BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig1464
         (709 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AC137997_1743907 Oryza sativa chromosome 3 BAC OJ1499_D04 gen...    94   2e-18   
gb:AP003904_1835003 Oryza sativa (japonica cultivar-group) genom...    26   1e-04   
gb:AY091003_1574235 Arabidopsis thaliana unknown protein (At3g05...    44   0.004   
gb:AY084926_1570008 Arabidopsis thaliana clone 121720 mRNA, comp...    44   0.004   
gb:AY070136_1566750 Arabidopsis thaliana AT3g04930/T9J14_12 mRNA...    26   0.014   
gb:AF235168_2219411 Cereal yellow dwarf virus-RPS RPV Mex-1, com...    36   0.59    
gb:BC068834_2555332 Xenopus laevis hypothetical protein LOC39846...    36   0.76    
gb:BC043960_2548372 Xenopus laevis hypothetical protein LOC39846...    36   0.76    
gb:AP004570_1841746 Oryza sativa (japonica cultivar-group) genom...    36   0.76    
gb:CR382138_1670834 Debaryomyces hansenii chromosome F of strain...    33   3.8     
gb:CR378664_93945 Photobacterium profundum SS9; segment 2/12.          33   3.8     
sp|P50809|VE2_HPV36|VE2_HPV36 Regulatory protein E2.>gb:HPU31785_2436143 H...    33   3.8     Human papillomavirus type 36
gb:AC105770_1738226 Oryza sativa (japonica cultivar-group) chrom...    26   4.8     
gb:AE016959_1022820 Oryza sativa (japonica cultivar-group) chrom...    26   5.7     
gb:AK122572_2069237 Mus musculus mRNA for mKIAA1921 protein.           33   6.5     
gb:AP004231_1839030 Oryza sativa (japonica cultivar-group) genom...    33   6.5     
gb:AE017345_1757022 Cryptococcus neoformans var. neoformans JEC2...    33   6.5     
sp|Q80T74|KBT9_MOUSE|KBT9_MOUSE Kelch repeat and BTB domain containing prot...    33   6.5     Mus musculus [mouse]
sp|P56434|FUT6_PANTR|FUT6_PANTR Alpha-(1,3)-fucosyltransferase (EC 2.4.1.65...    33   6.5     Pan troglodytes
gb:AY026037_1559013 Lycopersicon esculentum glycine-rich protein...    26   7.5     
gb:HSM806588_2018360 Homo sapiens mRNA; cDNA DKFZp686G01173 (fro...    32   8.5     
gb:AK128492_1917232 Homo sapiens cDNA FLJ46642 fis, clone TRACH3...    32   8.5     
gb:AK124904_1915758 Homo sapiens cDNA FLJ42914 fis, clone BRHIP3...    32   8.5     
gb:AP006849_1863086 Oryza sativa (japonica cultivar-group) genom...    32   8.5     
gb:SPAPB1E7_1718665 S.pombe chromosome I BAC pB1E7.                    32   8.5     
gb:AL935260_552492 Lactobacillus plantarum strain WCFS1 complete...    32   8.5     
gb:RSU26451_168303 Rhizobium sp. BR816 NodO (nodO), putative cyt...    32   8.5     
sp|Q9GKU6|FUT6_PONPY|FUT6_PONPY Alpha-(1,3)-fucosyltransferase (EC 2.4.1.65...    32   8.5     Pongo pygmaeus [orang utan]


>gb:AC137997_1743907 Oryza sativa chromosome 3 BAC OJ1499_D04
           genomic sequence, complete sequence.>gb:AC146936_1744635
           Oryza sativa chromosome 3 B1154F06 genomic sequence,
           complete sequence.
          Length = 478

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 75/199 (37%), Positives = 102/199 (51%), Gaps = 4/199 (2%)
 Frame = +2

Query: 125 KKRQRTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGAFNDSAS 304
           +KRQR+ SS+RLS+      SS P          P      AS S  P+S         +
Sbjct: 4   RKRQRSASSSRLSTL-----SSSP---------APHTAAAAASASSPPLSF-------PN 42

