BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig1481
         (987 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP002953_1823972 Oryza sativa (japonica cultivar-group) genom...   119   9e-26   
gb:AY087491_1572522 Arabidopsis thaliana clone 36000 mRNA, compl...   107   3e-22   
gb:BT008322_1639539 Arabidopsis thaliana At1g56720 gene, complet...   107   4e-22   
pir|B96609|B96609 probable protein kinase F25P12.84 [imported] -...   107   4e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AY085517_1570586 Arabidopsis thaliana clone 15535 mRNA, compl...    97   5e-19   
pir|D84860|D84860 probable protein kinase [imported] - Arabidops...    88   2e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1023261 Oryza sativa (japonica cultivar-group) chrom...    85   3e-15   
pir|T47793|T47793 receptor-like protein kinase - Arabidopsis tha...    81   4e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AB028620_1518053 Arabidopsis thaliana genomic DNA, chromosome...    78   2e-13   
pir|G86227|G86227 hypothetical protein [imported] - Arabidopsis ...    77   4e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AP003222_1825524 Oryza sativa (japonica cultivar-group) genom...    67   7e-10   
pir|T01086|T01086 probable serine/threonine-specific protein kin...    45   0.002   Arabidopsis thaliana [mouse-ear cress]
gb:AY093964_1575470 Arabidopsis thaliana At1g01540/F22L4_6 mRNA,...    45   0.002   
gb:ATY12776_1557476 Arabidopsis thaliana DNA, 40 kb surrounding ...    45   0.002   
pir|A86146|A86146 hypothetical protein F22L4.8 - Arabidopsis tha...    45   0.002   Arabidopsis thaliana [mouse-ear cress]
gb:AC119292_1739707 Oryza sativa (japonica cultivar-group) chrom...    42   0.019   
pir|T01711|T01711 probable serine/threonine-specific protein kin...    41   0.041   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00033_1693630 Oryza sativa genomic DNA, chromosome 4, BAC...    39   0.16    
gb:AP005469_1852408 Oryza sativa (japonica cultivar-group) genom...    37   0.46    
pir|T08929|T08929 hypothetical protein T15N24.80 - Arabidopsis t...    36   1.0     Arabidopsis thaliana [mouse-ear cress]
gb:AY133547_1581370 Arabidopsis thaliana At1g08920/F7G19_20 mRNA...    35   1.7     
gb:ATH249968_1552152 Arabidopsis thaliana mRNA for putative suga...    35   1.7     
gb:CP000001_853358 Bacillus cereus ZK, complete genome.                35   1.7     
gb:AJ829762_533209 Staphylococcus aureus subsp. aureus partial s...    35   1.7     
pir|A86221|A86221 hypothetical protein [imported] - Arabidopsis ...    35   1.7     Arabidopsis thaliana [mouse-ear cress]
gb:AE017322_442521 Listeria monocytogenes str. 4b F2365, section...    35   3.0     
gb:BC085432_2564381 Danio rerio cDNA clone IMAGE:7229518, partia...    34   3.9     
gb:AY186581_2517829 Danio rerio polycomb 2 mRNA, complete cds.         34   3.9     
gb:AK016614_1158807 Mus musculus adult male testis cDNA, RIKEN f...    34   3.9     
gb:AE017273_424273 Bacillus cereus ATCC 10987, section 10 of 18 ...    34   5.1     
gb:AE004969_61759 Neisseria gonorrhoeae FA 1090, complete genome.      34   5.1     
gb:CR382136_1669371 Debaryomyces hansenii chromosome D of strain...    33   6.6     
gb:AB013389_1512058 Arabidopsis thaliana genomic DNA, chromosome...    33   6.6     
gb:BC090215_2566432 Xenopus laevis cDNA clone MGC:85078 IMAGE:68...    33   8.6     
gb:OSJN00207_1696708 Oryza sativa genomic DNA, chromosome 4, BAC...    33   8.6     
gb:OSJN00014_1693293 Oryza sativa genomic DNA, chromosome 4, BAC...    33   8.6     
gb:CR382134_1667000 Debaryomyces hansenii chromosome B of strain...    33   8.6     
gb:CR382129_1662198 Yarrowia lipolytica chromosome C of strain C...    33   8.6     
gb:PFMAL7P1_1191954 Plasmodium falciparum 3D7 chromosome 7, *** ...    33   8.6     
gb:PFMAL7P1_1191873 Plasmodium falciparum 3D7 chromosome 7, *** ...    33   8.6     


>gb:AP002953_1823972 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0426D06.
          Length = 516

 Score =  119 bits (298), Expect = 9e-26
 Identities = 78/184 (42%), Positives = 103/184 (55%), Gaps = 12/184 (6%)
 Frame = +1

Query: 472 TSKKMGSNLNEGMSKETAVFGLKVWEXXXXXXXXXXXXXXXXXTFYLTLR--KKSMRAKE 645
           +S     +L + +S  T    LKVWE                 T +LT+R  K+  RA  
Sbjct: 5   SSSPSSPSLKDHLSSPTGPLHLKVWEVICIVLGAFMVVIFFV-TVWLTIRSRKRVRRASA 63

Query: 646 SLPLCQIPKVSKEIKEVQVDQVSKNE----DGNFPTVQDKSTEKESD------GEWKTKN 795
           ++P+ QIP +SKEIKEV+V+QV  ++    DG   T+QDKS+EKESD      G  K+K 
Sbjct: 64  NIPITQIPAISKEIKEVRVEQVPTSDFAAHDGVLMTIQDKSSEKESDKVMVHLGVSKSKR 123

Query: 796 GDNNGQSDSFHLVDKEYHGSHSREERNSAKFAVHHKYSSHPIAAPSPLTGLPEVSHLGWG 975
           GD +  S SF  +DK+  G  S +E  S  F  +   S+H I APSPL GLPE S+LGWG
Sbjct: 124 GDES-HSGSFRYMDKDL-GFQSADEGGSGTFRHN---SAHAITAPSPLVGLPEFSYLGWG 178

Query: 976 HWFT 987
           HWFT
Sbjct: 179 HWFT 182



>gb:AY087491_1572522 Arabidopsis thaliana clone 36000 mRNA, complete
           sequence.
          Length = 492

 Score =  107 bits (268), Expect = 3e-22
 Identities = 72/176 (40%), Positives = 98/176 (55%), Gaps = 8/176 (4%)
 Frame = +1

