BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig1482
         (701 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY248904_1592639 Nicotiana tabacum EIL2 mRNA, complete cds.        178   7e-44   
gb:AB015855_1512730 Nicotiana tabacum mRNA for transcription fac...   178   7e-44   
gb:AY248903_1592638 Nicotiana tabacum EIL1 mRNA, complete cds.        178   9e-44   
gb:AF328784_1786911 Lycopersicon esculentum EIL1 (EIL1) mRNA, co...   177   1e-43   
gb:AY248905_1592640 Nicotiana tabacum EIL3 mRNA, complete cds.        175   8e-43   
gb:AY248906_1592641 Nicotiana tabacum EIL4 mRNA, complete cds.        174   1e-42   
gb:AF328785_1786912 Lycopersicon esculentum EIL2 (EIL2) mRNA, co...   173   2e-42   
gb:AB108840_1526779 Lycopersicon esculentum LeEIL4 mRNA for EIN3...   173   3e-42   
gb:AF467783_1802440 Vigna radiata transcription factor EIL2 mRNA...   169   6e-41   
gb:AF467784_1802441 Vigna radiata transcription factor EIL1 mRNA...   162   7e-39   
gb:AB063191_1522205 Cucumis melo CmEIL1 mRNA for EIN3-like prote...   158   1e-37   
gb:AF004213_1760676 Arabidopsis thaliana ethylene-insensitive3-l...   156   4e-37   
sp|Q9SLH0|EIL1_ARATH|EIL1_ARATH ETHYLENE-INSENSITIVE3-like 1 protein.>pir|B...   156   4e-37   Arabidopsis thaliana [mouse-ear cress]
sp|O24606|EIN3_ARATH|EIN3_ARATH ETHYLENE-INSENSITIVE3 protein.>gb:AB025629_...   155   7e-37   Arabidopsis thaliana [mouse-ear cress]
gb:AY728192_1624914 Dianthus caryophyllus ethylene insensitive 3...   154   1e-36   
gb:AB063192_1522206 Cucumis melo CmEIL2 mRNA for EIN3-like prote...   154   1e-36   
gb:AF387795_1794920 Cucumis melo transcription factor (EIN3) mRN...   153   2e-36   
gb:AF261654_1781554 Dianthus caryophyllus ethylene-insensitive 3...   152   4e-36   
gb:AY728191_1624913 Dianthus caryophyllus ethylene insensitive 3...   152   6e-36   
gb:AB074971_1523295 Oryza sativa (japonica cultivar-group) OsEIL...   152   6e-36   
gb:AX077260_1460682 Sequence 3 from Patent WO0105953.                 151   1e-35   
gb:AX077258_1460681 Sequence 1 from Patent WO0105953.                 151   1e-35   
gb:AP003818_1833798 Oryza sativa (japonica cultivar-group) genom...   148   8e-35   
gb:AB074972_1523296 Oryza sativa (japonica cultivar-group) OsEIL...   148   8e-35   
gb:AY728193_1624915 Dianthus caryophyllus ethylene insensitive 3...   147   1e-34   
gb:AF328786_1786913 Lycopersicon esculentum EIL3 (EIL3) mRNA, co...   146   4e-34   
gb:AY248907_1592642 Nicotiana tabacum EIL5 mRNA, complete cds.        143   3e-33   
gb:FSY298994_1679428 Fagus sylvatica mRNA for EIN3/EIL-like tran...   141   1e-32   
gb:PEQ316086_1699812 Phalaenopsis equestris mRNA for ethylene-in...   139   5e-32   
gb:AP005254_1849655 Oryza sativa (japonica cultivar-group) genom...   138   1e-31   
sp|O23116|EIL3_ARATH|EIL3_ARATH ETHYLENE-INSENSITIVE3-like 3 protein.>pir|E...   137   2e-31   Arabidopsis thaliana [mouse-ear cress]
gb:AY353248_1601802 Petunia x hybrida EIL1 mRNA, complete cds.        118   1e-25   
gb:AF247568_1780592 Nicotiana tabacum EIN3 mRNA, partial cds.         115   7e-25   
sp|Q9LX16|EIL4_ARATH|EIL4_ARATH Putative ETHYLENE-INSENSITIVE3-like 4 prote...   113   3e-24   Arabidopsis thaliana [mouse-ear cress]
sp|Q9FJQ5|EIL5_ARATH|EIL5_ARATH Putative ETHYLENE-INSENSITIVE3-like 5 prote...   112   8e-24   Arabidopsis thaliana [mouse-ear cress]
sp|O23115|EIL2_ARATH|EIL2_ARATH ETHYLENE-INSENSITIVE3-like 2 protein.>gb:AC...   110   2e-23   Arabidopsis thaliana [mouse-ear cress]
gb:AP004096_1837670 Oryza sativa (japonica cultivar-group) genom...   110   3e-23   
gb:OSJN00075_1694376 Oryza sativa genomic DNA, chromosome 4, BAC...   103   3e-21   
gb:AY052825_1562911 Rosa hybrid cultivar EIN3-like transcription...    97   3e-19   
gb:AF443783_1800342 Rosa hybrid cultivar EIN3 (EIN3) mRNA, parti...    95   1e-18   
pir|H70449|H70449 hypothetical protein aq_1740 - Aquifex aeolicu...    34   2.9     Aquifex aeolicus
gb:AF156967_1773053 Saccharomyces kluyveri dihydropyrimidinase (...    33   3.7     