Query: 305 ADTVLRLYVDCPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSERWLNESK 484
           AD VLRL++D P  DDDA+  +  D     D  +++ S  L R  YF ALLS+RW     
Sbjct: 43  ADLVLRLHLD-PCPDDDADLDAGEDHRPSLD--LHVSSASLLRSRYFAALLSDRWSPAPT 99

Query: 485 DTAGDSGSASKMHRFSLGVPDTPRSIDD----HITVLQLLYTDDYSATIDSVSTALSLLE 652
             AG  G        SL V   PRS       H+ V++LL+T D++  I S + AL +L 
Sbjct: 100 SAAGGHG------HLSLAVA-APRSASHPFHAHVEVVRLLHTLDFAGAIHSPADALDILP 152

Query: 653 VALKLIFEECIKACVRFLE 709
           VAL+L+F+ C++AC RFLE
Sbjct: 153 VALQLLFDACVEACTRFLE 171



>gb:AP003904_1835003 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1051_A08.
          Length = 908

 Score = 25.8 bits (55), Expect(5) = 1e-04
 Identities = 5/5 (100%), Positives = 5/5 (100%)
 Frame = +1

Query: 91  WWWWW 105
           WWWWW
Sbjct: 22  WWWWW 26



 Score = 25.8 bits (55), Expect(5) = 1e-04
 Identities = 5/5 (100%), Positives = 5/5 (100%)
 Frame = +1

Query: 91  WWWWW 105
           WWWWW
Sbjct: 21  WWWWW 25



 Score = 25.8 bits (55), Expect(5) = 1e-04
 Identities = 5/5 (100%), Positives = 5/5 (100%)
 Frame = +1

Query: 91  WWWWW 105
           WWWWW
Sbjct: 20  WWWWW 24



 Score = 25.8 bits (55), Expect(5) = 1e-04
 Identities = 5/5 (100%), Positives = 5/5 (100%)
 Frame = +1

Query: 91  WWWWW 105
           WWWWW
Sbjct: 19  WWWWW 23



 Score = 20.4 bits (41), Expect(5) = 1e-04
 Identities = 4/5 (80%), Positives = 4/5 (80%)
 Frame = +1

Query: 91  WWWWW 105
           W WWW
Sbjct: 17  WAWWW 21



>gb:AY091003_1574235 Arabidopsis thaliana unknown protein
           (At3g05675) mRNA, complete cds.
          Length = 441

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 44/146 (30%), Positives = 65/146 (44%), Gaps = 5/146 (3%)
 Frame = +2

Query: 287 FNDSASADTVLRLYVDCPFDDDDAESISAVDSLDQSDVQIYLHSDVL-RRCEYFEALLSE 463
           F D +S+D V+RL  +   DD                  IY HS +L  + +YF   LS+
Sbjct: 14  FGDRSSSDIVVRLRNEEGRDD-----------------WIYCHSKILSEKSQYFADRLSD 56

Query: 464 RWLNESKDTAGDSGSASKMHRFSLGVPDTPRSIDDHITVLQLLY--TDDYSAT--IDSVS 631
           +W      T     S     R+ + V       D HI +L+LLY  +DD        +V 
Sbjct: 57  KW-----PTCKILDS-----RYCVEVICQESDYDHHINLLRLLYVVSDDVHEDNLCHNVK 106

Query: 632 TALSLLEVALKLIFEECIKACVRFLE 709
           +AL +L VA +L   + + ACV +LE
Sbjct: 107 SALGILSVAKELSCPQIVTACVNYLE 132



>gb:AY084926_1570008 Arabidopsis thaliana clone 121720 mRNA,
           complete sequence.
          Length = 441

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 44/146 (30%), Positives = 65/146 (44%), Gaps = 5/146 (3%)
 Frame = +2

Query: 287 FNDSASADTVLRLYVDCPFDDDDAESISAVDSLDQSDVQIYLHSDVL-RRCEYFEALLSE 463
           F D +S+D V+RL  +   DD                  IY HS +L  + +YF   LS+
Sbjct: 14  FGDRSSSDIVVRLRNEEGRDD-----------------WIYCHSKILSEKSQYFADRLSD 56