Query: 484 MGSNLNEGMSKETAVFGLKVWEXXXXXXXXXXXXXXXXXTFYLTLRKKSMRAKESLPLCQ 663
           MG +L   +S+E+ VFGLKVWE                 +  LT +KKS R+K  LP+ Q
Sbjct: 1   MGGDLKSQLSRESHVFGLKVWEVIGIAVALLIIAILSVLSCCLTSKKKSRRSKTGLPVIQ 60

Query: 664 IPK-VSKEIKEVQVDQVSKNE----DGNFPTVQDKS---TEKESDGEWKTKNGDNNGQSD 819
            P  VSKEI+EV+V+ VS +     +G   T+QDK+   +EK        K   ++G+S 
Sbjct: 61  TPPVVSKEIREVRVEHVSASNFAPGEGILLTIQDKNSKDSEKVMVHLDMRKKRSSSGRSG 120

Query: 820 SFHLVDKEYHGSHSREERNSAKFAVHHKYSSHPIAAPSPLTGLPEVSHLGWGHWFT 987
           SFH ++     S S EE +++        S + IA PSPL+GLPE SHLGWGHWFT
Sbjct: 121 SFHHLEIIDKHSESAEEVSASS-------SLYNIATPSPLSGLPE-SHLGWGHWFT 168



>gb:BT008322_1639539 Arabidopsis thaliana At1g56720 gene, complete
           cds.
          Length = 492

 Score =  107 bits (267), Expect = 4e-22
 Identities = 72/176 (40%), Positives = 98/176 (55%), Gaps = 8/176 (4%)
 Frame = +1

Query: 484 MGSNLNEGMSKETAVFGLKVWEXXXXXXXXXXXXXXXXXTFYLTLRKKSMRAKESLPLCQ 663
           MG +L   +S+E+ VFGLKVWE                 +  LT +KKS R+K  LP+ Q
Sbjct: 1   MGGDLKSQLSRESHVFGLKVWEVIGIAVALLIIAILSVLSCCLTSKKKSRRSKTGLPVIQ 60

Query: 664 IPK-VSKEIKEVQVDQVSKNE----DGNFPTVQDKS---TEKESDGEWKTKNGDNNGQSD 819
            P  VSKEI+EV+V+ VS +     +G   T+QDK+   +EK        K   ++G+S 
Sbjct: 61  TPPVVSKEIREVRVEHVSASNFAPGEGILLTIQDKNNKDSEKVMVHLDMRKKRSSSGRSG 120

Query: 820 SFHLVDKEYHGSHSREERNSAKFAVHHKYSSHPIAAPSPLTGLPEVSHLGWGHWFT 987
           SFH ++     S S EE +++        S + IA PSPL+GLPE SHLGWGHWFT
Sbjct: 121 SFHHLEIIDKHSDSAEEVSASS-------SLYNIATPSPLSGLPE-SHLGWGHWFT 168



>pir|B96609|B96609 probable protein kinase F25P12.84 [imported] -
           Arabidopsis thaliana>gb:AE005173_893547 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC009323_1536713 Arabidopsis thaliana
           chromosome I BAC F25P12 genomic sequence, complete
           sequence.
          Length = 495

 Score =  107 bits (267), Expect = 4e-22
 Identities = 72/176 (40%), Positives = 98/176 (55%), Gaps = 8/176 (4%)
 Frame = +1

Query: 484 MGSNLNEGMSKETAVFGLKVWEXXXXXXXXXXXXXXXXXTFYLTLRKKSMRAKESLPLCQ 663
           MG +L   +S+E+ VFGLKVWE                 +  LT +KKS R+K  LP+ Q
Sbjct: 1   MGGDLKSQLSRESHVFGLKVWEVIGIAVALLIIAILSVLSCCLTSKKKSRRSKTGLPVIQ 60

Query: 664 IPK-VSKEIKEVQVDQVSKNE----DGNFPTVQDKS---TEKESDGEWKTKNGDNNGQSD 819
            P  VSKEI+EV+V+ VS +     +G   T+QDK+   +EK        K   ++G+S 
Sbjct: 61  TPPVVSKEIREVRVEHVSASNFAPGEGILLTIQDKNNKDSEKVMVHLDMRKKRSSSGRSG 120

Query: 820 SFHLVDKEYHGSHSREERNSAKFAVHHKYSSHPIAAPSPLTGLPEVSHLGWGHWFT 987
           SFH ++     S S EE +++        S + IA PSPL+GLPE SHLGWGHWFT
Sbjct: 121 SFHHLEIIDKHSDSAEEVSASS-------SLYNIATPSPLSGLPE-SHLGWGHWFT 168



>gb:AY085517_1570586 Arabidopsis thaliana clone 15535 mRNA, complete
           sequence.
          Length = 484

 Score = 97.1 bits (240), Expect = 5e-19
 Identities = 64/174 (36%), Positives = 101/174 (58%), Gaps = 6/174 (3%)
 Frame = +1

Query: 484 MGSNLNEGMSKETAVFGLKVWEXXXXXXXXXXXXXXXXXTFYLTLRKKSMRAKESL-PLC 660
           MGS LN+ +S+     GL++WE                 + +LT R+K+ R+  +L P+ 
Sbjct: 1   MGSGLNDTLSRNYN--GLELWEIIVIVLSAIFVVVLAI-SLWLTFRRKTSRSSSNLIPVS 57

Query: 661 QI--PKVSKEIKEVQVDQVSKNEDGN-FPTVQDKSTEKESDGEWK--TKNGDNNGQSDSF 825
           +   P V +EIKE++VD+VS +  GN +P++ +K  +KE +   K  ++NGD++ +S SF
Sbjct: 58  RQIPPSVPEEIKEIRVDEVSSSNGGNGYPSISEKFGDKEPEKGIKAESENGDSS-RSGSF 116

Query: 826 HLVDKEYHGSHSREERNSAKFAVHHKYSSHPIAAPSPLTGLPEVSHLGWGHWFT 987
           + ++K+   S S               S++P+ APSPL+GLPE SHLGWGHWFT
Sbjct: 117 NHLEKKDGSSVS---------------SANPLTAPSPLSGLPEFSHLGWGHWFT 155



>pir|D84860|D84860 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AC006580_1534489 Arabidopsis thaliana
           chromosome 2 clone F23E6 map m551, complete
           sequence.>gb:AC006931_1534812 Arabidopsis thaliana
           chromosome 2 clone F7D19 map m551, complete sequence.
          Length = 494

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 60/171 (35%), Positives = 85/171 (49%), Gaps = 5/171 (2%)
 Frame = +1

