BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig1436
         (1276 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|S17446|S17446 photosystem II oxygen-evolving complex protein...   376   e-103   Nicotiana tabacum [American tobacco]
gb:NTT235B_1691785 N.tabacum mRNA (T23-5B) for PSII 23-kDa polyp...   370   e-101   
sp|O49080|PSBP_FRIAG|PSBP_FRIAG Oxygen-evolving enhancer protein 2, chlorop...   370   e-101   Fritillaria agrestis
sp|P93566|PSBP_SOLTU|PSBP_SOLTU Oxygen-evolving enhancer protein 2, chlorop...   369   e-101   Solanum tuberosum [potatoes]
sp|P16059|PSBP_PEA|PSBP_PEA Oxygen-evolving enhancer protein 2, chloropla...   368   e-100   Pisum sativum [garden pea]
gb:NTOEE2AR_1691657 N.tabacum mRNA for photosystem II oxygen evo...   366   e-100   
sp|P18212|PSBP_TOBAC|PSBP_TOBAC Oxygen-evolving enhancer protein 2, chlorop...   366   e-100   Nicotiana tabacum [American tobacco]
sp|P12302|PSBP_SPIOL|PSBP_SPIOL Oxygen-evolving enhancer protein 2, chlorop...   366   e-100   Spinacia oleracea
gb:NT23WOP2A_1691234 N.tabacum mRNA for 23 kDa polypeptide of wa...   365   1e-99   
sp|P29795|PSBP_LYCES|PSBP_LYCES Oxygen-evolving enhancer protein 2, chlorop...   363   4e-99   Solanum lycopersicum
gb:NTT232AF_1691784 N.tabacum mRNA (T23-2AF) for PSII 23-kDa pol...   362   1e-98   
sp|Q9SLQ8|PSBP_CUCSA|PSBP_CUCSA Oxygen-evolving enhancer protein 2, chlorop...   356   5e-97   Cucumis sativus [cucumbers]
sp|Q42029|PSP1_ARATH|PSP1_ARATH Oxygen-evolving enhancer protein 2-1, chlor...   355   1e-96   Arabidopsis thaliana [mouse-ear cress]
sp|O49344|PSP2_ARATH|PSP2_ARATH Oxygen-evolving enhancer protein 2-2, chlor...   347   3e-94   Arabidopsis thaliana [mouse-ear cress]
sp|Q40407|PSBP_NARPS|PSBP_NARPS Oxygen-evolving enhancer protein 2, chlorop...   341   2e-92   Narcissus pseudonarcissus
sp|P11594|PSBP_SINAL|PSBP_SINAL Oxygen-evolving enhancer protein 2, chlorop...   340   5e-92   Sinapis alba [bai jie]
pir|T02873|T02873 probable photosystem II oxygen-evolving comple...   339   8e-92   Oryza sativa Japonica Group [Japonica rice]
gb:SAOES23_1704743 Sinapis alba mRNA fragment for 23kD subunit o...   337   2e-91   
pir|S03888|S03888 photosystem II oxygen-evolving complex protein...   337   2e-91   Sinapis alba [bai jie]
sp|Q96334|PSBP_BRAJU|PSBP_BRAJU Oxygen-evolving enhancer protein 2, chlorop...   333   4e-90   Brassica juncea [brown mustard]
gb:NT23WOP2B_1691235 N.tabacum mRNA for 23 kDa polypeptide of wa...   332   1e-89   
gb:AF545584_1810529 Xerophyta humilis PsbP mRNA, partial cds.         327   3e-88   
gb:NTOEE2AG_1691656 N.tabacum gene for photosystem II oxygen evo...   321   2e-86   
pir|G84712|G84712 hypothetical protein At2g30790 [imported] - Ar...   320   5e-86   Arabidopsis thaliana [mouse-ear cress]
pir|T02078|T02078 photosystem II oxygen-evolving complex protein...   315   1e-84   Oryza sativa [red rice]
sp|Q00434|PSBP_WHEAT|PSBP_WHEAT Oxygen-evolving enhancer protein 2, chlorop...   315   1e-84   Triticum aestivum [Canadian hard winter wheat]
gb:AB043961_1520042 Bruguiera gymnorhiza mRNA for oxygen evolvin...   292   1e-77   
pir|T03873|T03873 photosystem II oxygen-evolving complex protein...   288   2e-76   Oryza sativa [red rice]
sp|P11471|PSBP_CHLRE|PSBP_CHLRE Oxygen-evolving enhancer protein 2, chlorop...   230   5e-59   Chlamydomonas reinhardtii
gb:NTRNATNM3_1691749 N.tabacum mRNA (TNM3) for PSII 23-kDa polyp...   213   7e-54   
gb:AK175738_1817726 Arabidopsis thaliana mRNA for putative photo...   207   3e-52   
gb:AY267696_1314519 Bigelowiella natans photosystem II protein P...   170   7e-41   
gb:AY222741_1590592 Vitis vinifera probable oxygen-evolving enha...   144   3e-33   
pir|AE2190|AE2190 hypothetical protein all3076 [imported] - Nost...    64   7e-09   Nostoc sp. PCC 7120
pir|PS0187|PS0187 photosystem II oxygen-evolving complex protein...    62   2e-08   Oryza sativa [red rice]
gb:AY535078_1612312 Beta vulgaris SNP marker MP_oec genomic sequ...    58   5e-07   
gb:AP004396_1841140 Oryza sativa (japonica cultivar-group) genom...    54   5e-06   
gb:AE016959_1022951 Oryza sativa (japonica cultivar-group) chrom...    54   9e-06   
pir|B60484|B60484 photosystem II oxygen-evolving complex protein...    50   8e-05   Pinus monticola
gb:BA000039_727859 Thermosynechococcus elongatus BP-1 DNA, compl...    49   2e-04   
sp|P82538|TL26_ARATH|TL26_ARATH Thylakoid lumenal 25.6 kDa protein, chlorop...    48   4e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AY233206_1591684 Vitis vinifera putative oxygen evolving enha...    44   0.009   
gb:AY072442_1567259 Arabidopsis thaliana unknown protein (At2g28...    39   0.17    
gb:AC007171_1535469 Arabidopsis thaliana chromosome 2 clone T8O1...    39   0.17    
pir|C24166|C24166 photosystem II extrinsic membrane protein - sp...    38   0.51    Spinacia oleracea
sp|P83687|PSBP_EUGGR|PSBP_EUGGR Oxygen-evolving enhancer protein 2 (OEE2) (...    37   0.66    Euglena gracilis
gb:AC135418_1742227 Oryza sativa (japonica cultivar-group) chrom...    37   0.87    
pir|A60484|A60484 photosystem II oxygen-evolving complex protein...    37   1.1     Pinus monticola
gb:AE017164_395553 Prochlorococcus marinus subsp. marinus str. C...    36   1.5     
pir|S75458|S75458 hypothetical protein sll1418 - Synechocystis s...    36   1.5     Synechocystis sp. PCC 6803
gb:AP003232_1825830 Oryza sativa (japonica cultivar-group) genom...    35   3.3     
pir|T21689|T21689 hypothetical protein F33A8.3 - Caenorhabditis ...    34   5.6     Caenorhabditis elegans [roundworm]
sp|P80660|PSP1_PHYPA|PSP1_PHYPA Oxygen-evolving enhancer protein 2 (OEE2) (...    34   5.6     Physcomitrella patens
gb:AY449461_1327379 Oikopleura dioica clone BACOIKO005 4xj24, co...    33   9.6     
gb:BX569691_775829 Synechococcus sp. WH8102 complete genome; seg...    33   9.6     
gb:AF072135_476277 Caulobacter crescentus hook associated protei...    33   9.6     
pir|H87360|H87360 hypothetical protein CC0899 [imported] - Caulo...    33   9.6     Caulobacter vibrioides