Query: 464 RWLNESKDTAGDSGSASKMHRFSLGVPDTPRSIDDHITVLQLLY--TDDYSAT--IDSVS 631
           +W      T     S     R+ + V       D HI +L+LLY  +DD        +V 
Sbjct: 57  KW-----PTCKILDS-----RYCVEVICQESDYDHHINLLRLLYVVSDDVHEDNLCHNVK 106

Query: 632 TALSLLEVALKLIFEECIKACVRFLE 709
           +AL +L VA +L   + + ACV +LE
Sbjct: 107 SALGILSVAKELSCPQIVTACVNYLE 132



>gb:AY070136_1566750 Arabidopsis thaliana AT3g04930/T9J14_12 mRNA,
           complete cds.>gb:AY079045_1568158 Arabidopsis thaliana
           AT3g04930/T9J14_12 mRNA, complete cds.
          Length = 416

 Score = 25.8 bits (55), Expect(4) = 0.014
 Identities = 5/5 (100%), Positives = 5/5 (100%)
 Frame = +1

Query: 91  WWWWW 105
           WWWWW
Sbjct: 382 WWWWW 386



 Score = 25.8 bits (55), Expect(4) = 0.014
 Identities = 5/5 (100%), Positives = 5/5 (100%)
 Frame = +1

Query: 91  WWWWW 105
           WWWWW
Sbjct: 381 WWWWW 385



 Score = 25.8 bits (55), Expect(4) = 0.014
 Identities = 5/5 (100%), Positives = 5/5 (100%)
 Frame = +1

Query: 91  WWWWW 105
           WWWWW
Sbjct: 380 WWWWW 384



 Score = 20.4 bits (41), Expect(4) = 0.014
 Identities = 4/5 (80%), Positives = 4/5 (80%)
 Frame = +1

Query: 91  WWWWW 105
           WWW W
Sbjct: 384 WWWSW 388



>gb:AF235168_2219411 Cereal yellow dwarf virus-RPS RPV Mex-1,
           complete genome.
          Length = 246

 Score = 36.2 bits (82), Expect = 0.59
 Identities = 17/45 (37%), Positives = 27/45 (60%)
 Frame = +3

Query: 333 IVPSMTMTPSRSQPSILWTSPMSRSISIPMCFAAASTSRLFCLSG 467
           I+ S   T  R+ P ++WTSP+ RS+S+  C A   ++  +CL G
Sbjct: 150 ILESCLRTVERNSPRLVWTSPVVRSLSVDKCIA---SNCAYCLLG 191



>gb:BC068834_2555332 Xenopus laevis hypothetical protein LOC398469,
           mRNA (cDNA clone MGC:81476 IMAGE:6636477), complete cds.
          Length = 530

 Score = 35.8 bits (81), Expect = 0.76
 Identities = 36/124 (29%), Positives = 54/124 (43%), Gaps = 13/124 (10%)
 Frame = +2

Query: 356 AESISA-VDSLDQSDVQ-------IYLHSDVLR-RCEYFEALLSERWLNESKDTAGDSGS 508
           AES+    DS + SD++       I++H  VL+ RCE+F  +    W   SKD  G    
Sbjct: 356 AESLKKEFDSKETSDLKFRVDGKDIHVHKAVLKIRCEHFRTMFQSHWNENSKDVIG---- 411

Query: 509 ASKMHRFSLGVPDTPRSIDDHITVLQLLYTDDYSA----TIDSVSTALSLLEVALKLIFE 676
              + +FS  V         +   L+ LYTD+        I  +  A S  E  LK + +
Sbjct: 412 ---IDQFSYPV---------YRAFLEYLYTDNVDLAPEDAIGLLDLATSYCEDRLKKLCQ 459

Query: 677 ECIK 688
           + IK
Sbjct: 460 DIIK 463



>gb:BC043960_2548372 Xenopus laevis hypothetical protein LOC398469,
           mRNA (cDNA clone IMAGE:5571253), partial cds.
          Length = 589