Query: 490 SNLNEGMSKETAVFGLK---VWEXXXXXXXXXXXXXXXXXTFYLTLRKKSMRAKESLPLC 660
           S+LN  MSK+ + FGLK   +W                  + ++T R+KS R+    P  
Sbjct: 5   SSLNAEMSKKISFFGLKGLKLWVWVCLVVGVFIVMILCILSLWITFRRKSRRSSSKFPFN 64

Query: 661 QIPKVSKEIKEVQVDQVSKNEDGNFPTVQDKSTEKESDGEW-KTKNGDNNGQSDSFHLVD 837
           QIP VSK+I+  +    + + +  +  + DKST K       +TK+ DN+  S    +  
Sbjct: 65  QIPHVSKDIRVDRAGFQNPHPESLYIEMNDKSTGKTMMSHLGRTKSSDNDTLSQCSSVNH 124

Query: 838 KEYH-GSHSREERNSAKFAVHHKYSSHPIAAPSPLTGLPEVSHLGWGHWFT 987
            E    SHS EE      +   +Y   P+ A SPL GLPE+SHLGWGHWFT
Sbjct: 125 HERACSSHSGEEGGFG--SAGRQYGGGPVTA-SPLVGLPEISHLGWGHWFT 172



>gb:AE016959_1023261 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC068923_1540502
           Oryza sativa chromosome 10 BAC OSJNBa0017E08 genomic
           sequence, complete sequence.>gb:AE017109_1753080 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           63 of 77 of the complete sequence.
          Length = 520

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 58/178 (32%), Positives = 86/178 (48%), Gaps = 11/178 (6%)
 Frame = +1

Query: 487 GSNLNEGMSKETAVFGLKVWEXXXXXXXXXXXXXXXXXTFYLTLRKKSMRAKESLPLCQI 666
           G  L   +S  T  FGL++W                    +   R+K  ++ + +P+ QI
Sbjct: 4   GETLRAELSSRTPPFGLRLWIVIGISIWVVIFFILGFMCLWSIYRRKPKKSFDKIPVSQI 63

Query: 667 PKVSKEIK--EVQVDQVSKN---EDGNFPTVQDKSTEKESDG------EWKTKNGDNNGQ 813
           P VSKEI   EV+   V +N   ++ +  +VQ+K  EK+S          K+ + DN  Q
Sbjct: 64  PDVSKEIAVDEVREHAVVENFRVQESHAISVQEKHYEKDSGKMLAHLVRSKSSDADNLSQ 123

Query: 814 SDSFHLVDKEYHGSHSREERNSAKFAVHHKYSSHPIAAPSPLTGLPEVSHLGWGHWFT 987
             S +  D+    S+S +E +S     H  +S +   + SPL GLPE SHLGWGHWFT
Sbjct: 124 CSSVYQCDRA-GSSYSGDEGSSGNARRH--FSQYATVSASPLVGLPEFSHLGWGHWFT 178



>pir|T47793|T47793 receptor-like protein kinase - Arabidopsis
           thaliana>gb:ATF17J16_1548972 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F17J16.
          Length = 512

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 57/177 (32%), Positives = 89/177 (50%), Gaps = 11/177 (6%)
 Frame = +1

Query: 490 SNLNEGMSKETAVFGLK---VWEXXXXXXXXXXXXXXXXXTFYLTLRKKSMRAKESL-PL 657
           S+L+  MSK+ +  GLK   +W                  + ++  R+KS R+   L P 
Sbjct: 5   SSLSADMSKKVSFLGLKGMKLWVLICLVVGTFVVLVFCILSLWIAFRRKSRRSSHKLLPF 64

Query: 658 CQIPKVSKEIK-EVQVDQVSKNEDGNFPTVQDKSTEKESD------GEWKTKNGDNNGQS 816
            QIP+V+K+I+ + +V   + NE+ +  T  DKS+++ S       G  K+ + D+  Q 
Sbjct: 65  SQIPRVAKDIRVDDRVGFQNHNENLSI-TNADKSSDRNSGKMMSYLGRTKSSDNDSISQC 123

Query: 817 DSFHLVDKEYHGSHSREERNSAKFAVHHKYSSHPIAAPSPLTGLPEVSHLGWGHWFT 987
            S H  ++    SHS E+ +       +  S   +   SPL GLPE+SHLGWGHWFT
Sbjct: 124 SSVHHHERAC-SSHSGEDGSFGAAWRQNSLSQGGLVTASPLVGLPEISHLGWGHWFT 179



>gb:AB028620_1518053 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone:MTO12.>gb:AY065430_1566536 Arabidopsis thaliana
           putative serine/threonine protein kinase (At3g17420)
           mRNA, complete cds.>gb:AY096380_1575926 Arabidopsis
           thaliana putative serine/threonine protein kinase
           (At3g17420) mRNA, complete cds.
          Length = 467

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 58/170 (34%), Positives = 77/170 (45%), Gaps = 2/170 (1%)
 Frame = +1

Query: 484 MGSNLNEGMSKETAVFGLKVWEXXXXXXXXXXXXXXXXXTFYLTLRKKSMRAKES-LPLC 660
           M S L   ++K   V  L++WE                   +L+ RKKS R+  + LP+ 
Sbjct: 1   MTSQLKRTLTKRYGV--LELWEIIVIALFAAFIVILVLSV-WLSFRKKSKRSNATTLPVT 57

Query: 661 QIPKVSKEIKEVQVDQVSKNEDG-NFPTVQDKSTEKESDGEWKTKNGDNNGQSDSFHLVD 837
           Q P+ ++EIKE+ VD  S N +G ++ T+ +K  E              NG   S  L  
Sbjct: 58  QSPRFTEEIKEISVDHGSSNNNGTSYQTLDEKFVEDIE-----------NGDKFSGSLEK 106

Query: 838 KEYHGSHSREERNSAKFAVHHKYSSHPIAAPSPLTGLPEVSHLGWGHWFT 987
           K   GSH      S               APSPL GLPEVSH+GWGHWFT
Sbjct: 107 KPLVGSHLPPSTPST-------------TAPSPLLGLPEVSHIGWGHWFT 143



>pir|G86227|G86227 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889950 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC003970_1531226 Arabidopsis thaliana
           chromosome I BAC F14J9 genomic sequence contains phyA
           marker, complete sequence.
          Length = 482

 Score = 77.4 bits (189), Expect = 4e-13
 Identities = 58/163 (35%), Positives = 77/163 (47%), Gaps = 11/163 (6%)
 Frame = +1

Query: 532 GLKVWEXXXXXXXXXXXXXXXXXTFYLTLRKKSMRAKE-SLPLCQIPKVSKEIKEVQVDQ 708
           GLK+W+                 +F L  +KKS R+K  SLP+ Q P VSKEIKEV+++ 
Sbjct: 3   GLKIWQAIFITIALIIIVVLSVLSFCLIWKKKSRRSKTLSLPIIQTPVVSKEIKEVRIEH 62

