb:AC092558_1735508 Oryza sativa chromosome 3 BAC OSJNBb0036F07 ...    88   3e-16   
gb:AY835929_1630421 Codonopsis lanceolata calmodulin 2 (CAM2) mR...    88   3e-16   
gb:AY517933_1610779 Arachis hypogaea calmodulin (CaM1) gene, com...    88   3e-16   
gb:ATHCAM1_1553088 A.thaliana calmodulin-1 (cam1) mRNA, complete...    88   3e-16   
gb:ATCMACAM5_1548008 A.thaliana mRNA (clone ACaM5) for calmoduli...    88   3e-16   
gb:AB127360_1528333 Scytosiphon lomentaria Slcen mRNA for centri...    88   3e-16   
gb:TVA249457_1401215 Trichomonas vaginalis mRNA for centrin (ce1...    88   3e-16   
gb:TVA249456_1401214 Trichomonas vaginalis mRNA for partial cent...    88   3e-16   
pir|T50929|T50929 calmodulin-1 [imported] - Arabidopsis thaliana...    88   3e-16   
pir|T49071|T49071 probable calmodulin [similarity] - Arabidopsis...    88   3e-16   
pir|S51932|S51932 calmodulin cam1 - maize>gb:ZMCAM1_1731788 Z.ma...    88   3e-16   
sp|P62150|CALM_ORYLA|CALM_ORYLA Calmodulin A (CaM A) (Fragment).>gb:AB05538...    88   3e-16   
gb:BC054948_2551154 Xenopus laevis centrin, EF-hand protein, 2, ...    88   3e-16   
gb:AF084448_2141407 Synthetic construct calmodulin mutant SYNCAM...    88   3e-16   
gb:AF084445_2141404 Synthetic construct calmodulin mutant SYNCAM...    88   3e-16   
gb:AF084441_2141400 Synthetic construct calmodulin mutant SYNCAM...    88   3e-16   
gb:AF084429_2141388 Synthetic construct calmodulin mutant SYNCAM...    88   3e-16   
gb:AF084428_2141387 Synthetic construct calmodulin mutant SYNCAM...    88   3e-16   
gb:AF084405_2141365 Synthetic construct calmodulin mutant SYNCAM...    88   3e-16   
pir|T07122|T07122 calmodulin CAM5 - soybean>gb:SOYCAM5_1715976 G...    88   3e-16   
pir|A38383|A38383 troponin C, fast skeletal muscle - mouse>gb:BC...    88   3e-16   
pir|S58924|S40086 calmodulin calm1 - maize>gb:ZMRNCAL_1732016 Z....    88   3e-16   
sp|P20801|TPCS_MOUSE|TPCS_MOUSE Troponin C, skeletal muscle (STNC).               88   3e-16   
sp|P41040|CALM_MAIZE|CALM_MAIZE Calmodulin (CaM).                                 88   3e-16   
gb:AF084444_2141403 Synthetic construct calmodulin mutant SYNCAM...    87   4e-16   
gb:AF084430_2141389 Synthetic construct calmodulin mutant SYNCAM...    87   4e-16   
gb:AF084404_2141364 Synthetic construct calmodulin mutant SYNCAM...    87   4e-16   
gb:AF084399_2141359 Synthetic construct calmodulin mutant SYNCAM...    87   4e-16   
gb:AF031482_1762572 Zea mays calmodulin (Zmrcalm) mRNA, complete...    87   4e-16   
gb:AY443472_1606378 Penicillium rolfsii isolate NRRL 1078 calmod...    87   4e-16   
gb:AY070232_1566753 Vitis vinifera calmodulin mRNA, complete cds.      87   4e-16   
gb:CQ856085_1454382 Sequence 31 from Patent WO2004070035.>gb:AF0...    87   4e-16   
gb:GIU59300_1385328 Giardia intestinalis centrin and malic enzym...    87   4e-16   
pir|A28442|TPRBCS troponin C, fast skeletal muscle - rabbit>gb:O...    87   4e-16   
sp|P02586|TPCS_RABIT|TPCS_RABIT Troponin C, skeletal muscle.                      87   4e-16   
sp|P53440|CALF_NAEGR|CALF_NAEGR Calmodulin, flagellar (CAM-1).>gb:NGU04381_...    87   4e-16   
gb:AF084423_2141382 Synthetic construct calmodulin mutant SYNCAM...    87   6e-16   
gb:AF084402_2141362 Synthetic construct calmodulin mutant SYNCAM...    87   6e-16   
gb:HSCAM3X1_2011252 H.sapiens CaMIII gene, exon 1 (and joined CDS).    87   6e-16   
gb:OSA271913_1692428 Oryza sativa partial mRNA for putative calm...    87   6e-16   
gb:AY443490_1606396 Penicillium jensenii isolate NRRL 909 calmod...    87   6e-16   
pir|A29422|A29422 calmodulin-like protein - chicken (fragment)         87   6e-16   
pir|A03014|TPPGCS troponin C, skeletal muscle - pig                    87   6e-16   
sp|P02587|TPCS_PIG|TPCS_PIG Troponin C, skeletal muscle.                        87   6e-16   
sp|Q06827|CATR_SCHDU|CATR_SCHDU Caltractin (Centrin).>pir|S42551|S42551 cal...    87   6e-16   
sp|P05419|CALN_CHICK|CALN_CHICK Neo-calmodulin (NeoCaM) (Fragment).>gb:CHKC...    87   6e-16   
gb:AB110088_2465480 Alligator mississippiensis TPCS mRNA for tro...    87   7e-16   
gb:AF084432_2141391 Synthetic construct calmodulin mutant SYNCAM...    87   7e-16   
gb:AF084406_2141366 Synthetic construct calmodulin mutant SYNCAM...    87   7e-16   
gb:AY517930_1610776 Arachis hypogaea calmodulin (CaM1) mRNA, com...    87   7e-16   
gb:PFACALMOD_1393653 Plasmodium falciparum calmodulin gene, comp...    87   7e-16   
pir|JC1033|JC1033 calmodulin - garden pea                              87   7e-16   
sp|P23286|CALM_CANAL|CALM_CANAL Calmodulin (CaM).>gb:YSACMD1_1728084 Candid...    87   7e-16   
gb:BC041495_2547947 Xenopus laevis similar to troponin C2, fast,...    86   1e-15   
gb:AF084443_2141402 Synthetic construct calmodulin mutant SYNCAM...    86   1e-15   
gb:AF084403_2141363 Synthetic construct calmodulin mutant SYNCAM...    86   1e-15   
gb:AF084397_2141357 Synthetic construct calmodulin mutant SYNCAM...    86   1e-15   
gb:MPCENT_1686785 M.pusilla centrin gene.                              86   1e-15   
gb:CQ856087_1454383 Sequence 33 from Patent WO2004070035.>gb:AF0...    86   1e-15   
gb:CQ856073_1454376 Sequence 19 from Patent WO2004070035.              86   1e-15   
gb:CQ856069_1454374 Sequence 15 from Patent WO2004070035.              86   1e-15   
gb:CQ856067_1454373 Sequence 13 from Patent WO2004070035.              86   1e-15   
gb:CQ856061_1454370 Sequence 7 from Patent WO2004070035.               86   1e-15   
pir|JW0063|JW0063 fast skeletal troponin C beta - African clawed...    86   1e-15   
pir|A03016|TPFGCS troponin C, skeletal muscle - edible frog (ten...    86   1e-15   
pir|JU0276|MCCKA calmodulin - yeast (Candida albicans)                 86   1e-15   
sp|P02589|TPCS_RANES|TPCS_RANES Troponin C, skeletal muscle.                      86   1e-15   
gb:BC061286_2553063 Xenopus tropicalis hypothetical protein MGC7...    86   1e-15   
gb:AP004308_1840004 Oryza sativa (japonica cultivar-group) genom...    86   1e-15   
gb:BOL427337_1633830 Brassica oleracea mRNA for calmodulin 1 (ca...    86   1e-15   
gb:AY443473_1606379 Penicillium manginii isolate NRRL 2134 calmo...    86   1e-15   
gb:CQ856079_1454379 Sequence 25 from Patent WO2004070035.>gb:MVU...    86   1e-15   
gb:AY575058_1431538 Sus scrofa troponin C2 (TNNC2) mRNA, complet...    86   1e-15   
pir|A71409|A71409 calmodulin 8 [imported] - Arabidopsis thaliana...    86   1e-15   
pir|JW0062|JW0062 fast skeletal troponin C alpha - African clawe...    86   1e-15   
pir|A34450|MCUMAK calmodulin - Achlya klebsiana>gb:ACKCAL_174536...    86   1e-15   
sp|P43646|CATR_TETST|CATR_TETST Caltractin (Centrin) (Fragment).                  86   1e-15   
sp|P15094|CALM_ACHKL|CALM_ACHKL Calmodulin (CaM).                                 86   1e-15   
gb:XLU37538_2583352 Xenopus laevis centrin (Xcen) mRNA, complete...    86   2e-15   
gb:BC084063_2563469 Xenopus laevis cDNA clone MGC:79959 IMAGE:68...    86   2e-15   
gb:BT008003_2150935 Synthetic construct Homo sapiens troponin C2...    86   2e-15   
gb:AF084440_2141399 Synthetic construct calmodulin mutant SYNCAM...    86   2e-15   
gb:HSDJ447F3_2012119 Human DNA sequence from clone RP3-447F3 on ...    86   2e-15   
gb:AY586020_1616427 Paxillus involutus strain Maj calmodulin (ca...    86   2e-15   
gb:AB127359_1528332 Ochromonas danica Odcen mRNA for centrin, co...    86   2e-15   
pir|A36574|TPHUCS troponin C, fast skeletal muscle [validated] -...    86   2e-15   
sp|P02585|TPCS_HUMAN|TPCS_HUMAN Troponin C, skeletal muscle.                      86   2e-15   
sp|P43645|CATR_SPESI|CATR_SPESI Caltractin (Centrin) (Fragment).                  86   2e-15   
gb:AF084408_2141368 Synthetic construct calmodulin mutant SYNCAM...    85   2e-15   
gb:AF081670_2141335 Synthetic construct VU91C calmodulin gene, c...    85   2e-15   
gb:AY586017_1616424 Paxillus involutus strain ATCC 200175 calmod...    85   2e-15   
pir|T51473|T51473 calmodulin-like protein - Arabidopsis thaliana...    85   2e-15   
sp|P05434|CATR_CHLRE|CATR_CHLRE Caltractin (Centrin) (20 kDa calcium-bindin...    85   2e-15   
gb:AP005891_1859716 Oryza sativa (japonica cultivar-group) genom...    85   3e-15   
gb:AF466266_1802283 Sonneratia paracaseolaris calmodulin gene, c...    85   3e-15   
gb:BLCAML1_1355345 Branchiostoma lanceolatum partial CaM2 gene f...    85   3e-15   
gb:AF141944_1244332 Tetrahymena thermophila centrin mRNA, comple...    84   4e-15   
pir|A03015|TPCHCS troponin C, skeletal muscle - chicken                84   4e-15   
sp|P02588|TPCS_CHICK|TPCS_CHICK Troponin C, skeletal muscle.                      84   4e-15   
gb:AF084433_2141392 Synthetic construct calmodulin mutant SYNCAM...    84   5e-15   
gb:AP002854_1823161 Oryza sativa (japonica cultivar-group) genom...    84   5e-15   
pir|T10726|T10726 calmodulin - green alga (Dunaliella salina)>gb...    84   5e-15   
gb:BT008058_2150990 Synthetic construct Homo sapiens centrin, EF...    84   6e-15   
gb:AX888004_1483457 Sequence 3867 from Patent EP1033401.               84   6e-15   
gb:CQ856065_1454372 Sequence 11 from Patent WO2004070035.              84   6e-15   
sp|P41208|CET2_HUMAN|CET2_HUMAN Centrin 2 (Caltractin isoform 1).>pir|A4965...    84   6e-15   
sp|P41210|CATR_ATRNU|CATR_ATRNU Caltractin (Centrin).>gb:CQ856077_1454378 S...    84   6e-15   
gb:U40423_1403370 Caenorhabditis elegans cosmid C24H10, complete...    83   8e-15   
gb:AE014134_1127424 Drosophila melanogaster chromosome 2L, compl...    83   8e-15   
sp|Q9R1K9|CET2_MOUSE|CET2_MOUSE Centrin 2 (Caltractin isoform 1).>gb:AK0040...    83   8e-15   
gb:AB110087_2465479 Sceloporus undulatus TPCS mRNA for troponin ...    83   1e-14   
gb:HUMTRC_2037862 Human (clone PWTNC4) skeletal muscle troponin ...    83   1e-14   
sp|P10246|TPCS_MELGA|TPCS_MELGA Troponin C, skeletal muscle.>pir|A40803|A40...    83   1e-14   
gb:AC006921_1534765 Arabidopsis thaliana chromosome 2 clone F2H1...    82   1e-14   
gb:CQ856083_1454381 Sequence 29 from Patent WO2004070035.              82   1e-14   
gb:PFMAL1P2_1394327 Plasmodium falciparum DNA from MAL1P2.             82   1e-14   
pir|F84777|F84777 probable calmodulin [imported] - Arabidopsis t...    82   1e-14   
gb:CHKTNC_2569610 Chicken troponin C (TNC) mRNA, complete cds.         82   2e-14   
gb:AF081671_2141336 Synthetic construct VU91D calmodulin gene, c...    82   2e-14   
gb:AY656694_1620264 Daucus carota calmodulin cam-211 mRNA, compl...    82   2e-14   
gb:DMBR7A4_1378233 Drosophila melanogaster BAC clone BACR7A4.          82   2e-14   
gb:BLA131662_1355329 Branchiostoma lanceolatum mRNA for calmodul...    82   2e-14   
gb:AE014298_1123800 Drosophila melanogaster chromosome X, comple...    82   2e-14   
gb:AF081669_2141334 Synthetic construct VU91B calmodulin gene, c...    82   2e-14   
pir|T19229|T19229 hypothetical protein C13C12.1 - Caenorhabditis...    82   2e-14   
sp|P04630|CALL_CAEEL|CALL_CAEEL Calmodulin-like protein.>pir|A24921|A24921 ...    82   2e-14   
gb:AP003735_1832620 Oryza sativa (japonica cultivar-group) genom...    81   3e-14   
gb:PCCENT_1699187 P.cristatum centrin gene.                            81   3e-14   
gb:AK010541_1155835 Mus musculus ES cells cDNA, RIKEN full-lengt...    81   3e-14   
gb:AK006940_1153775 Mus musculus adult male testis cDNA, RIKEN f...    81   3e-14   
gb:AE016959_1022354 Oryza sativa (japonica cultivar-group) chrom...    81   3e-14   
gb:BFL133837_1355238 Branchiostoma floridae mRNA for calmodulin-...    81   4e-14   
gb:FSCAMFPRO_1679268 F.sylvatica mRNA for CaMF protein.                80   5e-14   
gb:AY261858_1177651 Ciona intestinalis calmodulin-like mRNA, com...    80   9e-14   
gb:AY064400_587544 Nostoc punctiforme calmodulin (caM) gene, com...    80   9e-14   
sp|P54213|CATR_DUNSA|CATR_DUNSA Caltractin (Centrin).>pir|T10724|T10724 pro...    80   9e-14   
gb:AF180890_2478853 Danio rerio fast skeletal muscle troponin C ...    79   1e-13   
gb:ACA582714_1745309 Aspergillus carbonarius partial cdl gene fo...    79   1e-13   
gb:AF362367_2064162 Mus musculus centrin 4 mRNA, complete cds.>g...    79   2e-13   
gb:BT001346_1356119 Drosophila melanogaster AT23738 full insert ...    79   2e-13   
gb:AF081668_2141333 Synthetic construct VU91A calmodulin gene, c...    78   3e-13   
gb:AY293058_2081644 Mus musculus skin calmodulin-related factor ...    78   3e-13   
gb:AB036744_2044992 Mus musculus DD112 gene, complete cds.             78   3e-13   
gb:AY275526_1594370 Pyrus communis calmodulin mRNA, partial cds.       78   3e-13   
gb:AE013599_1130545 Drosophila melanogaster chromosome 2R, compl...    78   3e-13   
sp|Q9JM83|CLM4_MOUSE|CLM4_MOUSE Calmodulin 4 (Calcium-binding protein Dd112...    78   3e-13   
gb:BC076164_2559038 Danio rerio zgc:92680, mRNA (cDNA clone MGC:...    77   5e-13   
gb:ATHACRP_1552968 Arabidopsis thaliana calmodulin-related prote...    77   5e-13   
gb:AX399961_1467274 Sequence 132 from Patent WO0218424.>gb:AL732...    77   5e-13   
gb:BFL249588_1355250 Branchiostoma floridae mRNA for calmodulin-...    77   5e-13   
pir|JW0065|JW0065 fast skeletal troponin C - Entosphenus japonic...    77   5e-13   
sp|P25071|TCH3_ARATH|TCH3_ARATH Calmodulin-related protein 3, touch-induced...    77   5e-13   
sp|Q9NZT1|CAL5_HUMAN|CAL5_HUMAN Calmodulin-like protein 5 (Calmodulin-like ...    77   5e-13   
gb:TRU426040_2580961 Takifugu rubripes vader gene, cetn gene, fg...    77   6e-13   
gb:BC039172_1982496 Homo sapiens calmodulin-like 5, mRNA (cDNA c...    77   6e-13   
gb:ATAC009895_1543082 Arabidopsis thaliana chromosome III BAC T2...    77   6e-13   
pir|T24672|T24672 hypothetical protein T07G12.1 - Caenorhabditis...    77   6e-13   
gb:AF169154_1887491 Homo sapiens CaBP2 (CABP2) mRNA, complete cd...    77   8e-13   
gb:AY086972_1572010 Arabidopsis thaliana clone 3005 mRNA, comple...    77   8e-13   
gb:U40427_1403385 Caenorhabditis elegans cosmid F43C9, complete ...    77   8e-13   
sp|Q9NPB3|CAB2_HUMAN|CAB2_HUMAN Calcium-binding protein CaBP2.                    77   8e-13   
gb:AP003022_1824304 Oryza sativa (japonica cultivar-group) genom...    76   1e-12   
gb:GFU560771_1679941 Fusarium proliferatum partial cld gene for ...    76   1e-12   
gb:AK003648_1151988 Mus musculus 18-day embryo whole body cDNA, ...    76   1e-12   
pir|A03032|MCUR2A Spec 2a protein - sea urchin (Strongylocentrot...    76   1e-12   
sp|P81660|TPCS_ANGAN|TPCS_ANGAN Troponin C, skeletal muscle (TNC).                76   1e-12   
gb:AB016888_1513162 Arabidopsis thaliana genomic DNA, chromosome...    75   2e-12   
gb:BC006182_1970087 Homo sapiens calmodulin 3 (phosphorylase kin...    75   2e-12   
gb:AP005319_1850533 Oryza sativa (japonica cultivar-group) genom...    75   2e-12   
gb:AP004368_1840911 Oryza sativa (japonica cultivar-group) genom...    75   2e-12   
gb:AF518003_1807691 Solanum tuberosum calcium-dependent protein ...    75   2e-12   
gb:LEY14764_1684811 Lycopersicon esculentum mRNA for calmodulin ...    75   2e-12   
gb:LES308296_1684562 Lycopersicon esculentum mRNA for calcium-de...    75   2e-12   
gb:AY144497_1583548 Oryza sativa (japonica cultivar-group) OsCDP...    75   2e-12   
gb:AY088908_1573916 Arabidopsis thaliana clone 99348 mRNA, compl...    75   2e-12   
gb:AY664415_1620625 Zea mays cultivar B73 locus 9009, complete s...    75   3e-12   
gb:AY089597_1297253 Drosophila melanogaster RE19335 full insert ...    75   3e-12   
pir|G96794|G96794 probable calmodulin, 4214-3681 [imported] - Ar...    75   3e-12   
pir|T01989|T01989 calcium-dependent protein kinase (EC 2.7.1.-) ...    75   3e-12   
gb:CQ856081_1454380 Sequence 27 from Patent WO2004070035.              74   4e-12   
gb:AJ699161_1813475 Nicotiana plumbaginifolia mRNA for calcium-d...    74   5e-12   
gb:AF329729_1786996 Nicotiana tabacum regulator of gene silencin...    74   5e-12   
sp|P49258|CALL_DROME|CALL_DROME Calmodulin related protein 97A (Androcam pr...    74   5e-12   
gb:AF169157_2057616 Mus musculus L-CaBP2 (Cabp2) mRNA, complete ...    74   7e-12   
gb:AK117892_1815900 Arabidopsis thaliana At2g31500 mRNA for puta...    74   7e-12   
pir|E84721|E84721 probable calcium-dependent protein kinase [imp...    74   7e-12   
pir|S54788|S54788 calcium-stimulated protein kinase - Chlamydomo...    74   7e-12   
sp|Q9JLK4|CAB2_MOUSE|CAB2_MOUSE Calcium-binding protein CaBP2.                    74   7e-12   
gb:AF363784_1791547 Lycopersicon esculentum calcium-dependent pr...    73   9e-12   
gb:AF216527_1778089 Dunaliella tertiolecta calcium-dependent pro...    73   9e-12   
gb:AF035944_1762929 Fragaria x ananassa calcium-dependent protei...    73   9e-12   
gb:ATAC018363_1543666 Arabidopsis thaliana chromosome III BAC F1...    73   9e-12   
gb:DMCAMR97A_1378505 D.melanogaster DmCamr 97A mRNA for calmodul...    73   9e-12   
gb:CEC18E9_1360585 Caenorhabditis elegans cosmid C18E9, complete...    73   9e-12   
gb:BFL249589_1355251 Branchiostoma floridae partial mRNA for cal...    73   9e-12   
sp|P15159|TPC_TACTR|TPC_TACTR Troponin C.>pir|JX0072|JX0072 troponin C, st...    73   9e-12   
gb:MUSCAMC_2125379 Mus musculus calmodulin (CamC) mRNA, 5' end.        73   1e-11   
gb:AP004368_1840908 Oryza sativa (japonica cultivar-group) genom...    73   1e-11   
gb:AF418563_1798362 Solanum tuberosum calcium-dependent protein ...    73   1e-11   
gb:AY072054_1566957 Prorocentrum minimum calmodulin mRNA, partia...    73   1e-11   
pir|T15596|T15596 hypothetical protein C24H10.5 - Caenorhabditis...    73   1e-11   
gb:STU20291_1722974 Solanum tuberosum clone PCM2 calmodulin gene...    72   1e-11   
gb:NPAJ5039_1691050 Nicotiana plumbaginifolia mRNA for calmoduli...    72   1e-11   
gb:BT000036_1634314 Arabidopsis thaliana calmodulin-like protein...    72   1e-11   
gb:AY301062_1597321 Zea mays calcium-dependent protein kinase Zm...    72   1e-11   
gb:AY052319_1562692 Arabidopsis thaliana AT4g23650/F9D16_120 mRN...    72   1e-11   
gb:AC011560_1537233 Arabidopsis thaliana chromosome 3 BAC F13M14...    72   1e-11   
gb:AF169155_1415406 Bos taurus CaBP2 (CABP2) mRNA, complete cds.       72   1e-11   
gb:AF359239_1265308 Giardia intestinalis calmodulin-like protein...    72   1e-11   
pir|A45472|A45472 protein kinase (EC 2.7.1.37) - malaria parasit...    72   1e-11   
pir|T05597|S71774 calcium-dependent protein kinase (EC 2.7.1.-) ...    72   1e-11   
sp|P62344|CDP1_PLAF7|CDP1_PLAF7 Calcium-dependent protein kinase 1 (EC 2.7....    72   1e-11   
sp|Q9N1Q9|CAB2_BOVIN|CAB2_BOVIN Calcium-binding protein CaBP2.                    72   1e-11   
gb:AB008556_2460480 Lampetra japonica mRNA for troponin C, compl...    72   2e-11   
gb:AF414128_1797604 Musa acuminata calmodulin-like protein mRNA,...    72   2e-11   
gb:AC098571_1736751 Oryza sativa (japonica cultivar-group) chrom...    72   2e-11   
gb:AY394009_1604751 Vitis labrusca x Vitis vinifera calcium-depe...    72   2e-11   
gb:ATT2L20_1555752 Arabidopsis thaliana DNA chromosome 5, BAC cl...    72   2e-11   
pir|T06791|T06791 calmodulin TaCaM2-1 - wheat>gb:TAU48690_172472...    72   2e-11   
gb:AF334107_2063571 Rattus norvegicus centrin1 mRNA, partial cds.      72   2e-11   
gb:AP001313_1821169 Arabidopsis thaliana genomic DNA, chromosome...    72   2e-11   
gb:AF493612_1805025 Acetabularia acetabulum centrin mRNA, partia...    72   2e-11   
pir|JW0066|JW0066 slow cardiac troponin C - Entosphenus japonicus      72   2e-11   
gb:AF169156_2057615 Mus musculus S-CaBP2 (Cabp2) mRNA, complete ...    71   3e-11   
gb:AY189287_1938092 Homo sapiens LP7057 protein mRNA, complete c...    71   3e-11   
gb:AF334832_1787484 Castanea sativa calmodulin mRNA, partial cds.      71   3e-11   
gb:NTA344154_1691347 Nicotiana tabacum mRNA for calcium-dependen...    71   3e-11   
gb:AF169150_1415404 Bos taurus S-CaBP1 (CABP1) mRNA, complete cd...    71   3e-11   


>gb:ATAC009400_1542971 Arabidopsis thaliana chromosome III BAC
           F14P13 genomic sequence, complete
           sequence.>gb:BT003114_1636695 Arabidopsis thaliana
           At3g10190 mRNA, complete cds.
          Length = 209

 Score =  177 bits (450), Expect = 2e-43
 Identities = 87/164 (53%), Positives = 114/164 (69%)
 Frame = +2

Query: 266 GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP 445
           GG  TPTS+LP +    S       Y E++QAFKLIDRD+DG + + +LE+LLS++G +P
Sbjct: 50  GGSVTPTSILPEVPSPYS-------YVEILQAFKLIDRDNDGAVSRHDLESLLSRLGPDP 102

Query: 446 PSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAE 625
            + EE+ +ML EVD DGDG I LEE +    +  P    +EL++ F+FFD D DG ISA+
Sbjct: 103 LTEEEINVMLKEVDCDGDGTIRLEELASRVVSLDPARDSTELKETFEFFDADRDGLISAD 162