 Score = 35.8 bits (81), Expect = 0.76
 Identities = 36/124 (29%), Positives = 54/124 (43%), Gaps = 13/124 (10%)
 Frame = +2

Query: 356 AESISA-VDSLDQSDVQ-------IYLHSDVLR-RCEYFEALLSERWLNESKDTAGDSGS 508
           AES+    DS + SD++       I++H  VL+ RCE+F  +    W   SKD  G    
Sbjct: 415 AESLKKEFDSKETSDLKFRVDGKDIHVHKAVLKIRCEHFRTMFQSHWNENSKDVIG---- 470

Query: 509 ASKMHRFSLGVPDTPRSIDDHITVLQLLYTDDYSA----TIDSVSTALSLLEVALKLIFE 676
              + +FS  V         +   L+ LYTD+        I  +  A S  E  LK + +
Sbjct: 471 ---IDQFSYPV---------YRAFLEYLYTDNVDLAPEDAIGLLDLATSYCEDRLKKLCQ 518

Query: 677 ECIK 688
           + IK
Sbjct: 519 DIIK 522



>gb:AP004570_1841746 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0625E02.
          Length = 439

 Score = 35.8 bits (81), Expect = 0.76
 Identities = 40/147 (27%), Positives = 57/147 (38%), Gaps = 1/147 (0%)
 Frame = +2

Query: 272 SSRGAFNDSASADTVLRLYVDCPFDDDDAESISAVDSLDQSDVQIYLHSDVLRR-CEYFE 448
           + R    D A++D V+RL                    +  D  +Y HS VL     YF 
Sbjct: 8   AGRPKIGDLATSDVVVRLRTP-----------------EGRDEWLYCHSGVLAAGSRYFA 50

Query: 449 ALLSERWLNESKDTAGDSGSASKMHRFSLGVPDTPRSIDDHITVLQLLYTDDYSATIDSV 628
             LS+ W      T    GS     R+ + V      +  H+T L+LLY  +  +    V
Sbjct: 51  DRLSDDW-----PTCQILGS-----RYCVEVHCQELDLSPHVTALRLLYAAEPCSRF-GV 99

Query: 629 STALSLLEVALKLIFEECIKACVRFLE 709
             AL +L+ A  L       ACV +LE
Sbjct: 100 RGALGVLQAAAHLACPRVAAACVDYLE 126



>gb:CR382138_1670834 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 542

 Score = 33.5 bits (75), Expect = 3.8
 Identities = 43/181 (23%), Positives = 64/181 (35%), Gaps = 8/181 (4%)
 Frame = +2

Query: 137 RTGSSNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGAFNDSASADTV 316
           R+ SS+ +SS+     SSR        S+ PS+    +S S    S   +F  S+S    
Sbjct: 126 RSSSSSSVSSSSVRSSSSRSSSRSLSSSNNPSSSSFISSSSSSSASPSSSFLTSSSIPFS 185

Query: 317 LRLYVDCPFDDDDAESISAV-------DSLDQSDVQIYLHSDVLRRCEYFEALLSERWLN 475
                       +  S+S          S   S   +  HS+   R     +       +
Sbjct: 186 SSESSSSHSSSQERSSLSVTLSSSSSSPSSTPSQASLTSHSESSTRASSSRSSSRSSSRS 245

Query: 476 ESKDTAGDSGSASKMHRFSLGVPDTPRSIDDHITVLQLLYTDDYSATI-DSVSTALSLLE 652
            S  T   S  +S   R S     + R+   H+T    L    Y  TI DS +T  SL+ 
Sbjct: 246 SSSHTQSSSSPSSSSDRTSSDRTSSDRTSSSHVTPTSSLSFSSYYTTIEDSGTTITSLVT 305

Query: 653 V 655
           V
Sbjct: 306 V 306



>gb:CR378664_93945 Photobacterium profundum SS9; segment 2/12.
          Length = 778

 Score = 33.5 bits (75), Expect = 3.8
 Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 2/95 (2%)
 Frame = +2