Query: 709 VSKNEDGNFPTVQDKSTEKESDGEWKTKNGDNNGQSDSFHL---VDKEYHGSHSREERNS 879
           V              ST    D +      +NN +SD F L   ++K      S     S
Sbjct: 63  V-------------VSTSSNFDPQ-----DENNNESDKFLLNLEMEKNRENGLSSSRSGS 104

Query: 880 AK---FAVHHKYSSH----PIAAPSPLTGLPEVSHLGWGHWFT 987
            K     V ++ +S        +PSPL+GLPE SHLGWGHWFT
Sbjct: 105 GKEGYLCVANRSTSSLYEMATPSPSPLSGLPE-SHLGWGHWFT 146



>gb:AP003222_1825524 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0003E08.
          Length = 492

 Score = 66.6 bits (161), Expect = 7e-10
 Identities = 52/172 (30%), Positives = 81/172 (47%), Gaps = 6/172 (3%)
 Frame = +1

Query: 490 SNLNEGMSKETAVFGLKVWEXXXXXXXXXXXXXXXXXTFYLTLRKKSMRAK--ESLPLCQ 663
           ++++  +S+ T V  L+VW                    +L++R+K   A   +     +
Sbjct: 6   NSISSALSQTTPVLRLRVW-VLIAIGIGILMAILFIIALWLSMRRKKKTAVGFDGRSHME 64

Query: 664 IPKVSKEIKEVQVDQVSKNEDGN-FPTVQDKSTEKESDG---EWKTKNGDNNGQSDSFHL 831
           IP VSK+I   +VD  S ++ G     VQDK  + +      E ++ + D   Q  S + 
Sbjct: 65  IPIVSKDINVDRVDAQSLHDSGTPIMPVQDKYEQMKGVSHLAESRSVDVDAFSQCSSVYN 124

Query: 832 VDKEYHGSHSREERNSAKFAVHHKYSSHPIAAPSPLTGLPEVSHLGWGHWFT 987
           ++K      S  E  S+        SS+  A+ SPL GLPE+SHLGWGHWFT
Sbjct: 125 IEK---AGSSYSEDYSSSGPGRKGSSSYGYASASPLVGLPELSHLGWGHWFT 173



>pir|T01086|T01086 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) T10P11.10 - Arabidopsis
           thaliana>gb:AC002330_1530281 Arabidopsis thaliana BAC
           T10P11 from chromosome IV, near 15 cM, complete
           sequence.>gb:ATCHRIV6_1546251 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 6.>gb:BT004208_1637304
           Arabidopsis thaliana clone RAFL15-29-F09 (R50149)
           putative serine/threonine protein kinase (At4g02630)
           mRNA, complete cds.>gb:BT005583_1638523 Arabidopsis
           thaliana clone U50149 putative serine/threonine protein
           kinase (At4g02630) mRNA, complete cds.
          Length = 492

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 43/182 (23%), Positives = 68/182 (37%), Gaps = 17/182 (9%)
 Frame = +1

Query: 493 NLNEGMSKETAVFGLKVWEXXXXXXXXXXXXXXXXXTFYLTLRK----KSMRAKESLPLC 660
           ++N  +S+ T++FGL++W                  + +   R+    KS+ +       
Sbjct: 6   SVNNQLSRHTSIFGLRLWVVLGVCVGAAIVLLLVLISLWFIYRRSNKNKSLESSSKSNHT 65

Query: 661 QIPKVSKEIKEV----------QVDQVSKNEDGNFPTVQ---DKSTEKESDGEWKTKNGD 801
            +P VSKEI+E+          +  Q  + ED N   ++   D        G W T +G 
Sbjct: 66  IVPVVSKEIQEIRPPIQPDPTPEPHQNQQREDDNKIHIEIGKDHRIAYPERGGW-TGSGS 124

Query: 802 NNGQSDSFHLVDKEYHGSHSREERNSAKFAVHHKYSSHPIAAPSPLTGLPEVSHLGWGHW 981
            +G  D   L+                                  L+G PEVSHLGWGHW
Sbjct: 125 GSGSGDQGLLM----------------------------------LSG-PEVSHLGWGHW 149

Query: 982 FT 987
           +T
Sbjct: 150 YT 151



>gb:AY093964_1575470 Arabidopsis thaliana At1g01540/F22L4_6 mRNA,
           complete cds.>gb:AF367265_1791718 Arabidopsis thaliana
           At1g01540/F22L4_6 mRNA, complete cds.
          Length = 479

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 43/168 (25%), Positives = 62/168 (36%), Gaps = 4/168 (2%)
 Frame = +1

Query: 496 LNEGMSKETAVFGLKVWEXXXXXXXXXXXXXXXXXTFYLTLRKKSMRAKESLPLCQI--P 669
           LN  +SK T++FGL++W                  +  LT R+K+ + +       I  P
Sbjct: 9   LNTELSKPTSIFGLRLWVVIGILLGSLIVIALFLLSLCLTSRRKNRKPRADFASAAIATP 68

Query: 670 KVSKEIKEVQVDQVSKNEDGNFPTVQDKSTEKESDGEWKTKNGDNNGQSDSFHLVDKEYH 849
            +SKEIKE+                Q++S   E              Q D   +  +   
Sbjct: 69  PISKEIKEI-------------VPAQNQSVPAEI-------------QVDIGKIEHRVVF 102

Query: 850 GSH--SREERNSAKFAVHHKYSSHPIAAPSPLTGLPEVSHLGWGHWFT 987
                S E R +A  +    YS             PEVSHLGWG W+T
Sbjct: 103 SDRVSSGESRGTASASETASYSGSGNCG-------PEVSHLGWGRWYT 143



>gb:ATY12776_1557476 Arabidopsis thaliana DNA, 40 kb surrounding
           ACS1 locus.>gb:AF332429_1787241 Arabidopsis thaliana
           clone C00102 (h) putative protein serine/threonine
           kinase (At1g01540) mRNA, complete cds.
          Length = 472

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 43/168 (25%), Positives = 62/168 (36%), Gaps = 4/168 (2%)
 Frame = +1

Query: 496 LNEGMSKETAVFGLKVWEXXXXXXXXXXXXXXXXXTFYLTLRKKSMRAKESLPLCQI--P 669
           LN  +SK T++FGL++W                  +  LT R+K+ + +       I  P
Sbjct: 9   LNTELSKPTSIFGLRLWVVIGILLGSLIVIALFLLSLCLTSRRKNRKPRADFASAAIATP 68