Query: 626 ELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME 757
           EL  VF TIGD RCTL+DC+RMI  VD +GDGFVCF +F RMM+
Sbjct: 163 ELLRVFSTIGDERCTLDDCKRMIADVDEDGDGFVCFTEFSRMMD 206



>gb:AY084696_1569783 Arabidopsis thaliana clone 11537 mRNA, complete
           sequence.
          Length = 216

 Score =  174 bits (441), Expect = 3e-42
 Identities = 96/173 (55%), Positives = 115/173 (66%), Gaps = 5/173 (2%)
 Frame = +2

Query: 251 GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ 430
           G  K G  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L AL+S+
Sbjct: 46  GNLKQGPTATPISVLPQNSGDF--------YTELVQAFKLIDRDDDGVVSRGDLAALISR 97

Query: 431 VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFD 595
           +  EPPS+EE+ LML EVD    GCISLE+   L+S  A  S +      ELR+ F+ FD
Sbjct: 98  LSHEPPSQEEVSLMLREVDGGDGGCISLED---LASRVAGTSGEGSVETEELREVFEIFD 154

Query: 596 TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            D +GKISAEEL  VF  IGD RCTLE+C RMI  VD NGDGFVCF+DFCRMM
Sbjct: 155 VDRNGKISAEELHRVFGVIGDERCTLEECMRMIATVDGNGDGFVCFDDFCRMM 207



>sp|P30188|CALL_ARATH Calmodulin-like protein.>pir|D84841|D84841
           calmodulin-like protein [imported] - Arabidopsis
           thaliana>gb:AC005662_1532865 Arabidopsis thaliana
           chromosome 2 clone F13H10 map CIC11C08, complete
           sequence.>gb:AY056357_1563666 Arabidopsis thaliana
           putative calmodulin protein (At2g41410) mRNA, complete
           cds.>gb:AF360307_1791253 Arabidopsis thaliana putative
           calmodulin protein (At2g41410) mRNA, complete cds.
          Length = 216

 Score =  174 bits (441), Expect = 3e-42
 Identities = 96/173 (55%), Positives = 115/173 (66%), Gaps = 5/173 (2%)
 Frame = +2

Query: 251 GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ 430
           G  K G  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L AL+S+
Sbjct: 46  GNLKQGPTATPISVLPQNSGDF--------YTELVQAFKLIDRDDDGVVSRGDLAALISR 97

Query: 431 VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFD 595
           +  EPPS+EE+ LML EVD    GCISLE+   L+S  A  S +      ELR+ F+ FD
Sbjct: 98  LSHEPPSQEEVSLMLREVDGGDGGCISLED---LASRVAGTSGEGSVETEELREVFEIFD 154

Query: 596 TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            D +GKISAEEL  VF  IGD RCTLE+C RMI  VD NGDGFVCF+DFCRMM
Sbjct: 155 VDRNGKISAEELHRVFGVIGDERCTLEECMRMIATVDGNGDGFVCFDDFCRMM 207



>pir|S29595|S29595 calmodulin-related protein (clone PM129) -
           Arabidopsis thaliana>gb:ATCALLP_1544154 A.thaliana mRNA
           for calmodulin like protein.
          Length = 215

 Score =  170 bits (430), Expect = 5e-41
 Identities = 95/173 (54%), Positives = 112/173 (64%), Gaps = 5/173 (2%)
 Frame = +2

Query: 251 GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ 430
           G  K G  +TP SV     D          Y ELVQAFKLIDRDDDG + + +L AL+S+
Sbjct: 46  GNLKQGPTATPISVSSNSGD---------FYTELVQAFKLIDRDDDGVVSRGDLAALISR 96

Query: 431 VGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFD 595
           +  EPPS+EE+ LML EVD    GCISLE+   L+S  A  S +      ELR+ F+ FD
Sbjct: 97  LSHEPPSQEEVSLMLREVDGGDGGCISLED---LASRVAGTSGEGSVETEELREVFEIFD 153

Query: 596 TDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            D +GKISAEEL  VF  IGD RCTLE+C RMI  VD NGDGFVCF+DFCRMM
Sbjct: 154 VDRNGKISAEELHRVFGVIGDERCTLEECMRMIATVDGNGDGFVCFDDFCRMM 206



>pir|F86379|F86379 protein F21J9.28 [imported] - Arabidopsis
           thaliana>gb:AE005172_891415 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC000103_1530021 Genomic sequence for
           Arabidopsis thaliana BAC F21J9 from chromosome I,
           complete sequence.
          Length = 186

 Score =  109 bits (272), Expect = 1e-22
 Identities = 62/137 (45%), Positives = 88/137 (64%), Gaps = 1/137 (0%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           EL   FK  D + DGKI  +EL A+++ +G E P  EEL   ++E+DR GDG I+ EEF 
Sbjct: 37  ELEAVFKKFDVNGDGKISSKELGAIMTSLGHEVPE-EELEKAITEIDRKGDGYINFEEFV 95

Query: 527 VLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV 703
            L++     +   E L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI GV
Sbjct: 96  ELNTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGDE-CSIAECRKMIGGV 154

Query: 704 DNNGDGFVCFEDFCRMM 754
           D +GDG + FE+F  MM
Sbjct: 155 DKDGDGTIDFEEFKIMM 171



>gb:AY088814_1573824 Arabidopsis thaliana clone 95959 mRNA, complete
           sequence.
          Length = 157

 Score =  107 bits (268), Expect = 3e-22
 Identities = 61/145 (42%), Positives = 94/145 (64%), Gaps = 5/145 (3%)
 Frame = +2

Query: 335 GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP--SREELRLMLSEVDRDGDGCI 508
           G   ++ + F+  D+++DGKI  +EL+ +   +GA  P  S+EE + M+ E D DG+G I
Sbjct: 11  GSMEDIKKVFQRFDKNNDGKISIDELKDV---IGALSPNASQEETKAMMKEFDLDGNGFI 67

Query: 509 SLEEFSVLSSAFAPPSCDSELRD---AFDFFDTDHDGKISAEELFNVFKTIGDSRCTLED 679
            L+EF  L       S +S +RD   AFD +D D +G+ISA EL +V K +G+ +C+++D
Sbjct: 68  DLDEFVALFQISDQSSNNSAIRDLKEAFDLYDLDRNGRISANELHSVMKNLGE-KCSIQD 126

Query: 680 CRRMILGVDNNGDGFVCFEDFCRMM 754
           C+RMI  VD++GDG V FE+F +MM
Sbjct: 127 CQRMISKVDSDGDGCVDFEEFKKMM 151



>pir|D96689|D96689 calmodulin-related protein, 72976-72503
           [imported] - Arabidopsis thaliana>gb:AE005173_894288
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC020665_1538592 Arabidopsis thaliana
           chromosome 1 BAC T27F4 genomic sequence, complete
           sequence.>gb:AY063853_1565801 Arabidopsis thaliana
           putative calmodulin-related protein (At1g66400) mRNA,
           complete cds.>gb:AY117325_1579366 Arabidopsis thaliana
           putative calmodulin-related protein (At1g66400) mRNA,
           complete cds.
          Length = 157

 Score =  107 bits (267), Expect = 4e-22
 Identities = 61/145 (42%), Positives = 94/145 (64%), Gaps = 5/145 (3%)
 Frame = +2

Query: 335 GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP--SREELRLMLSEVDRDGDGCI 508
           G   ++ + F+  D+++DGKI  +EL+ +   +GA  P  S+EE + M+ E D DG+G I
Sbjct: 11  GSMEDIKKVFQRFDKNNDGKISIDELKDV---IGALSPNASQEETKAMMKEFDLDGNGFI 67

Query: 509 SLEEFSVLSSAFAPPSCDSELRD---AFDFFDTDHDGKISAEELFNVFKTIGDSRCTLED 679
            L+EF  L       S +S +RD   AFD +D D +G+ISA EL +V K +G+ +C+++D
Sbjct: 68  DLDEFVALFQISDQSSNNSAIRDLKEAFDLYDLDRNGRISANELHSVMKNLGE-KCSIQD 126

Query: 680 CRRMILGVDNNGDGFVCFEDFCRMM 754
           C+RMI  VD++GDG V FE+F +MM
Sbjct: 127 CQRMINKVDSDGDGCVDFEEFKKMM 151



>gb:AC120985_1739980 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1532_D06, complete sequence.
          Length = 156

 Score =  107 bits (266), Expect = 5e-22
 Identities = 62/150 (41%), Positives = 87/150 (58%), Gaps = 13/150 (8%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AEL Q F+  D + DGKI  EEL ++L  +GA P    E+R M+ E+D D DG + L EF
Sbjct: 2   AELEQVFRRYDANGDGKISAEELASVLRALGA-PLGPGEVRRMMDEMDSDRDGFVDLSEF 60

Query: 524 SVLSSAFAPP-------------SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
           +       P              + ++ELR+AF  +D D +GKISA EL  V + +GD +
Sbjct: 61  AAFHCGPTPAHGGKGGDAKDQEAASEAELREAFRMYDADSNGKISARELHRVLRQLGD-K 119

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
           C++ DC RMI  VD +GDG V F++F +MM
Sbjct: 120 CSVADCSRMIRSVDADGDGCVNFDEFKKMM 149



 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 27/67 (40%), Positives = 41/67 (61%)
 Frame = +2

Query: 323 DELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDG 502
           D+ +   AEL +AF++ D D +GKI   EL  +L Q+G +  S  +   M+  VD DGDG
Sbjct: 80  DQEAASEAELREAFRMYDADSNGKISARELHRVLRQLG-DKCSVADCSRMIRSVDADGDG 138

Query: 503 CISLEEF 523
           C++ +EF
Sbjct: 139 CVNFDEF 145



>gb:AP003735_1832624 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1147A04.
          Length = 185

 Score =  106 bits (265), Expect = 7e-22
 Identities = 59/138 (42%), Positives = 86/138 (62%), Gaps = 2/138 (1%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ + F+  D + DG+I + EL AL   +G    + +EL  M++E D DGDG ISL+EF+
Sbjct: 40  EMERVFRKFDANGDGRISRSELGALFESLG-HAATDDELARMMAEADADGDGFISLDEFA 98

Query: 527 VLSSAFAPPSC--DSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            L++  +  +   + +LR AF  FD D +G ISA EL  V   +G+ + T++ CRRMI G
Sbjct: 99  ALNATASGDAAAVEEDLRHAFRVFDADGNGTISAAELARVLHGLGE-KATVQQCRRMIEG 157

Query: 701 VDNNGDGFVCFEDFCRMM 754
           VD NGDG + FE+F  MM
Sbjct: 158 VDQNGDGLISFEEFKVMM 175



>gb:SRO309072_1722429 Sesbania rostrata mRNA for calcium binding
           protein.
          Length = 172

 Score =  102 bits (255), Expect = 1e-20
 Identities = 57/136 (41%), Positives = 84/136 (61%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           EL + F   D + DGKI   EL+ +L  +G+  PS +EL  ++ ++D D DG I+L EF+
Sbjct: 32  ELKRVFSRFDANGDGKISVNELDNVLRALGSTVPS-DELERVMKDLDTDNDGFINLTEFA 90

Query: 527 VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD 706
               + A     SELR+AFD +D D +G ISA EL  V   +G  +C++E+C  MI  VD
Sbjct: 91  AFCRSDAADGGASELREAFDLYDQDKNGLISAAELCLVLNRLG-MKCSVEECHNMIKSVD 149

Query: 707 NNGDGFVCFEDFCRMM 754
           ++GDG V F++F +MM
Sbjct: 150 SDGDGNVNFDEFKQMM 165



 Score = 45.8 bits (107), Expect = 0.001
 Identities = 27/67 (40%), Positives = 40/67 (59%)
 Frame = +2

Query: 323 DELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDG 502
           D   G  +EL +AF L D+D +G I   EL  +L+++G +  S EE   M+  VD DGDG
Sbjct: 96  DAADGGASELREAFDLYDQDKNGLISAAELCLVLNRLGMK-CSVEECHNMIKSVDSDGDG 154

Query: 503 CISLEEF 523
            ++ +EF
Sbjct: 155 NVNFDEF 161



>pir|T49012|T49012 calmodulin-like protein - Arabidopsis
           thaliana>gb:ATF25L23_1550069 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F25L23.
          Length = 195

 Score =  102 bits (254), Expect = 1e-20
 Identities = 52/138 (37%), Positives = 87/138 (63%), Gaps = 1/138 (0%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           +L + F++ D++ DG+I KEEL   L  +G   P ++ ++ M+ ++D +GDGC+ + EF 
Sbjct: 51  DLKRVFQMFDKNGDGRITKEELNDSLENLGIFMPDKDLIQ-MIQKMDANGDGCVDINEFE 109

Query: 527 VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG-DSRCTLEDCRRMILGV 703
            L  +      + ++RDAF+ FD D DG I+ EEL +V  ++G     TLE C+ MI+ V
Sbjct: 110 SLYGSIVEEKEEGDMRDAFNVFDQDGDGFITVEELNSVMTSLGLKQGKTLECCKEMIMQV 169

Query: 704 DNNGDGFVCFEDFCRMME 757
           D +GDG V +++F +MM+
Sbjct: 170 DEDGDGRVNYKEFLQMMK 187



>gb:AC002335_1530396 Arabidopsis thaliana chromosome 2 clone T1O24
           map CIC10F02, complete sequence.>gb:AC004450_1531715
           Arabidopsis thaliana chromosome 2 clone F14B2 map
           CIC10F02, complete sequence.>gb:AY062815_1565471
           Arabidopsis thaliana putative Ca2+-binding protein
           (At2g43290; T1O24.3) mRNA, complete
           cds.>gb:AY081574_1568834 Arabidopsis thaliana putative
           Ca2+-binding protein (At2g43290) mRNA, complete
           cds.>gb:AY087087_1572123 Arabidopsis thaliana clone
           31535 mRNA, complete sequence.>gb:AF250344_1780878
           Arabidopsis thaliana calmodulin-like MSS3 (T01024.3)
           mRNA, complete cds.
          Length = 215

 Score =  102 bits (253), Expect = 2e-20
 Identities = 57/167 (34%), Positives = 104/167 (62%), Gaps = 7/167 (4%)
 Frame = +2

Query: 278 TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE 457
           +P+++LP+ +   +P +     +EL + F++ D++ DG+I KEEL   L  +G   P ++
Sbjct: 43  SPSTMLPSPSSSSAPTKRIDP-SELKRVFQMFDKNGDGRITKEELNDSLENLGIYIPDKD 101

Query: 458 ELRLMLSEVDRDGDGCISLEEFSVLSSAFAPP------SCDSELRDAFDFFDTDHDGKIS 619
            L  M+ ++D +GDGC+ ++EF  L S+          + + +++DAF+ FD D DG I+
Sbjct: 102 -LTQMIHKIDANGDGCVDIDEFESLYSSIVDEHHNDGETEEEDMKDAFNVFDQDGDGFIT 160

Query: 620 AEELFNVFKTIGDSRC-TLEDCRRMILGVDNNGDGFVCFEDFCRMME 757
            EEL +V  ++G  +  TL+ C++MI+ VD +GDG V +++F +MM+
Sbjct: 161 VEELKSVMASLGLKQGKTLDGCKKMIMQVDADGDGRVNYKEFLQMMK 207



>pir|A86317|A86317 protein T10O22.19 [imported] - Arabidopsis
           thaliana>gb:AE005172_890786 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC069551_1540960 Genomic sequence for
           Arabidopsis thaliana BAC T10O22 from chromosome I,
           complete sequence.>gb:AY045805_1561319 Arabidopsis
           thaliana putative calcium-binding protein (At1g18210)
           mRNA, complete cds.>gb:AY079394_1568283 Arabidopsis
           thaliana putative calcium-binding protein (At1g18210)
           mRNA, complete cds.>gb:T10F20_1723325 Sequence of BAC
           T10F20 from Arabidopsis thaliana chromosome 1, complete
           sequence.
          Length = 170

 Score =  102 bits (253), Expect = 2e-20
 Identities = 66/153 (43%), Positives = 87/153 (56%)
 Frame = +2

Query: 296 PALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLML 475
           PA  D  +P+EL        + F   D + DGKI   EL  +   +G    +  EL  +L
Sbjct: 13  PATVDMANPEELK-------KVFDQFDSNGDGKISVLELGGVFKAMGTSY-TETELNRVL 64

Query: 476 SEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG 655
            EVD D DG I+L+EFS L  +    S  +E+RDAFD +D D +G ISA EL  V   +G
Sbjct: 65  EEVDTDRDGYINLDEFSTLCRS---SSSAAEIRDAFDLYDQDKNGLISASELHQVLNRLG 121

Query: 656 DSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            S C++EDC RMI  VD +GDG V FE+F +MM
Sbjct: 122 MS-CSVEDCTRMIGPVDADGDGNVNFEEFQKMM 153



 Score = 46.6 bits (109), Expect = 9e-04
 Identities = 32/80 (40%), Positives = 46/80 (57%), Gaps = 9/80 (11%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE+  AF L D+D +G I   EL  +L+++G    S E+   M+  VD DGDG ++ EEF
Sbjct: 91  AEIRDAFDLYDQDKNGLISASELHQVLNRLGMSC-SVEDCTRMIGPVDADGDGNVNFEEF 149

Query: 524 -------SVLSS--AFAPPS 556
                  S+L+S  + APPS
Sbjct: 150 QKMMTSSSLLNSNGSAAPPS 169



>gb:AC136222_1743097 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0088M05, complete sequence.
          Length = 201

 Score =  101 bits (251), Expect = 3e-20
 Identities = 62/141 (43%), Positives = 83/141 (58%), Gaps = 5/141 (3%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E  + F+  D + DG+I + EL AL   VG    + +E+  M+ E D DGDG ISL EF+
Sbjct: 55  ETERVFRKFDANGDGRISRAELAALFRSVG-HAVTDDEVARMMQEADSDGDGYISLGEFA 113

Query: 527 VLSSAFAPPSCDS-----ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM 691
            +S   APP  D+     +LR AF  FD D +G I+  EL  V + IG++  T+  CRRM
Sbjct: 114 AIS---APPPGDAAAAEEDLRHAFGVFDADGNGVITPAELARVLRGIGEA-ATVAQCRRM 169

Query: 692 ILGVDNNGDGFVCFEDFCRMM 754
           I GVD NGDG + FE+F  MM
Sbjct: 170 IDGVDRNGDGLINFEEFKLMM 190



 Score = 46.6 bits (109), Expect = 9e-04
 Identities = 27/76 (35%), Positives = 42/76 (55%)
 Frame = +2

Query: 320 PDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGD 499
           P + +    +L  AF + D D +G I   EL  +L  +G E  +  + R M+  VDR+GD
Sbjct: 120 PGDAAAAEEDLRHAFGVFDADGNGVITPAELARVLRGIG-EAATVAQCRRMIDGVDRNGD 178

Query: 500 GCISLEEFSVLSSAFA 547
           G I+ EEF ++ +A A
Sbjct: 179 GLINFEEFKLMMAAGA 194



>gb:ATAC009853_1543056 Arabidopsis thaliana chromosome III BAC F21O3
           genomic sequence, complete sequence.
          Length = 153

 Score =  101 bits (251), Expect = 3e-20
 Identities = 57/140 (40%), Positives = 89/140 (63%), Gaps = 2/140 (1%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AEL + F++ DR+ DGKI K+EL   L  +G   P ++ ++ M+ ++D +GDG + +EEF
Sbjct: 4   AELARIFQMFDRNGDGKITKQELNDSLENLGIYIPDKDLVQ-MIEKIDLNGDGYVDIEEF 62

Query: 524 SVLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC-TLEDCRRMIL 697
             L         + E +R+AF+ FD + DG I+ EEL +V  ++G  +  TLEDC+RMI 
Sbjct: 63  GGLYQTIMEERDEEEDMREAFNVFDQNRDGFITVEELRSVLASLGLKQGRTLEDCKRMIS 122

Query: 698 GVDNNGDGFVCFEDFCRMME 757
            VD +GDG V F++F +MM+
Sbjct: 123 KVDVDGDGMVNFKEFKQMMK 142



>gb:OSJN00061_1694128 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0091E11, complete
           sequence.>gb:OSJN00138_1695523 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OJ990528_30, complete sequence.
          Length = 196

 Score =  100 bits (249), Expect = 5e-20
 Identities = 59/152 (38%), Positives = 88/152 (57%), Gaps = 15/152 (9%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AEL + F+L DR+ DG+I +EELE  L ++G   P+ +EL  +++ +D +GDGC+ +EEF
Sbjct: 37  AELARVFELFDRNGDGRITREELEDSLGKLGIPVPA-DELAAVIARIDANGDGCVDVEEF 95

Query: 524 SVLSSAFAPPSCDS--------------ELRDAFDFFDTDHDGKISAEELFNVFKTIG-D 658
             L  +      DS              ++R+AF  FD + DG I+ +EL  V  ++G  
Sbjct: 96  GELYRSIMAGGDDSKDGRAKEEEEEEDGDMREAFRVFDANGDGYITVDELGAVLASLGLK 155

Query: 659 SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
              T E+CRRMI  VD +GDG V F +F +MM
Sbjct: 156 QGRTAEECRRMIGQVDRDGDGRVDFHEFLQMM 187



>gb:AP003214_1825346 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBa0083M16.
          Length = 181

 Score =  100 bits (248), Expect = 6e-20
 Identities = 63/165 (38%), Positives = 88/165 (53%), Gaps = 5/165 (3%)
 Frame = +2

Query: 275 STPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSR 454
           +T    +P       P  L+   AE+ + F   D D DG+I   EL A+   + A PPS 
Sbjct: 3   NTTEKKMPQQQQVERPTALAPADAEIERVFTRFDADGDGRISPSELAAVTRAI-APPPSE 61

Query: 455 E----ELRLMLSEVDRDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKIS 619
                E+  M++E+D D DG + L EF+            ++ELR AFD +D D DG+I+
Sbjct: 62  SAGGREVAAMMNELDTDRDGFVDLGEFAAFHGRGRGDAEHEAELRAAFDVYDVDGDGRIT 121

Query: 620 AEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
           A EL  V   IG+  C+ E+C RMI  VD +GDG V FE+F +MM
Sbjct: 122 AAELGKVLGRIGEG-CSAEECERMIASVDVDGDGCVGFEEFKKMM 165



>gb:LJA251808_1684970 Lotus japonicus mRNA for calcium-binding
           protein (cbp1 gene).
          Length = 230

 Score = 99.8 bits (247), Expect = 8e-20
 Identities = 54/139 (38%), Positives = 88/139 (63%), Gaps = 2/139 (1%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           EL + F++ DR+ DG+I K+EL   L  +G   P +E L  M+  +D +GDGC+ ++EF 
Sbjct: 85  ELKRVFQMFDRNGDGRITKKELNDSLENLGIFIPDKE-LTQMIERIDVNGDGCVDIDEFG 143

Query: 527 VLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC-TLEDCRRMILG 700
            L  +      + E +R+AF+ FD + DG I+ EEL  V  ++G  +  T+EDC++MI+ 
Sbjct: 144 ELYQSIMDERDEEEDMREAFNVFDQNGDGFITVEELRTVLASLGIKQGRTVEDCKKMIMK 203

Query: 701 VDNNGDGFVCFEDFCRMME 757
           VD +GDG V +++F +MM+
Sbjct: 204 VDVDGDGMVDYKEFKQMMK 222



 Score = 40.0 bits (92), Expect = 0.080
 Identities = 29/96 (30%), Positives = 47/96 (48%), Gaps = 4/96 (4%)
 Frame = +2

Query: 467 LMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFK 646
           L++ +   D D C  L     L ++  P    +EL+  F  FD + DG+I+ +EL +  +
Sbjct: 56  LVIQKTTDDCDPCQLLP----LDTSLIPKMDPTELKRVFQMFDRNGDGRITKKELNDSLE 111

Query: 647 TIG----DSRCTLEDCRRMILGVDNNGDGFVCFEDF 742
            +G    D   T     +MI  +D NGDG V  ++F
Sbjct: 112 NLGIFIPDKELT-----QMIERIDVNGDGCVDIDEF 142



>pir|D84864|D84864 probable calcium binding protein [imported] -
           Arabidopsis thaliana
          Length = 169

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 53/145 (36%), Positives = 92/145 (63%), Gaps = 7/145 (4%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           +EL + F++ D++ DG+I KEEL   L  +G   P ++ L  M+ ++D +GDGC+ ++EF
Sbjct: 18  SELKRVFQMFDKNGDGRITKEELNDSLENLGIYIPDKD-LTQMIHKIDANGDGCVDIDEF 76

Query: 524 SVLSSAFAPP------SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC-TLEDC 682
             L S+          + + +++DAF+ FD D DG I+ EEL +V  ++G  +  TL+ C
Sbjct: 77  ESLYSSIVDEHHNDGETEEEDMKDAFNVFDQDGDGFITVEELKSVMASLGLKQGKTLDGC 136

Query: 683 RRMILGVDNNGDGFVCFEDFCRMME 757
           ++MI+ VD +GDG V +++F +MM+
Sbjct: 137 KKMIMQVDADGDGRVNYKEFLQMMK 161



>gb:AF078680_1766262 Olea europaea calcium-binding protein (PCA23)
           mRNA, complete cds.
          Length = 171

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 56/149 (37%), Positives = 87/149 (58%), Gaps = 4/149 (2%)
 Frame = +2

Query: 320 PDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGD 499
           P+E+ G+       F   D + DGKI  +EL   L  +G+   S+EE+  M+ E+D D D
Sbjct: 18  PNEVQGV-------FNRFDANGDGKISGDELACALKALGSNT-SKEEIARMMEEIDTDKD 69

Query: 500 GCISLEEFSVLSSAFAPP----SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC 667
           G I+++EF+    A   P      ++EL++AF+ +D DH+G IS+ EL  +   +G+ R 
Sbjct: 70  GFINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGE-RY 128

Query: 668 TLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
              DC  MI  VD++GDG+V FE+F +MM
Sbjct: 129 AEHDCVEMIKSVDSDGDGYVSFEEFKKMM 157



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 29/71 (40%), Positives = 41/71 (57%)
 Frame = +2