>gb:AY248904_1592639 Nicotiana tabacum EIL2 mRNA, complete cds.
          Length = 616

 Score =  178 bits (452), Expect = 7e-44
 Identities = 97/160 (60%), Positives = 101/160 (63%)
 Frame = +2

Query: 221 MMMFDDMGFCNDLDSFLAPLKEPADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRR 400
           MMMF++MGFC DLD F APLKE                                    RR
Sbjct: 1   MMMFEEMGFCGDLDFFPAPLKE-----VETAASQIEQESEPVMDDDYSDEEIDVDELERR 55

Query: 401 MWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC 580
           MWRDKMKLKRL                R+   SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct: 56  MWRDKMKLKRLKEMTKGGKEGVDAVKQRQ---SQEQARRKKMSRAQDGILKYMLKMMEVC 112

Query: 581 KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct: 113 KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA 152



>gb:AB015855_1512730 Nicotiana tabacum mRNA for transcription factor
           TEIL, complete cds.
          Length = 615

 Score =  178 bits (452), Expect = 7e-44
 Identities = 97/160 (60%), Positives = 101/160 (63%)
 Frame = +2

Query: 221 MMMFDDMGFCNDLDSFLAPLKEPADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRR 400
           MMMF++MGFC DLD F APLKE                                    RR
Sbjct: 1   MMMFEEMGFCGDLDFFPAPLKE-----VETAASQIEQESEPVMDDDYSDEEIDVDELERR 55

Query: 401 MWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC 580
           MWRDKMKLKRL                R+   SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct: 56  MWRDKMKLKRLKEMTKGGKEGVDAVKQRQ---SQEQARRKKMSRAQDGILKYMLKMMEVC 112

Query: 581 KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct: 113 KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA 152



>gb:AY248903_1592638 Nicotiana tabacum EIL1 mRNA, complete cds.
          Length = 618

 Score =  178 bits (451), Expect = 9e-44
 Identities = 97/160 (60%), Positives = 101/160 (63%)
 Frame = +2

Query: 221 MMMFDDMGFCNDLDSFLAPLKEPADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRR 400
           MMMF++MGFC DLD F APLKE                                    RR
Sbjct: 1   MMMFEEMGFCGDLDFFPAPLKE---VETAASQIEQEQEQEPVMDDDYSDEEIDVDELERR 57

Query: 401 MWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC 580
           MWRDKMKLKRL                R+   SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct: 58  MWRDKMKLKRLKEMTKGGKEGVDAVKQRQ---SQEQARRKKMSRAQDGILKYMLKMMEVC 114

Query: 581 KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct: 115 KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA 154



>gb:AF328784_1786911 Lycopersicon esculentum EIL1 (EIL1) mRNA,
           complete cds.
          Length = 610

 Score =  177 bits (450), Expect = 1e-43
 Identities = 97/160 (60%), Positives = 101/160 (63%)
 Frame = +2

Query: 221 MMMFDDMGFCNDLDSFLAPLKEPADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRR 400
           MMMF++MGFC DLD F APLKE                                    RR
Sbjct: 1   MMMFEEMGFCGDLDFFPAPLKE----VEVSAPQSQTEPDSVVDDDYSDEEEIEVDELERR 56

Query: 401 MWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC 580
           MWRDKMKLKRL                 +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct: 57  MWRDKMKLKRLKEMSKSKEGVDPA----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVC 112

Query: 581 KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFD NGPA
Sbjct: 113 KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDRNGPA 152



>gb:AY248905_1592640 Nicotiana tabacum EIL3 mRNA, complete cds.
          Length = 300

 Score =  175 bits (443), Expect = 8e-43
 Identities = 97/160 (60%), Positives = 99/160 (61%)
 Frame = +2

Query: 221 MMMFDDMGFCNDLDSFLAPLKEPADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRR 400
           MMMFDDM FC DLD F APLKE                                    RR
Sbjct: 1   MMMFDDMRFCGDLDFFSAPLKE-----VEAAAPQTEPEPEPVVDDDYSDEEIDVDELERR 55

Query: 401 MWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC 580
           MWRDKMKLKRL                 +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct: 56  MWRDKMKLKRLKEMTKSKEGVDPA----KHRQSQEQARRKKMSRAQDGILKYMLKMMEVC 111

Query: 581 KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           KAQGFVYGIIPEKGKPV GASDNLREWWKDKVRFD NGPA
Sbjct: 112 KAQGFVYGIIPEKGKPVGGASDNLREWWKDKVRFDRNGPA 151



>gb:AY248906_1592641 Nicotiana tabacum EIL4 mRNA, complete cds.
          Length = 603

 Score =  174 bits (442), Expect = 1e-42
 Identities = 96/160 (60%), Positives = 100/160 (62%)
 Frame = +2

Query: 221 MMMFDDMGFCNDLDSFLAPLKEPADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRR 400
           MMMF++MGFC DLD F APLKE                                    RR
Sbjct: 1   MMMFEEMGFCGDLDFFPAPLKE-----VEVAAPHTEPEPELVVDDDYSDEEIDMDELERR 55

Query: 401 MWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC 580
           MWRDKMKLKRL                 +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct: 56  MWRDKMKLKRLKEMTKSKEGVDPA----KHRQSQEQARRKKMSRAQDGILKYMLKMMEVC 111