Query: 670 KVSKEIKEVQVDQVSKNEDGNFPTVQDKSTEKESDGEWKTKNGDNNGQSDSFHLVDKEYH 849
            +SKEIKE+                Q++S   E              Q D   +  +   
Sbjct: 69  PISKEIKEI-------------VPAQNQSVPAEI-------------QVDIGKIEHRVVF 102

Query: 850 GSH--SREERNSAKFAVHHKYSSHPIAAPSPLTGLPEVSHLGWGHWFT 987
                S E R +A  +    YS             PEVSHLGWG W+T
Sbjct: 103 SDRVSSGESRGTASASETASYSGSGNCG-------PEVSHLGWGRWYT 143



>pir|A86146|A86146 hypothetical protein F22L4.8 - Arabidopsis
           thaliana>gb:AE005172_889202 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F22L4_1677883 Sequence of BAC F22L4 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 497

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 43/168 (25%), Positives = 62/168 (36%), Gaps = 4/168 (2%)
 Frame = +1

Query: 496 LNEGMSKETAVFGLKVWEXXXXXXXXXXXXXXXXXTFYLTLRKKSMRAKESLPLCQI--P 669
           LN  +SK T++FGL++W                  +  LT R+K+ + +       I  P
Sbjct: 9   LNTELSKPTSIFGLRLWVVIGILLGSLIVIALFLLSLCLTSRRKNRKPRADFASAAIATP 68

Query: 670 KVSKEIKEVQVDQVSKNEDGNFPTVQDKSTEKESDGEWKTKNGDNNGQSDSFHLVDKEYH 849
            +SKEIKE+                Q++S   E              Q D   +  +   
Sbjct: 69  PISKEIKEI-------------VPAQNQSVPAEI-------------QVDIGKIEHRVVF 102

Query: 850 GSH--SREERNSAKFAVHHKYSSHPIAAPSPLTGLPEVSHLGWGHWFT 987
                S E R +A  +    YS             PEVSHLGWG W+T
Sbjct: 103 SDRVSSGESRGTASASETASYSGSGNCG-------PEVSHLGWGRWYT 143



>gb:AC119292_1739707 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0088F07, complete sequence.
          Length = 538

 Score = 42.0 bits (97), Expect = 0.019
 Identities = 51/184 (27%), Positives = 71/184 (38%), Gaps = 20/184 (10%)
 Frame = +1

Query: 496 LNEGMSKETAVFGLKVWEXXXXXXXXXXXXXXXXXTFYLT-LRKKSMRAKES-------- 648
           L   +S+ TAV GL++W                  +F+L   R++   AK +        
Sbjct: 14  LRNELSRRTAVLGLRLWVLVGIAVGAAFLLLLAVISFHLAQARRRKPAAKRASSAAAAAA 73

Query: 649 ------LPL--CQIPKVSKEIKEVQVDQVSKNEDGNFPTVQDKSTEKESDGEW-KTKNGD 801
                 +PL    IP VSKEI+EV V   S             +  KE  G      +GD
Sbjct: 74  APGGAAVPLSPATIPPVSKEIQEVAVHVGSLRHY----LEAGATFLKEGGGVGGAVVDGD 129

Query: 802 NNGQSDSFHLVDKEYHGSHSREERNSAKFAVHHKYSSHPIAAPSPL-TGL-PEVSHLGWG 975
           + G S  +            R     A   V    S    +A + +  G+ PEVSHLGWG
Sbjct: 130 SLGGSTVYGSQRVHIEAGKGRRMVAYADGEVGPVASDLAASAQAAVGVGVGPEVSHLGWG 189

Query: 976 HWFT 987
           HW+T
Sbjct: 190 HWYT 193



>pir|T01711|T01711 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) A_IG002N01.22 - Arabidopsis
           thaliana>gb:ATCHRIV3_1544819 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 3.>gb:IG002N01_1683033
           Arabidopsis thaliana BAC IG002N01.
          Length = 450

 Score = 40.8 bits (94), Expect = 0.041
 Identities = 42/171 (24%), Positives = 65/171 (38%), Gaps = 6/171 (3%)
 Frame = +1

Query: 493 NLNEGMSKETAVFGLKVWEXXXXXXXXXXXXXXXXXTFYLTLRKKSMRAKE---SLPLCQ 663
           ++N  +SK T++FGLK+W                  +  LT R+++ + +    +     
Sbjct: 8   SINNELSKPTSIFGLKLWVVIGILLGSLIVIALFFLSLCLTSRRRNRKPRHADFASAAVA 67

Query: 664 IPKVSKEIKEVQVDQVSKNEDGNFPTVQDKSTEKESD---GEWKTKNGDNNGQSDSFHLV 834
            P +SKEI+E+        +D   PT Q  + E + D    E +    D     +S    
Sbjct: 68  TPPISKEIQEIVRPPA---QDHCHPT-QPVAAEIQVDIGKTEHRVVFSDRVSSGES---- 119

Query: 835 DKEYHGSHSREERNSAKFAVHHKYSSHPIAAPSPLTGLPEVSHLGWGHWFT 987
                G+ S     S    V                  PEVSHLGWG W+T
Sbjct: 120 ----RGTVSETASYSGSGCVG-----------------PEVSHLGWGRWYT 149



>gb:OSJN00033_1693630 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0042L16, complete sequence.
          Length = 526

 Score = 38.9 bits (89), Expect = 0.16
 Identities = 13/15 (86%), Positives = 15/15 (100%)
 Frame = +1

Query: 943 GLPEVSHLGWGHWFT 987
           G+PEVSHLGWGHW+T
Sbjct: 170 GVPEVSHLGWGHWYT 184



>gb:AP005469_1852408 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0040I22.
          Length = 506

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 862 REERNSAKFAVHHKYSSHPIAAPSPLTGLPEVSHLGWGHWFT 987
           +E R +     H   SS   +  +P   +PEVSHLGWGHW+T
Sbjct: 128 KEHRITYPEPPHRSGSSSHGSGEAP--SVPEVSHLGWGHWYT 167



>pir|T08929|T08929 hypothetical protein T15N24.80 - Arabidopsis
           thaliana>gb:ATCHRIV65_1546544 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           65.>gb:ATT15N24_1554551 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T15N24 (ESSA project).
          Length = 763

 Score = 36.2 bits (82), Expect = 1.0
 Identities = 22/79 (27%), Positives = 41/79 (51%), Gaps = 4/79 (5%)
 Frame = +1