>pir|S17446|S17446 photosystem II oxygen-evolving complex protein 2
           precursor - common tobacco
          Length = 268

 Score =  376 bits (966), Expect = e-103
 Identities = 191/261 (73%), Positives = 204/261 (78%), Gaps = 3/261 (1%)
 Frame = +2

Query: 116 MASTQCFYLHHXXXXXXXXXXXX---NRYVPVLKPNQLVCRAQKQXXXXXXXXXXXXXXX 286
           MASTQCF   H                RYV  LKPNQLVCRAQKQ               
Sbjct: 1   MASTQCFLHQHALSSSAARTTSSVSSQRYVSSLKPNQLVCRAQKQSSPQEDDGNSVVVSR 60

Query: 287 XXXXXXTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNP 466
                 TVLIGAAA+GSKVSPADAAYGEAANVFGKPK NT+FL   GDGFKLQVP+KWNP
Sbjct: 61  RLAL--TVLIGAAAIGSKVSPADAAYGEAANVFGKPKENTDFLAYNGDGFKLQVPAKWNP 118

Query: 467 SKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGK 646
           SKEVEFPGQVLRYEDNFD TSN+ V VTPTDKKSITDYGSPEEFL QVD+LLGKQAY GK
Sbjct: 119 SKEVEFPGQVLRYEDNFDSTSNLIVTVTPTDKKSITDYGSPEEFLTQVDFLLGKQAYFGK 178