Query: 581 KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           KAQGFVYGIIPEKGKPV GASDNLREWWKDKVRFD NGPA
Sbjct: 112 KAQGFVYGIIPEKGKPVGGASDNLREWWKDKVRFDRNGPA 151



>gb:AF328785_1786912 Lycopersicon esculentum EIL2 (EIL2) mRNA,
           complete cds.
          Length = 614

 Score =  173 bits (439), Expect = 2e-42
 Identities = 95/160 (59%), Positives = 101/160 (63%)
 Frame = +2

Query: 221 MMMFDDMGFCNDLDSFLAPLKEPADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRR 400
           MMMF+D+GFC DLD F APLKE                                    +R
Sbjct: 1   MMMFEDIGFCADLDFFPAPLKE-----AETVAAVPPIVPEPMMDDDDSDEEIDVDELEKR 55

Query: 401 MWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC 580
           MWRDKMKLKRL                 +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct: 56  MWRDKMKLKRLKEMSKGKEGVDAV----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVC 111

Query: 581 KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct: 112 KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA 151



>gb:AB108840_1526779 Lycopersicon esculentum LeEIL4 mRNA for
           EIN3-like protein, complete cds.
          Length = 605

 Score =  173 bits (438), Expect = 3e-42
 Identities = 94/160 (58%), Positives = 100/160 (62%)
 Frame = +2

Query: 221 MMMFDDMGFCNDLDSFLAPLKEPADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRR 400
           MMMF++MGFC DLD F APLKE                                    +R
Sbjct: 1   MMMFEEMGFCGDLDFFPAPLKE-------VEVAAPQTEAEQVVDDDYSDEDIDVDELEKR 53

Query: 401 MWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC 580
           +WRDKMKLKRL                 +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct: 54  VWRDKMKLKRLKEMNQGMEDVDSV----KRRQSQEQARRKKMSRAQDGILKYMLKMMEVC 109

Query: 581 KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           KAQGFVYGIIPEKGKPV GASDNLREWWKDKVRFD NGPA
Sbjct: 110 KAQGFVYGIIPEKGKPVGGASDNLREWWKDKVRFDRNGPA 149



>gb:AF467783_1802440 Vigna radiata transcription factor EIL2 mRNA,
           complete cds.
          Length = 622

 Score =  169 bits (427), Expect = 6e-41
 Identities = 92/162 (56%), Positives = 99/162 (61%)
 Frame = +2

Query: 215 LKMMMFDDMGFCNDLDSFLAPLKEPADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 394
           + MMMFD+MGFCNDLD+  A L E                                    
Sbjct: 1   MMMMMFDEMGFCNDLDTVTATLGEE-------NITTGQADPEAIVEDDFSDEEIGVDELE 53

Query: 395 RRMWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMME 574
            RMW+DKM LKRL                 +  +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct: 54  HRMWKDKMLLKRLKEQSKSKEGIDAV----KQRQSQEQARRKKMSRAQDGILKYMLKMME 109

Query: 575 VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           VCKAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct: 110 VCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA 151



>gb:AF467784_1802441 Vigna radiata transcription factor EIL1 mRNA,
           complete cds.
          Length = 609

 Score =  162 bits (409), Expect = 7e-39
 Identities = 88/160 (55%), Positives = 97/160 (60%)
 Frame = +2

Query: 221 MMMFDDMGFCNDLDSFLAPLKEPADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRR 400
           MMMF+D+GFC DLD    PL +                                    +R
Sbjct: 1   MMMFEDIGFCGDLDLLSCPLGDE------DVVAVRHTDPDPVVEDDYSDEEIDVDELEKR 54

Query: 401 MWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC 580
           MWRDK++ KRL                 +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct: 55  MWRDKVRHKRLKEQQKAKEGTDAV----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVC 110

Query: 581 KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           KAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct: 111 KAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA 150



>gb:AB063191_1522205 Cucumis melo CmEIL1 mRNA for EIN3-like protein,
           complete cds.
          Length = 693

 Score =  158 bits (399), Expect = 1e-37
 Identities = 86/160 (53%), Positives = 97/160 (60%)
 Frame = +2

Query: 221 MMMFDDMGFCNDLDSFLAPLKEPADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRR 400
           MMMF++MGFC+D+D   A + E                                    RR
Sbjct: 2   MMMFNEMGFCDDMDFLSASIVE-------GDAVAPPTDPEVLVEDDYSDEEIDMDELERR 54

Query: 401 MWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC 580
           MWRDKM+LKRL                 +  +SQ+QARRKKMSRA DGILKYMLK+MEVC
Sbjct: 55  MWRDKMRLKRLKEQSKVKEGIDIV----KQRQSQDQARRKKMSRAHDGILKYMLKIMEVC 110

Query: 581 KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
            AQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct: 111 NAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA 150



>gb:AF004213_1760676 Arabidopsis thaliana
           ethylene-insensitive3-like1 (EIL1) mRNA, complete cds.
          Length = 584

 Score =  156 bits (394), Expect = 4e-37
 Identities = 78/102 (76%), Positives = 82/102 (80%)
 Frame = +2

Query: 395 RRMWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMME 574
           +RMWRDKM+LKRL                R+   SQEQARRKKMSRAQDGILKYMLKMME
Sbjct: 53  KRMWRDKMRLKRLKEQQSKCKGGVDGSKQRQ---SQEQARRKKMSRAQDGILKYMLKMME 109