Query: 311 EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDR 490
           E  P   SG   EL +AF+L D+D +G I   EL  +L+++G E  +  +   M+  VD 
Sbjct: 84  ETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLG-ERYAEHDCVEMIKSVDS 142

Query: 491 DGDGCISLEEF 523
           DGDG +S EEF
Sbjct: 143 DGDGYVSFEEF 153



>gb:AY484589_1608334 Musa acuminata clone MuH9, genomic sequence.
          Length = 210

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 57/140 (40%), Positives = 85/140 (60%), Gaps = 2/140 (1%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           +EL + F++ DR+ DG+I K EL   L  +G   P  E L  M+  +D +GDGC+ +EEF
Sbjct: 64  SELKRVFQMFDRNGDGRITKAELTDSLENLGILVPEAE-LASMIERIDANGDGCVDVEEF 122

Query: 524 SVLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC-TLEDCRRMIL 697
             L         + E +R+AF+ FD + DG I+ EEL +V  ++G  +  T EDCR+MI 
Sbjct: 123 GTLYRTIMDERDEEEDMREAFNVFDRNGDGFITVEELRSVLASLGLKQGRTAEDCRKMIN 182

Query: 698 GVDNNGDGFVCFEDFCRMME 757
            VD +GDG V F++F +MM+
Sbjct: 183 EVDVDGDGVVNFKEFKQMMK 202



 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 34/106 (32%), Positives = 50/106 (47%)
 Frame = +2

Query: 422 LSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTD 601
           +S   A  PS  EL+ +    DR+GDG I+  E +           ++EL    +  D +
Sbjct: 55  ISIASAMDPS--ELKRVFQMFDRNGDGRITKAELTDSLENLGILVPEAELASMIERIDAN 112

Query: 602 HDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFED 739
            DG +  EE   +++TI D R   ED R      D NGDGF+  E+
Sbjct: 113 GDGCVDVEEFGTLYRTIMDERDEEEDMREAFNVFDRNGDGFITVEE 158



 Score = 37.4 bits (85), Expect = 0.52
 Identities = 25/71 (35%), Positives = 37/71 (52%)
 Frame = +2

Query: 530 LSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDN 709
           ++SA  P    SEL+  F  FD + DG+I+  EL +  + +G       +   MI  +D 
Sbjct: 57  IASAMDP----SELKRVFQMFDRNGDGRITKAELTDSLENLG-ILVPEAELASMIERIDA 111

Query: 710 NGDGFVCFEDF 742
           NGDG V  E+F
Sbjct: 112 NGDGCVDVEEF 122



>sp|Q9M7R0|ALL8_OLEEU Calcium-binding allergen Ole e 8
           (PCA18/PCA23).>gb:AF078679_1766261 Olea europaea
           calcium-binding protein (PCA18) mRNA, complete cds.
          Length = 171

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 55/149 (36%), Positives = 88/149 (59%), Gaps = 4/149 (2%)
 Frame = +2

Query: 320 PDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGD 499
           P+E+ G+       F   D + DGKI  +EL  +L  +G+   S+EE+  ++ E+D D D
Sbjct: 18  PNEVQGV-------FNRFDANGDGKISGDELAGVLKALGSNT-SKEEIGRIMEEIDTDKD 69

Query: 500 GCISLEEFSVLSSAFAPP----SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC 667
           G I+++EF+    A   P      ++EL++AF+ +D DH+G IS+ EL  +   +G+ R 
Sbjct: 70  GFINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGE-RY 128

Query: 668 TLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
              DC  MI  VD++GDG+V FE+F +MM
Sbjct: 129 AEHDCVEMIKSVDSDGDGYVSFEEFKKMM 157



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 29/71 (40%), Positives = 41/71 (57%)
 Frame = +2

Query: 311 EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDR 490
           E  P   SG   EL +AF+L D+D +G I   EL  +L+++G E  +  +   M+  VD 
Sbjct: 84  ETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLG-ERYAEHDCVEMIKSVDS 142

Query: 491 DGDGCISLEEF 523
           DGDG +S EEF
Sbjct: 143 DGDGYVSFEEF 153



>gb:MSA295608_1687026 Medicago sativa mRNA for putative
           calmodulin-related protein (pprg1 gene).
          Length = 167

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 54/136 (39%), Positives = 85/136 (62%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           +  + F   D++ DGKI + EL+ +++ +G +  + EE+  M+ E+DR+GDG I L+EF 
Sbjct: 4   KFARIFNKFDKNGDGKISRTELKEMMTALGCKTTT-EEVTRMMEELDRNGDGYIDLKEFG 62

Query: 527 VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD 706
            L +         ELR+AF+ +D   +G  SA+EL  V + +G+ +C+L DCRRMI  VD
Sbjct: 63  ELHNGGGDTK---ELREAFEMYDLGKNGLTSAKELHAVMRRLGE-KCSLGDCRRMIGNVD 118

Query: 707 NNGDGFVCFEDFCRMM 754
            + DG V FE+F +MM
Sbjct: 119 ADSDGNVNFEEFKKMM 134



 Score = 41.2 bits (95), Expect = 0.036
 Identities = 23/64 (35%), Positives = 37/64 (57%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           EL +AF++ D   +G    +EL A++ ++G E  S  + R M+  VD D DG ++ EEF 
Sbjct: 73  ELREAFEMYDLGKNGLTSAKELHAVMRRLG-EKCSLGDCRRMIGNVDADSDGNVNFEEFK 131

Query: 527 VLSS 538
            + S
Sbjct: 132 KMMS 135



>gb:LPU57550_1389019 Loligo pealei calmodulin-like myosin-light
           chain mRNA, partial cds.
          Length = 149

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 54/138 (39%), Positives = 78/138 (56%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE+  AF + D D DG+I  +EL +++  +G   PS  EL  M+ EVD DG+G I   EF
Sbjct: 10  AEIKDAFDMFDIDGDGQITSKELRSVMKSLG-RTPSDAELEEMIREVDTDGNGTIEYAEF 68

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
             +++    P   + E+R+AF  FD D +G I+A EL  V     D + T E+   MI  
Sbjct: 69  VEMMAKQMGPTDPEKEMREAFRVFDKDGNGLITAAELRQVMANFSDEKLTSEEISEMIRE 128

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG V +E+F +MM
Sbjct: 129 ADIDGDGMVNYEEFVKMM 146



>sp|P14533|CABO_LOLPE Squidulin (Optic LOBE calcium-binding protein)
           (SCABP).>pir|A33353|A33353 calcium-binding protein -
           squid (Watasenia scintillans)
          Length = 149

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 54/138 (39%), Positives = 78/138 (56%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE+  AF + D D DG+I  +EL +++  +G   PS  EL  M+ EVD DG+G I   EF
Sbjct: 10  AEIKDAFDMFDIDGDGQITSKELRSVMKSLG-RTPSDAELEEMIREVDTDGNGTIEYAEF 68

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
             +++    P   + E+R+AF  FD D +G I+A EL  V     D + T E+   MI  
Sbjct: 69  VEMMAKQMGPTDPEKEMREAFRVFDKDGNGLITAAELRQVMANFSDEKLTSEEISEMIRE 128

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG V +E+F +MM
Sbjct: 129 ADIDGDGMVNYEEFVKMM 146



>gb:AB050849_1521040 Nicotiana tabacum mRNA for calmodulin NtCaM13,
           complete cds.
          Length = 150

 Score = 97.1 bits (240), Expect = 5e-19
 Identities = 58/152 (38%), Positives = 91/152 (59%), Gaps = 1/152 (0%)
 Frame = +2

Query: 302 LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE 481
           + D ++ D++     EL +AF L DRD DG I  EEL  ++  +  + P+ EEL+ M++E
Sbjct: 1   MGDILNQDQI----VELQEAFSLFDRDGDGCITVEELATVIRSLD-QNPTEEELQDMITE 55

Query: 482 VDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGD 658
           VD DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+
Sbjct: 56  VDSDGNGTIEFTEFLNLMAKKMKDTDAEEELKEAFKVFDKDQNGYISANELRHVMINLGE 115

Query: 659 SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            + T E+  +MI   D +GDG V F++F +MM
Sbjct: 116 -KLTDEEVEQMIKEADLDGDGQVNFDEFVKMM 146



>sp|O64943|POC2_JUNOX Polcalcin Jun o 2 (Calcium-binding pollen
           allergen Jun o 2).>gb:AF031471_1762570 Juniperus
           oxycedrus pollen allergen Jun o 4 mRNA, complete cds.
          Length = 165

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 54/136 (39%), Positives = 82/136 (60%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           EL + FK  D + DGKI   EL  +L  +G++     E++ M+ E D DGDG +SL+EF 
Sbjct: 26  ELEEVFKKFDANGDGKISGSELADILRSLGSDV-GEAEVKAMMEEADADGDGYVSLQEFV 84

Query: 527 VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD 706
            L++  A      +L++AF  FD D +G ISA EL +  +++G+  CT+E+ + +I  VD
Sbjct: 85  DLNNKGASVK---DLKNAFKVFDRDCNGSISAAELCHTLESVGEP-CTIEESKNIIHNVD 140

Query: 707 NNGDGFVCFEDFCRMM 754
            NGDG +  E+F  MM
Sbjct: 141 KNGDGLISVEEFQTMM 156



 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 28/65 (43%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           +L  AFK+ DRD +G I   EL   L  VG EP + EE + ++  VD++GDG IS+EEF 
Sbjct: 95  DLKNAFKVFDRDCNGSISAAELCHTLESVG-EPCTIEESKNIIHNVDKNGDGLISVEEFQ 153

Query: 527 VLSSA 541
            + ++
Sbjct: 154 TMMTS 158



>sp|P62184|CALM_RENRE Calmodulin (CaM).>pir|A90223|MCXAM calmodulin
           - sea anemone (Metridium senile) (tentative sequence)
          Length = 148

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 57/150 (38%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DGDG I   EF ++++        + E+R+AF  FD D DG ISA EL +V   +G+ +
Sbjct: 57  ADGDGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGDGFISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F +MM
Sbjct: 116 LTDEEVDEMIREADIDGDGQVNYEEFVKMM 145



>gb:AB060552_1521820 Oryza sativa (japonica cultivar-group) OsCAM-2
           mRNA for Calmodulin-2, complete cds.
          Length = 166

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 60/150 (40%), Positives = 84/150 (56%), Gaps = 13/150 (8%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  + F   D+D DG I  EEL+ ++  +G + P+REEL  M+ +VD DG+G I   EF
Sbjct: 14  AEFRETFAFFDKDGDGCITLEELDTVVRSLG-QTPTREELAEMIRDVDVDGNGTIEFAEF 72

Query: 524 SVLSSAFAP-------------PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
             L +  A               + D ELR+AF  FD D DG ISA EL +V  ++G+ +
Sbjct: 73  LALMARKASRGGENGGGGDDSGDAADEELREAFKVFDKDQDGLISAAELRHVMISLGE-K 131

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+  +MI   D +GDG V F++F RMM
Sbjct: 132 LTDEEVEQMIREADLDGDGQVNFDEFVRMM 161



>pir|A03023|MCSW calmodulin - scallop (Patinopecten sp.) (tentative
           sequence)
          Length = 148

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 57/150 (38%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DGDG I   EF ++++        + E+R+AF  FD D DG ISA EL +V   +G+ +
Sbjct: 57  ADGDGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGDGFISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F  MM
Sbjct: 116 LTDEEVDEMIREADIDGDGQVNYEEFVTMM 145



 Score = 46.6 bits (109), Expect = 9e-04
 Identities = 24/65 (36%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D DG I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 84  EIREAFRVFDKDGDGFISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 142

Query: 527 VLSSA 541
            + ++
Sbjct: 143 TMMTS 147



>pir|A90036|MCJZR calmodulin - sea pansy (Renilla reniformis)
           (tentative sequence)
          Length = 147

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 55/138 (39%), Positives = 83/138 (60%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I   EF
Sbjct: 9   AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVDADGBGTIDFPEF 67

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            ++++        + E+R+AF  FD D DG ISA EL +V   +G+ + T E+   MI  
Sbjct: 68  LTMMARKMKDTDSEEEIREAFRVFDKDGDGFISAAELRHVMTNLGE-KLTDEEVDEMIRE 126

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG V +E+F +MM
Sbjct: 127 ADIDGDGQVNYEEFVKMM 144



>sp|P02595|CALM_PATSP Calmodulin (CaM).
          Length = 148

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 57/150 (38%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DGDG I   EF ++++        + E+R+AF  FD D DG ISA EL +V   +G+ +
Sbjct: 57  ADGDGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGDGFISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F  MM
Sbjct: 116 LTDEEVDEMIREADIDGDGQVNYEEFVTMM 145



 Score = 46.6 bits (109), Expect = 9e-04
 Identities = 24/65 (36%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D DG I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 84  EIREAFRVFDKDGDGFISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 142

Query: 527 VLSSA 541
            + ++
Sbjct: 143 TMMTS 147



>gb:CR382131_1664883 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 152

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/152 (35%), Positives = 94/152 (61%), Gaps = 1/152 (0%)
 Frame = +2

Query: 302 LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE 481
           ++D+++ D++    AE  +AF L D+++DGKI  +EL  ++  +G + PS  EL  M++E
Sbjct: 1   MSDQLTEDQV----AEFREAFSLFDKNNDGKITTKELGTVMRSLG-QNPSESELADMINE 55

Query: 482 VDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGD 658
           VD + DG I   EF ++++        + E+R+AF  FD D++G ISA+EL +V  +IG+
Sbjct: 56  VDANNDGTIDFAEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAQELRHVMTSIGE 115

Query: 659 SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            + T E+   MI   D NGDG + + +F +++
Sbjct: 116 -KLTDEEVDMMIKEADANGDGRIDYNEFVQLL 146



>pir|T08585|T08585 calmodulin - soybean>gb:SOYSCAM4X_1716101 Soybean
           calmodulin (SCaM-4) mRNA, complete cds.
          Length = 150

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 55/134 (41%), Positives = 83/134 (61%), Gaps = 1/134 (0%)
 Frame = +2

Query: 356 QAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVL 532
           +AF L D+D DG I  EEL  ++  +  + P+ EEL+ M+SEVD DG+G I  +EF S++
Sbjct: 15  EAFGLFDKDGDGCITVEELATVIRSLD-QNPTEEELQDMISEVDADGNGTIEFDEFLSLM 73

Query: 533 SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNN 712
           +        + EL++AF  FD D +G ISA EL +V   +G+ + T E+  +MI   D +
Sbjct: 74  AKKVKDTDAEEELKEAFKVFDKDQNGYISASELRHVMINLGE-KLTDEEVEQMIKEADLD 132

Query: 713 GDGFVCFEDFCRMM 754
           GDG V +E+F +MM
Sbjct: 133 GDGQVNYEEFVKMM 146



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 24/63 (38%), Positives = 39/63 (61%)
 Frame = +2

Query: 566 ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFC 745
           + ++AF  FD D DG I+ EEL  V +++ D   T E+ + MI  VD +G+G + F++F 
Sbjct: 12  DFKEAFGLFDKDGDGCITVEELATVIRSL-DQNPTEEELQDMISEVDADGNGTIEFDEFL 70

Query: 746 RMM 754
            +M
Sbjct: 71  SLM 73



>gb:AY088760_1573773 Arabidopsis thaliana clone 94584 mRNA, complete
           sequence.
          Length = 145

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 56/136 (41%), Positives = 81/136 (59%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           EL + F   D +DDGKI   EL  +   +G    + EEL  +L E+D D DG I+ EEF+
Sbjct: 2   ELKKVFDKFDANDDGKISVSELGNVFKSMGTSY-TEEELNRVLDEIDIDCDGFINQEEFA 60

Query: 527 VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD 706
            +  +    S   E+R+AFD +D + +G IS+ E+  V   +G + C++EDC RMI  VD
Sbjct: 61  TICRS---SSSAVEIREAFDLYDQNKNGLISSSEIHKVLNRLGMT-CSVEDCVRMIGHVD 116

Query: 707 NNGDGFVCFEDFCRMM 754
            +GDG V FE+F +MM
Sbjct: 117 TDGDGNVNFEEFQKMM 132



 Score = 42.7 bits (99), Expect = 0.012
 Identities = 23/65 (35%), Positives = 39/65 (60%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF L D++ +G I   E+  +L+++G    S E+   M+  VD DGDG ++ EEF 
Sbjct: 71  EIREAFDLYDQNKNGLISSSEIHKVLNRLGMTC-SVEDCVRMIGHVDTDGDGNVNFEEFQ 129

Query: 527 VLSSA 541
            + S+
Sbjct: 130 KMMSS 134



>sp|Q12798|CET1_HUMAN Centrin 1 (Caltractin isoform
           2).>pir|I38424|I38424 centrin -
           human>gb:BC029515_1979533 Homo sapiens centrin, EF-hand
           protein, 1, mRNA (cDNA clone MGC:33791 IMAGE:5297994),
           complete cds.>gb:HSU03270_2021457 Homo sapiens centrin
           mRNA, complete cds.
          Length = 172

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 62/170 (36%), Positives = 93/170 (54%), Gaps = 1/170 (0%)
 Frame = +2

Query: 251 GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ 430
           G+KKP   ST      A   E++ D+      E+ +AF L D D  G I  +EL+  +  
Sbjct: 4   GFKKPSAASTGQKRKVAPKPELTEDQKQ----EVREAFDLFDVDGSGTIDAKELKVAMRA 59

Query: 431 VGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHD 607
           +G EP  +EE++ M+SEVDR+G G IS  +F +V++   +      E+  AF  FD D  
Sbjct: 60  LGFEP-RKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDET 118

Query: 608 GKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME 757
           GKIS + L  V   +G++  T E+ + MI   D +GDG V  E+F R+M+
Sbjct: 119 GKISFKNLKRVANELGEN-LTDEELQEMIDEADRDGDGEVNEEEFLRIMK 167



>pir|S28956|MCTE calmodulin - Tetrahymena
           pyriformis>pir|S28954|S28954 calmodulin - Tetrahymena
           thermophila>gb:TETCALW_1400021 T.pyriformis mRNA for
           calmodulin.
          Length = 149

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 56/150 (37%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF S+++        + EL +AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLSLMARKMKDTDTEEELIEAFKVFDRDGNGLISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F RMM
Sbjct: 117 LTDEEVDEMIREADIDGDGHINYEEFVRMM 146



>sp|P02598|CALM_TETPY Calmodulin (CaM).
          Length = 148

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 56/150 (37%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF S+++        + EL +AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLSLMARKMKDTDTEEELIEAFKVFDRDGNGLISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F RMM
Sbjct: 116 LTDEEVDEMIREADIDGDGHINYEEFVRMM 145



>gb:AF510075_1807163 Ceratopteris richardii calmodulin 1 mRNA,
           complete cds.
          Length = 149

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 56/150 (37%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           ++++ D++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   EQLTTDQI----AEFKEAFGLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQEMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F RMM
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVRMM 146



>gb:PPCAMPROT_1701294 Physcomitrella patens mRNA for calmodulin.
          Length = 149

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 54/151 (35%), Positives = 91/151 (60%), Gaps = 1/151 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DDLTEEQI----AEFKEAFSLFDKDGDGSITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMME 757
            T E+   MI   D +GDG V +++F +MM+
Sbjct: 117 LTDEEVDEMIRDADVDGDGQVDYDEFVKMMK 147



 Score = 44.7 bits (104), Expect = 0.003
 Identities = 24/65 (36%), Positives = 39/65 (60%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           EL +AFK+ D+D +G I   EL  +++ +G E  + EE+  M+ + D DGDG +  +EF 
Sbjct: 85  ELKEAFKVFDKDQNGFISAAELRHVMTNLG-EKLTDEEVDEMIRDADVDGDGQVDYDEFV 143

Query: 527 VLSSA 541
            +  A
Sbjct: 144 KMMKA 148



>pir|A84532|A84532 probable calmodulin-like protein [imported] -
           Arabidopsis thaliana>gb:CQ789583_1452873 Sequence 33
           from Patent WO2004022780.>gb:AC006248_1533856
           Arabidopsis thaliana chromosome 2 clone F9O13 map mi398,
           complete sequence.>gb:AY128375_1580674 Arabidopsis
           thaliana putative calmodulin-like protein (At2g15680)
           mRNA, complete cds.>gb:BT006571_1639458 Arabidopsis
           thaliana At2g15680 gene, complete cds.
          Length = 187

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 55/136 (40%), Positives = 82/136 (60%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ + F   D D DGKI + E + +L  +G E  + E++  +   VD DGDG I   EF 
Sbjct: 50  EMRRVFSRFDLDKDGKISQTEYKVVLRALGQER-AIEDVPKIFKAVDLDGDGFIDFREF- 107

Query: 527 VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD 706
           + +   +     S++R++F  FD + DGKISAEE+ +V   +G+ RC+LEDC RM+  VD
Sbjct: 108 IDAYKRSGGIRSSDIRNSFWTFDLNGDGKISAEEVMSVLWKLGE-RCSLEDCNRMVRAVD 166

Query: 707 NNGDGFVCFEDFCRMM 754
            +GDG V  E+F +MM
Sbjct: 167 ADGDGLVNMEEFIKMM 182



 Score = 50.4 bits (119), Expect = 6e-05
 Identities = 28/67 (41%), Positives = 39/67 (58%)
 Frame = +2

Query: 542 FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDG 721
           F+ PS + E+R  F  FD D DGKIS  E   V + +G  R  +ED  ++   VD +GDG
Sbjct: 43  FSQPSVN-EMRRVFSRFDLDKDGKISQTEYKVVLRALGQER-AIEDVPKIFKAVDLDGDG 100

Query: 722 FVCFEDF 742
           F+ F +F
Sbjct: 101 FIDFREF 107



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 24/66 (36%), Positives = 41/66 (62%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           +++  +F   D + DGKI  EE+ ++L ++G E  S E+   M+  VD DGDG +++EEF
Sbjct: 120 SDIRNSFWTFDLNGDGKISAEEVMSVLWKLG-ERCSLEDCNRMVRAVDADGDGLVNMEEF 178

Query: 524 SVLSSA 541
             + S+
Sbjct: 179 IKMMSS 184



>pir|T06437|T06437 calmodulin - garden pea>gb:PSU13736_1702465 Pisum
           sativum Alaska calmodulin-like protein mRNA, complete
           cds.
          Length = 150

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 52/134 (38%), Positives = 83/134 (61%), Gaps = 1/134 (0%)
 Frame = +2

Query: 356 QAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-SVL 532
           +AF L D+D DG +  EEL  ++  +  + P+ EEL+ M+SEVD DG+G I  +EF +++
Sbjct: 15  EAFGLFDKDGDGCVTVEELATVIRSLD-QNPTEEELQDMISEVDADGNGTIEFDEFLNLM 73

Query: 533 SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNN 712
           +        + ELR+AF  FD D +G IS  EL +V   +G+ + + E+ ++MI   D +
Sbjct: 74  ARKMKDTDAEEELREAFKVFDKDQNGYISPSELRHVMMNLGE-KLSDEEVKQMIKEADMD 132

Query: 713 GDGFVCFEDFCRMM 754
           GDG V ++DF +MM
Sbjct: 133 GDGQVDYDDFVKMM 146



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 23/63 (36%), Positives = 39/63 (61%)
 Frame = +2

Query: 566 ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFC 745
           + ++AF  FD D DG ++ EEL  V +++ D   T E+ + MI  VD +G+G + F++F 
Sbjct: 12  DFKEAFGLFDKDGDGCVTVEELATVIRSL-DQNPTEEELQDMISEVDADGNGTIEFDEFL 70

Query: 746 RMM 754
            +M
Sbjct: 71  NLM 73



>pir|JC1309|JC1309 calmodulin - Stylonychia
           lemnae>gb:SLECALMODU_1397680 Stylonychia lemnae
           calmodulin gene, complete cds.
          Length = 149

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 55/138 (39%), Positives = 82/138 (59%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I   EF
Sbjct: 11  AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVDADGNGTIDFPEF 69

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            S+++        + EL +AF  FD D +G ISA EL +V   +G+ + T E+   MI  
Sbjct: 70  LSLMARKMKDTDTEEELVEAFKVFDRDGNGLISAAELRHVMTNLGE-KLTDEEVDEMIRE 128

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG + +E+F RMM
Sbjct: 129 ADVDGDGHINYEEFVRMM 146



>sp|P27166|CALM_STYLE Calmodulin (CaM).
          Length = 148

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 55/138 (39%), Positives = 82/138 (59%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I   EF
Sbjct: 10  AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVDADGNGTIDFPEF 68

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            S+++        + EL +AF  FD D +G ISA EL +V   +G+ + T E+   MI  
Sbjct: 69  LSLMARKMKDTDTEEELVEAFKVFDRDGNGLISAAELRHVMTNLGE-KLTDEEVDEMIRE 127

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG + +E+F RMM
Sbjct: 128 ADVDGDGHINYEEFVRMM 145



>sp|P05933|CALM_SCHPO Calmodulin (CaM).>pir|A26614|MCZP calmodulin -
           fission yeast (Schizosaccharomyces
           pombe)>gb:SPAC3A12_1717797 S.pombe chromosome I cosmid
           c3A12.>gb:YSPCAM1A_1731048 Schizosaccharomyces pombe
           cam1 gene encoding calmodulin, complete cds.
          Length = 150

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 52/138 (37%), Positives = 83/138 (60%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L DRD DG I   EL  ++  +G + P+  EL+ M++EVD DG+G I   EF
Sbjct: 12  AEFREAFSLFDRDQDGNITSNELGVVMRSLG-QSPTAAELQDMINEVDADGNGTIDFTEF 70

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            ++++        + E+R+AF  FD D +G I+ EEL +V  ++G+ R + E+   MI  
Sbjct: 71  LTMMARKMKDTDNEEEVREAFKVFDKDGNGYITVEELTHVLTSLGE-RLSQEEVADMIRE 129

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG + +E+F R++
Sbjct: 130 ADTDGDGVINYEEFSRVI 147



>sp|P11121|CALM_PYUSP Calmodulin (CaM).>pir|JK0015|MCAZS calmodulin
           - sea squirt
          Length = 148

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 56/150 (37%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DGDG I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGDGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F  MM
Sbjct: 116 LTDEEVDEMIREADIDGDGQVNYEEFVTMM 145



 Score = 44.7 bits (104), Expect = 0.003
 Identities = 23/65 (35%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 84  EIREAFRVFDKDGNGFISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 142