Query: 299 ASADTVLRLYVDCPFDD-DDAESISAVDSL-DQSDVQIYLHSDVLRRCEYFEALLSERWL 472
           A  D + RL + CP DD DD E I  ++ + D     +  HS+     E F  LL    L
Sbjct: 614 AITDVIQRLVLTCPLDDFDDDEEIETIEPISDTQPAVVVEHSN----NEMFNQLLDLEML 669

Query: 473 NESKDTAGDSGSASKMHRFSLGVPDTPRSIDDHIT 577
               +  G       +  F   +PD    +D ++T
Sbjct: 670 ESYVEIVGTKPVHESIAMFEKMMPDYIAILDSNMT 704



>sp|P50809|VE2_HPV36 Regulatory protein E2.>gb:HPU31785_2436143
           Human papillomavirus type 36, complete genome.
          Length = 509

 Score = 33.5 bits (75), Expect = 3.8
 Identities = 30/101 (29%), Positives = 45/101 (44%), Gaps = 3/101 (2%)
 Frame = -3

Query: 680 TPQISTSELPQAMTALLKRYLSSPNSRLYREVEEQ*CGRRLI*AYPERRD*TGAS*MRFQ 501
           T Q++TSE PQ      ++Y   P+SR  R   +Q   RR        R  +  S  R Q
Sbjct: 230 TKQLTTSEQPQQTETKGRKYGRRPSSRTRRPQAKQ---RR-----SRSRHRSSRSRSRSQ 281

Query: 500 NPPQCPLTHSTTAQTKEPRSTRSG---EAHRNGDRSGHRTG 387
           +    P T S T +++ P   ++G    + R+  RS  R G
Sbjct: 282 SRSHTPTTRSATTRSRSPSLAKTGVQRVSTRSRSRSTSRRG 322



>gb:AC105770_1738226 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1362_D02, complete
           sequence.>gb:AC117265_1739394 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OJ1281_H05, complete
           sequence.
          Length = 336

 Score = 26.2 bits (56), Expect(2) = 4.8
 Identities = 7/22 (31%), Positives = 11/22 (50%)
 Frame = +1

Query: 91  WWWWWRNRCCGEEETTYRKQQP 156
           WWWWW +     + +  R+  P
Sbjct: 22  WWWWWGSSLQSADFSLGRRTAP 43



 Score = 25.8 bits (55), Expect(2) = 4.8
 Identities = 5/5 (100%), Positives = 5/5 (100%)
 Frame = +1

Query: 91  WWWWW 105
           WWWWW
Sbjct: 21  WWWWW 25



>gb:AE016959_1022820 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017099_1752639
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 53 of 77 of the complete sequence.
          Length = 1030

 Score = 25.8 bits (55), Expect(2) = 5.7
 Identities = 5/5 (100%), Positives = 5/5 (100%)
 Frame = +1

Query: 91  WWWWW 105
           WWWWW
Sbjct: 19  WWWWW 23



 Score = 25.8 bits (55), Expect(2) = 5.7
 Identities = 5/5 (100%), Positives = 5/5 (100%)
 Frame = +1

Query: 91  WWWWW 105
           WWWWW
Sbjct: 18  WWWWW 22



>gb:AK122572_2069237 Mus musculus mRNA for mKIAA1921 protein.
          Length = 1004

 Score = 32.7 bits (73), Expect = 6.5
 Identities = 30/100 (30%), Positives = 46/100 (46%)
 Frame = +2

Query: 410 LHSDVLRRCEYFEALLSERWLNESKDTAGDSGSASKMHRFSLGVPDTPRSIDDHITVLQL 589
           +H +VL  C  +   L +R + +S        S S   +  L + +    + +   +L+ 
Sbjct: 471 VHQNVLASCSLYFKDLIQRSVQDS--------SQSSREKLELVLSNLQADVLE--LLLEF 520

Query: 590 LYTDDYSATIDSVSTALSLLEVALKLIFEECIKACVRFLE 709
           +YT   S  IDS + A +LLE A K  F    K CV FLE
Sbjct: 521 VYTG--SLVIDSAN-AKTLLEAASKFQFHTFCKVCVSFLE 557