Query: 575 VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           VCKAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct: 110 VCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA 151



>sp|Q9SLH0|EIL1_ARATH ETHYLENE-INSENSITIVE3-like 1
           protein.>pir|B84668|B84668 ethylene-insensitive3-like1
           (EIL1) [imported] - Arabidopsis
           thaliana>gb:AC005623_1532853 Arabidopsis thaliana
           chromosome 2 clone T20P8 map B68, complete
           sequence.>gb:AY065191_1566345 Arabidopsis thaliana
           ethylene-insensitive3-like1 (EIL1) (At2g27050; T20P8.10)
           mRNA, complete cds.>gb:BT003344_1636767 Arabidopsis
           thaliana ethylene-insensitive3-like1 (EIL1) (At2g27050)
           mRNA, complete cds.
          Length = 584

 Score =  156 bits (394), Expect = 4e-37
 Identities = 78/102 (76%), Positives = 82/102 (80%)
 Frame = +2

Query: 395 RRMWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMME 574
           +RMWRDKM+LKRL                R+   SQEQARRKKMSRAQDGILKYMLKMME
Sbjct: 53  KRMWRDKMRLKRLKEQQSKCKEGVDGSKQRQ---SQEQARRKKMSRAQDGILKYMLKMME 109

Query: 575 VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           VCKAQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct: 110 VCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA 151



>sp|O24606|EIN3_ARATH ETHYLENE-INSENSITIVE3
           protein.>gb:AB025629_1516532 Arabidopsis thaliana
           genomic DNA, chromosome 3, P1 clone:
           MOE17.>gb:AY069875_1566621 Arabidopsis thaliana
           AT3g20770/MOE17_6 mRNA, complete
           cds.>gb:AF004216_1760679 Arabidopsis thaliana
           ethylene-insensitive3 (EIN3) mRNA, complete
           cds.>gb:AF004217_1760680 Arabidopsis thaliana
           ethylene-insensitive3 (EIN3) gene, complete cds.
          Length = 628

 Score =  155 bits (392), Expect = 7e-37
 Identities = 86/159 (54%), Positives = 95/159 (59%)
 Frame = +2

Query: 224 MMFDDMGFCNDLDSFLAPLKEPADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRRM 403
           MMF++MG C ++D F +      D                                 RRM
Sbjct: 1   MMFNEMGMCGNMDFFSSGSLGEVDFCPVPQAEPDSIVEDDYTDDEIDVDELE-----RRM 55

Query: 404 WRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMMEVCK 583
           WRDKM+LKRL                 +  +SQEQARRKKMSRAQDGILKYMLKMMEVCK
Sbjct: 56  WRDKMRLKRLKEQDKGKEGVDAA----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVCK 111

Query: 584 AQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           AQGFVYGIIPE GKPV+GASDNLREWWKDKVRFD NGPA
Sbjct: 112 AQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPA 150



>gb:AY728192_1624914 Dianthus caryophyllus ethylene insensitive
           3-like 3 mRNA, complete cds.
          Length = 591

 Score =  154 bits (390), Expect = 1e-36
 Identities = 77/102 (75%), Positives = 82/102 (80%)
 Frame = +2

Query: 395 RRMWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMME 574
           RRMWRDKM+LKRL                 +  +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct: 56  RRMWRDKMRLKRLKDQSKVKEGVDVA----KQRQSQEQARRKKMSRAQDGILKYMLKMME 111

Query: 575 VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           VCKAQGFVYGIIPEKGKPV+GASDNLREWWK+KVRFD NGPA
Sbjct: 112 VCKAQGFVYGIIPEKGKPVTGASDNLREWWKEKVRFDRNGPA 153



>gb:AB063192_1522206 Cucumis melo CmEIL2 mRNA for EIN3-like protein,
           complete cds.
          Length = 615

 Score =  154 bits (390), Expect = 1e-36
 Identities = 85/160 (53%), Positives = 95/160 (59%)
 Frame = +2

Query: 221 MMMFDDMGFCNDLDSFLAPLKEPADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRR 400
           M +F+D+ FC +L+ F AP  E                                    RR
Sbjct: 4   MGIFEDISFCRNLEYFSAPPGEQE--------TAQEHEAEAVLEEDYSDEELDVDELERR 55

Query: 401 MWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC 580
           MWRD+M L+RL                 +  +SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct: 56  MWRDRMLLRRLKEQSKEKEGADSS----KQRQSQEQARRKKMSRAQDGILKYMLKMMEVC 111

Query: 581 KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           KAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct: 112 KAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA 151



>gb:AF387795_1794920 Cucumis melo transcription factor (EIN3) mRNA,
           partial cds.
          Length = 621

 Score =  153 bits (387), Expect = 2e-36
 Identities = 84/159 (52%), Positives = 94/159 (59%)
 Frame = +2

Query: 224 MMFDDMGFCNDLDSFLAPLKEPADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRRM 403
           MMF++MG C D+D   A + E                                    RRM
Sbjct: 1   MMFNEMGMCGDMDFLSASIVE-------GDAVAPPTDPEVVVEDDYSDEEIDMDELERRM 53

Query: 404 WRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMMEVCK 583
           WRDKM+LKRL                 +  +SQ+QARRKKMSRA DGILKYMLK+MEVC 
Sbjct: 54  WRDKMRLKRLKEQSKVKEGIDIV----KQRQSQDQARRKKMSRAHDGILKYMLKIMEVCN 109