Query: 670 KVSKEIKEVQVDQVSKNEDGNFPTVQDKST----EKESDGEWKTKNGDNNGQSDSFHLVD 837
           K  KE  + + D+ +  +DGN   ++++ T    +K +D + K +NGD N Q ++    +
Sbjct: 157 KAGKEDIQHEADKANGTKDGNTGDIKEEGTLVDEDKGTDMDEKVENGDENKQVENVEGKE 216

Query: 838 KEYHGSHSREERNSAKFAV 894
           KE    +  +E  +AK  V
Sbjct: 217 KEDKEENKTKEVEAAKAEV 235



>gb:AY133547_1581370 Arabidopsis thaliana At1g08920/F7G19_20 mRNA,
           complete cds.>gb:AF367260_1791713 Arabidopsis thaliana
           At1g08920/F7G19_20 mRNA, complete cds.
          Length = 470

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 7/74 (9%)
 Frame = +3

Query: 285 SCEARLFHLFGCFGHWVLLGLLGL----RSVIELGFLSLSEQGIWWWSFRDLRFKDCRLS 452
           SC   LF++ G F HW  L L+GL      V+ L F+  S + +  W       K+CR S
Sbjct: 168 SCGLSLFYVIGNFVHWRNLALIGLIPCALQVVTLFFIPESPRLLGKWGHE----KECRAS 223

Query: 453 LS---GRSFDIQED 485
           L    G   DI E+
Sbjct: 224 LQSLRGDDADISEE 237



>gb:ATH249968_1552152 Arabidopsis thaliana mRNA for putative sugar
           transporter (SUGTL2 gene).
          Length = 477

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 7/74 (9%)
 Frame = +3

Query: 285 SCEARLFHLFGCFGHWVLLGLLGL----RSVIELGFLSLSEQGIWWWSFRDLRFKDCRLS 452
           SC   LF++ G F HW  L L+GL      V+ L F+  S + +  W       K+CR S
Sbjct: 168 SCGLSLFYVIGNFVHWRNLALIGLIPCALQVVTLFFIPESPRLLGKWGHE----KECRAS 223

Query: 453 LS---GRSFDIQED 485
           L    G   DI E+
Sbjct: 224 LQSLRGDDADISEE 237



>gb:CP000001_853358 Bacillus cereus ZK, complete genome.
          Length = 481

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 28/102 (27%), Positives = 46/102 (45%), Gaps = 2/102 (1%)
 Frame = +1

Query: 673 VSKEIKEVQVDQVSKNEDGNFPTVQDKSTEKESDGEWKTKNGDNN-GQSDSFHLVDKEYH 849
           VS   +E+  D+ +KN     P +  +S    SDG+W   N  +  G +  +   DK +H
Sbjct: 178 VSDHFEELGFDESAKNVLFRNPNI--RSFGGNSDGDWMHINSMSTIGPNKFYDQGDKRFH 235

Query: 850 GSHSR-EERNSAKFAVHHKYSSHPIAAPSPLTGLPEVSHLGW 972
             +   + R S   A+  K + + +    P    P+V HLGW
Sbjct: 236 PDNIIWDARESNIIAIIDKKTGNIVWKLGPDYSSPDVKHLGW 277



>gb:AJ829762_533209 Staphylococcus aureus subsp. aureus partial spa
           gene for protein A.
          Length = 343

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 23/74 (31%), Positives = 33/74 (44%), Gaps = 4/74 (5%)
 Frame = +1

Query: 667 PKVSKEI----KEVQVDQVSKNEDGNFPTVQDKSTEKESDGEWKTKNGDNNGQSDSFHLV 834
           P VSKEI    K++   Q  K ED N P+ +D +   + DG    K   N    D  +  
Sbjct: 231 PSVSKEILAEAKKLNDAQAPKEEDNNKPSKEDNNKPGKDDGNKPGKEDGNKPGKDDGNKP 290

Query: 835 DKEYHGSHSREERN 876
            KE +    +E+ N
Sbjct: 291 GKEDNNKPGKEDGN 304



>pir|A86221|A86221 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889896 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F7G19_1678558 Sequence of BAC F7G19 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 454

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 7/74 (9%)
 Frame = +3

Query: 285 SCEARLFHLFGCFGHWVLLGLLGL----RSVIELGFLSLSEQGIWWWSFRDLRFKDCRLS 452
           SC   LF++ G F HW  L L+GL      V+ L F+  S + +  W       K+CR S
Sbjct: 166 SCGLSLFYVIGNFVHWRNLALIGLIPCALQVVTLFFIPESPRLLGKWGHE----KECRAS 221

Query: 453 LS---GRSFDIQED 485
           L    G   DI E+
Sbjct: 222 LQSLRGDDADISEE 235



>gb:AE017322_442521 Listeria monocytogenes str. 4b F2365, section 1
           of 10 of the complete genome.>gb:AE017262_1074877
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 565

 Score = 34.7 bits (78), Expect = 3.0
 Identities = 23/83 (27%), Positives = 36/83 (43%)
 Frame = +1

Query: 682 EIKEVQVDQVSKNEDGNFPTVQDKSTEKESDGEWKTKNGDNNGQSDSFHLVDKEYHGSHS 861
           +IK   +D+  K  D  +PT  +     E  G+   K G+     D+ H+++  Y G H 
Sbjct: 478 KIKNSLIDEWEKQTDQIWPTYTE-DVISEKTGKVLRKKGE---LYDAHHIIENSYGGEHK 533

Query: 862 REERNSAKFAVHHKYSSHPIAAP 930
               + AKF   H+   H   AP
Sbjct: 534 WWNIHPAKFPDEHQGGIHGSGAP 556



>gb:BC085432_2564381 Danio rerio cDNA clone IMAGE:7229518, partial
           cds.
          Length = 259

 Score = 34.3 bits (77), Expect = 3.9
 Identities = 28/123 (22%), Positives = 48/123 (39%), Gaps = 5/123 (4%)
 Frame = +1

Query: 619 RKKSMRAKESLPLCQIPKVSKEIKEVQVDQVSKNEDGNFPTVQDKSTEKESDGEWKTKNG 798
           RK+  + K   PL Q+P  ++    +   Q +  ++ N P V      +     ++  + 
Sbjct: 70  RKRGPKPKH--PLIQLPAFARRSSILGGLQDTSLDEENQPKVDSLQMHRSRPQHYQLNSK 127

Query: 799 DNNGQSDSFHLVDKEYHGSHSREERNSAKFAVHHKYSSHPIAAPSPLTGLPEV-----SH 963
            ++    S   +  E H S  ++         HH Y   P    +PLTG  EV     S+
Sbjct: 128 KHHQYQPSCKEISVEQHMSGKKKHFYQLNSKKHHHYQPDPKMYDTPLTGPKEVKGQDPSN 187