Query: 527 VLSSA 541
            + ++
Sbjct: 143 TMMTS 147



>gb:AB178711_2140839 Synthetic construct YC2.60 gene for yellow
           cameleon 2.60, complete cds.
          Length = 653

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 55/152 (36%), Positives = 92/152 (60%), Gaps = 1/152 (0%)
 Frame = +2

Query: 302 LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE 481
           ++D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++E
Sbjct: 230 MHDQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINE 284

Query: 482 VDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGD 658
           VD DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+
Sbjct: 285 VDADGNGTIYFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGE 344

Query: 659 SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            + T E+   MI   D +GDG V +E+F +MM
Sbjct: 345 -KLTDEEVDEMIREADIDGDGQVNYEEFVQMM 375



>gb:BC008437_1971379 Homo sapiens calmodulin 2 (phosphorylase
           kinase, delta), mRNA (cDNA clone MGC:14639
           IMAGE:4092978), complete cds.
          Length = 149

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 55/150 (36%), Positives = 91/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+  +MI   D +GDG V +E+F +MM
Sbjct: 117 LTDEEVDQMIREADIDGDGQVNYEEFVQMM 146



 Score = 45.8 bits (107), Expect = 0.001
 Identities = 24/65 (36%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 85  EIREAFRVFDKDGNGYISAAELRHVMTNLG-EKLTDEEVDQMIREADIDGDGQVNYEEFV 143

Query: 527 VLSSA 541
            + +A
Sbjct: 144 QMMTA 148



>gb:AF089808_1767313 Pyricularia grisea calmodulin gene, complete
           cds.>gb:AF103729_1768232 Pyricularia grisea calmodulin
           (cam) gene, complete cds.
          Length = 149

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 91/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D ++ +++S    E  +AF L D+D DG+I  +EL  ++  +G + PS  EL+ M++EVD
Sbjct: 3   DSLTEEQVS----EFKEAFSLFDKDGDGQITTKELGTVMRSLG-QNPSESELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            D +G I   EF ++++        + E+R+AF FFD D++G ISA EL +V  +IG+ +
Sbjct: 58  ADNNGTIDFPEFLTMMARKMKDTDSEEEIREAFKFFDRDNNGFISAAELRHVMTSIGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T ++   MI   D +GDG + + +F ++M
Sbjct: 117 LTDDEVDEMIREADQDGDGRIDYNEFVQLM 146



>pir|T06644|T06644 calmodulin homolog T20K18.210 - Arabidopsis
           thaliana>gb:ATCHRIV35_1545050 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           35.>gb:ATT20K18_1555023 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T20K18 (ESSA project).
          Length = 152

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 54/138 (39%), Positives = 84/138 (60%), Gaps = 2/138 (1%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           EL + F++ D++ DGKI K EL+     VG   P  E +  M++++D +GDG + ++EF 
Sbjct: 5   ELSRVFQMFDKNGDGKIAKNELKDFFKSVGIMVPENE-INEMIAKMDVNGDGAMDIDEFG 63

Query: 527 VLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC-TLEDCRRMILG 700
            L         + E +R+AF  FD + DG I+ EEL +V  ++G  +  TLEDC++MI  
Sbjct: 64  SLYQEMVEEKEEEEDMREAFRVFDQNGDGFITDEELRSVLASMGLKQGRTLEDCKKMISK 123

Query: 701 VDNNGDGFVCFEDFCRMM 754
           VD +GDG V F++F +MM
Sbjct: 124 VDVDGDGMVNFKEFKQMM 141



 Score = 42.7 bits (99), Expect = 0.012
 Identities = 24/96 (25%), Positives = 45/96 (46%)
 Frame = +2

Query: 452 REELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEEL 631
           R EL  +    D++GDG I+  E      +      ++E+ +     D + DG +  +E 
Sbjct: 3   RGELSRVFQMFDKNGDGKIAKNELKDFFKSVGIMVPENEINEMIAKMDVNGDGAMDIDEF 62

Query: 632 FNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFED 739
            ++++ + + +   ED R      D NGDGF+  E+
Sbjct: 63  GSLYQEMVEEKEEEEDMREAFRVFDQNGDGFITDEE 98



>pir|B45594|MCZQF calmodulin - malaria parasite (Plasmodium
           falciparum)>gb:AE014187_938789 Plasmodium falciparum 3D7
           chromosome 14 complete sequence.>gb:AE014821_1227865
           Plasmodium falciparum 3D7 chromosome 14 section 6 of 13
           of the complete sequence.>gb:PFACALMO_1393652 Plasmodium
           falciparum calmodulin gene, complete
           cds.>gb:PFACAM_1393655 P.falciparum calmodulin gene,
           complete cds.
          Length = 149

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++E+D
Sbjct: 3   DKLTEEQIS----EFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEID 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL +AF  FD D DG ISA+EL +V   +G+ +
Sbjct: 58  TDGNGTIDFPEFLTLMARKLKDTDTEEELIEAFRVFDRDGDGYISADELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F +MM
Sbjct: 117 LTNEEVDEMIREADIDGDGQINYEEFVKMM 146



>pir|A32005|MCKM calmodulin - Chlamydomonas
           reinhardtii>gb:CRECAM_1673311 C.reinhardtii calmodulin
           gene, complete cds.
          Length = 163

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 57/138 (41%), Positives = 82/138 (59%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M+SEVD DG+G I   EF
Sbjct: 14  AEFKEAFALFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMISEVDADGNGTIDFPEF 72

Query: 524 SVLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            +L +        + ELR+AF  FD D +G ISA EL +V   +G+ + + E+   MI  
Sbjct: 73  LMLMARKMKETDHEDELREAFKVFDKDGNGFISAAELRHVMTNLGE-KLSEEEVDEMIRE 131

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG V +E+F RMM
Sbjct: 132 ADVDGDGQVNYEEFVRMM 149



 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 28/74 (37%), Positives = 44/74 (59%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           EL +AFK+ D+D +G I   EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct: 88  ELREAFKVFDKDGNGFISAAELRHVMTNLG-EKLSEEEVDEMIREADVDGDGQVNYEEFV 146

Query: 527 VLSSAFAPPSCDSE 568
            + ++ A    D +
Sbjct: 147 RMMTSGATDDKDKK 160



>pir|A03022|MCEE calmodulin - electric eel>gb:ELCCALMA_2571685
           E.electricus calmodulin mRNA, complete cds.
          Length = 149

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 55/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMAKKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F +MM
Sbjct: 117 LTDEEVDEMIREADIDGDGQVNYEEFVQMM 146



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 24/65 (36%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 85  EIREAFRVFDKDGNGYISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 143

Query: 527 VLSSA 541
            + +A
Sbjct: 144 QMMTA 148



>sp|P25070|TCH2_ARATH Calmodulin-related protein 2,
           touch-induced.>gb:AB016873_1512928 Arabidopsis thaliana
           genomic DNA, chromosome 5, TAC
           clone:K22F20.>gb:AY086500_1571548 Arabidopsis thaliana
           clone 25475 mRNA, complete sequence.>gb:AF026473_1762199
           Arabidopsis thaliana calmodulin-related protein (TCH2)
           gene, complete cds.
          Length = 161

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 52/145 (35%), Positives = 90/145 (62%), Gaps = 5/145 (3%)
 Frame = +2

Query: 335 GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISL 514
           G   ++ + F+  D++ DGKI  +EL+ ++  + +   S EE   M+ + D DG+G I L
Sbjct: 13  GSMDDIKKVFQRFDKNGDGKISVDELKEVIRAL-SPTASPEETVTMMKQFDLDGNGFIDL 71

Query: 515 EEFSVLSSAFAPPSCD-----SELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLED 679
           +EF  L         +     S+L++AF+ +D D +G+ISA+EL +V K +G+ +C+++D
Sbjct: 72  DEFVALFQIGIGGGGNNRNDVSDLKEAFELYDLDGNGRISAKELHSVMKNLGE-KCSVQD 130

Query: 680 CRRMILGVDNNGDGFVCFEDFCRMM 754
           C++MI  VD +GDG V F++F +MM
Sbjct: 131 CKKMISKVDIDGDGCVNFDEFKKMM 155



 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 25/65 (38%), Positives = 45/65 (69%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           ++L +AF+L D D +G+I  +EL +++  +G E  S ++ + M+S+VD DGDGC++ +EF
Sbjct: 93  SDLKEAFELYDLDGNGRISAKELHSVMKNLG-EKCSVQDCKKMISKVDIDGDGCVNFDEF 151

Query: 524 SVLSS 538
             + S
Sbjct: 152 KKMMS 156



>sp|P62203|CALM_PLAF7 Calmodulin (CaM).>sp|P24044|CALM_PLAFA
           Calmodulin (CaM).
          Length = 148

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++E+D
Sbjct: 2   DKLTEEQIS----EFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEID 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL +AF  FD D DG ISA+EL +V   +G+ +
Sbjct: 57  TDGNGTIDFPEFLTLMARKLKDTDTEEELIEAFRVFDRDGDGYISADELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F +MM
Sbjct: 116 LTNEEVDEMIREADIDGDGQINYEEFVKMM 145



>sp|Q9UWF0|CALM_MAGGR Calmodulin (CaM).
          Length = 148

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 91/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D ++ +++S    E  +AF L D+D DG+I  +EL  ++  +G + PS  EL+ M++EVD
Sbjct: 2   DSLTEEQVS----EFKEAFSLFDKDGDGQITTKELGTVMRSLG-QNPSESELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            D +G I   EF ++++        + E+R+AF FFD D++G ISA EL +V  +IG+ +
Sbjct: 57  ADNNGTIDFPEFLTMMARKMKDTDSEEEIREAFKFFDRDNNGFISAAELRHVMTSIGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T ++   MI   D +GDG + + +F ++M
Sbjct: 116 LTDDEVDEMIREADQDGDGRIDYNEFVQLM 145



>sp|P02594|CALM_ELEEL Calmodulin (CaM).
          Length = 148

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 55/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLTMMAKKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F +MM
Sbjct: 116 LTDEEVDEMIREADIDGDGQVNYEEFVQMM 145



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 24/65 (36%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 84  EIREAFRVFDKDGNGYISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 142

Query: 527 VLSSA 541
            + +A
Sbjct: 143 QMMTA 147



>sp|P04352|CALM_CHLRE Calmodulin (CaM).
          Length = 162

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 57/138 (41%), Positives = 82/138 (59%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M+SEVD DG+G I   EF
Sbjct: 13  AEFKEAFALFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMISEVDADGNGTIDFPEF 71

Query: 524 SVLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            +L +        + ELR+AF  FD D +G ISA EL +V   +G+ + + E+   MI  
Sbjct: 72  LMLMARKMKETDHEDELREAFKVFDKDGNGFISAAELRHVMTNLGE-KLSEEEVDEMIRE 130

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG V +E+F RMM
Sbjct: 131 ADVDGDGQVNYEEFVRMM 148



 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 28/74 (37%), Positives = 44/74 (59%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           EL +AFK+ D+D +G I   EL  +++ +G E  S EE+  M+ E D DGDG ++ EEF 
Sbjct: 87  ELREAFKVFDKDGNGFISAAELRHVMTNLG-EKLSEEEVDEMIREADVDGDGQVNYEEFV 145

Query: 527 VLSSAFAPPSCDSE 568
            + ++ A    D +
Sbjct: 146 RMMTSGATDDKDKK 159



>gb:BT007488_2150420 Synthetic construct Homo sapiens calmodulin 1
           (phosphorylase kinase, delta) mRNA, partial
           cds.>gb:BT007567_2150499 Synthetic construct Homo
           sapiens calmodulin 3 (phosphorylase kinase, delta) mRNA,
           partial cds.>gb:BT007607_2150539 Synthetic construct
           Homo sapiens calmodulin 2 (phosphorylase kinase, delta)
           mRNA, partial cds.
          Length = 150

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 55/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F +MM
Sbjct: 117 LTDEEVDEMIREADIDGDGQVNYEEFVQMM 146



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 24/65 (36%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 85  EIREAFRVFDKDGNGYISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 143

Query: 527 VLSSA 541
            + +A
Sbjct: 144 QMMTA 148



>gb:AX441273_1468394 Sequence 4 from Patent
           EP1209167.>gb:RNO550759_2152701 Synthetic construct
           pN1-G-CaMP gene for calcium-sensing GFP analog.
          Length = 416

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 55/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 270 DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 324

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 325 ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGE-K 383

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F +MM
Sbjct: 384 LTDEEVDEMIREADIDGDGQVNYEEFVQMM 413



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 24/65 (36%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 352 EIREAFRVFDKDGNGYISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 410

Query: 527 VLSSA 541
            + +A
Sbjct: 411 QMMTA 415



>gb:AY341376_1321182 Pinctada fucata calmodulin mRNA, complete cds.
          Length = 149

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 55/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F +MM
Sbjct: 117 LTDEEVDEMIREADIDGDGQVNYEEFVKMM 146



>gb:AB063181_1197051 Metridium senile CaM mRNA for calmodulin,
           complete cds.>gb:AB063183_1197053 Metridium senile CaM
           gene for calmodulin, complete cds.
          Length = 149

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 55/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F +MM
Sbjct: 117 LTDEEVDEMIREADIDGDGQVNYEEFVKMM 146



>gb:CR859751_1183854 Pongo pygmaeus mRNA; cDNA DKFZp469L1534 (from
           clone DKFZp469L1534).
          Length = 149

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 55/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITAKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F +MM
Sbjct: 117 LTDEEVDEMIREADIDGDGQVNYEEFVQMM 146



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 24/65 (36%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 85  EIREAFRVFDKDGNGYISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 143

Query: 527 VLSSA 541
            + +A
Sbjct: 144 QMMTA 148



>gb:AK013695_1157606 Mus musculus adult male hippocampus cDNA, RIKEN
           full-length enriched library, clone:2900055D23
           product:calmodulin 1, full insert sequence.
          Length = 149

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 55/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F +MM
Sbjct: 117 LTDEEVDEMIREADIDGDGQVNYEEFLQMM 146



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 24/65 (36%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 85  EIREAFRVFDKDGNGYISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFL 143

Query: 527 VLSSA 541
            + +A
Sbjct: 144 QMMTA 148



>pir|A03029|MCDO calmodulin - slime mold (Dictyostelium discoideum) 
           (tentative sequence)
          Length = 151

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 54/153 (35%), Positives = 93/153 (60%), Gaps = 1/153 (0%)
 Frame = +2

Query: 299 ALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLS 478
           A +++++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++
Sbjct: 1   ASSZZLTEEQI----AEFKEAFSLFDKDGDGSITTKELGTVMRSLG-QNPTEAELQDMIN 55

Query: 479 EVDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG 655
           EVD DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V  ++G
Sbjct: 56  EVDADGNGNIDFPEFLTMMARKMQDTDTEEEIREAFKVFDKDGNGYISAAELRHVMTSLG 115

Query: 656 DSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
           + + T E+   MI   D +GDG V +++F +MM
Sbjct: 116 E-KLTNEEVDEMIREADLDGDGQVNYDEFVKMM 147



>pir|A03026|MCCHM calmodulin, striated muscle -
           chicken>gb:CHKCM11_2568916 Chicken cCM1 gene coding for
           a calmodulin-like protein.
          Length = 149

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 57/138 (41%), Positives = 79/138 (57%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L DRD DG I   EL  ++  +G + P+  EL+ M+ EVD DG G I   EF
Sbjct: 11  AEFKEAFSLFDRDGDGCITTMELGTVMRSLG-QNPTEAELQDMVGEVDADGSGTIDFPEF 69

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            S+++        + E+R+AF  FD D +G ISA EL +V   +G+ + T E+   MI  
Sbjct: 70  LSLMARKMRDSDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGE-KLTDEEVDEMIKE 128

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D N DG V +E+F RMM
Sbjct: 129 ADCNNDGQVNYEEFVRMM 146



>pir|I51202|I51202 calmodulin - duck>pir|A92394|MCCH calmodulin -
           chicken>pir|S48728|MCHU calmodulin [validated] -
           human>pir|S03206|MCRT calmodulin [validated] -
           rat>pir|JC1305|JC1305 calmodulin - Japanese
           medaka>pir|I51402|I51402 calmodulin - African clawed
           frog>pir|S37707|S37707 calmodulin -
           mouse>gb:AK004673_1152499 Mus musculus adult male lung
           cDNA, RIKEN full-length enriched library,
           clone:1200009I03 product:calmodulin 1, full insert
           sequence.>gb:AK012247_1156853 Mus musculus 11 days
           embryo whole body cDNA, RIKEN full-length enriched
           library, clone:2700016F01 product:calmodulin 2, full
           insert sequence.>gb:AK012564_1157029 Mus musculus 11
           days embryo whole body cDNA, RIKEN full-length enriched
           library, clone:2700084L11 product:calmodulin 2, full
           insert sequence.>gb:AK013068_1157305 Mus musculus 10, 11
           days embryo whole body cDNA, RIKEN full-length enriched
           library, clone:2810410I22 product:calmodulin 2, full
           insert sequence.>gb:AK088141_1175219 Mus musculus 2 days
           neonate thymus thymic cells cDNA, RIKEN full-length
           enriched library, clone:E430004P19 product:calmodulin 1,
           full insert sequence.>gb:AY880425_1180467 Gekko
           japonicus GekBS194P mRNA, complete
           cds.>gb:CR859086_1183223 Pongo pygmaeus mRNA; cDNA
           DKFZp459D046 (from clone
           DKFZp459D046).>gb:CR859453_1183569 Pongo pygmaeus mRNA;
           cDNA DKFZp469E1312 (from clone
           DKFZp469E1312).>gb:CR859976_1184073 Pongo pygmaeus mRNA;
           cDNA DKFZp459L2128 (from clone
           DKFZp459L2128).>gb:CR861201_1185211 Pongo pygmaeus mRNA;
           cDNA DKFZp459F053 (from clone
           DKFZp459F053).>gb:CR861371_1185370 Pongo pygmaeus mRNA;
           cDNA DKFZp459B012 (from clone
           DKFZp459B012).>gb:AB099053_1410376 Bos taurus mRNA for
           similar to calmodulin, partial cds, clone:
           ORCS12959.>gb:AY046946_1424344 Ovis aries calmodulin 2
           (CALM2) mRNA, complete cds.>gb:AX887973_1483426 Sequence
           3836 from Patent EP1033401.>gb:AC006536_1875171 Homo
           sapiens chromosome 14 clone BAC257P13 map 14q31,
           complete sequence.>gb:BC000454_1966736 Homo sapiens
           calmodulin 1 (phosphorylase kinase, delta), mRNA (cDNA
           clone MGC:8460 IMAGE:2821489), complete
           cds.>gb:BC003354_1968772 Homo sapiens calmodulin 2
           (phosphorylase kinase, delta), mRNA (cDNA clone MGC:5226
           IMAGE:2899899), complete cds.>gb:BC005137_1969628 Homo
           sapiens calmodulin 3 (phosphorylase kinase, delta), mRNA
           (cDNA clone MGC:1447 IMAGE:3504793), complete
           cds.>gb:BC006464_1970303 Homo sapiens calmodulin 2
           (phosphorylase kinase, delta), mRNA (cDNA clone MGC:2168
           IMAGE:3542044), complete cds.>gb:BC008597_1971448 Homo
           sapiens calmodulin 1 (phosphorylase kinase, delta), mRNA
           (cDNA clone MGC:17489 IMAGE:3452971), complete
           cds.>gb:BC011834_1973245 Homo sapiens calmodulin 1
           (phosphorylase kinase, delta), mRNA (cDNA clone
           MGC:20018 IMAGE:3942245), complete
           cds.>gb:BC017385_1976084 Homo sapiens calmodulin 2
           (phosphorylase kinase, delta), mRNA (cDNA clone
           MGC:22803 IMAGE:3681165), complete
           cds.>gb:BC018677_1976567 Homo sapiens calmodulin 2
           (phosphorylase kinase, delta), mRNA (cDNA clone
           MGC:27282 IMAGE:4656551), complete
           cds.>gb:BC026065_1978680 Homo sapiens calmodulin 2
           (phosphorylase kinase, delta), mRNA (cDNA clone
           MGC:22809 IMAGE:3683323), complete
           cds.>gb:BC047523_1983895 Homo sapiens calmodulin 1
           (phosphorylase kinase, delta), mRNA (cDNA clone
           MGC:26695 IMAGE:4819353), complete
           cds.>gb:BT006818_1990256 Homo sapiens calmodulin 1
           (phosphorylase kinase, delta) mRNA, complete
           cds.>gb:BT006855_1990293 Homo sapiens calmodulin 3
           (phosphorylase kinase, delta) mRNA, complete
           cds.>gb:BT009916_1991014 Homo sapiens calmodulin 2
           (phosphorylase kinase, delta) mRNA, complete
           cds.>gb:CR541990_1994216 Homo sapiens full open reading
           frame cDNA clone RZPDo834B0735D for gene CALM2,
           calmodulin 2 (phosphorylase kinase, delta); complete
           cds, incl. stopcodon.>gb:CR542021_1994247 Homo sapiens
           full open reading frame cDNA clone RZPDo834F0635D for
           gene CALM2, calmodulin 2 (phosphorylase kinase, delta);
           complete cds, without stopcodon.>gb:HSCALM2S04_2011245
           Homo sapiens calmodulin (CALM2) gene, exons 3-6, and
           complete cds.>gb:HSCALMG2_2011246 Human calmodulin
           (CALM1) gene, exons 2,3,4,5 and 6, and complete
           cds.>gb:HUMALDN_2029131 Human mRNA for calmodulin,
           complete cds.>gb:HUMCALCBP_2029804 Human calmodulin
           mRNA, complete cds.>gb:HUMCAM_2029825 Human calmodulin
           mRNA, complete cds.>gb:HUMCAMA_2029827 Human calmodulin
           mRNA, complete cds.>gb:AF178845_2058002 Rattus
           norvegicus calmodulin mRNA, complete
           cds.>gb:BC021347_2093387 Mus musculus calmodulin 2, mRNA
           (cDNA clone MGC:29145 IMAGE:4006686), complete
           cds.>gb:BC050926_2100554 Mus musculus calmodulin 3, mRNA
           (cDNA clone MGC:61409 IMAGE:6411878), complete
           cds.>gb:BC051444_2100745 Mus musculus calmodulin 2, mRNA
           (cDNA clone MGC:60634 IMAGE:30072702), complete
           cds.>gb:BC054805_2101841 Mus musculus calmodulin 1, mRNA
           (cDNA clone MGC:64720 IMAGE:6838207), complete
           cds.>gb:BC058485_2103266 Rattus norvegicus calmodulin 2,
           mRNA (cDNA clone MGC:72870 IMAGE:6921326), complete
           cds.>gb:BC063187_2105207 Rattus norvegicus calmodulin 3,
           mRNA (cDNA clone MGC:73021 IMAGE:6890866), complete
           cds.>gb:MMCALMOD_2114396 M.musculus mRNA for
           calmodulin.>gb:MUSCALMDA_2125368 Mouse calmodulin (Cam
           III) mRNA, complete cds.>gb:MUSCAM_2125378 Mus musculus
           calmodulin synthesis (CaM) cDNA, complete
           cds.>gb:RATCAM_2131687 Rat calmodulin mRNA, complete
           cds.>gb:RATCAMA_2131690 Rat calmodulin (RCM3) mRNA,
           complete cds.>gb:RATCAMB_2131691 Rat calmodulin mRNA,
           complete cds, clone prCM79.>gb:RNCAMI1_2134570
           R.norvegicus CaMI gene, exon 1 (and joined
           CDS).>gb:RNCAMII1_2134571 R.norvegicus CaMII gene, exon
           1 (and joined CDS).>gb:RNCAMIII_2134572 R.norvegicus
           CaMIII gene for calmodulin III.>gb:RNRCM1_2136303
           R.norvegicus mRNA for calmodulin
           (pRCM1).>gb:RSPRCM4_2138360 R.norvegicus mRNA for
           calmodulin.>gb:SYNARBCAL_2153065 A.punctulata synthetic
           calmodulin mRNA, complete cds.>gb:AF085250_2472358 Perca
           flavescens calmodulin (CAL1) mRNA, complete
           cds.>gb:AJ720728_2502915 Gallus gallus mRNA for
           hypothetical protein, clone 24e7.>gb:AL935145_2504888
           Zebrafish DNA sequence from clone CH211-173B9 in linkage
           group 20 Contains the calm1b gene for calmodulin 1b, the
           gene for a novel protein similar to proteasome (prosome,
           macropain) 26S subunit ATPase 1 (psmc1), the gene for a
           novel protein similar to vertebrate potassium channel
           subfamily K member 13 (KCNK13) and a novel gene
           (zgc:77655), complete sequence.>gb:AY627883_2540889
           Ctenopharyngodon idella calmodulin mRNA, complete
           cds.>gb:AY656698_2542400 Ctenopharyngodon idella
           calmodulin gene, complete cds.>gb:AY656699_2542401
           Carassius auratus calmodulin short form mRNA, complete
           cds.>gb:AY656700_2542402 Carassius auratus calmodulin
           long form mRNA, complete cds.>gb:BC044434_2548741 Danio
           rerio zgc:76987, mRNA (cDNA clone MGC:55591
           IMAGE:2643406), complete cds.>gb:BC045298_2549144 Danio
           rerio calmodulin 2, gamma, mRNA (cDNA clone MGC:55296
           IMAGE:2600247), complete cds.>gb:BC053150_2550542 Danio
           rerio zgc:63926, mRNA (cDNA clone MGC:63926
           IMAGE:6790866), complete cds.>gb:BC054600_2551010 Danio
           rerio calmodulin 2, beta (phosphorylase kinase, delta),
           mRNA (cDNA clone MGC:64036 IMAGE:6793395), complete
           cds.>gb:BC054973_2551178 Xenopus laevis calmodulin 2,
           mRNA (cDNA clone MGC:64460 IMAGE:6880839), complete
           cds.>gb:BC059427_2552404 Danio rerio calmodulin 2,
           delta, mRNA (cDNA clone MGC:73045 IMAGE:4143672),
           complete cds.>gb:BC059500_2552477 Danio rerio calmodulin
           1b, mRNA (cDNA clone MGC:73137 IMAGE:4790643), complete
           cds.>gb:BC065426_2553984 Danio rerio calmodulin 1b, mRNA
           (cDNA clone MGC:77596 IMAGE:6996363), complete
           cds.>gb:BC066752_2554588 Danio rerio zgc:76987, mRNA
           (cDNA clone MGC:76987 IMAGE:6525928), complete
           cds.>gb:BC068339_2555027 Danio rerio calmodulin 2,
           delta, mRNA (cDNA clone MGC:85641 IMAGE:6805537),
           complete cds.>gb:BC071404_2556145 Danio rerio calmodulin
           2, gamma, mRNA (cDNA clone MGC:86728 IMAGE:6897628),
           complete cds.>gb:BC072232_2556489 Xenopus laevis cDNA
           clone MGC:81515 IMAGE:6637306, complete
           cds.>gb:BC082143_2562503 Xenopus laevis MGC98355
           protein, mRNA (cDNA clone MGC:98355 IMAGE:7196920),
           complete cds.>gb:BC082340_2562577 Xenopus tropicalis
           cmd-1-prov protein, mRNA (cDNA clone MGC:79465
           IMAGE:5383674), complete cds.>gb:BC082735_2562877
           Xenopus tropicalis cmd-1-prov protein, mRNA (cDNA clone
           MGC:89835 IMAGE:7028720), complete
           cds.>gb:BC087213_2565070 Xenopus laevis hypothetical
           LOC495889, mRNA (cDNA clone MGC:98170 IMAGE:7201099),
           complete cds.>gb:CHKCALMA_2568849 Chicken calmodulin
           mRNA, complete cds.>gb:CHKCAM6_2568852 Chicken CaM gene
           encoding calmodulin, exon 6.>gb:DUKCA_2571428 Anas
           platyrhynchos mRNA for calmodulin, complete
           cds.>gb:XELCAMA_2581779 X.laevis calmodulin gene, mRNA,
           clone 11G2.>gb:XELCAMB_2581780 X.laevis calmodulin gene,
           mRNA, clone 71.
          Length = 149