Query: 584 AQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           AQGFVYGIIPEKGKPV+GASDNLREWWKDKVRFD NGPA
Sbjct: 110 AQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPA 148



>gb:AF261654_1781554 Dianthus caryophyllus ethylene-insensitive
           3-like protein 1 (EIL1) mRNA, complete cds.
          Length = 662

 Score =  152 bits (385), Expect = 4e-36
 Identities = 78/102 (76%), Positives = 80/102 (78%)
 Frame = +2

Query: 395 RRMWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMME 574
           RRMWRDKM LKRL                +   +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct: 52  RRMWRDKMLLKRLKEQNKDRCREGIDNVKKR--QSQEQARRKKMSRAQDGILKYMLKMME 109

Query: 575 VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           VCKAQGFVYGIIPEKGKPVSGASDNLR WWKDKVRFD NGPA
Sbjct: 110 VCKAQGFVYGIIPEKGKPVSGASDNLRAWWKDKVRFDRNGPA 151



>gb:AY728191_1624913 Dianthus caryophyllus ethylene insensitive
           3-like 2 mRNA, complete cds.
          Length = 662

 Score =  152 bits (384), Expect = 6e-36
 Identities = 78/102 (76%), Positives = 80/102 (78%)
 Frame = +2

Query: 395 RRMWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMME 574
           RRMWRDKM LKRL                +   +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct: 52  RRMWRDKMLLKRLKEQNKDRCREWIDNVKKR--QSQEQARRKKMSRAQDGILKYMLKMME 109

Query: 575 VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           VCKAQGFVYGIIPEKGKPVSGASDNLR WWKDKVRFD NGPA
Sbjct: 110 VCKAQGFVYGIIPEKGKPVSGASDNLRAWWKDKVRFDRNGPA 151



>gb:AB074971_1523295 Oryza sativa (japonica cultivar-group) OsEIL1
           mRNA for ethylene-insensitive-3-like protein, complete
           cds.
          Length = 640

 Score =  152 bits (384), Expect = 6e-36
 Identities = 77/105 (73%), Positives = 82/105 (78%), Gaps = 3/105 (2%)
 Frame = +2

Query: 395 RRMWRDKMKLKRLXXXXXXXXXXXXXXXXRETNK---SQEQARRKKMSRAQDGILKYMLK 565
           RRMWRD+MKLKRL                 + +K   SQEQARRKKMSRAQDGILKYMLK
Sbjct: 83  RRMWRDRMKLKRLKELQLSRGKDPAGGVVGDPSKPRQSQEQARRKKMSRAQDGILKYMLK 142

Query: 566 MMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           MMEVC+AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct: 143 MMEVCRAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA 187



>gb:AX077260_1460682 Sequence 3 from Patent WO0105953.
          Length = 647

 Score =  151 bits (381), Expect = 1e-35
 Identities = 76/108 (70%), Positives = 81/108 (75%), Gaps = 6/108 (5%)
 Frame = +2

Query: 395 RRMWRDKMKLKRLXXXXXX------XXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKY 556
           RRMWRD+MKLKRL                       +  +SQEQARRKKMSRAQDGILKY
Sbjct: 82  RRMWRDRMKLKRLRELQQSRGKDPMASGGGLADGSSKPRQSQEQARRKKMSRAQDGILKY 141

Query: 557 MLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           MLKMMEVC+AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct: 142 MLKMMEVCRAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA 189



>gb:AX077258_1460681 Sequence 1 from Patent WO0105953.
          Length = 643

 Score =  151 bits (381), Expect = 1e-35
 Identities = 76/108 (70%), Positives = 81/108 (75%), Gaps = 6/108 (5%)
 Frame = +2

Query: 395 RRMWRDKMKLKRLXXXXXXXXXXXXXXX------XRETNKSQEQARRKKMSRAQDGILKY 556
           RRMWRD+MKLKRL                       +  +SQEQARRKKMSRAQDGILKY
Sbjct: 82  RRMWRDRMKLKRLRELQQTGGKDSLASGVGLADGSSKPRQSQEQARRKKMSRAQDGILKY 141

Query: 557 MLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           MLKMMEVC+AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct: 142 MLKMMEVCRAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA 189



>gb:AP003818_1833798 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1200_C08.
          Length = 593

 Score =  148 bits (374), Expect = 8e-35
 Identities = 74/107 (69%), Positives = 80/107 (74%), Gaps = 5/107 (4%)
 Frame = +2

Query: 395 RRMWRDKMKLKRL-----XXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYM 559
           RRMWRD+++ KRL                     R+  +SQEQARRKKMSRAQDGILKYM
Sbjct: 85  RRMWRDRVRHKRLKELQQSRAGRESRAGDAGGGGRQQRQSQEQARRKKMSRAQDGILKYM 144

Query: 560 LKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           LKMMEVC AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct: 145 LKMMEVCNAQGFVYGIIPEKGKPVSGASDNLRSWWKEKVRFDRNGPA 191



>gb:AB074972_1523296 Oryza sativa (japonica cultivar-group) OsEIL2
           mRNA for ethylene-insensitive-3-like protein, complete
           cds.
          Length = 593

 Score =  148 bits (374), Expect = 8e-35
 Identities = 74/107 (69%), Positives = 80/107 (74%), Gaps = 5/107 (4%)
 Frame = +2