>gb:AP004231_1839030 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:OSJNBa0026J14.>gb:AP004614_1842104 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OSJNBa0042P21.
          Length = 183

 Score = 32.7 bits (73), Expect = 6.5
 Identities = 38/119 (31%), Positives = 50/119 (42%), Gaps = 6/119 (5%)
 Frame = +2

Query: 131 RQRTGS-SNRLSSTVAAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGAFNDSA-- 301
           R+R G    R+SS + A+        +D C    S  RR  + S  P     A   S   
Sbjct: 56  RRRLGQRGQRMSSLLQAVCEHLG---VDLCEGDDSP-RRLGTFSSSPTPHAAASTSSPPL 111

Query: 302 ---SADTVLRLYVDCPFDDDDAESISAVDSLDQSDVQIYLHSDVLRRCEYFEALLSERW 469
              +AD VLRL   CP    D E    V     S + +++ S  L    YF ALLS+RW
Sbjct: 112 SFPNADLVLRLD-PCP----DYEVDFDVSEDHHSSIDLHVSSAPLLHSHYFGALLSDRW 165



>gb:AE017345_1757022 Cryptococcus neoformans var. neoformans JEC21
           chromosome 5, complete sequence.
          Length = 489

 Score = 32.7 bits (73), Expect = 6.5
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 5/73 (6%)
 Frame = +2

Query: 131 RQRTGSSNRLSSTV-----AAIDSSRPDEILDECSHKPSALRRTASHSHLPISSRGAFND 295
           +Q++  S  + +TV     A I+  +PDEIL      PS L R+A    +  S R    D
Sbjct: 71  QQQSSDSEAVQTTVVHRLLAQINPPQPDEILSHLKANPSDLTRSAGELLIAYSKR--CGD 128

Query: 296 SASADTVLRLYVD 334
             +   VLRL +D
Sbjct: 129 VRTQKDVLRLMID 141



>sp|Q80T74|KBT9_MOUSE Kelch repeat and BTB domain containing protein
           9.
          Length = 655

 Score = 32.7 bits (73), Expect = 6.5
 Identities = 30/100 (30%), Positives = 46/100 (46%)
 Frame = +2

Query: 410 LHSDVLRRCEYFEALLSERWLNESKDTAGDSGSASKMHRFSLGVPDTPRSIDDHITVLQL 589
           +H +VL  C  +   L +R + +S        S S   +  L + +    + +   +L+ 
Sbjct: 122 VHQNVLASCSLYFKDLIQRSVQDS--------SQSSREKLELVLSNLQADVLE--LLLEF 171

Query: 590 LYTDDYSATIDSVSTALSLLEVALKLIFEECIKACVRFLE 709
           +YT   S  IDS + A +LLE A K  F    K CV FLE
Sbjct: 172 VYTG--SLVIDSAN-AKTLLEAASKFQFHTFCKVCVSFLE 208



>sp|P56434|FUT6_PANTR Alpha-(1,3)-fucosyltransferase (EC 2.4.1.65)
           (Galactoside 3-L- fucosyltransferase)
           (Fucosyltransferase 6) (FUCT-VI).>gb:PTY14035_2040167
           Pan troglodytes FUT6 gene.
          Length = 359

 Score = 32.7 bits (73), Expect = 6.5
 Identities = 27/75 (36%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
 Frame = +3

Query: 204 SWTNVLTNHLLFGAPPLTLIFRSPRAARLMIRHPLIPSSGSTLIVPSMTMTPSRSQPSIL 383
           SW   LT  LLF        F   R +R     P +  +GS    P  T TP+ S P IL
Sbjct: 12  SWRCCLTT-LLFQLLVAVCFFSYLRVSR---DDPTVYPNGSHF--PDSTGTPAHSIPLIL 65