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 55/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F +MM
Sbjct: 117 LTDEEVDEMIREADIDGDGQVNYEEFVQMM 146



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 24/65 (36%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 85  EIREAFRVFDKDGNGYISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 143

Query: 527 VLSSA 541
            + +A
Sbjct: 144 QMMTA 148



>sp|P02597|CALS_CHICK Calmodulin, striated muscle.
          Length = 148

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 57/138 (41%), Positives = 79/138 (57%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L DRD DG I   EL  ++  +G + P+  EL+ M+ EVD DG G I   EF
Sbjct: 10  AEFKEAFSLFDRDGDGCITTMELGTVMRSLG-QNPTEAELQDMVGEVDADGSGTIDFPEF 68

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            S+++        + E+R+AF  FD D +G ISA EL +V   +G+ + T E+   MI  
Sbjct: 69  LSLMARKMRDSDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGE-KLTDEEVDEMIKE 127

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D N DG V +E+F RMM
Sbjct: 128 ADCNNDGQVNYEEFVRMM 145



>sp|Q95NR9|CALM_METSE Calmodulin (CaM).
          Length = 148

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 55/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F +MM
Sbjct: 116 LTDEEVDEMIREADIDGDGQVNYEEFVKMM 145



>sp|P62144|CALM_ANAPL Calmodulin (CaM).>sp|P62157|CALM_BOVIN
           Calmodulin (CaM).>sp|P62149|CALM_CHICK Calmodulin
           (CaM).>sp|P62158|CALM_HUMAN Calmodulin
           (CaM).>sp|P62204|CALM_MOUSE Calmodulin
           (CaM).>sp|P62156|CALM_ONCSP Calmodulin
           (CaM).>sp|P62160|CALM_RABIT Calmodulin
           (CaM).>sp|P62161|CALM_RAT Calmodulin
           (CaM).>sp|P62151|CALM_TORCA Calmodulin
           (CaM).>sp|P62155|CALM_XENLA Calmodulin
           (CaM).>pir|A94541|MCON calmodulin -
           salmon>pir|A90719|MCBO calmodulin [validated] -
           bovine>gb:AX441271_1468392 Sequence 2 from Patent
           EP1209167.
          Length = 148

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 55/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F +MM
Sbjct: 116 LTDEEVDEMIREADIDGDGQVNYEEFVQMM 145



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 24/65 (36%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 84  EIREAFRVFDKDGNGYISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 142

Query: 527 VLSSA 541
            + +A
Sbjct: 143 QMMTA 147



>gb:AF084411_2141371 Synthetic construct calmodulin mutant SYNCAM57A
           gene, complete cds.
          Length = 149

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 55/150 (36%), Positives = 91/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++ A      + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARAMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AY656690_1620260 Daucus carota caomodulin cam-207 mRNA, complete
           cds.
          Length = 149

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMGSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYEEFVKVM 146



>gb:AB041711_1519702 Chara corallina cccam1 mRNA for calmodulin,
           complete cds.>gb:AB041712_1519703 Chara corallina cccam2
           mRNA for calmodulin, complete cds.>gb:AB044286_1520115
           Chara corallina ccam mRNA for calmodulin, complete cds.
          Length = 148

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 53/138 (38%), Positives = 83/138 (60%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           +E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I   EF
Sbjct: 10  SEFKEAFSLFDKDGDGSITTKELGTVMRSLG-QNPTEAELQDMINEVDVDGNGTIDFHEF 68

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            ++++        + EL++AF  FD D +G ISA EL +V   +G+ + T E+   MI  
Sbjct: 69  LNLMARKMKDTDSEEELKEAFKVFDKDQNGYISAAELRHVMTNLGE-KLTDEEVDEMIRE 127

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG V +E+F +MM
Sbjct: 128 ADVDGDGQVNYEEFVKMM 145



>gb:TVU38786_1401278 Trichomonas vaginalis calmodulin (CAM) and E2
           ubiquitin-conjugating enzyme (TvUBC1) genes, partial
           cds.
          Length = 134

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 50/133 (37%), Positives = 79/133 (59%), Gaps = 1/133 (0%)
 Frame = +2

Query: 359 AFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS-VLS 535
           AF + D+D DG+I  +EL  ++  +G + PS  EL+ M++E+D DG+G I  +EF  +++
Sbjct: 1   AFNIFDKDGDGRITAKELGTVMRSLG-QNPSEAELQDMINEIDLDGNGTIEFDEFLYMMN 59

Query: 536 SAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNG 715
                   + E++DAF  FD D DGKI+A EL +V K +G+   T E+   MI   D N 
Sbjct: 60  RQMKEGDTEEEIKDAFRVFDKDGDGKITAAELAHVMKNLGEP-LTQEEVDEMIAQADTNK 118

Query: 716 DGFVCFEDFCRMM 754
           DG + + +F  +M
Sbjct: 119 DGIIDYGEFVHLM 131



 Score = 43.1 bits (100), Expect = 0.009
 Identities = 28/102 (27%), Positives = 46/102 (45%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AEL      ID D +G I  +E   ++++   E  + EE++      D+DGDG I+  E 
Sbjct: 32  AELQDMINEIDLDGNGTIEFDEFLYMMNRQMKEGDTEEEIKDAFRVFDKDGDGKITAAEL 91

Query: 524 SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKT 649
           + +      P    E+ +     DT+ DG I   E  ++  T
Sbjct: 92  AHVMKNLGEPLTQEEVDEMIAQADTNKDGIIDYGEFVHLMLT 133



>gb:SDO18166_1397395 Suberites domuncula mRNA for calmodulin.
          Length = 149

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 55/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  TDGNGTIDFPEFLTMMARKMKETDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F  MM
Sbjct: 117 LTDEEVDEMIREADTDGDGQVNYEEFVGMM 146



>gb:DDICALA_1377025 Dictyostelium discoideum calmodulin (calA) gene,
           complete cds.
          Length = 152

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 53/138 (38%), Positives = 84/138 (60%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I   EF
Sbjct: 13  AEFKEAFSLFDKDGDGSITTKELGTVMRSLG-QNPTEAELQDMINEVDADGNGNIDFPEF 71

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            ++++        + E+R+AF  FD D +G ISA EL +V  ++G+ + T E+   MI  
Sbjct: 72  LTMMARKMQDTDTEEEIREAFKVFDKDGNGYISAAELRHVMTSLGE-KLTNEEVDEMIRE 130

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG V +++F +MM
Sbjct: 131 ADLDGDGQVNYDEFVKMM 148



>gb:AB063182_1197052 Halichondria okadai CaM mRNA for calmodulin,
           complete cds.>gb:AB063184_1197054 Halichondria okadai
           CaM gene for calmodulin, complete cds.
          Length = 149

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 56/152 (36%), Positives = 89/152 (58%), Gaps = 1/152 (0%)
 Frame = +2

Query: 302 LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE 481
           + D +S +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++E
Sbjct: 1   MTDALSEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINE 55

Query: 482 VDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGD 658
           VD DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+
Sbjct: 56  VDADGNGTIDFPEFLTMMARKMKETDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE 115

Query: 659 SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            + T E+   MI   D +GDG V +E+F  MM
Sbjct: 116 -KLTDEEVDEMIREADIDGDGQVNYEEFVAMM 146



 Score = 44.7 bits (104), Expect = 0.003
 Identities = 23/65 (35%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 85  EIREAFRVFDKDGNGFISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 143

Query: 527 VLSSA 541
            + ++
Sbjct: 144 AMMTS 148



>gb:AB022702_1194077 Physarum polycephalum CaM mRNA for calmodulin,
           complete cds.
          Length = 149

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 53/138 (38%), Positives = 84/138 (60%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I   EF
Sbjct: 11  AEFKEAFSLFDKDGDGNITTKELGTVMRSLG-QNPTEAELQDMINEVDADGNGTIDFPEF 69

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            ++++   A    + E+R+AF  FD D +G ISA EL +V   +G+ + + E+   MI  
Sbjct: 70  LTMMARKMADTDTEEEIREAFKVFDKDGNGFISAAELRHVMTNLGE-KLSDEEVDEMIRE 128

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG V +++F +MM
Sbjct: 129 ADVDGDGQVNYDEFVKMM 146



>gb:AK010118_1155547 Mus musculus adult male tongue cDNA, RIKEN
           full-length enriched library, clone:2310068O22
           product:CALMODULIN homolog [Metridium senile], full
           insert sequence.
          Length = 149

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 51/150 (34%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++E+D
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGSITTQELGTVMRSLG-QNPTEAELQGMVNEID 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
           +DG+G +   EF +++S        + E+R+AF  FD D +G +SA EL +V   +G+ +
Sbjct: 58  KDGNGTVDFPEFLTMMSRKMKDTDSEEEIREAFRVFDKDGNGFVSAAELRHVMTKLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            + E+   MI   D +GDG V +E+F  M+
Sbjct: 117 LSDEEVDEMIQAADTDGDGQVNYEEFVHML 146



>pir|S58311|S58311 calmodulin - Bidens pilosa>gb:BPCALMGEN_1633983
           B.pilosa mRNA for calmodulin.
          Length = 149

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISARELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYEEFVKVM 146



>pir|S10995|MCUTC calmodulin - Trypanosoma cruzi>gb:TCCALB2_1399667
           Trypanosoma cruzi CalA2 calmodulin gene.
          Length = 149

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D++S +++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLSNEQIS----EFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
           +DG G I   EF ++++        + E+++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  QDGSGTIDFPEFLTLMARKMQDSDSEEEIKEAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F +MM
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYEEFVKMM 146



>sp|P04464|CALM_WHEAT Calmodulin (CaM).
          Length = 148

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTDEQI----AEFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D DG ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQDGFISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 116 LTDEEVDEMIREADVDGDGQINYEEFVKVM 145



>sp|P18061|CALM_TRYCR Calmodulin (CaM).
          Length = 148

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D++S +++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLSNEQIS----EFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
           +DG G I   EF ++++        + E+++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  QDGSGTIDFPEFLTLMARKMQDSDSEEEIKEAFRVFDKDGNGFISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F +MM
Sbjct: 116 LTDEEVDEMIREADVDGDGQINYEEFVKMM 145



>sp|O97341|CALM_SUBDO Calmodulin (CaM).
          Length = 148

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 55/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  TDGNGTIDFPEFLTMMARKMKETDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F  MM
Sbjct: 116 LTDEEVDEMIREADTDGDGQVNYEEFVGMM 145



>sp|O96102|CALM_PHYPO Calmodulin (CaM).
          Length = 148

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 53/138 (38%), Positives = 84/138 (60%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I   EF
Sbjct: 10  AEFKEAFSLFDKDGDGNITTKELGTVMRSLG-QNPTEAELQDMINEVDADGNGTIDFPEF 68

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            ++++   A    + E+R+AF  FD D +G ISA EL +V   +G+ + + E+   MI  
Sbjct: 69  LTMMARKMADTDTEEEIREAFKVFDKDGNGFISAAELRHVMTNLGE-KLSDEEVDEMIRE 127

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG V +++F +MM
Sbjct: 128 ADVDGDGQVNYDEFVKMM 145



>sp|P02599|CALM_DICDI Calmodulin (CaM).
          Length = 151

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 53/138 (38%), Positives = 84/138 (60%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I   EF
Sbjct: 12  AEFKEAFSLFDKDGDGSITTKELGTVMRSLG-QNPTEAELQDMINEVDADGNGNIDFPEF 70

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            ++++        + E+R+AF  FD D +G ISA EL +V  ++G+ + T E+   MI  
Sbjct: 71  LTMMARKMQDTDTEEEIREAFKVFDKDGNGYISAAELRHVMTSLGE-KLTNEEVDEMIRE 129

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG V +++F +MM
Sbjct: 130 ADLDGDGQVNYDEFVKMM 147



>gb:AF084453_2141412 Synthetic construct calmodulin mutant SYNCAM34
           gene, complete cds.
          Length = 149

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/150 (36%), Positives = 91/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG+V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGWVNYEEFVQVM 146



>gb:AB178714_2140842 Synthetic construct YC3.60pm gene for yellow
           cameleon 3.60-pm, complete cds.
          Length = 691

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/152 (35%), Positives = 92/152 (60%), Gaps = 1/152 (0%)
 Frame = +2

Query: 302 LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE 481
           ++D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++E
Sbjct: 230 MHDQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINE 284

Query: 482 VDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGD 658
           VD DG+G I   EF ++++        + E+R+AF  FD D +G ISA +L +V   +G+
Sbjct: 285 VDADGNGTIYFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAQLRHVMTNLGE 344

Query: 659 SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            + T E+   MI   D +GDG V +E+F +MM
Sbjct: 345 -KLTDEEVDEMIREADIDGDGQVNYEEFVQMM 375



>gb:AB178712_2140840 Synthetic construct YC3.60 gene for yellow
           cameleon 3.60, complete cds.
          Length = 653

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/152 (35%), Positives = 92/152 (60%), Gaps = 1/152 (0%)
 Frame = +2

Query: 302 LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE 481
           ++D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++E
Sbjct: 230 MHDQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINE 284

Query: 482 VDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGD 658
           VD DG+G I   EF ++++        + E+R+AF  FD D +G ISA +L +V   +G+
Sbjct: 285 VDADGNGTIYFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAQLRHVMTNLGE 344

Query: 659 SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            + T E+   MI   D +GDG V +E+F +MM
Sbjct: 345 -KLTDEEVDEMIREADIDGDGQVNYEEFVQMM 375



>gb:AF150059_1772546 Brassica napus calmodulin (CaM1) mRNA, complete
           cds.
          Length = 149

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 53/150 (35%), Positives = 91/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA+EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISADELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T ++   MI   D +GDG + +E+F ++M
Sbjct: 117 LTDDEVDEMIREADVDGDGQINYEEFVKVM 146



>gb:SCO318521_1708917 Solanum commersonii mRNA for putative
           calmodulin (caM3 gene).
          Length = 149

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTESELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLVARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYEEFVKVM 146



>gb:PETCALPRO_1699839 Petunia hybrida CAM53 mRNA, complete cds.
          Length = 184

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYEEFVKVM 146



>gb:HAU79736_1681549 Helianthus annuus calmodulin (HaCaM) mRNA,
           complete cds.
          Length = 149

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYEEFVKVM 146



>gb:CACAM1_1644848 C.annuum mRNA for calmodulin-1.
          Length = 150

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 52/150 (34%), Positives = 88/150 (58%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+  
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKL 117

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
              E+   MI   D +GDG + +++F ++M
Sbjct: 118 TDEEEVDEMIREADVDGDGQIQYDEFVKVM 147



>gb:AY656688_1620258 Daucus carota calmodulin cam-205 mRNA, complete
           cds.
          Length = 149

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQIS----EFKEAFSLFDKDGDGCIATKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYEEFVKVM 146



>gb:AY656686_1620256 Daucus carota calmodulin cam-203 mRNA, complete
           cds.
          Length = 149

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGRINYEEFVKVM 146



>gb:AY364011_1602813 Daucus carota calmodulin 4 mRNA, partial
           cds.>gb:AY364012_1602814 Daucus carota calmodulin 8
           mRNA, partial cds.
          Length = 150

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYEEFVKVM 146



>gb:AY116967_1579127 Arabidopsis thaliana AT3g22930/F5N5_10 mRNA,
           complete cds.>gb:AF428309_1799239 Arabidopsis thaliana
           AT3g22930/F5N5_10 mRNA, complete
           cds.>gb:AP001300_1821006 Arabidopsis thaliana genomic
           DNA, chromosome 3, BAC clone:F5N5.
          Length = 173

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 52/137 (37%), Positives = 84/137 (61%), Gaps = 1/137 (0%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF- 523
           E  +AF L D+D DG I  +EL  ++  +  + P+ +EL+ M++E+D DG+G I   EF 
Sbjct: 35  EFKEAFCLFDKDGDGCITADELATVIRSLD-QNPTEQELQDMITEIDSDGNGTIEFSEFL 93

Query: 524 SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV 703
           +++++       D EL++AF  FD D +G ISA EL +V   +G+ + T E+  +MI   
Sbjct: 94  NLMANQLQETDADEELKEAFKVFDKDQNGYISASELRHVMINLGE-KLTDEEVDQMIKEA 152

Query: 704 DNNGDGFVCFEDFCRMM 754
           D +GDG V +++F RMM
Sbjct: 153 DLDGDGQVNYDEFVRMM 169



>gb:AB076905_1197653 Ciona intestinalis Ci-CaM mRNA for calmodulin
           homologue, complete cds.>gb:CICAM_1372255 Ciona
           intestinalis mRNA for calmodulin.
          Length = 149

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 55/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F  MM
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVNMM 146



>pir|G85041|G85041 probable calmodulin [imported] - Arabidopsis
           thaliana>gb:AC005275_1532360 Arabidopsis thaliana BAC
           F4C21 from chromosome IV, top arm, near 17 cM, complete
           sequence.>gb:ATCHRIV8_1547310 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 8.>gb:BT003938_1637062
           Arabidopsis thaliana clone RAFL15-24-E07 (R20727)
           putative calmodulin (At4g03290) mRNA, complete
           cds.>gb:BT005119_1638065 Arabidopsis thaliana clone
           U20727 putative calmodulin (At4g03290) mRNA, complete
           cds.
          Length = 154

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 52/142 (36%), Positives = 85/142 (59%), Gaps = 5/142 (3%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           EL + F++ D+D DGKI  +EL      +G   P  +EL  ++ ++D +GDGC+ +EEF 
Sbjct: 5   ELNRVFQMFDKDGDGKITTKELNESFKNLGIIIPE-DELTQIIQKIDVNGDGCVDIEEFG 63

Query: 527 VLSSAFAPPSCDS----ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC-TLEDCRRM 691
            L         D     ++++AF+ FD + DG I+ +EL  V  ++G  +  TLE+CR+M
Sbjct: 64  ELYKTIMVEDEDEVGEEDMKEAFNVFDRNGDGFITVDELKAVLSSLGLKQGKTLEECRKM 123

Query: 692 ILGVDNNGDGFVCFEDFCRMME 757
           I+ VD +GDG V + +F +MM+
Sbjct: 124 IMQVDVDGDGRVNYMEFRQMMK 145



 Score = 42.7 bits (99), Expect = 0.012
 Identities = 24/60 (40%), Positives = 34/60 (56%)
 Frame = +2

Query: 563 SELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDF 742
           +EL   F  FD D DGKI+ +EL   FK +G      ++  ++I  +D NGDG V  E+F
Sbjct: 4   TELNRVFQMFDKDGDGKITTKELNESFKNLG-IIIPEDELTQIIQKIDVNGDGCVDIEEF 62



>pir|A03025|MCWT calmodulin - wheat
          Length = 149

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 53/138 (38%), Positives = 83/138 (60%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I   EF
Sbjct: 11  AEFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVDADGNGTIDFPEF 69

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            ++++        + EL++AF  FD D DG ISA EL +V   +G+ + T E+   MI  
Sbjct: 70  LNLMARKMKDTDSEEELKEAFRVFDKDQDGFISAAELRHVMTNLGE-KLTDEEVDEMIRE 128

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG + +E+F ++M
Sbjct: 129 ADVDGDGQINYEEFVKVM 146



>pir|A03028|MCUTG calmodulin - Trypanosoma brucei
           gambiense>pir|A48111|A48111 calmodulin C - Trypanosoma
           brucei>gb:TBCALUBG_1398992 T. brucei genes for
           calmodulin, EFH5 and ubiquitin.
          Length = 149

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D++S +++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLSNEQIS----EFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
           +DG G I   EF ++++        + E+++AF  FD D +G ISA EL ++   +G+ +
Sbjct: 58  QDGSGTIDFPEFLTLMARKMQDSDSEEEIKEAFRVFDKDGNGFISAAELRHIMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F +MM
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYEEFVKMM 146



>pir|S16138|MCPZDC calmodulin - carrot>pir|S22971|S22971 calmodulin
           - trumpet lily>pir|S40301|S40301 calmodulin - red
           bryony>pir|S70768|S70768 calmodulin CAM81 - garden
           petunia>pir|T47417|T47417 calmodulin 7 [similarity] -
           Arabidopsis thaliana>gb:AB050839_1521030 Nicotiana
           tabacum mRNA for calmodulin NtCaM3, complete
           cds.>gb:AB050840_1521031 Nicotiana tabacum mRNA for
           calmodulin NtCaM4, complete cds.>gb:AB050841_1521032
           Nicotiana tabacum mRNA for calmodulin NtCaM5, complete
           cds.>gb:AB050842_1521033 Nicotiana tabacum mRNA for
           calmodulin NtCaM6, complete cds.>gb:AB050843_1521034
           Nicotiana tabacum mRNA for calmodulin NtCaM7, complete
           cds.>gb:AB050844_1521035 Nicotiana tabacum mRNA for
           calmodulin NtCaM8, complete cds.>gb:AB050847_1521038
           Nicotiana tabacum mRNA for calmodulin NtCaM11, complete
           cds.>gb:AB050848_1521039 Nicotiana tabacum mRNA for
           calmodulin NtCaM12, complete cds.>gb:ATT28A8_1555555
           Arabidopsis thaliana DNA chromosome 3, BAC clone
           T28A8.>gb:AY088477_1573496 Arabidopsis thaliana clone
           7008 mRNA, complete sequence.>gb:AY297816_1596495
           Euphorbia characias calmodulin mRNA, complete
           cds.>gb:AY543014_1612778 Daucus carota calmodulin cam-11
           mRNA, complete cds.>gb:AY543015_1612779 Daucus carota
           calmodulin cam-16 mRNA, complete
           cds.>gb:AY656685_1620255 Daucus carota calmodulin
           cam-202 mRNA, complete cds.>gb:AY656687_1620257 Daucus
           carota calmodulin cam-204 mRNA, complete
           cds.>gb:AY656691_1620261 Daucus carota calmodulin
           cam-208 mRNA, complete cds.>gb:AY656692_1620262 Daucus
           carota calmodulin cam-209 mRNA, complete
           cds.>gb:DCCAM1G_1675656 Carrot Ccam-1 gene for
           calmodulin.>gb:LILCALMODU_1684923 Lilium longiflorum
           calmodulin mRNA, complete cds.>gb:LLCALMOD_1685071
           L.longiflorum mRNA encoding
           calmodulin.>gb:MDCAMR_1685921 M.domestica CaM mRNA for
           calmodulin.>gb:PETCAM81_1699840 Petunia hybrida CAM81
           mRNA,.>gb:PSU13882_1702466 Pisum sativum Alaska
           calmodulin mRNA, complete cds.>gb:AF178073_1774663
           Arabidopsis thaliana calmodulin 7 (CAM7) mRNA, complete
           cds.>gb:AF292108_1783766 Prunus avium calmodulin mRNA,
           complete cds.>gb:AF295637_1783945 Elaeis guineensis
           calmodulin mRNA, complete cds.>gb:AF494219_1805159
           Medicago truncatula calmodulin 1 mRNA, complete
           cds.>gb:AJ843114_1814499 Plantago major mRNA for
           calmodulin (cam1 gene).>gb:AJ843115_1814500 Plantago
           major mRNA for calmodulin (cam2 gene).
          Length = 149

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYEEFVKVM 146



>pir|A35603|MCPP calmodulin - Paramecium
           tetraurelia>gb:PARCAM_1391598 P.tetraurelia calmodulin
           gene, complete cds.>gb:S68025_1396769 CAM=calmodulin
           [Paramecium tetraurelia, Genomic, 636
           nt].>gb:AY618352_2145800 Cloning vector pVZ-CAM.fa,
           complete sequence.
          Length = 149

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/138 (39%), Positives = 82/138 (59%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I   EF
Sbjct: 11  AEFKEAFALFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVDADGNGTIDFPEF 69

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            S+++        + EL +AF  FD D +G ISA EL +V   +G+ + T ++   MI  
Sbjct: 70  LSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGE-KLTDDEVDEMIRE 128

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG + +E+F RMM
Sbjct: 129 ADIDGDGHINYEEFVRMM 146