Query: 964 LGW 972
            GW
Sbjct: 188 KGW 190



>gb:AY186581_2517829 Danio rerio polycomb 2 mRNA, complete cds.
          Length = 477

 Score = 34.3 bits (77), Expect = 3.9
 Identities = 28/123 (22%), Positives = 48/123 (39%), Gaps = 5/123 (4%)
 Frame = +1

Query: 619 RKKSMRAKESLPLCQIPKVSKEIKEVQVDQVSKNEDGNFPTVQDKSTEKESDGEWKTKNG 798
           RK+  + K   PL Q+P  ++    +   Q +  ++ N P V      +     ++  + 
Sbjct: 70  RKRGPKPKH--PLIQLPAFARRSSILGGLQDTSLDEENQPKVDSLQMHRSRPQHYQLNSK 127

Query: 799 DNNGQSDSFHLVDKEYHGSHSREERNSAKFAVHHKYSSHPIAAPSPLTGLPEV-----SH 963
            ++    S   +  E H S  ++         HH Y   P    +PLTG  EV     S+
Sbjct: 128 KHHQYQPSCKEISVEQHMSGKKKHFYQLNSKKHHHYQPDPKMYDTPLTGPKEVKGQDPSN 187

Query: 964 LGW 972
            GW
Sbjct: 188 KGW 190



>gb:AK016614_1158807 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4933402E13
           product:hypothetical MAGE family containing protein,
           full insert sequence.
          Length = 429

 Score = 34.3 bits (77), Expect = 3.9
 Identities = 23/92 (25%), Positives = 42/92 (45%), Gaps = 1/92 (1%)
 Frame = +1

Query: 664 IPKVSKEIKEVQVDQVSKNEDGNFPTVQDKSTEKESDGEWKTKNGDNNGQSDSFHLVDKE 843
           +P   K+ +E + + + ++EDGN    ++ + EKE + E K K  +     D  +  + E
Sbjct: 34  LPTAEKDEREGEEEVLKEDEDGNKQETEEDNVEKEDEDEEKEKEEEKEESGDEVNEEEDE 93

Query: 844 YHGSHSREERN-SAKFAVHHKYSSHPIAAPSP 936
                +REE + S+        S    + PSP
Sbjct: 94  -----TREEEDISSMILSSSNVSLAAFSPPSP 120



>gb:AE017273_424273 Bacillus cereus ATCC 10987, section 10 of 18 of
           the complete genome.>gb:AE017194_1062692 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 481

 Score = 33.9 bits (76), Expect = 5.1
 Identities = 27/102 (26%), Positives = 46/102 (45%), Gaps = 2/102 (1%)
 Frame = +1

Query: 673 VSKEIKEVQVDQVSKNEDGNFPTVQDKSTEKESDGEWKTKNGDNN-GQSDSFHLVDKEYH 849
           VS   +E+  D+ +KN     P +  +S    SDG+W   N  +  G +  +   D+ +H
Sbjct: 178 VSDHFEELGFDESAKNVLFRNPNI--RSFGGNSDGDWMHINSMSTIGPNKFYDQGDERFH 235

Query: 850 GSHSR-EERNSAKFAVHHKYSSHPIAAPSPLTGLPEVSHLGW 972
             +   + R S   A+  K + + +    P    P+V HLGW
Sbjct: 236 PENIIWDARESNIIAIIDKKTGNIVWKLGPDYSSPDVKHLGW 277



>gb:AE004969_61759 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 180

 Score = 33.9 bits (76), Expect = 5.1
 Identities = 26/102 (25%), Positives = 47/102 (46%)
 Frame = +1

Query: 622 KKSMRAKESLPLCQIPKVSKEIKEVQVDQVSKNEDGNFPTVQDKSTEKESDGEWKTKNGD 801
           K +MRAK+ + L  I  ++  +K+ +VD+ ++ +D     +  K  ++  DG    K   
Sbjct: 44  KTAMRAKDQVSLGTIRLINAAVKQFEVDERTEADDAKITAILTKMVKQRKDG---AKIYT 100

Query: 802 NNGQSDSFHLVDKEYHGSHSREERNSAKFAVHHKYSSHPIAA 927
             G+ D   L DKE           +A+  V H+Y    ++A
Sbjct: 101 EAGRQD---LADKE-----------NAEIDVLHRYLPQMLSA 128



>gb:CR382136_1669371 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 221

 Score = 33.5 bits (75), Expect = 6.6
 Identities = 23/74 (31%), Positives = 33/74 (44%)
 Frame = +1

Query: 664 IPKVSKEIKEVQVDQVSKNEDGNFPTVQDKSTEKESDGEWKTKNGDNNGQSDSFHLVDKE 843
           + K+   + E   D   + E+ N    +DK  E E  G+ K   GD NG S S H   + 
Sbjct: 24  LQKLKSLVSEYLADMNDEEEEEN--ETEDKHKEHEETGKEKENEGDKNGHSHS-HSHSQH 80

Query: 844 YHGSHSREERNSAK 885
            H SH    + +AK
Sbjct: 81  KH-SHDNVHQKNAK 93



>gb:AB013389_1512058 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K1F13.>gb:AY149928_1584877 Arabidopsis
           thaliana At5g66540/K1F13_21 mRNA, complete
           cds.>gb:AF389279_1795119 Arabidopsis thaliana
           AT5g66540/K1F13_21 mRNA, complete cds.
          Length = 524

 Score = 33.5 bits (75), Expect = 6.6
 Identities = 23/77 (29%), Positives = 38/77 (49%)
 Frame = +1

Query: 673 VSKEIKEVQVDQVSKNEDGNFPTVQDKSTEKESDGEWKTKNGDNNGQSDSFHLVDKEYHG 852
           V  E KE++ +  S+ ED       ++  E+E + E + K+GDN G  D F  + KE   
Sbjct: 124 VDDEDKEIESND-SEGEDEEEEEEDEEEEEEEEEEEEEEKDGDNEGIEDKFFKI-KEL-- 179

Query: 853 SHSREERNSAKFAVHHK 903
               EE  + ++ + HK
Sbjct: 180 EEFLEEGEAEEYGIDHK 196



>gb:BC090215_2566432 Xenopus laevis cDNA clone MGC:85078
           IMAGE:6867173, complete cds.
          Length = 845

 Score = 33.1 bits (74), Expect = 8.6
 Identities = 25/90 (27%), Positives = 41/90 (45%), Gaps = 2/90 (2%)
 Frame = +1