Query: 395 RRMWRDKMKLKRL-----XXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYM 559
           RRMWRD+++ KRL                     R+  +SQEQARRKKMSRAQDGILKYM
Sbjct: 85  RRMWRDRVRHKRLKELQQSRAGRESRAGDAGGGGRQQRQSQEQARRKKMSRAQDGILKYM 144

Query: 560 LKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           LKMMEVC AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct: 145 LKMMEVCNAQGFVYGIIPEKGKPVSGASDNLRSWWKEKVRFDRNGPA 191



>gb:AY728193_1624915 Dianthus caryophyllus ethylene insensitive
           3-like 4 mRNA, complete cds.
          Length = 704

 Score =  147 bits (372), Expect = 1e-34
 Identities = 74/102 (72%), Positives = 80/102 (78%)
 Frame = +2

Query: 395 RRMWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMME 574
           +RMWRDKM L+RL                +  ++SQEQARRKKMSRAQDGILKYMLKMME
Sbjct: 46  QRMWRDKMLLRRLKEQTKDKCATEVDCGKK--HQSQEQARRKKMSRAQDGILKYMLKMME 103

Query: 575 VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           VC AQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct: 104 VCNAQGFVYGIIPEKGKPVSGASDNLRAWWKEKVRFDRNGPA 145



>gb:AF328786_1786913 Lycopersicon esculentum EIL3 (EIL3) mRNA,
           complete cds.
          Length = 601

 Score =  146 bits (368), Expect = 4e-34
 Identities = 73/102 (71%), Positives = 79/102 (77%)
 Frame = +2

Query: 395 RRMWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMME 574
           RRMWRD+M L+RL                 +  +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct: 51  RRMWRDRMLLRRLKEKNKNKVVGDGA----KQRQSQEQARRKKMSRAQDGILKYMLKMME 106

Query: 575 VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           VC AQGFVYGIIPEKGKPV+GASDNLR WWK+KVRFD NGPA
Sbjct: 107 VCNAQGFVYGIIPEKGKPVTGASDNLRAWWKEKVRFDRNGPA 148



>gb:AY248907_1592642 Nicotiana tabacum EIL5 mRNA, complete cds.
          Length = 608

 Score =  143 bits (360), Expect = 3e-33
 Identities = 82/160 (51%), Positives = 91/160 (56%)
 Frame = +2

Query: 221 MMMFDDMGFCNDLDSFLAPLKEPADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRR 400
           MMMF++MGF  + +    PL    D                                 RR
Sbjct: 1   MMMFEEMGFPGNFEFMSDPLGCGGDVAQEVEHKPTGVEENYSDEEMDVDELE------RR 54

Query: 401 MWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMMEVC 580
           MWR +M  +RL                R+   SQEQARRKKMSRAQDGILKYMLKMMEVC
Sbjct: 55  MWRYRMLWRRLKEKNKNKEVGGDGAKQRQ---SQEQARRKKMSRAQDGILKYMLKMMEVC 111

Query: 581 KAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
            AQGFVYGIIPEKGKPV+GASDNLR WWK+KVRFD NGPA
Sbjct: 112 NAQGFVYGIIPEKGKPVTGASDNLRAWWKEKVRFDRNGPA 151



>gb:FSY298994_1679428 Fagus sylvatica mRNA for EIN3/EIL-like
           transcription regulator (einl1 gene), clone FsEINL1.
          Length = 594

 Score =  141 bits (356), Expect = 1e-32
 Identities = 68/102 (66%), Positives = 80/102 (78%)
 Frame = +2

Query: 395 RRMWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMME 574
           RRMW+D++KLKRL                ++  ++ +QA RKKMSRAQDGILKYMLK+ME
Sbjct: 43  RRMWKDRIKLKRLKERQKIAAQQAAEK--QKPKQTTDQAPRKKMSRAQDGILKYMLKLME 100

Query: 575 VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           VCKA+GFVYGIIPEKGKPVSGASDN+R WWK+KVRFD NGPA
Sbjct: 101 VCKARGFVYGIIPEKGKPVSGASDNIRAWWKEKVRFDKNGPA 142



>gb:PEQ316086_1699812 Phalaenopsis equestris mRNA for
           ethylene-insensitive 3 protein (in3 gene).
          Length = 621

 Score =  139 bits (350), Expect = 5e-32
 Identities = 70/102 (68%), Positives = 77/102 (75%)
 Frame = +2

Query: 395 RRMWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMME 574
           RR+WR ++ +K+                     +SQEQARRKKMSRAQDGILKYMLKMME
Sbjct: 83  RRIWRYRLLVKQRKEQQNTKNRDFSDSVKHR--QSQEQARRKKMSRAQDGILKYMLKMME 140

Query: 575 VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           VCKAQGFVYGIIPEKGKPVSGASDNLR WWK+KVRFD NGPA
Sbjct: 141 VCKAQGFVYGIIPEKGKPVSGASDNLRGWWKEKVRFDRNGPA 182



>gb:AP005254_1849655 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OSJNBb0064I19.>gb:AP005816_1858343 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:B1168A08.
          Length = 619

 Score =  138 bits (347), Expect = 1e-31
 Identities = 64/101 (63%), Positives = 74/101 (73%)
 Frame = +2