Query: 384 -WTSPMSRSISIPMC 425
            WT P ++ I++P C
Sbjct: 66  LWTWPFNKPIALPRC 80



>gb:AY026037_1559013 Lycopersicon esculentum glycine-rich protein
           LeGRP1 mRNA, complete cds.
          Length = 284

 Score = 25.8 bits (55), Expect(3) = 7.5
 Identities = 5/5 (100%), Positives = 5/5 (100%)
 Frame = +1

Query: 91  WWWWW 105
           WWWWW
Sbjct: 8   WWWWW 12



 Score = 23.1 bits (48), Expect(3) = 7.5
 Identities = 6/7 (85%), Positives = 6/7 (85%), Gaps = 1/7 (14%)
 Frame = +1

Query: 91  WWWW-WR 108
           WWWW WR
Sbjct: 9   WWWWTWR 15



 Score = 20.8 bits (42), Expect(3) = 7.5
 Identities = 4/5 (80%), Positives = 4/5 (80%)
 Frame = +1

Query: 91  WWWWW 105
           W WWW
Sbjct: 16  WLWWW 20



>gb:HSM806588_2018360 Homo sapiens mRNA; cDNA DKFZp686G01173 (from
           clone DKFZp686G01173).
          Length = 1210

 Score = 32.3 bits (72), Expect = 8.5
 Identities = 15/38 (39%), Positives = 26/38 (68%)
 Frame = +3

Query: 300 HPLIPSSGSTLIVPSMTMTPSRSQPSILWTSPMSRSIS 413
           HP++P SG+   + S+T++ S S+PS   T P ++S+S
Sbjct: 571 HPILPFSGNPEFLKSVTVS-SNSEPSTALTKPRAKSLS 607



>gb:AK128492_1917232 Homo sapiens cDNA FLJ46642 fis, clone
           TRACH3003037, weakly similar to Rho/Rac guanine
           nucleotide exchange factor.
          Length = 1053

 Score = 32.3 bits (72), Expect = 8.5
 Identities = 15/38 (39%), Positives = 26/38 (68%)
 Frame = +3

Query: 300 HPLIPSSGSTLIVPSMTMTPSRSQPSILWTSPMSRSIS 413
           HP++P SG+   + S+T++ S S+PS   T P ++S+S
Sbjct: 194 HPILPFSGNPEFLKSVTVS-SNSEPSTALTKPRAKSLS 230



>gb:AK124904_1915758 Homo sapiens cDNA FLJ42914 fis, clone
           BRHIP3025161, weakly similar to Rho/Rac guanine
           nucleotide exchange factor.
          Length = 1430

 Score = 32.3 bits (72), Expect = 8.5
 Identities = 15/38 (39%), Positives = 26/38 (68%)
 Frame = +3

Query: 300 HPLIPSSGSTLIVPSMTMTPSRSQPSILWTSPMSRSIS 413
           HP++P SG+   + S+T++ S S+PS   T P ++S+S
Sbjct: 571 HPILPFSGNPEFLKSVTVS-SNSEPSTALTKPRAKSLS 607



>gb:AP006849_1863086 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OSJNBa0054F02.
          Length = 103

 Score = 32.3 bits (72), Expect = 8.5
 Identities = 26/73 (35%), Positives = 33/73 (45%), Gaps = 5/73 (6%)
 Frame = +3

Query: 207 WTNVLTNHLLFGAPPLTLIFRSPRAARLMIRHP---LIPSSGSTLIVPSMTMTPS--RSQ 371
           W N  T     G+ P    F +P A    IR P   L   + S  + P  + TP+  RS 
Sbjct: 7   WKNTRT-----GSAPARSFFPAPFAGGRYIRAPTPVLRSMTTSLDVTPVASSTPAGTRSV 61

Query: 372 PSILWTSPMSRSI 410
           PSI WT P+  SI
Sbjct: 62  PSIRWTRPLLYSI 74



>gb:SPAPB1E7_1718665 S.pombe chromosome I BAC pB1E7.
          Length = 1236

 Score = 32.3 bits (72), Expect = 8.5
 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 3/95 (3%)
 Frame = +3