Query: 622 KKSMRAKESLPLCQIPKVSKEIKEVQVDQVSKNEDGNFPTVQDKSTEKESDGE--WKTKN 795
           KK  RAK+        K   ++K+ +  +  KN+D +    +DK  +   DG+  WK  N
Sbjct: 455 KKEQRAKKK-------KDKDKLKDKERSK-DKNKDRSKDKEKDKEKDGTKDGKVLWKDSN 506

Query: 796 GDNNGQSDSFHLVDKEYHGSHSREERNSAK 885
            D + +   F L D     S S+++ N  K
Sbjct: 507 KDEDSELHRFKLKDFNEIDSKSKQKENCGK 536



>gb:OSJN00207_1696708 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0049I21, complete sequence.
          Length = 248

 Score = 33.1 bits (74), Expect = 8.6
 Identities = 25/105 (23%), Positives = 49/105 (46%), Gaps = 5/105 (4%)
 Frame = +1

Query: 616 LRKKSMRAKESLPLCQIPKVSKEIKEVQVDQVSKNEDGNFPTVQDKSTEKESDGEWKTKN 795
           L KK+   K++    +I K  KE    +++  +K E+      ++K  +++     + + 
Sbjct: 132 LEKKTKETKDAKEELKITKREKEYLNTKLE--TKREENKRLDEENKKLQRKIKDLQEMQK 189

Query: 796 G---DNNGQSDSFHLVDKEYHGSHSR--EERNSAKFAVHHKYSSH 915
           G     + + DSF  VD  +HG H R  +E +  +F +H +   H
Sbjct: 190 GWITTTSTKLDSFESVDHNHHGMHHRVHKEVHRHEFHMHQEVRHH 234



>gb:OSJN00014_1693293 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0068L06, complete
           sequence.>gb:OSJN00294_1698101 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: B1160F02, complete sequence.
          Length = 604

 Score = 33.1 bits (74), Expect = 8.6
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 7/73 (9%)
 Frame = -3

Query: 937 EEMEQLSDARSICDEPQIWLNSFLLVNVTRDTPCQQDETNPIDRYYRHSLF-------SI 779
           EE+ + +DAR +      W  SF+     ++ P  +DE N I R  RH +          
Sbjct: 218 EEINEATDARDVSMIEANWRESFIRFLTKQELPQDKDEANRISRRSRHYVVHETELYKKS 277

Query: 778 PHQILSQWIYLEQ 740
           P  IL + + LE+
Sbjct: 278 PSGILQRCVSLEE 290



>gb:CR382134_1667000 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 699

 Score = 33.1 bits (74), Expect = 8.6
 Identities = 21/94 (22%), Positives = 42/94 (44%)
 Frame = +1

Query: 685 IKEVQVDQVSKNEDGNFPTVQDKSTEKESDGEWKTKNGDNNGQSDSFHLVDKEYHGSHSR 864
           I+E++ D V+   D      + +  E+E +GE + +  + + + D   L + +   S   
Sbjct: 291 IEEIEEDDVNFGSDEQEEEGEGEEEEQEEEGEGEEEEQEEDDEDD---LAEDDLASSSDS 347

Query: 865 EERNSAKFAVHHKYSSHPIAAPSPLTGLPEVSHL 966
           EE      +  H++  HP    S    +PE+S +
Sbjct: 348 EENEENDDS--HEHDEHPSDPESDTEEVPEISEI 379



>gb:CR382129_1662198 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 931

 Score = 33.1 bits (74), Expect = 8.6
 Identities = 23/94 (24%), Positives = 40/94 (42%), Gaps = 13/94 (13%)
 Frame = +1

Query: 673 VSKEIKEVQVDQVSKNEDGNFP---------TVQDKSTEKESDGEWKTKNGDNN----GQ 813
           +S+ I E Q ++   +EDGN+P          V +K   +E++GE +  + D +    G 
Sbjct: 598 ISEPIHEWQPEEPLPSEDGNWPFEEEYHYEDPVHEKPHYEENNGEHREDHSDASQELLGV 657

Query: 814 SDSFHLVDKEYHGSHSREERNSAKFAVHHKYSSH 915
            +  H  D E    H   + +  +    H  S H
Sbjct: 658 DEELHHGDDEGDEEHEEHQEDHQELHQEHSESHH 691



>gb:PFMAL7P1_1191954 Plasmodium falciparum 3D7 chromosome 7, ***
           SEQUENCING IN PROGRESS ***, 12 ordered pieces.
          Length = 1003

 Score = 33.1 bits (74), Expect = 8.6
 Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 15/96 (15%)
 Frame = +1

Query: 628 SMRAKESLPLCQIPK---VSKEI------------KEVQVDQVSKNEDGNFPTVQDKSTE 762
           +++ KES+   Q P+   VSK+I            KE+  +QV  N + N      K+ +
Sbjct: 222 NVKIKESINESQTPEKVDVSKKIQEDSSTQNNETVKELLTEQVQHNNNNNNNNKDAKNDD 281

Query: 763 KESDGEWKTKNGDNNGQSDSFHLVDKEYHGSHSREE 870
           K  D      N +NN  SD+ +     Y   H+ +E
Sbjct: 282 KSDDNNNNNNNNNNNSISDNHN-----YENIHNEKE 312



>gb:PFMAL7P1_1191873 Plasmodium falciparum 3D7 chromosome 7, ***
            SEQUENCING IN PROGRESS ***, 12 ordered pieces.
          Length = 1125

 Score = 33.1 bits (74), Expect = 8.6
 Identities = 20/78 (25%), Positives = 33/78 (42%), Gaps = 5/78 (6%)
 Frame = +1

Query: 688  KEVQVDQVSKNEDGNFPTV-----QDKSTEKESDGEWKTKNGDNNGQSDSFHLVDKEYHG 852
            KE + D  +KN+D N          D +    +DG+    +GDNN   D+ +  D    G
Sbjct: 965  KENKNDGDNKNDDDNNKNDGDDNNNDSNDNNNNDGDDNNNDGDNNNDDDNNNDDDNNNDG 1024

Query: 853  SHSREERNSAKFAVHHKY 906
              + ++ N  +   H  Y
Sbjct: 1025 DDNNDDDNEEEDLTHPNY 1042


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,008,676,666
Number of Sequences: 1806583
Number of extensions: 20922423
Number of successful extensions: 59583
Number of sequences better than 10.0: 40
Number of HSP's better than 10.0 without gapping: 55472
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 59248
length of database: 581,917,975
effective HSP length: 125
effective length of database: 356,095,100
effective search space used: 72287305300
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)