Query: 395 RRMWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMME 574
           RRMW+DK+KLKR+                 +T K  EQA RKK +R QDGIL+YMLK+ME
Sbjct: 42  RRMWKDKIKLKRIKERQQKLALQQAALEESKTKKMSEQALRKKTARVQDGILRYMLKLME 101

Query: 575 VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGP 697
           VC A+GFVYGIIP KGKPVSGASDN+R WWK+KVRFD NGP
Sbjct: 102 VCNARGFVYGIIPHKGKPVSGASDNIRAWWKEKVRFDVNGP 142



>sp|O23116|EIL3_ARATH ETHYLENE-INSENSITIVE3-like 3
           protein.>pir|E96764|E96764 ethylene-insensitive3-like3
           (EIL3), 60307-58378 [imported] - Arabidopsis
           thaliana>gb:AE005173_894919 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC012679_1537782 Arabidopsis thaliana
           chromosome 1 BAC F25P22 genomic sequence, complete
           sequence.>gb:AY070044_1566687 Arabidopsis thaliana
           putative ethylene-insensitive protein EIL3 (At1g73730)
           mRNA, complete cds.>gb:AY133839_1581659 Arabidopsis
           thaliana clone U18784 putative ethylene-insensitive
           protein EIL3 (At1g73730) mRNA, complete
           cds.>gb:AF004215_1760678 Arabidopsis thaliana
           ethylene-insensitive3-like3 (EIL3) mRNA, complete cds.
          Length = 567

 Score =  137 bits (345), Expect = 2e-31
 Identities = 66/103 (64%), Positives = 80/103 (77%), Gaps = 1/103 (0%)
 Frame = +2

Query: 395 RRMWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKS-QEQARRKKMSRAQDGILKYMLKMM 571
           RRMW+D+++LKR+                +ET K   +QA+RKKMSRAQDGILKYMLK+M
Sbjct: 42  RRMWKDRVRLKRIKERQKAGSQGAQT---KETPKKISDQAQRKKMSRAQDGILKYMLKLM 98

Query: 572 EVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           EVCK +GFVYGIIPEKGKPVSG+SDN+R WWK+KV+FD NGPA
Sbjct: 99  EVCKVRGFVYGIIPEKGKPVSGSSDNIRAWWKEKVKFDKNGPA 141



>gb:AY353248_1601802 Petunia x hybrida EIL1 mRNA, complete cds.
          Length = 646

 Score =  118 bits (295), Expect = 1e-25
 Identities = 53/61 (86%), Positives = 58/61 (95%)
 Frame = +2

Query: 518 KKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGP 697
           KKMSRAQDGILKYMLKMMEVC A+GFVYGIIP+KGKPVSGASDN+R WWK+KV+FD NGP
Sbjct: 53  KKMSRAQDGILKYMLKMMEVCNARGFVYGIIPDKGKPVSGASDNIRAWWKEKVKFDKNGP 112

Query: 698 A 700
           A
Sbjct: 113 A 113



>gb:AF247568_1780592 Nicotiana tabacum EIN3 mRNA, partial cds.
          Length = 150

 Score =  115 bits (288), Expect = 7e-25
 Identities = 52/55 (94%), Positives = 54/55 (98%)
 Frame = +2

Query: 536 QDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           QDGILKYMLKMMEVCKAQGFVYGIIPEKGKPV+GASDNL+EWWKDKVRFD NGPA
Sbjct: 1   QDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLKEWWKDKVRFDRNGPA 55



>sp|Q9LX16|EIL4_ARATH Putative ETHYLENE-INSENSITIVE3-like 4
           protein.>pir|T50016|T50016 transcription factor
           TEIL/ethylene-insensitive-like protein - Arabidopsis
           thaliana>gb:ATT31P16_1555848 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T31P16 (ESSA project).
          Length = 471

 Score =  113 bits (283), Expect = 3e-24
 Identities = 51/101 (50%), Positives = 70/101 (69%)
 Frame = +2

Query: 395 RRMWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMME 574
           RRMW+D+  +++                   T    E +RRKKM+R+QD +LKYM+K+ME
Sbjct: 27  RRMWKDRNLMEKKLKQQKRHSNDVVSF----TTHRAEASRRKKMARSQDSVLKYMMKIME 82

Query: 575 VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGP 697
           VCKA+GFVYGI+PEKGKP++G+SD+LR WWK+ V+FD N P
Sbjct: 83  VCKAKGFVYGIVPEKGKPITGSSDSLRRWWKENVQFDQNAP 123



>sp|Q9FJQ5|EIL5_ARATH Putative ETHYLENE-INSENSITIVE3-like 5
           protein.>gb:AB013395_1512156 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1 clone:MQN23.
          Length = 557

 Score =  112 bits (279), Expect = 8e-24
 Identities = 53/112 (47%), Positives = 71/112 (63%), Gaps = 11/112 (9%)
 Frame = +2

Query: 395 RRMWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQ-----------EQARRKKMSRAQD 541
           +RMW+D+  + +L                  T+ S            E +RRKKM+R+QD
Sbjct: 42  KRMWKDRNLMCKLKQQKRDNLNSVISSPSSSTSASSSSSSSVIVRRTEASRRKKMARSQD 101

Query: 542 GILKYMLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGP 697
            +LKYM+K+MEVCKAQGFVYGI+PEKGKPV+G+SD+LR WWK+ V+FD   P
Sbjct: 102 SVLKYMMKIMEVCKAQGFVYGIVPEKGKPVTGSSDSLRRWWKENVQFDQTAP 153