>pir|A30900|MCBH calmodulin - barley>pir|S24952|S24952 calmodulin 1
           (clone lambda DASH) - rice>gb:BLYCAMA_1633130 Barley cam
           gene encoding calmodulin, complete cds.>gb:CACAM_1644847
           Cicer arietinum mRNA for CaM
           protein.>gb:OSCALMOD1_1692812 O.sativa gene encoding
           calmodulin.>gb:RICCALMODU_1703562 Oryza sativa
           calmodulin gene, complete cds.>gb:S81594_1704612
           auxin-regulated calmodulin [Vigna radiata=mung bean,
           Wilczek, seedling, mRNA, 921 nt].>gb:SOYSCAM2X_1716099
           Soybean calmodulin (SCaM-2) mRNA, complete
           cds.>gb:TAU48242_1724720 Triticum aestivum calmodulin
           TaCaM1-1 mRNA, complete cds.>gb:TAU48688_1724721
           Triticum aestivum calmodulin TaCaM1-2 mRNA, complete
           cds.>gb:TAU48689_1724722 Triticum aestivum calmodulin
           TaCaM1-3 mRNA, complete cds.>gb:TAU48693_1724726
           Triticum aestivum calmodulin TaCaM3-1 mRNA, complete
           cds.>gb:TAU49103_1724729 Triticum aestivum calmodulin
           TaCaM3-2 mRNA, complete cds.>gb:TAU49104_1724730
           Triticum aestivum calmodulin TaCaM3-3 mRNA, complete
           cds.>gb:TAU49105_1724731 Triticum aestivum calmodulin
           TaCaM4-1 mRNA, complete cds.>gb:VIRCALMOD_1727242 Vigna
           radiata calmodulin mRNA, complete
           cds.>gb:AF042840_1763652 Oryza sativa clone F14605
           calmodulin (CaM1) mRNA, complete
           cds.>gb:AF441191_1800101 Oryza sativa clone 15079
           calmodulin (CaM) mRNA, complete cds.>gb:AP000969_1820692
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 1, clone:P0011D01.>gb:AP003813_1833730 Oryza
           sativa (japonica cultivar-group) genomic DNA, chromosome
           7, BAC clone:OJ1150_E04.>gb:AP003818_1833813 Oryza
           sativa (japonica cultivar-group) genomic DNA, chromosome
           7, BAC clone:OJ1200_C08.
          Length = 149

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQI----AEFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYEEFVKVM 146



>pir|S53006|S53006 calmodulin - leaf mustard>pir|S22503|S22503
           calmodulin [similarity] - Arabidopsis
           thaliana>pir|H84667|H84667 calmodulin (cam2) [imported]
           - Arabidopsis thaliana>gb:AC004261_1531627 Arabidopsis
           thaliana chromosome 2 clone T3K9 map CIC11C08, complete
           sequence.>gb:AC005623_1532851 Arabidopsis thaliana
           chromosome 2 clone T20P8 map B68, complete
           sequence.>gb:ATCAL_1544150 A.thaliana gene for
           calmodulin.>gb:ATHCAM2_1553089 A.thaliana calmodulin-2
           (cam2) mRNA, complete cds.>gb:ATHCAM3_1553090
           Arabidopsis thaliana cam-3 gene, complete
           cds.>gb:ATHCRP_1553135 Arabidopsis thaliana genes for
           calmodulin and calmodulin-related protein, complete
           cds.>gb:ATT8M16_1556494 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T8M16.>gb:AY046048_1561535
           Arabidopsis thaliana putative calmodulin-3 protein
           (At3g56800) mRNA, complete cds.>gb:AY057567_1563984
           Arabidopsis thaliana AT3g56800/T8M16_130 mRNA, complete
           cds.>gb:AY065179_1566333 Arabidopsis thaliana calmodulin
           (cam2) (At2g41110; T3K9.12) mRNA, complete
           cds.>gb:AY085660_1570728 Arabidopsis thaliana clone
           16715 mRNA, complete sequence.>gb:AY091301_1574505
           Arabidopsis thaliana putative calmodulin-3 protein
           (At3g56800) mRNA, complete cds.>gb:AY128752_1580832
           Arabidopsis thaliana calmodulin cam2 (At2g41110) mRNA,
           complete cds.>gb:BNACALM_1633389 Brassica juncea
           calmodulin mRNA, complete cds.>gb:BNU10150_1633651
           Brassica napus Naehan calmodulin (bcm1) mRNA, complete
           cds.>gb:BT002351_1635954 Arabidopsis thaliana clone
           C105327 putative calmodulin (At2g27030) mRNA, complete
           cds.>gb:AK175278_1817266 Arabidopsis thaliana mRNA for
           calmodulin, complete cds, clone:
           RAFL21-71-H09.>gb:AK176855_1818843 Arabidopsis thaliana
           mRNA for calmodulin, complete cds, clone: RAFL25-41-D23.
          Length = 149

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 117 LTDEEVDEMIKEADVDGDGQINYEEFVKVM 146



>sp|P04465|CALM_TRYBB Calmodulin (CaM).
          Length = 148

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D++S +++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLSNEQIS----EFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
           +DG G I   EF ++++        + E+++AF  FD D +G ISA EL ++   +G+ +
Sbjct: 57  QDGSGTIDFPEFLTLMARKMQDSDSEEEIKEAFRVFDKDGNGFISAAELRHIMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F +MM
Sbjct: 116 LTDEEVDEMIREADVDGDGQINYEEFVKMM 145



>sp|P21251|CALM_STIJA Calmodulin (CaM).>pir|JK0011|MCSFCU calmodulin
           - sea cucumber (Stichopus japonicus)
          Length = 148

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 55/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F  MM
Sbjct: 116 LTDEEVDEMIREADIDGDGQVNYEEFVTMM 145



 Score = 45.1 bits (105), Expect = 0.002
 Identities = 23/65 (35%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 84  EIREAFRVFDKDGNGYISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 142

Query: 527 VLSSA 541
            + ++
Sbjct: 143 TMMTS 147



>sp|P07463|CALM_PARTE Calmodulin (CaM).
          Length = 148

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/138 (39%), Positives = 82/138 (59%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I   EF
Sbjct: 10  AEFKEAFALFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVDADGNGTIDFPEF 68

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            S+++        + EL +AF  FD D +G ISA EL +V   +G+ + T ++   MI  
Sbjct: 69  LSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGE-KLTDDEVDEMIRE 127

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG + +E+F RMM
Sbjct: 128 ADIDGDGHINYEEFVRMM 145



>sp|P93171|CALM_HELAN Calmodulin (CaM).
          Length = 148

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTEDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 116 LTDEEVDEMIREADVDGDGQINYEEFVKVM 145



>sp|P11118|CALM_EUGGR Calmodulin (CaM).>pir|S21212|MCEG calmodulin -
           Euglena gracilis
          Length = 148

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 53/138 (38%), Positives = 83/138 (60%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD+DG G I   EF
Sbjct: 10  AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVDQDGSGTIDFPEF 68

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            +++S        + E+++AF  FD D +G ISA EL +V   +G+ + T E+   MI  
Sbjct: 69  LTLMSRKMHDTDTEEEIKEAFRVFDKDGNGFISAAELRHVMTNLGE-KLTDEEVDEMIRE 127

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG + +E+F +MM
Sbjct: 128 ADVDGDGQINYEEFVKMM 145



>sp|O02367|CALM_CIOIN Calmodulin (CaM) (Ci-CaM).
          Length = 148

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 55/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F  MM
Sbjct: 116 LTDEEVDEMIREADVDGDGQVNYEEFVNMM 145



>sp|P27164|CAL3_PETHY Calmodulin-related protein.
          Length = 183

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 116 LTDEEVDEMIREADVDGDGQINYEEFVKVM 145



>sp|P62163|CAL2_SOYBN Calmodulin 2 (CaM-2).>sp|P62162|CALM_HORVU
           Calmodulin (CaM).>sp|P29612|CALM_ORYSA Calmodulin (CaM).
          Length = 148

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTDDQI----AEFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 116 LTDEEVDEMIREADVDGDGQINYEEFVKVM 145



>sp|P25069|CAL2_ARATH Calmodulin 2/3/5.
          Length = 148

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 116 LTDEEVDEMIKEADVDGDGQINYEEFVKVM 145



>sp|P62200|CAL1_DAUCA Calmodulin 1/11/16 (CaM
           1/11/16).>sp|P62199|CAL1_PETHY Calmodulin 1 (CaM
           1).>sp|P59220|CAL7_ARATH Calmodulin
           7.>sp|P62202|CALM_BRYDI Calmodulin (CaM)
           (BC329).>sp|P62201|CALM_LILLO Calmodulin (CaM).
          Length = 148

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 116 LTDEEVDEMIREADVDGDGQINYEEFVKVM 145



>gb:AF084424_2141383 Synthetic construct calmodulin mutant SYNCAM3
           gene, complete cds.
          Length = 149

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 55/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ R
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGE-R 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AF084419_2141379 Synthetic construct calmodulin mutant SYNCAM64A
           gene, complete cds.
          Length = 147

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 58/149 (38%), Positives = 89/149 (59%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC 667
            DG+G I   EF  L  A      DSEL++AF  FD D +G ISA EL +V   +G+ + 
Sbjct: 58  ADGNGTIDFPEFLNLM-ARKMKDTDSELKEAFRVFDKDGNGFISAAELRHVMTNLGE-KL 115

Query: 668 TLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
           T E+   MI   D +GDG V +E+F ++M
Sbjct: 116 TDEEVDEMIREADVDGDGQVNYEEFVQVM 144



>gb:AP000815_1820615 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0003H10.
          Length = 149

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQI----AEFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +++F ++M
Sbjct: 117 LTDEEVEEMIREADVDGDGQINYDEFVKVM 146



>gb:AF030033_1762454 Phaseolus vulgaris calmodulin (CaM) mRNA,
           PvCaM-2 allele, complete cds.
          Length = 149

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 117 LTYEEVDEMIREADVDGDGQINYEEFVKVM 146



>gb:AY656693_1620263 Daucus carota calmodulin cam-210 mRNA, complete
           cds.
          Length = 149

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   M+   D +GDG + +E+F ++M
Sbjct: 117 LTDEEVDEMVREADVDGDGQINYEEFVKVM 146



>gb:AB050837_1521028 Nicotiana tabacum mRNA for calmodulin NtCaM1,
           complete cds.>gb:AB050838_1521029 Nicotiana tabacum mRNA
           for calmodulin NtCaM2, complete
           cds.>gb:CAN010645_1645054 Capsicum annuum mRNA for
           calmodulin 3.>gb:SCO318522_1708918 Solanum commersonii
           mRNA for putative calmodulin (caM5
           gene).>gb:TOMCALM1LE_1725621 Tomato (L.esculentum)
           calmodulin mRNA, complete cds.
          Length = 149

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 55/138 (39%), Positives = 82/138 (59%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M+SEVD D +G I   EF
Sbjct: 11  AEFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMISEVDADQNGTIDFPEF 69

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            ++++        + EL++AF  FD D +G ISA EL +V   +G+ + T E+   MI  
Sbjct: 70  LNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGE-KLTDEEVDEMIRE 128

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG V +E+F RMM
Sbjct: 129 ADIDGDGQVNYEEFVRMM 146



>gb:LRU291615_1389057 Lumbricus rubellus mRNA for calmodulin
           (calmodulin gene).
          Length = 149

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 55/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F  MM
Sbjct: 117 LTDEEVDEMIREADIDGDGQVNYEEFVTMM 146



>gb:BLA133486_1355331 Branchiostoma lanceolatum mRNA for calmodulin
           2.
          Length = 149

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 54/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   M+   D +GDG V +E+F  MM
Sbjct: 117 LTDEEVDEMVREADIDGDGQVNYEEFVEMM 146



>gb:AY542983_1334439 Bigelowiella natans calmodulin mRNA, complete
           cds.
          Length = 154

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 52/138 (37%), Positives = 83/138 (60%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I   EF
Sbjct: 16  AEFKEAFSLFDKDGDGSITTKELGTVMRSLG-QNPTEAELQDMINEVDADGNGDIDFSEF 74

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            ++++        + E+++AF  FD D +G ISA EL +V   +G+ + T E+   MI  
Sbjct: 75  LTMMARKMKDTDSEDEIKEAFKVFDKDGNGYISAAELRHVMTNLGE-KLTDEEVDEMIRE 133

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG + +E+F +MM
Sbjct: 134 ADIDGDGQINYEEFVKMM 151



>gb:AB081567_1198121 Strongylocentrotus intermedius exCaM mRNA for
           calmodulin, complete cds.>gb:AB081569_1198123
           Strongylocentrotus intermedius CaM gene for calmodulin,
           complete cds.
          Length = 156

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 55/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 10  DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 64

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 65  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE-K 123

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F  MM
Sbjct: 124 LTDEEVDEMIREADIDGDGQVNYEEFVTMM 153



 Score = 44.7 bits (104), Expect = 0.003
 Identities = 23/65 (35%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 92  EIREAFRVFDKDGNGFISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 150

Query: 527 VLSSA 541
            + ++
Sbjct: 151 TMMTS 155



>gb:AB018797_1193809 Halocynthia roretzi gene for calmodulin B,
           complete cds.
          Length = 149

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 55/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMARKMKETDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F  MM
Sbjct: 117 LTDEEVDEMIREADIDGDGQVNYEEFVTMM 146



>gb:AY232217_1177510 Drosophila yakuba clone yak-ad_Cam mRNA
           sequence.
          Length = 146

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 55/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F  MM
Sbjct: 117 LTDEEVDEMIREADIDGDGQVNYEEFVTMM 146



>pir|E96689|E96689 calmodulin [imported] - Arabidopsis
           thaliana>gb:AE005173_894289 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AB016873_1512929 Arabidopsis thaliana
           genomic DNA, chromosome 5, TAC
           clone:K22F20.>gb:AC020665_1538593 Arabidopsis thaliana
           chromosome 1 BAC T27F4 genomic sequence, complete
           sequence.>gb:AC074025_1541185 Arabidopsis thaliana
           chromosome 1 BAC F28G11 genomic sequence, complete
           sequence.>gb:AY048276_1561737 Arabidopsis thaliana
           AT5g37780/K22F20_20 mRNA, complete
           cds.>gb:AY059809_1564653 Arabidopsis thaliana Unknown
           protein mRNA, complete cds.>gb:AY072520_1567337
           Arabidopsis thaliana unknown protein mRNA, complete
           cds.>gb:AY072628_1567376 Arabidopsis thaliana
           AT5g37780/K22F20_20 mRNA, complete
           cds.>gb:AY088476_1573495 Arabidopsis thaliana clone 6982
           mRNA, complete sequence.>gb:AY113902_1578313 Arabidopsis
           thaliana putative calmodulin-4 protein (At1g66410) mRNA,
           complete cds.>gb:AF370293_1792178 Arabidopsis thaliana
           putative calmodulin-4 protein (At1g66410) mRNA, complete
           cds.
          Length = 149

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 117 LTDEEVEEMIREADVDGDGQINYEEFVKIM 146



>pir|C96763|C96763 protein calmodulin F25P22.4 [imported] -
           Arabidopsis thaliana>gb:AE005173_894909 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC012679_1537772 Arabidopsis thaliana
           chromosome 1 BAC F25P22 genomic sequence, complete
           sequence.
          Length = 163

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 55/136 (40%), Positives = 80/136 (58%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           EL + F   D + DGKI   EL  +   +G    + EEL  +L E+D D DG I+ EEF+
Sbjct: 20  ELKKVFDKFDANGDGKISVSELGNVFKSMGTSY-TEEELNRVLDEIDIDCDGFINQEEFA 78

Query: 527 VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD 706
            +  +    S   E+R+AFD +D + +G IS+ E+  V   +G + C++EDC RMI  VD
Sbjct: 79  TICRS---SSSAVEIREAFDLYDQNKNGLISSSEIHKVLNRLGMT-CSVEDCVRMIGHVD 134

Query: 707 NNGDGFVCFEDFCRMM 754
            +GDG V FE+F +MM
Sbjct: 135 TDGDGNVNFEEFQKMM 150



 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 31/64 (48%), Positives = 42/64 (65%)
 Frame = +2

Query: 551 PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVC 730
           PS D EL+  FD FD + DGKIS  EL NVFK++G S  T E+  R++  +D + DGF+ 
Sbjct: 15  PSTDMELKKVFDKFDANGDGKISVSELGNVFKSMGTS-YTEEELNRVLDEIDIDCDGFIN 73

Query: 731 FEDF 742
            E+F
Sbjct: 74  QEEF 77



 Score = 42.7 bits (99), Expect = 0.012
 Identities = 23/65 (35%), Positives = 39/65 (60%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF L D++ +G I   E+  +L+++G    S E+   M+  VD DGDG ++ EEF 
Sbjct: 89  EIREAFDLYDQNKNGLISSSEIHKVLNRLGMTC-SVEDCVRMIGHVDTDGDGNVNFEEFQ 147

Query: 527 VLSSA 541
            + S+
Sbjct: 148 KMMSS 152



>pir|T31737|T31737 hypothetical protein T21H3.3 - Caenorhabditis
           elegans>gb:AB200392_1203203 Dugesia japonica CaM mRNA
           for calmodulin, complete cds.>gb:AB200393_1203204
           Dugesia japonica CaM gene for calmodulin, complete
           cds.>gb:AF016429_1232284 Caenorhabditis elegans cosmid
           T21H3, complete sequence.>gb:CEL132193_1365753
           Caenorhabditis elegans mRNA for calmodulin.
          Length = 149

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 55/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F  MM
Sbjct: 117 LTDEEVDEMIREADIDGDGQVNYEEFVTMM 146



 Score = 45.8 bits (107), Expect = 0.001
 Identities = 28/102 (27%), Positives = 46/102 (45%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AEL      +D D +G I   E   ++++   +  S EE+R      D+DG+G IS  E 
Sbjct: 47  AELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAEL 106

Query: 524 SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKT 649
             + +       D E+ +     D D DG+++ EE   +  T
Sbjct: 107 RHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTT 148



>pir|S01173|MCFF calmodulin [validated] - fruit fly (Drosophila
           melanogaster)>pir|S13248|MCGAC calmodulin - California
           sea hare>gb:AE013599_1131406 Drosophila melanogaster
           chromosome 2R, complete sequence.>gb:AE013599_1131407
           Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AB003081_1192825 Branchiostoma lanceolatum
           mRNA for calmodulin, complete cds.>gb:AB003082_1192826
           Branchiostoma floridae mRNA for calmodulin, complete
           cds.>gb:AB003083_1192827 Halocynthia roretzi mRNA for
           calmodulin, complete cds.>gb:AB018796_1193808
           Halocynthia roretzi gene for calmodulin A, complete
           cds.>gb:AB081568_1198122 Strongylocentrotus intermedius
           CaM mRNA for calmodulin, complete cds.>gb:ACCALM_1208246
           A.californica mRNA for calmodulin.>gb:AE003823_1226344
           Drosophila melanogaster chromosome 2R, section 27 of 74
           of the complete sequence.>gb:AE003823_1226345 Drosophila
           melanogaster chromosome 2R, section 27 of 74 of the
           complete sequence.>gb:AY036120_1288492 Aplysia
           californica calmodulin mRNA, complete
           cds.>gb:AY118890_1300612 Drosophila melanogaster LD01127
           full insert cDNA.>gb:AY603558_1340280 Culicoides
           sonorensis clone CsCAM1 calmodulin mRNA, complete
           cds.>gb:AY737546_1348940 Toxoptera citricida putative
           calmodulin mRNA, complete cds.>gb:BFRNAC_1355267
           B.floridae mRNA for calmodulin.>gb:BLRNAC_1355350
           B.lanceolatum mRNA for calmodulin.>gb:BT003282_1356793
           Drosophila melanogaster LD02334 full insert cDNA.
          Length = 149

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 55/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F  MM
Sbjct: 117 LTDEEVDEMIREADIDGDGQVNYEEFVTMM 146



 Score = 44.7 bits (104), Expect = 0.003
 Identities = 23/65 (35%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 85  EIREAFRVFDKDGNGFISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 143

Query: 527 VLSSA 541
            + ++
Sbjct: 144 TMMTS 148



>sp|Q8STF0|CALM_STRIE Calmodulin (CaM).
          Length = 155

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 55/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 9   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 63

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 64  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE-K 122

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F  MM
Sbjct: 123 LTDEEVDEMIREADIDGDGQVNYEEFVTMM 152



 Score = 44.7 bits (104), Expect = 0.003
 Identities = 23/65 (35%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 91  EIREAFRVFDKDGNGFISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 149

Query: 527 VLSSA 541
            + ++
Sbjct: 150 TMMTS 154



>sp|P27161|CALM_LYCES Calmodulin (CaM).
          Length = 148

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 55/138 (39%), Positives = 82/138 (59%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M+SEVD D +G I   EF
Sbjct: 10  AEFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMISEVDADQNGTIDFPEF 68

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            ++++        + EL++AF  FD D +G ISA EL +V   +G+ + T E+   MI  
Sbjct: 69  LNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGE-KLTDEEVDEMIRE 127

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG V +E+F RMM
Sbjct: 128 ADIDGDGQVNYEEFVRMM 145



>sp|Q9GRJ1|CALM_LUMRU Calmodulin (CaM).
          Length = 148

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 55/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F  MM
Sbjct: 116 LTDEEVDEMIREADIDGDGQVNYEEFVTMM 145



>sp|Q95NI4|CALM_HALOK Calmodulin (CaM).
          Length = 148

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 56/150 (37%), Positives = 88/150 (58%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D +S +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DALSEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLTMMARKMKETDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F  MM
Sbjct: 116 LTDEEVDEMIREADIDGDGQVNYEEFVAMM 145



 Score = 44.7 bits (104), Expect = 0.003
 Identities = 23/65 (35%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 84  EIREAFRVFDKDGNGFISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 142

Query: 527 VLSSA 541
            + ++
Sbjct: 143 AMMTS 147



>sp|O96081|CALB_HALRO Calmodulin B (CaM B).
          Length = 148

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 55/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLTMMARKMKETDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F  MM
Sbjct: 116 LTDEEVDEMIREADIDGDGQVNYEEFVTMM 145



>sp|Q9UB37|CAL2_BRALA Calmodulin 2 (CaM 2).
          Length = 148

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 54/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   M+   D +GDG V +E+F  MM
Sbjct: 116 LTDEEVDEMVREADIDGDGQVNYEEFVEMM 145



>sp|P62147|CAL1_BRAFL Calmodulin 1 (CaM 1).>sp|P62148|CAL1_BRALA
           Calmodulin 1 (CaM 1).>sp|P62153|CALA_HALRO Calmodulin A
           (CaM A).>sp|P62145|CALM_APLCA Calmodulin
           (CaM).>sp|P62152|CALM_DROME Calmodulin
           (CaM).>sp|P62154|CALM_LOCMI Calmodulin
           (CaM).>pir|JK0010|MCLQ calmodulin - migratory
           locust>gb:DMCAMR_1378504 Drosophila melanogaster
           calmodulin mRNA.
          Length = 148

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 55/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F  MM
Sbjct: 116 LTDEEVDEMIREADIDGDGQVNYEEFVTMM 145



 Score = 44.7 bits (104), Expect = 0.003
 Identities = 23/65 (35%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 84  EIREAFRVFDKDGNGFISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 142

Query: 527 VLSSA 541
            + ++
Sbjct: 143 TMMTS 147



>sp|P25854|CAL1_ARATH Calmodulin 1/4.
          Length = 148

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTDEQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 116 LTDEEVEEMIREADVDGDGQINYEEFVKIM 145



>gb:AY281363_2524709 Epinephelus akaara calmodulin (CAL1) mRNA,
           complete cds.
          Length = 149

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADIDGDGQVNYEEFVQIM 146



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 24/65 (36%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 85  EIREAFRVFDKDGNGYISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 143

Query: 527 VLSSA 541
            + +A
Sbjct: 144 QIMTA 148



>gb:AF081672_2472152 Gallus gallus calmodulin mRNA, complete cds.
          Length = 149

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 55/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E    MI   D +GDG V +E+F +MM
Sbjct: 117 LTDEQVDEMIRESDIDGDGQVNYEEFVQMM 146



 Score = 43.5 bits (101), Expect = 0.007
 Identities = 23/65 (35%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + E++  M+ E D DGDG ++ EEF 
Sbjct: 85  EIREAFRVFDKDGNGYISAAELRHVMTNLG-EKLTDEQVDEMIRESDIDGDGQVNYEEFV 143

Query: 527 VLSSA 541
            + +A
Sbjct: 144 QMMTA 148



>gb:AF084394_2141354 Synthetic construct calmodulin mutant SYNCAM10
           gene, complete cds.
          Length = 149

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AF264065_1781795 Blastocladiella emersonii calmodulin (CaM)
           gene, complete cds.
          Length = 149

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 51/150 (34%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL +M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELLVMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMARKMKDSDSEEEIKEAFKVFDKDGNGYISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            + ++   MI   D +GDG + +E+F +MM
Sbjct: 117 LSEDEVEEMIREADVDGDGQINYEEFVKMM 146



>gb:AF064552_1765465 Apium graveolens calmodulin mRNA, complete cds.
          Length = 150

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFLVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYEEFVKVM 146



>gb:POU91642_1701176 Pleurotus ostreatus calmodulin mRNA, complete
           cds.>gb:POU91643_1701177 Pleurotus ostreatus calmodulin
           (CaM) gene, complete cds.
          Length = 149

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 53/150 (35%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D++S +++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLSEEQIS----EFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMARKMRDTDSEEEIKEAFKVFDKDGNGYISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T  +   MI   D +GDG + +E+F +MM
Sbjct: 117 LTDNEVDEMIREADVDGDGQINYEEFVKMM 146



>gb:FSCAMF1_1679267 F.sylvatica mRNA for CaMF-1 protein.
          Length = 148

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 53/150 (35%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
           RDG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+  
Sbjct: 58  RDGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEK- 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
              ++   MI   D +GDG + +E+F ++M
Sbjct: 117 -LTDEVDEMIREADVDGDGQINYEEFVKVM 145



>gb:CACAM2_1644849 C.annuum mRNA for calmodulin-2.
          Length = 149

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 54/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF +L +        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLILMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +++F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYDEFVKVM 146



>pir|S58314|S58314 calmodulin - moss (Physcomitrella patens)
          Length = 149

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 52/151 (34%), Positives = 91/151 (60%), Gaps = 1/151 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DDLTEEQI----AEFKEAFSLFDKDGDGSITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA ++ +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAADVRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMME 757
            T E+   MI   D +GDG V +++F +MM+
Sbjct: 117 LTDEEVDEMIRDADVDGDGQVDYDEFVKMMK 147