Query: 318 SGSTLIVPSMTMTPSRSQPSILWTSPMSRSISIPMCFAAASTSRLFCLSGG*MSQ---RT 488
           SGS+ I  + + TPS S  S   TS +S S SIP   ++  +S +  +S G  S     T
Sbjct: 513 SGSSAIPSTSSSTPSSSIISSPMTSVLSSSSSIPTSSSSDFSSSITTISSGISSSSIPST 572

Query: 489 LRGILEAHLRCTGLVSAFRIRLDQSTTTSLFFNFS 593
              +       T   S+  + +  S+T+S F + S
Sbjct: 573 FSSVSSILSSSTSSPSSTSLSISSSSTSSTFSSAS 607



>gb:AL935260_552492 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 9/11.
          Length = 617

 Score = 32.3 bits (72), Expect = 8.5
 Identities = 27/82 (32%), Positives = 39/82 (47%), Gaps = 1/82 (1%)
 Frame = +2

Query: 140 TGSSNRLSSTVAA-IDSSRPDEILDECSHKPSALRRTASHSHLPISSRGAFNDSASADTV 316
           + SSN  SS  ++ +DSS  D   +  S   S+   ++S S   + S    + S S+  V
Sbjct: 324 SSSSNSSSSNNSSDVDSSSDDSNSESSSAVDSSSDDSSSESSSAVDSSSDHSSSESSSAV 383

Query: 317 LRLYVDCPFDDDDAESISAVDS 382
                D   DD  +ES SAVDS
Sbjct: 384 -----DSSSDDSSSESSSAVDS 400



>gb:RSU26451_168303 Rhizobium sp. BR816 NodO (nodO), putative
           cytochrome P450, putative ferrodoxin, putative alcohol
           dehydrogenase, putative LuxA, and nodulation protein D
           (nodD2) genes, complete cds; and unknown gene.
          Length = 196

 Score = 32.3 bits (72), Expect = 8.5
 Identities = 29/97 (29%), Positives = 43/97 (44%), Gaps = 11/97 (11%)
 Frame = +2

Query: 383 LDQSDVQIYLHSDVLRRCEYF----------EALLSERWLNESKDTAGDSGSASKMHRFS 532
           +DQ  +   L  + +R C Y           EAL S  W +   +    SGSA     F+
Sbjct: 16  MDQKKIAELLDREAIRDCLYRYCRGIDRADEEALRSPYWPDAHDNHGAYSGSAEGFIAFA 75

Query: 533 LGVPDT-PRSIDDHITVLQLLYTDDYSATIDSVSTAL 640
           LG+  T PR+I   IT + + +     A ++S  TAL
Sbjct: 76  LGIFKTEPRNIHQ-ITNVLIEFISPTEAAVESYFTAL 111



>sp|Q9GKU6|FUT6_PONPY Alpha-(1,3)-fucosyltransferase (EC 2.4.1.65)
           (Galactoside 3-L- fucosyltransferase)
           (Fucosyltransferase 6) (FUCT-VI).>gb:AB051859_1868094
           Pongo pygmaeus FUT6 gene for fucosyltransferase,
           complete cds.
          Length = 359

 Score = 32.3 bits (72), Expect = 8.5
 Identities = 27/75 (36%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
 Frame = +3

Query: 204 SWTNVLTNHLLFGAPPLTLIFRSPRAARLMIRHPLIPSSGSTLIVPSMTMTPSRSQPSIL 383
           SW   LT  LLF        F   R +R     P +  +GS    P  T TP+ S P IL
Sbjct: 12  SWRCCLTA-LLFQLLVAVCFFSYLRVSR---DDPTVYPNGSPF--PDSTGTPAHSIPLIL 65

Query: 384 -WTSPMSRSISIPMC 425
            WT P ++ I++P C
Sbjct: 66  LWTWPFNKPIALPRC 80


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 661,333,600
Number of Sequences: 1806583
Number of extensions: 12466471
Number of successful extensions: 42049
Number of sequences better than 10.0: 28
Number of HSP's better than 10.0 without gapping: 40308
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 41945
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 41418643248
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)