>sp|O23115|EIL2_ARATH ETHYLENE-INSENSITIVE3-like 2
           protein.>gb:AC140977_1744079 Arabidopsis thaliana
           chromosome 5 BAC F13M11 genomic sequence, complete
           sequence.>gb:AF004214_1760677 Arabidopsis thaliana
           ethylene-insensitive3-like2 (EIL2) mRNA, complete cds.
          Length = 518

 Score =  110 bits (276), Expect = 2e-23
 Identities = 55/102 (53%), Positives = 69/102 (67%)
 Frame = +2

Query: 395 RRMWRDKMKLKRLXXXXXXXXXXXXXXXXRETNKSQEQARRKKMSRAQDGILKYMLKMME 574
           +++WRDK +LKRL                ++ +   E + ++ M +AQDGILKYM K ME
Sbjct: 52  KKIWRDKQRLKRLKEMAKNGLGTRLLLK-QQHDDFPEHSSKRTMYKAQDGILKYMSKTME 110

Query: 575 VCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
             KAQGFVYGI+ E GK V+G+SDNLREWWKDKVRFD NGPA
Sbjct: 111 RYKAQGFVYGIVLENGKTVAGSSDNLREWWKDKVRFDRNGPA 152



>gb:AP004096_1837670 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1743_B12.
          Length = 432

 Score =  110 bits (274), Expect = 3e-23
 Identities = 50/55 (90%), Positives = 51/55 (92%)
 Frame = +2

Query: 536 QDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           QDGILKYMLKMMEVC AQGFVYGIIPEKGKPVS ASDNLR WWK+KVRFD NGPA
Sbjct: 74  QDGILKYMLKMMEVCNAQGFVYGIIPEKGKPVSSASDNLRSWWKEKVRFDRNGPA 128



>gb:OSJN00075_1694376 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0036B21, complete sequence.
          Length = 445

 Score =  103 bits (257), Expect = 3e-21
 Identities = 53/109 (48%), Positives = 67/109 (61%), Gaps = 8/109 (7%)
 Frame = +2

Query: 395 RRMWRDKMKLKRLXXXXXXXXXXXXXXXX---RETNKSQEQA-----RRKKMSRAQDGIL 550
           +RMW+D+M L +L                   RE   ++E+      RRK M RAQDG+L
Sbjct: 43  KRMWKDQMLLMKLEGRSGHEGALAAQDHRVVRREEEAAEEEPPEARYRRKAMLRAQDGVL 102

Query: 551 KYMLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGP 697
           ++MLKMME C A+GFVYGI+ E G PVSG+SD+LR WWKD V FD  GP
Sbjct: 103 RHMLKMMEACNARGFVYGIVDESGVPVSGSSDSLRGWWKDDVAFDRAGP 151



>gb:AY052825_1562911 Rosa hybrid cultivar EIN3-like transcription
           factor (EIN3) mRNA, partial cds.
          Length = 136

 Score = 97.1 bits (240), Expect = 3e-19
 Identities = 43/45 (95%), Positives = 44/45 (97%)
 Frame = +2

Query: 566 MMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           MMEVC+AQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFD NGPA
Sbjct: 1   MMEVCRAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDRNGPA 45



>gb:AF443783_1800342 Rosa hybrid cultivar EIN3 (EIN3) mRNA, partial
           cds.
          Length = 184

 Score = 94.7 bits (234), Expect = 1e-18
 Identities = 41/48 (85%), Positives = 46/48 (95%)
 Frame = +2

Query: 557 MLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLREWWKDKVRFDXNGPA 700
           MLKMMEVC+A+GFVYGIIPEKGKPVSGASDN+R WWK+KV+FD NGPA
Sbjct: 1   MLKMMEVCQARGFVYGIIPEKGKPVSGASDNIRAWWKEKVKFDKNGPA 48



>pir|H70449|H70449 hypothetical protein aq_1740 - Aquifex
           aeolicus>gb:AE000754_26980 Aquifex aeolicus VF5 section
           86 of 109 of the complete genome.>gb:AE000657_977511
           Aquifex aeolicus VF5 complete genome.
          Length = 172

 Score = 33.9 bits (76), Expect = 2.9
 Identities = 16/38 (42%), Positives = 22/38 (57%)
 Frame = +2

Query: 545 ILKYMLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLRE 658
           +L Y LK  ++   +G    IIP+KGK + GAS  L E
Sbjct: 124 LLNYHLKAADIVGLRGVPLNIIPDKGKVIEGASPKLLE 161



>gb:AF156967_1773053 Saccharomyces kluyveri dihydropyrimidinase
           (PYD2) gene, pyd2-1 allele, complete cds.
          Length = 542

 Score = 33.5 bits (75), Expect = 3.7
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 2/52 (3%)
 Frame = +2

Query: 542 GILKYMLKMMEV-CKAQGFVYGIIPEKGKPVSGASD-NLREWWKDKVRFDXN 691
           G L  M+K++E+ C     VYG+ P+KG  + G SD +L  W+ D  + + N
Sbjct: 412 GNLTSMMKLVEIQCTNPAKVYGMYPQKGSILPGVSDADLVIWYPDDSKKEYN 463


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 515,924,055
Number of Sequences: 1806583
Number of extensions: 8805673
Number of successful extensions: 28390
Number of sequences better than 10.0: 42
Number of HSP's better than 10.0 without gapping: 26722
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28232
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 40692000384
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)