 Score = 42.4 bits (98), Expect = 0.016
 Identities = 22/65 (33%), Positives = 39/65 (60%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           EL +AFK+ D+D +G I   ++  +++ +G E  + EE+  M+ + D DGDG +  +EF 
Sbjct: 85  ELKEAFKVFDKDQNGFISAADVRHVMTNLG-EKLTDEEVDEMIRDADVDGDGQVDYDEFV 143

Query: 527 VLSSA 541
            +  A
Sbjct: 144 KMMKA 148



>pir|A38278|MCHUNB calmodulin-related protein NB-1 -
           human>gb:AL732437_1932741 Human DNA sequence from clone
           RP11-116G8 on chromosome 10 Contains the NET1 gene for
           neuroepithelial cell transforming gene 1, the gene for
           calmodulin-like skin protein (CLSP), the CALML3 gene for
           calmodulin-like 3 (CLP) and four CpG islands, complete
           sequence.>gb:BC031889_1980264 Homo sapiens
           calmodulin-like 3, mRNA (cDNA clone MGC:30093
           IMAGE:4777524), complete cds.>gb:HSCAMPSG_2011260
           H.sapiens intronless calmodulin-like gene (CLP gene) for
           calmodulin-like protein.>gb:HUMNB1_2035060 Human NB-1
           mRNA, complete cds.
          Length = 149

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 52/150 (34%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ ++++    E  +AF L D+D DG I   EL  ++  +G + P+  ELR M+SE+D
Sbjct: 3   DQLTEEQVT----EFKEAFSLFDKDGDGCITTRELGTVMRSLG-QNPTEAELRDMMSEID 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
           RDG+G +   EF  +++        + E+R+AF  FD D +G +SA EL +V   +G+ +
Sbjct: 58  RDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            + E+   MI   D +GDG V +E+F R++
Sbjct: 117 LSDEEVDEMIRAADTDGDGQVNYEEFVRVL 146



>sp|O94739|CLM_PLEOS Calmodulin (CaM).
          Length = 148

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 53/150 (35%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D++S +++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLSEEQIS----EFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLTMMARKMRDTDSEEEIKEAFKVFDKDGNGYISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T  +   MI   D +GDG + +E+F +MM
Sbjct: 116 LTDNEVDEMIREADVDGDGQINYEEFVKMM 145



>sp|P11120|CALM_PLECO Calmodulin (CaM).>pir|JK0014|MCMRP calmodulin
           - cornucopia mushroom
          Length = 148

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 53/150 (35%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D++S +++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLSEEQIS----EFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLTMMARKMRDTDSEEEIKEAFKVFDKDGNGYISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T  +   MI   D +GDG + +E+F +MM
Sbjct: 116 LTDNEVDEMIREADIDGDGQINYEEFVKMM 145



>sp|Q39752|CALM_FAGSY Calmodulin (CaM).
          Length = 147

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 53/150 (35%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
           RDG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+  
Sbjct: 57  RDGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEK- 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
              ++   MI   D +GDG + +E+F ++M
Sbjct: 116 -LTDEVDEMIREADVDGDGQINYEEFVKVM 144



>sp|Q7T3T2|CALM_EPIAK Calmodulin (CaM).
          Length = 148

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 116 LTDEEVDEMIREADIDGDGQVNYEEFVQIM 145



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 24/65 (36%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 84  EIREAFRVFDKDGNGYISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 142

Query: 527 VLSSA 541
            + +A
Sbjct: 143 QIMTA 147



>sp|Q9HFY6|CALM_BLAEM Calmodulin (CaM).
          Length = 148

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 51/150 (34%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL +M++EVD
Sbjct: 2   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELLVMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLTMMARKMKDSDSEEEIKEAFKVFDKDGNGYISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            + ++   MI   D +GDG + +E+F +MM
Sbjct: 116 LSEDEVEEMIREADVDGDGQINYEEFVKMM 145



>sp|P27482|CALL_HUMAN Calmodulin-related protein NB-1
           (Calmodulin-like protein) (CLP).
          Length = 148

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 52/150 (34%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ ++++    E  +AF L D+D DG I   EL  ++  +G + P+  ELR M+SE+D
Sbjct: 2   DQLTEEQVT----EFKEAFSLFDKDGDGCITTRELGTVMRSLG-QNPTEAELRDMMSEID 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
           RDG+G +   EF  +++        + E+R+AF  FD D +G +SA EL +V   +G+ +
Sbjct: 57  RDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            + E+   MI   D +GDG V +E+F R++
Sbjct: 116 LSDEEVDEMIRAADTDGDGQVNYEEFVRVL 145



>gb:AF187305_2479191 Myxine glutinosa calmodulin (CaM) mRNA,
           complete cds.
          Length = 149

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EV+
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVN 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F +MM
Sbjct: 117 LTDEEVDEMIREADIDGDGQVNYEEFVQMM 146



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 24/65 (36%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 85  EIREAFRVFDKDGNGYISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 143

Query: 527 VLSSA 541
            + +A
Sbjct: 144 QMMTA 148



>gb:AF084420_2141380 Synthetic construct calmodulin mutant SYNCAM64B
           gene, complete cds.
          Length = 148

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 55/149 (36%), Positives = 88/149 (59%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC 667
            DG+G I   EF  L +     +   EL++AF  FD D +G ISA EL +V   +G+ + 
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEELKEAFRVFDKDGNGFISAAELRHVMTNLGE-KL 116

Query: 668 TLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
           T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 TDEEVDEMIREADVDGDGQVNYEEFVQVM 145



>gb:AF084414_2141374 Synthetic construct calmodulin mutant SYNCAM57D
           gene, complete cds.
          Length = 149

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARVMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AF084413_2141373 Synthetic construct calmodulin mutant SYNCAM57C
           gene, complete cds.
          Length = 149

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARGMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AB178713_2140841 Synthetic construct YC4.60 gene for yellow
           cameleon 4.60, complete cds.
          Length = 653

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 53/152 (34%), Positives = 92/152 (60%), Gaps = 1/152 (0%)
 Frame = +2

Query: 302 LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE 481
           ++D+++ +++    AE  +AF L D+D DG I  ++L  ++  +G + P+  EL+ M++E
Sbjct: 230 MHDQLTEEQI----AEFKEAFSLFDKDGDGTITTKQLGTVMRSLG-QNPTEAELQDMINE 284

Query: 482 VDRDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGD 658
           VD DG+G I   EF ++++        + E+R+AF  FD D +G ISA +L +V   +G+
Sbjct: 285 VDADGNGTIYFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAQLRHVMTNLGE 344

Query: 659 SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            + T E+   MI   D +GDG V +E+F +MM
Sbjct: 345 -KLTDEEVDEMIREADIDGDGQVNYEEFVQMM 375



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 28/107 (26%), Positives = 47/107 (43%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AEL      +D D +G I   E   ++++   +  S EE+R      D+DG+G IS  + 
Sbjct: 276 AELQDMINEVDADGNGTIYFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAQL 335

Query: 524 SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
             + +       D E+ +     D D DG+++ EE   +    G  R
Sbjct: 336 RHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKGGKR 382



>gb:BC086350_2109541 Rattus norvegicus calmodulin-like 3
           (predicted), mRNA (cDNA clone MGC:105977 IMAGE:7302843),
           complete cds.
          Length = 149

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 50/138 (36%), Positives = 83/138 (60%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++E+D+DG+G +   EF
Sbjct: 11  AEFKEAFSLFDKDGDGCITTQELGTVMRSLG-QNPTEAELQDMVNEIDKDGNGTVDFPEF 69

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            +++S        + E+R+AF  FD D +G +SA EL +V   +G+ + + E+   MI  
Sbjct: 70  LTMMSRKMKDTDSEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGE-KLSDEEVDEMIQA 128

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG V +E+F  M+
Sbjct: 129 ADTDGDGQVNYEEFVHML 146



>gb:BC005457_2089889 Mus musculus calmodulin-like 3, mRNA (cDNA
           clone MGC:6356 IMAGE:3493620), complete cds.
          Length = 149

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 50/150 (33%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++E+D
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGSITTQELGTVMRSLG-QNPTEAELQGMVNEID 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
           +DG+G +   +F +++S        + E+R+AF  FD D +G +SA EL +V   +G+ +
Sbjct: 58  KDGNGTVDFPKFLTMMSRKMKDTDSEEEIREAFRVFDKDGNGFVSAAELRHVMTKLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            + E+   MI   D +GDG V +E+F  M+
Sbjct: 117 LSDEEVDEMIQAADTDGDGQVNYEEFVHML 146



>gb:AC129718_1740644 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0088I06, complete
           sequence.>gb:AF042839_1763651 Oryza sativa calmodulin
           (CaM2) mRNA, complete cds.>gb:AF441190_1800100 Oryza
           sativa clone 15295 calmodulin (CaM) mRNA, complete cds.
          Length = 149

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYEEFVKVM 146



>gb:MSCALMODU_1687070 Mougeotia scalaris mRNA for calmodulin.
          Length = 149

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 53/150 (35%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGSITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA +  +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGYISAADWRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F +MM
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVKMM 146



>gb:BYNCALMOD_1644692 Bryonia dioica calmodulin (Bc329) mRNA,
           complete cds.
          Length = 149

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 54/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG   +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQTNYEEFVKVM 146



>gb:AY830128_1629335 Hevea brasiliensis calmodulin (CaM) mRNA,
           complete cds.>gb:AY830129_1629336 Hevea brasiliensis
           calmodulin (CaM) gene, complete cds.>gb:AF468661_1802476
           Stevia rebaudiana calmodulin mRNA, complete
           cds.>gb:AF474074_1803111 Stevia rebaudiana calmodulin
           mRNA, complete cds.
          Length = 148

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 54/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D ++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DPLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYEEFVKVM 146



>gb:AY656689_1620259 Daucus carota calmodulin cam-206 mRNA, complete
           cds.
          Length = 149

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 54/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++          EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSGEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYEEFVKVM 146



>gb:AB050845_1521036 Nicotiana tabacum mRNA for calmodulin NtCaM9,
           complete cds.>gb:AB050846_1521037 Nicotiana tabacum mRNA
           for calmodulin NtCaM10, complete
           cds.>gb:AY456265_1607168 Nicotiana attenuata calmodulin
           mRNA, complete cds.>gb:BOL427338_1633831 Brassica
           oleracea mRNA for calmodulin 2 (cam2
           gene).>gb:CAU83402_1645579 Capsicum annuum calmodulin
           mRNA, complete cds.>gb:AC136471_1743198 Solanum demissum
           chromosome 11 BAC PGEC561 genomic sequence, complete
           sequence.>gb:AF108889_1768641 Capsicum annuum calmodulin
           mRNA, complete cds.
          Length = 149

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +++F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYDEFVKVM 146



>gb:DDICAL_1377024 D.discoideum calmodulin mRNA, partial cds.
          Length = 139

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 52/137 (37%), Positives = 83/137 (60%), Gaps = 1/137 (0%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF- 523
           E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I   EF 
Sbjct: 1   EFKEAFSLFDKDGDGSITTKELGTVMRSLG-QNPTEAELQDMINEVDADGNGNIDFPEFL 59

Query: 524 SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV 703
           ++++        + E+R+AF  FD D +G ISA EL +V  ++G+ + T E+   MI   
Sbjct: 60  TMMARKMQDTDTEEEIREAFKVFDKDGNGYISAAELRHVMTSLGE-KLTNEEVDEMIREA 118

Query: 704 DNNGDGFVCFEDFCRMM 754
           D +GDG V +++F +MM
Sbjct: 119 DLDGDGQVNYDEFVKMM 135



 Score = 42.0 bits (97), Expect = 0.021
 Identities = 24/95 (25%), Positives = 45/95 (47%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AEL      +D D +G I   E   ++++   +  + EE+R      D+DG+G IS  E 
Sbjct: 36  AELQDMINEVDADGNGNIDFPEFLTMMARKMQDTDTEEEIREAFKVFDKDGNGYISAAEL 95

Query: 524 SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEE 628
             + ++      + E+ +     D D DG+++ +E
Sbjct: 96  RHVMTSLGEKLTNEEVDEMIREADLDGDGQVNYDE 130



>gb:AY269783_1315013 Branchiostoma belcheri tsingtaunese calmodulin
           mRNA, complete cds.
          Length = 149

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 55/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVTTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F  MM
Sbjct: 117 LTDEEVDEMIREADIDGDGQVNYEEFVTMM 146



 Score = 43.5 bits (101), Expect = 0.007
 Identities = 23/65 (35%), Positives = 40/65 (61%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  + + +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 85  EIREAFRVFDKDGNGFISAAELRHVTTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 143

Query: 527 VLSSA 541
            + ++
Sbjct: 144 TMMTS 148



>pir|S22860|S22860 calmodulin 2 (clone lambda DASH) -
           rice>gb:OSCALMOD2_1692813 O.sativa gene encoding
           calmodulin.>gb:RICCALMODL_1703561 Oryza sativa
           calmodulin gene, complete cds.
          Length = 149

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQI----AEFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +++F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYDEFVKVM 146



>pir|S60237|S60237 calmodulin PCM2/PCM4/PCM5/PCM6/PCM7/PCM8 -
           potato>gb:SCO318520_1708916 Solanum commersonii mRNA for
           putative calmodulin (caM1 gene).>gb:STU20294_1722977
           Solanum tuberosum clone PCM5 calmodulin gene, complete
           cds.>gb:STU20295_1722978 Solanum tuberosum clone PCM6
           calmodulin mRNA, complete cds.>gb:STU20296_1722979
           Solanum tuberosum clone PCM7 calmodulin gene, complete
           cds.>gb:STU20297_1722980 Solanum tuberosum clone PCM8
           calmodulin gene, complete cds.
          Length = 149

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +++F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYDEFVKVM 146



>pir|A91104|MCRB calmodulin - rabbit (tentative sequence)
          Length = 148

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   + +GDG V +E+F +MM
Sbjct: 116 LTDEEVDEMIREANIDGDGQVNYEEFVQMM 145



 Score = 43.5 bits (101), Expect = 0.007
 Identities = 23/65 (35%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E + DGDG ++ EEF 
Sbjct: 84  EIREAFRVFDKDGNGYISAAELRHVMTNLG-EKLTDEEVDEMIREANIDGDGQVNYEEFV 142

Query: 527 VLSSA 541
            + +A
Sbjct: 143 QMMTA 147



>sp|Q9U6D3|CALM_MYXGL Calmodulin (CaM).
          Length = 148

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EV+
Sbjct: 2   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVN 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F +MM
Sbjct: 116 LTDEEVDEMIREADIDGDGQVNYEEFVQMM 145



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 24/65 (36%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 84  EIREAFRVFDKDGNGYISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 142

Query: 527 VLSSA 541
            + +A
Sbjct: 143 QMMTA 147



>sp|O82018|CALM_MOUSC Calmodulin (CaM).
          Length = 148

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 53/150 (35%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTEEQI----AEFKEAFSLFDKDGDGSITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA +  +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGYISAADWRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F +MM
Sbjct: 116 LTDEEVDEMIREADVDGDGQVNYEEFVKMM 145



>sp|P93087|CALM_CAPAN Calmodulin (CaM).
          Length = 148

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +++F ++M
Sbjct: 116 LTDEEVDEMIREADVDGDGQINYDEFVKVM 145



>gb:AY513748_2535813 Oreochromis mossambicus calmodulin mRNA,
           complete cds.
          Length = 149

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 55/150 (36%), Positives = 88/150 (58%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL  V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRYVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E    MI   D +GDG V +E+F +MM
Sbjct: 117 LTDEXVDEMIREADIDGDGQVNYEEFVQMM 146



 Score = 43.1 bits (100), Expect = 0.009
 Identities = 23/65 (35%), Positives = 40/65 (61%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + E +  M+ E D DGDG ++ EEF 
Sbjct: 85  EIREAFRVFDKDGNGYISAAELRYVMTNLG-EKLTDEXVDEMIREADIDGDGQVNYEEFV 143

Query: 527 VLSSA 541
            + +A
Sbjct: 144 QMMTA 148



>gb:AB110086_2465478 Trachemys scripta elegans TPCS mRNA for
           troponin C, complete cds.
          Length = 161

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 53/144 (36%), Positives = 78/144 (54%), Gaps = 4/144 (2%)
 Frame = +2

Query: 338 LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLE 517
           + AE   AF + D D  G I  +EL  ++  +G + P++EEL  ++ EVD DG G I  E
Sbjct: 17  MIAEFKAAFDMFDADGGGDISTKELGTVMRMLG-QTPTKEELDAIIEEVDEDGSGTIDFE 75

Query: 518 EFSVL----SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCR 685
           EF V+        A    + EL + F  FD + DG I AEEL  +F+  G+S  T E+  
Sbjct: 76  EFLVMMVRQMKEDAKGKSEEELAECFRIFDKNADGYIDAEELTEIFRASGES-VTEEEIE 134

Query: 686 RMILGVDNNGDGFVCFEDFCRMME 757
            ++   D N DG + F++F +MME
Sbjct: 135 ELMKDGDKNNDGRIDFDEFLKMME 158



>gb:AB055386_2462717 Clemmys japonica CaM-C III mRNA for calmodulin,
           partial cds.
          Length = 136

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 53/134 (39%), Positives = 80/134 (59%), Gaps = 1/134 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I   EF
Sbjct: 4   AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVDADGNGTIDFPEF 62

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            ++++        + E+R+AF  FD D DG ISA EL +V   +G+ + T E+   MI  
Sbjct: 63  LTMMARKMKDTDSEEEIREAFRVFDKDGDGYISAAELRHVMTNLGE-KLTDEEVDEMIRE 121

Query: 701 VDNNGDGFVCFEDF 742
            D +GDG V +E+F
Sbjct: 122 ADIDGDGQVNYEEF 135



>gb:SYNCAM_2153134 Synthetic construct VU1 calmodulin gene, complete
           cds.>gb:SYNGCAL_2153273 Synthetic calmodulin gene,
           complete cds.
          Length = 149

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AF084438_2141397 Synthetic construct calmodulin mutant SYNCAM45
           gene, complete cds.
          Length = 149

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEKELKEAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AF084436_2141395 Synthetic construct calmodulin mutant SYNCAM43
           gene, complete cds.
          Length = 149

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 53/150 (35%), Positives = 92/150 (61%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P++++L+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTKKKLQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AF084431_2141390 Synthetic construct calmodulin mutant SYNCAM9
           gene, complete cds.
          Length = 149

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGWISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AF084425_2141384 Synthetic construct calmodulin mutant SYNCAM5
           gene, complete cds.
          Length = 149

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELVTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AF084421_2141381 Synthetic construct calmodulin mutant SYNCAM71A
           gene, complete cds.
          Length = 149

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 26/65 (40%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           EL +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 85  ELKEAFRVFDKDGNGFISAAELRHVMTNLG-EKLTDEEVDEMIREADVDGDGQVNYEEFV 143

Query: 527 VLSSA 541
            + SA
Sbjct: 144 QVMSA 148



>gb:AF084412_2141372 Synthetic construct calmodulin mutant SYNCAM57B
           gene, complete cds.
          Length = 149

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMAREMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AF084395_2141355 Synthetic construct calmodulin mutant SYNCAM11
           gene, complete cds.
          Length = 149

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARPMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AF084393_2141353 Synthetic construct calmodulin mutant SYNCAM6
           gene, complete cds.
          Length = 149

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARPLKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AF084391_2141351 Synthetic construct calmodulin mutant SYNCAM2
           gene, complete cds.
          Length = 149

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELVTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARPLKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AY650306_1958253 Macaca fascicularis calmodulin 1 mRNA, partial
           cds.
          Length = 141

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 53/137 (38%), Positives = 82/137 (59%), Gaps = 1/137 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I   EF
Sbjct: 7   AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVDADGNGTIDFPEF 65

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            ++++        + E+R+AF  FD D +G ISA EL +V   +G+ + T E+   MI  
Sbjct: 66  LTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGE-KLTDEEVDEMIRE 124

Query: 701 VDNNGDGFVCFEDFCRM 751
            D +GDG V +E+F +M
Sbjct: 125 ADIDGDGQVNYEEFVQM 141



>gb:AP003260_1826564 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0468B07.
          Length = 187

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 55/150 (36%), Positives = 87/150 (58%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D++S +++     E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M+SEVD
Sbjct: 3   DQLSEEQIG----EFREAFSLFDKDGDGSITTKELGTVMRSLG-QNPTEAELQDMISEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            D +G I  +EF  +++        + EL++AF  FD D +G ISA EL +V   IG+ R
Sbjct: 58  TDSNGNIEFKEFLGLMARKLRDKDSEEELKEAFRVFDKDQNGFISATELRHVMANIGE-R 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F + M
Sbjct: 117 LTDEEVGEMISEADVDGDGQINYEEFVKCM 146



>gb:TAU48691_1724724 Triticum aestivum calmodulin TaCaM2-2 mRNA,
           complete cds.>gb:TAU48692_1724725 Triticum aestivum
           calmodulin TaCaM2-3 mRNA, complete cds.
          Length = 149

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 52/150 (34%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQI----AEFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   M+   D +GDG + +++F ++M
Sbjct: 117 LTDEEVDEMVREADVDGDGQINYDEFVKVM 146



>gb:OSCALM_1692811 O.sativa mRNA for
           calmodulin.>gb:ZMCALMODU_1731786 Zea mays mRNA for
           calmodulin.>gb:AF030034_1762455 Phaseolus vulgaris
           calmodulin (CaM) mRNA, PvCaM-3 allele, complete cds.
          Length = 149

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYEEFVKVM 146



>gb:TGCM_1400127 T.gondii mRNA for calmodulin.
          Length = 146

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 54/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL +AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTLMARKMKDTDTEEELIEAFKVFDRDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F +MM
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYEEFVKMM 146



>pir|S35187|S35187 calmodulin 6 - Arabidopsis
           thaliana>gb:ATCMACAM6_1548009 A.thaliana mRNA (clone
           ACaM6) for calmodulin.>gb:AY050350_1562129 Arabidopsis
           thaliana AT3g43810/T28A8_100 mRNA, complete
           cds.>gb:AY094037_1575543 Arabidopsis thaliana
           AT3g43810/T28A8_100 mRNA, complete
           cds.>gb:AC140977_1744071 Arabidopsis thaliana chromosome
           5 BAC F13M11 genomic sequence, complete sequence.
          Length = 149

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            + E+   MI   D +GDG + +E+F ++M
Sbjct: 117 LSDEEVDEMIREADVDGDGQINYEEFVKVM 146



>pir|S58709|S58709 calmodulin - Neurospora
           crassa>gb:CTU15993_1674259 Colletotrichum trifolii
           calmodulin (cam) gene, complete cds.>gb:NC94C8_1688823
           Neurospora crassa DNA linkage group V cosmid contig
           94C8.>gb:NCCALMOE_1690485 N.crassa mRNA for
           calmodulin.>gb:NEUCALMDLN_1690786 Neurospora crassa
           calmodulin gene, complete cds.>gb:AF034964_1762840
           Glomerella cingulata calmodulin (cam) mRNA, complete
           cds.
          Length = 149

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 52/150 (34%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D ++ +++S    E  +AF L D+D DG+I  +EL  ++  +G + PS  EL+ M++EVD
Sbjct: 3   DSLTEEQVS----EFKEAFSLFDKDGDGQITTKELGTVMRSLG-QNPSESELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            D +G I   EF ++++        + E+R+AF  FD D++G ISA EL +V  +IG+ +
Sbjct: 58  ADNNGTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T ++   MI   D +GDG + + +F ++M
Sbjct: 117 LTDDEVDEMIREADQDGDGRIDYNEFVQLM 146



>pir|I49567|I49567 calmodulin - mouse>gb:MUSCALMDB_2125369 Mouse
           calmodulin (Cam I) mRNA, complete cds.
          Length = 149

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 54/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D D  I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDNTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+R+AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F +MM
Sbjct: 117 LTDEEVDEMIREADIDGDGQVNYEEFVQMM 146



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 24/65 (36%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 85  EIREAFRVFDKDGNGYISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 143

Query: 527 VLSSA 541
            + +A
Sbjct: 144 QMMTA 148



>pir|T02887|T02887 probable calmodulin - rice>gb:OSU37936_1698442
           Oryza sativa clone pFDRSC61 novel calmodulin-like
           protein mRNA, complete cds.>gb:AF064456_1765462 Oryza
           sativa subsp. indica calmodulin-like protein gene,
           complete cds.>gb:AF231026_1779162 Oryza sativa
           calmodulin-like protein mRNA, complete cds.
          Length = 187

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 55/150 (36%), Positives = 87/150 (58%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D++S +++     E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M+SEVD
Sbjct: 3   DQLSEEQI----VEFREAFSLFDKDGDGSITTKELGTVMRSLG-QNPTEAELQDMISEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            D +G I  +EF  +++        + EL++AF  FD D +G ISA EL +V   IG+ R
Sbjct: 58  ADSNGNIEFKEFLGLMARKLRDKDSEEELKEAFRVFDKDQNGFISAAELRHVMANIGE-R 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F + M
Sbjct: 117 LTDEEVGEMISEADVDGDGQINYEEFVKCM 146



>pir|S10533|MCAA calmodulin - alfalfa>gb:MSCAL1_1687069 Alfalfa cal1
           mRNA for calmodulin.>gb:SOYSCAM1X_1716098 Soybean
           calmodulin (SCaM-1) mRNA, complete
           cds.>gb:SOYSCAM3X_1716100 Soybean calmodulin (SCaM-3)
           mRNA, complete cds.>gb:VIRCALMODU_1727243 Vigna radiata
           calmodulin mRNA, complete cds.>gb:AF030032_1762453
           Phaseolus vulgaris calmodulin (CaM) mRNA, PvCaM-1
           allele, complete cds.>gb:AF494220_1805160 Medicago
           truncatula calmodulin 2 mRNA, complete cds.
          Length = 149

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYEEFVKVM 146



>sp|P17928|CALM_MEDSA Calmodulin (CaM).
          Length = 148

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTDEQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 116 LTDEEVDEMIREADVDGDGQINYEEFVKVM 145



>sp|P61861|CALM_COLGL Calmodulin (CaM).>sp|P61860|CALM_COLTR
           Calmodulin (CaM).>sp|P61859|CALM_NEUCR Calmodulin (CaM).
          Length = 148

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 52/150 (34%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D ++ +++S    E  +AF L D+D DG+I  +EL  ++  +G + PS  EL+ M++EVD
Sbjct: 2   DSLTEEQVS----EFKEAFSLFDKDGDGQITTKELGTVMRSLG-QNPSESELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            D +G I   EF ++++        + E+R+AF  FD D++G ISA EL +V  +IG+ +
Sbjct: 57  ADNNGTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T ++   MI   D +GDG + + +F ++M
Sbjct: 116 LTDDEVDEMIREADQDGDGRIDYNEFVQLM 145



>sp|Q03509|CAL6_ARATH Calmodulin 6.
          Length = 148

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            + E+   MI   D +GDG + +E+F ++M
Sbjct: 116 LSDEEVDEMIREADVDGDGQINYEEFVKVM 145



>gb:AF084452_2141411 Synthetic construct calmodulin mutant SYNCAM33
           gene, complete cds.
          Length = 149

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGWIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AF084450_2141409 Synthetic construct calmodulin mutant SYNCAM31
           gene, complete cds.
          Length = 149

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDWEEELKEAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AF084434_2141393 Synthetic construct calmodulin mutant SYNCAM24
           gene, complete cds.
          Length = 149

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 53/138 (38%), Positives = 83/138 (60%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I   EF
Sbjct: 11  AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVDADGNGTIDFPEF 69

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            ++++        + EL++AF  FD D +G ISA EL +V   +G+ + T E+   MI  
Sbjct: 70  LNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGE-KLTDEEVDEMIRE 128

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG V +E+F ++M
Sbjct: 129 ADVDGDGQVNYEEFVQVM 146



>gb:AF084416_2141376 Synthetic construct calmodulin mutant SYNCAM58C
           gene, complete cds.
          Length = 149

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G++ 
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEN- 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AF084401_2141361 Synthetic construct calmodulin mutant SYNCAM49
           gene, complete cds.
          Length = 149

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 52/138 (37%), Positives = 85/138 (61%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P++++L+ M++EVD DG+G I   EF
Sbjct: 11  AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTKKKLQDMINEVDADGNGTIDFPEF 69

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            ++++        + EL++AF  FD D +G ISA EL +V   +G+ + T E+   MI  
Sbjct: 70  LNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGE-KLTDEEVDEMIRE 128

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG V +E+F ++M
Sbjct: 129 ADVDGDGQVNYEEFVQVM 146



>gb:AF334833_1787485 Castanea sativa calmodulin mRNA, complete cds.
          Length = 148

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 54/144 (37%), Positives = 84/144 (58%), Gaps = 1/144 (0%)
 Frame = +2

Query: 326 ELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGC 505
           +L+G  AE    F L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD D +G 
Sbjct: 4   QLTGQIAEFKGIFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVDADQNGT 62

Query: 506 ISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDC 682
           I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ + T E+ 
Sbjct: 63  IDFSEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGE-KLTDEEV 121

Query: 683 RRMILGVDNNGDGFVCFEDFCRMM 754
             MI   D +GDG V +++F RMM
Sbjct: 122 DEMIQKADLDGDGQVNYQEFVRMM 145



>gb:AF104986_1768275 Magnaporthe grisea calmodulin (MgCaM) gene,
           complete cds.
          Length = 149

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 52/150 (34%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D ++ +++S    E  +AF L D+D DG+I  +EL  ++  +G + PS  EL+ M++EVD
Sbjct: 3   DSLTEEQVS----EFKKAFSLFDKDGDGQITTKELGTVMRSLG-QNPSESELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            D +G I   EF ++++        + E+R+AF  FD D++G ISA EL +V  +IG+ +
Sbjct: 58  ADNNGTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T ++   MI   D +GDG + + +F ++M
Sbjct: 117 LTDDEVDEMIREADQDGDGRIDYNEFVQLM 146



>gb:NEUCLMDLN_1690793 Neurospora crassa calmodulin mRNA, complete
           cds.
          Length = 149

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 52/150 (34%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D ++ +++S    E  +AF L D+D DG+I  +EL  ++  +G + PS  EL+ M++EVD
Sbjct: 3   DSLTEEQVS----EFKEAFSLFDKDGDGQITTKELGTVMLSLG-QNPSESELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            D +G I   EF ++++        + E+R+AF  FD D++G ISA EL +V  +IG+ +
Sbjct: 58  ADNNGTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T ++   MI   D +GDG + + +F ++M
Sbjct: 117 LTDDEVDEMIREADQDGDGRIDYNEFVQLM 146



>gb:AY572856_1615749 Arachis hypogaea calmodulin (CaM-3) gene,
           complete cds.
          Length = 148

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D ++ +++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DPLTDEQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I + EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDIPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYEEFVKVM 146



>gb:LTCAMA_1389228 L.tarentolae CAM A gene for calmodulin.
          Length = 140

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 51/138 (36%), Positives = 83/138 (60%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           +E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD+DG G I   EF
Sbjct: 2   SEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVDQDGSGTIDFPEF 60

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            ++++        + E+++AF  FD D +G ISA E+ +V   +G+ R T E+   MI  
Sbjct: 61  LTLMARKMQDSDSEEEIKEAFRVFDKDGNGFISAAEVRHVMTKLGEKR-TDEEVDEMIRE 119

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG + +E+F +MM
Sbjct: 120 ADVDGDGQINYEEFVKMM 137



>pir|JC1094|JC1094 calmodulin - rice
          Length = 148

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 52/138 (37%), Positives = 83/138 (60%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I   EF
Sbjct: 11  AEFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVDADGNGTIDFPEF 69

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            ++++        + EL++AF  FD D +G ISA EL +V   +G+ + T E+   MI  
Sbjct: 70  LNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-KLTDEEVDEMIRE 128

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG + +E+F ++M
Sbjct: 129 ADVDGDGQINYEEFVKVM 146



>pir|H86194|H86194 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889616 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:T21E18_1723749 Sequence of BAC T21E18 from
           Arabidopsis thaliana chromosome 1, complete
           sequence.>gb:AF332466_1787278 Arabidopsis thaliana clone
           C00174 (e) putative calcium-binding protein (At1g05990)
           mRNA, complete cds.
          Length = 150

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 50/140 (35%), Positives = 85/140 (60%), Gaps = 3/140 (2%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           EL + F++ D++ DG I  +EL   L  +G   P +E L  M+ ++D +GDGC+ ++EF 
Sbjct: 5   ELKRVFQMFDKNGDGTITGKELSETLRSLGIYIPDKE-LTQMIEKIDVNGDGCVDIDEFG 63

Query: 527 VLSSAFAPPSCDSE--LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC-TLEDCRRMIL 697
            L         + E  +++AF+ FD + DG I+ +EL  V  ++G  +  TL+DC++MI 
Sbjct: 64  ELYKTIMDEEDEEEEDMKEAFNVFDQNGDGFITVDELKAVLSSLGLKQGKTLDDCKKMIK 123

Query: 698 GVDNNGDGFVCFEDFCRMME 757
            VD +GDG V +++F +MM+
Sbjct: 124 KVDVDGDGRVNYKEFRQMMK 143



>pir|S35185|S35185 calmodulin 4 - Arabidopsis
           thaliana>gb:ATCMACAM4_1548007 A.thaliana mRNA (clone
           ACaM4) for calmodulin.
          Length = 149

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 53/150 (35%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG +  E+F ++M
Sbjct: 117 LTDEEVEEMIREADVDGDGQINHEEFVKIM 146



>pir|T16039|T16039 hypothetical protein F12A10.5 - Caenorhabditis
           elegans>gb:U28731_1402486 Caenorhabditis elegans cosmid
           F12A10, complete sequence.
          Length = 145

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 49/139 (35%), Positives = 83/139 (59%), Gaps = 1/139 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE+ + F+  D++ DG+I ++ELE  L Q+G E  S  ++  M+ + D DG+GCI ++EF
Sbjct: 7   AEIREVFREFDKNGDGRITRQELEVALLQLG-EKASNSKIETMIEQADLDGNGCIDIDEF 65

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            +VL      P  + ELRD F+ FD + DG IS ++L  V   +G+ + T  + + MI  
Sbjct: 66  LNVLRRQICDPKEERELRDVFNVFDKNGDGVISIDDLIFVMCQLGE-KLTETEAKEMIKQ 124

Query: 701 VDNNGDGFVCFEDFCRMME 757
            D + DG + F++F  +++
Sbjct: 125 GDLDHDGMIDFQEFVNIIK 143



 Score = 33.1 bits (74), Expect = 9.8
 Identities = 17/65 (26%), Positives = 36/65 (55%)
 Frame = +2

Query: 560 DSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFED 739
           ++E+R+ F  FD + DG+I+ +EL      +G+ + +      MI   D +G+G +  ++
Sbjct: 6   EAEIREVFREFDKNGDGRITRQELEVALLQLGE-KASNSKIETMIEQADLDGNGCIDIDE 64

Query: 740 FCRMM 754
           F  ++
Sbjct: 65  FLNVL 69



>pir|S70767|S70767 calmodulin CAM72 - garden
           petunia>gb:PETRCAM72A_1699868 Petunia hybrida calmodulin
           (CAM72) mRNA, complete cds.
          Length = 149

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 53/138 (38%), Positives = 82/138 (59%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M+SEVD D +G I   EF
Sbjct: 11  AEFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMISEVDADQNGTIDFPEF 69

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            ++++        + EL++AF  FD D +G ISA ++ +V   +G+ + T E+   MI  
Sbjct: 70  LNLMARKMKDTDSEEELKEAFKVFDKDQNGYISAADVRHVMTNLGE-KLTDEEVDEMIRE 128

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG V +E+F RMM
Sbjct: 129 ADMDGDGQVNYEEFVRMM 146



>pir|A03024|MCSP calmodulin - spinach (tentative sequence)
          Length = 148

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 52/138 (37%), Positives = 83/138 (60%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I   EF
Sbjct: 10  AEFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVDADGNGTIDFPEF 68

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            ++++        + EL++AF  FD D +G ISA EL +V   +G+ + T E+   MI  
Sbjct: 69  LNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-KLTDEEVDEMIRE 127

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG + +E+F ++M
Sbjct: 128 ADVDGDGQINYEEFVKVM 145



>pir|A32556|MCPO calmodulin - potato>gb:POTCAM_1701077 Solanum
           tuberosum clone PCM1 calmodulin mRNA, complete cds.
          Length = 149

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 54/138 (39%), Positives = 81/138 (58%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M+SE D D +G I   EF
Sbjct: 11  AEFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMISEADADQNGTIDFPEF 69

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            ++++        + EL++AF  FD D +G ISA EL +V   +G+ + T E+   MI  
Sbjct: 70  LNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGE-KLTDEEVDEMIRE 128

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG V +E+F RMM
Sbjct: 129 ADIDGDGQVNYEEFVRMM 146



>pir|A37123|MCAS calmodulin - Emericella nidulans>pir|JC4216|JC4216
           calmodulin - Aspergillus oryzae>gb:ASNCMDA_1542195
           Aspergillus oryzae cmdA gene for calmodulin, complete
           cds.>gb:EMECALM_1676605 Aspergillus nidulans calmodulin
           gene, complete cds.>gb:HCCMD_1681639 Histoplasma
           capsulatum 186AS calmodulin mRNA, complete
           cds.>gb:AF072882_1765910 Ajellomyces capsulatus
           calmodulin (CAM1) gene, complete
           cds.>gb:AF481920_1803934 Paracoccidioides brasiliensis
           calmodulin (campb) gene, complete cds.
          Length = 149

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 52/150 (34%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D ++ +++S    E  +AF L D+D DG+I  +EL  ++  +G + PS  EL+ M++EVD
Sbjct: 3   DSLTEEQVS----EYKEAFSLFDKDGDGQITTKELGTVMRSLG-QNPSESELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            D +G I   EF ++++        + E+R+AF  FD D++G ISA EL +V  +IG+ +
Sbjct: 58  ADNNGTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T ++   MI   D +GDG + + +F ++M
Sbjct: 117 LTDDEVDEMIREADQDGDGRIDYNEFVQLM 146



>sp|P04353|CALM_SPIOL Calmodulin (CaM).
          Length = 148

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 52/138 (37%), Positives = 83/138 (60%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I   EF
Sbjct: 10  AEFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVDADGNGTIDFPEF 68

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            ++++        + EL++AF  FD D +G ISA EL +V   +G+ + T E+   MI  
Sbjct: 69  LNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-KLTDEEVDEMIRE 127

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG + +E+F ++M
Sbjct: 128 ADVDGDGQINYEEFVKVM 145



>sp|P13868|CALM_SOLTU Calmodulin (CaM).
          Length = 148

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 54/138 (39%), Positives = 81/138 (58%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M+SE D D +G I   EF
Sbjct: 10  AEFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMISEADADQNGTIDFPEF 68

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            ++++        + EL++AF  FD D +G ISA EL +V   +G+ + T E+   MI  
Sbjct: 69  LNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGE-KLTDEEVDEMIRE 127

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG V +E+F RMM
Sbjct: 128 ADIDGDGQVNYEEFVRMM 145



>sp|P60206|CALM_AJECA Calmodulin (CaM).>sp|P60205|CALM_ASPOR
           Calmodulin (CaM).>sp|P60204|CALM_EMENI Calmodulin (CaM).
          Length = 148

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 52/150 (34%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D ++ +++S    E  +AF L D+D DG+I  +EL  ++  +G + PS  EL+ M++EVD
Sbjct: 2   DSLTEEQVS----EYKEAFSLFDKDGDGQITTKELGTVMRSLG-QNPSESELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            D +G I   EF ++++        + E+R+AF  FD D++G ISA EL +V  +IG+ +
Sbjct: 57  ADNNGTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T ++   MI   D +GDG + + +F ++M
Sbjct: 116 LTDDEVDEMIREADQDGDGRIDYNEFVQLM 145



>sp|P27163|CAL2_PETHY Calmodulin 2 (CaM 2).
          Length = 148

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 53/138 (38%), Positives = 82/138 (59%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M+SEVD D +G I   EF
Sbjct: 10  AEFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMISEVDADQNGTIDFPEF 68

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            ++++        + EL++AF  FD D +G ISA ++ +V   +G+ + T E+   MI  
Sbjct: 69  LNLMARKMKDTDSEEELKEAFKVFDKDQNGYISAADVRHVMTNLGE-KLTDEEVDEMIRE 127

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D +GDG V +E+F RMM
Sbjct: 128 ADMDGDGQVNYEEFVRMM 145



>gb:AF084451_2141410 Synthetic construct calmodulin mutant SYNCAM32
           gene, complete cds.
          Length = 149

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGWITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AF084418_2141378 Synthetic construct calmodulin mutant SYNCAM63A
           gene, complete cds.
          Length = 149

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 54/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E    MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEQVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AF084415_2141375 Synthetic construct calmodulin mutant SYNCAM58A
           gene, complete cds.
          Length = 149

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 54/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+  
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGED- 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AF084396_2141356 Synthetic construct calmodulin mutant SYNCAM30
           gene, complete cds.
          Length = 149

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDREEELKEAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AF007889_1760942 Symbiodinium microadriaticum calmodulin
           (SMCaM1) mRNA, partial cds.
          Length = 138

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 53/137 (38%), Positives = 81/137 (59%), Gaps = 1/137 (0%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF- 523
           E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I   EF 
Sbjct: 1   EFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVDADGNGTIDFPEFL 59

Query: 524 SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV 703
           S+++        + EL +AF  FD D +G ISA EL +V   +G+ + T E+   MI   
Sbjct: 60  SLMARKMKDTDTEEELIEAFKVFDRDGNGFISAAELRHVMTNLGE-KLTDEEVDEMIREA 118

Query: 704 DNNGDGFVCFEDFCRMM 754
           D +GDG + +E+F +MM
Sbjct: 119 DVDGDGQINYEEFVKMM 135



 Score = 44.3 bits (103), Expect = 0.004
 Identities = 29/95 (30%), Positives = 44/95 (46%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AEL      +D D +G I   E  +L+++   +  + EEL       DRDG+G IS  E 
Sbjct: 36  AELQDMINEVDADGNGTIDFPEFLSLMARKMKDTDTEEELIEAFKVFDRDGNGFISAAEL 95

Query: 524 SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEE 628
             + +       D E+ +     D D DG+I+ EE
Sbjct: 96  RHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEE 130



>gb:PHTCALPIA_1700175 P.infestans calmodulin (calA) gene, complete
           cds.>gb:AF085344_1767177 Pythium splendens calmodulin
           mRNA, complete cds.
          Length = 149

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 52/150 (34%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+ +AF  FD D +G ISA EL ++   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMARKMKDTDSEEEILEAFKVFDKDGNGFISAAELRHIMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F +MM
Sbjct: 117 LTDEEVDEMIREADIDGDGQINYEEFVKMM 146



>gb:MDCAMG_1685920 M.domestica CaM gene for calmodulin.
          Length = 149

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 53/150 (35%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEE-FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   E  ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEPLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYEEFVKVM 146



>pir|JU0232|JU0232 calmodulin - fungus (Fusarium oxysporum)
           (fragment)
          Length = 143

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 52/146 (35%), Positives = 87/146 (59%), Gaps = 1/146 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D ++ +++S    E  +AF L D+D DG+I  +EL  ++  +G + PS  EL+ M++EVD
Sbjct: 2   DSLTEEQVS----EFKEAFSLFDKDGDGQITTKELGTVMRSLG-QNPSESELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            D +G I   EF ++++        + E+R+AF  FD D+DG ISA EL +V  +IG+ +
Sbjct: 57  ADNNGTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNDGFISAAELRHVMTSIGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDF 742
            T ++   MI   D +GDG + + +F
Sbjct: 116 LTDDEVDEMIREADQDGDGRIDYNEF 141



>pir|S02691|S02691 calmodulin B - sea urchin (Arbacia punctulata)
           (fragment)
          Length = 138

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 53/137 (38%), Positives = 81/137 (59%), Gaps = 1/137 (0%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF- 523
           E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I   EF 
Sbjct: 1   EFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVDADGNGTIDFPEFL 59

Query: 524 SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV 703
           ++++        + E+R+AF  FD D +G ISA EL +V   +G+ + T E+   MI   
Sbjct: 60  TMMARKMKETDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE-KLTDEEVDEMIREA 118

Query: 704 DNNGDGFVCFEDFCRMM 754
           D +GDG V +E+F  MM
Sbjct: 119 DIDGDGQVNYEEFVAMM 135



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 28/95 (29%), Positives = 44/95 (46%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AEL      +D D +G I   E   ++++   E  S EE+R      D+DG+G IS  E 
Sbjct: 36  AELQDMINEVDADGNGTIDFPEFLTMMARKMKETDSEEEIREAFRVFDKDGNGFISAAEL 95

Query: 524 SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEE 628
             + +       D E+ +     D D DG+++ EE
Sbjct: 96  RHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEE 130



 Score = 44.7 bits (104), Expect = 0.003
 Identities = 23/65 (35%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 74  EIREAFRVFDKDGNGFISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 132

Query: 527 VLSSA 541
            + ++
Sbjct: 133 AMMTS 137



>sp|P27165|CALM_PHYIN Calmodulin (CaM).
          Length = 148

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 52/150 (34%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+ +AF  FD D +G ISA EL ++   +G+ +
Sbjct: 57  ADGNGTIDFPEFLTMMARKMKDTDSEEEILEAFKVFDKDGNGFISAAELRHIMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F +MM
Sbjct: 116 LTDEEVDEMIREADIDGDGQINYEEFVKMM 145



>sp|P48976|CALM_MALDO Calmodulin (CaM).
          Length = 148

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 53/150 (35%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 2   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 56

Query: 488 RDGDGCISLEE-FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   E  ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 57  ADGNGTIDFPEPLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 115

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 116 LTDEEVDEMIREADVDGDGQINYEEFVKVM 145



>sp|P05932|CALB_ARBPU Calmodulin beta (Cam B) (Fragment).
          Length = 138

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 53/137 (38%), Positives = 81/137 (59%), Gaps = 1/137 (0%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF- 523
           E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I   EF 
Sbjct: 1   EFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVDADGNGTIDFPEFL 59

Query: 524 SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV 703
           ++++        + E+R+AF  FD D +G ISA EL +V   +G+ + T E+   MI   
Sbjct: 60  TMMARKMKETDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE-KLTDEEVDEMIREA 118

Query: 704 DNNGDGFVCFEDFCRMM 754
           D +GDG V +E+F  MM
Sbjct: 119 DIDGDGQVNYEEFVAMM 135



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 28/95 (29%), Positives = 44/95 (46%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AEL      +D D +G I   E   ++++   E  S EE+R      D+DG+G IS  E 
Sbjct: 36  AELQDMINEVDADGNGTIDFPEFLTMMARKMKETDSEEEIREAFRVFDKDGNGFISAAEL 95

Query: 524 SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEE 628
             + +       D E+ +     D D DG+++ EE
Sbjct: 96  RHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEE 130



 Score = 44.7 bits (104), Expect = 0.003
 Identities = 23/65 (35%), Positives = 41/65 (63%)
 Frame = +2

Query: 347 ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS 526
           E+ +AF++ D+D +G I   EL  +++ +G E  + EE+  M+ E D DGDG ++ EEF 
Sbjct: 74  EIREAFRVFDKDGNGFISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGDGQVNYEEFV 132

Query: 527 VLSSA 541
            + ++
Sbjct: 133 AMMTS 137



>gb:AF084446_2141405 Synthetic construct calmodulin mutant SYNCAM36
           gene, complete cds.
          Length = 149

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G I+A EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFIAAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AF084435_2141394 Synthetic construct calmodulin mutant SYNCAM39
           gene, complete cds.
          Length = 149

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 54/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++          EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSKEELKEAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AF084417_2141377 Synthetic construct calmodulin mutant SYNCAM62
           gene, complete cds.
          Length = 149

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + +L++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEQLKEAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AF084410_2141370 Synthetic construct calmodulin mutant SYNCAM56
           gene, complete cds.
          Length = 149

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 54/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL+ AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKTAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AF084409_2141369 Synthetic construct calmodulin mutant SYNCAM55
           gene, complete cds.
          Length = 149

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 54/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL+ AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKKAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AF084398_2141358 Synthetic construct calmodulin mutant SYNCAM46
           gene, complete cds.
          Length = 149

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 54/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++          EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSKKELKEAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:AF083238_2141344 Synthetic calmodulin mutant SYNCAM29.
          Length = 149

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 54/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E    MI   D +GDG V +E+F ++M
Sbjct: 117 LTDEKVDEMIREADVDGDGQVNYEEFVQVM 146



>gb:CR382136_1669070 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 148

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 52/138 (37%), Positives = 82/138 (59%), Gaps = 1/138 (0%)
 Frame = +2

Query: 344 AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF 523
           AE  +AF L D+D DGKI  +EL  ++  +G + PS  EL  M++EVD D DG I   EF
Sbjct: 10  AEFKEAFSLFDKDGDGKITTKELGTVMRSLG-QNPSESELTDMINEVDVDSDGSIDFPEF 68

Query: 524 -SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG 700
            ++++        ++E+ +AF  FD + DGKISA EL +V  +IG+ + +  D  +MI  
Sbjct: 69  LTMMARKMKDTDSEAEIAEAFKVFDRNGDGKISAAELRHVLTSIGE-KLSDADVDQMIRE 127

Query: 701 VDNNGDGFVCFEDFCRMM 754
            D N DG +  ++F +++
Sbjct: 128 ADVNNDGEIDIQEFTQLL 145



>gb:AY657030_1620290 Salvia miltiorrhiza calmodulin mRNA, complete
           cds.
          Length = 148

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 53/150 (35%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D ++ +++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DPLTDEQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDRDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYEEFVKVM 146



>gb:AY656684_1620254 Daucus carota calmodulin cam-201 mRNA, complete
           cds.
          Length = 149

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 53/150 (35%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + + +F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYVEFVKVM 146



>gb:AY585925_1616332 Paxillus involutus strain ATCC 200175
           calmodulin (calA) mRNA, complete
           cds.>gb:AF457919_1801406 Paxillus involutus calmodulin A
           gene, complete cds.
          Length = 149

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 52/150 (34%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D++S +++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLSEEQIS----EFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEGELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF ++++        + E+++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLTMMARKMRDTDSEEEIKEAFKVFDKDGNGYISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T  +   MI   D +GDG + +++F +MM
Sbjct: 117 LTDTEVDEMIREADVDGDGQINYDEFVKMM 146



>gb:AY517931_1610777 Arachis hypogaea calmodulin (CaM2) mRNA,
           complete cds.
          Length = 148

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 55/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D ++ +++S    E  +AF L+D+D DG I  +EL A+   +G + P+  EL+ M++EVD
Sbjct: 3   DPLTDEQIS----EFKEAFSLLDKDGDGCITTKELGAVTRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
            DG+G I   EF  L++        + EL++AF  FD D +G ISA EL +V   +G+ +
Sbjct: 58  ADGNGTIDFPEFLNLTARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F ++M
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYEEFVKVM 146



>gb:TRBCMRSG_1400621 Trypanosoma brucei gambiense calmodulin genes,
           tandemly repeated, complete cds.>gb:TRBCMRSG_1400622
           Trypanosoma brucei gambiense calmodulin genes, tandemly
           repeated, complete cds.>gb:TRBCMRSG_1400623 Trypanosoma
           brucei gambiense calmodulin genes, tandemly repeated,
           complete cds.
          Length = 149

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 52/150 (34%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = +2

Query: 308 DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD 487
           D++S +++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD
Sbjct: 3   DQLSNEQIS----EFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 57

Query: 488 RDGDGCISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR 664
           +DG G I   EF ++++        + E+++AF  FD D +G  SA EL ++   +G+ +
Sbjct: 58  QDGSGTIDFPEFLTLMARKMQDSDSEEEIKEAFRVFDKDGNGFNSAAELRHIMTNLGE-K 116

Query: 665 CTLEDCRRMILGVDNNGDGFVCFEDFCRMM 754
            T E+   MI   D +GDG + +E+F +MM
Sbjct: 117 LTDEEVDEMIREADVDGDGQINYEEFVKMM 146


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 902,578,586
Number of Sequences: 1806583
Number of extensions: 16751456
Number of successful extensions: 60059
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 49539
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 55250
length of database: 581,917,975
effective HSP length: 125
effective length of database: 356,095,100
effective search space used: 81545777900
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)