Query: 647 TDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKL 826
           TDSEGGF+  AVATAN+LETS+  VGGK+YY +SVLTRTADGDEGGKHQLI+A+V+ GKL
Sbjct: 179 TDSEGGFESGAVATANLLETSSSTVGGKEYYILSVLTRTADGDEGGKHQLISATVNGGKL 238

Query: 827 YICKAQAGDKRWFKGARKFVE 889
           YICKAQAGDKRWFKGARKFVE
Sbjct: 239 YICKAQAGDKRWFKGARKFVE 259



>gb:NTT235B_1691785 N.tabacum mRNA (T23-5B) for PSII 23-kDa
           polypeptide.
          Length = 266

 Score =  370 bits (950), Expect = e-101
 Identities = 188/259 (72%), Positives = 201/259 (77%), Gaps = 3/259 (1%)
 Frame = +2

Query: 122 STQCFYLHHXXXXXXXXXXXX---NRYVPVLKPNQLVCRAQKQXXXXXXXXXXXXXXXXX 292
           STQCF   H                RYV  LKPNQLVCRAQKQ                 
Sbjct: 1   STQCFLHQHALSSSAARTTSSVSSQRYVSSLKPNQLVCRAQKQSSAQEDDGNSVAVSRRL 60

Query: 293 XXXXTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSK 472
               TVLIGAAAVGSKVSPADAAYGEAANVFGKPK NT+FL   GDGFKLQVP+KWNPSK
Sbjct: 61  AL--TVLIGAAAVGSKVSPADAAYGEAANVFGKPKQNTDFLAYNGDGFKLQVPAKWNPSK 118

Query: 473 EVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTD 652
           EVEFPGQVLRYEDNFD TSN+ V VTPTDKKSIT YGSPEEFL+QVD+LLGKQAY GKTD
Sbjct: 119 EVEFPGQVLRYEDNFDSTSNLIVTVTPTDKKSITGYGSPEEFLSQVDFLLGKQAYFGKTD 178

Query: 653 SEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYI 832
           SEGGF+  AVATAN+LE S   VGGK+YY +SVLTRTADGDEGGKHQLI+A+V++GKLYI
Sbjct: 179 SEGGFESGAVATANLLEASNTTVGGKEYYILSVLTRTADGDEGGKHQLISATVNDGKLYI 238

Query: 833 CKAQAGDKRWFKGARKFVE 889
           CKAQAGDKRWFKGARKFVE
Sbjct: 239 CKAQAGDKRWFKGARKFVE 257



>sp|O49080|PSBP_FRIAG Oxygen-evolving enhancer protein 2,
           chloroplast precursor (OEE2) (23 kDa subunit of oxygen
           evolving system of photosystem II) (OEC 23 kDa subunit)
           (23 kDa thylakoid membrane protein).>gb:AF037458_1763144
           Fritillaria agrestis photosystem II oxygen evolving
           complex protein 2 precursor (psbP) mRNA, complete cds.
          Length = 264

 Score =  370 bits (949), Expect = e-101
 Identities = 182/259 (70%), Positives = 207/259 (79%), Gaps = 1/259 (0%)
 Frame = +2

Query: 116 MASTQCFYLHHXXXXXXXXXXX-XNRYVPVLKPNQLVCRAQKQXXXXXXXXXXXXXXXXX 292
           MAS+ CF LHH             +R VP +KP+QL+CRAQK                  
Sbjct: 1   MASSACFLLHHAPSTPATTSRTPSHRLVPTIKPSQLICRAQKSSDTDENSSTAVSRRLAL 60

Query: 293 XXXXTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSK 472
               T+LIG+AAVG+K++PA+AAYGEAANVFGK KTNT+FLP TGDGF L +P+KWNPSK
Sbjct: 61  ----TILIGSAAVGTKIAPANAAYGEAANVFGKAKTNTDFLPYTGDGFNLLIPAKWNPSK 116

Query: 473 EVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTD 652
           EVEFPGQVLRYEDNFD TSN+ V VTPT KKSITDYG+PEEFL+ VDYLLGKQAYSGKT 
Sbjct: 117 EVEFPGQVLRYEDNFDVTSNVSVTVTPTSKKSITDYGTPEEFLSTVDYLLGKQAYSGKTA 176

Query: 653 SEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYI 832
           SEGGFDP++VATANILE STPVVGGKQYY ISVLTRTADGDEGGKH +I+A+V++GKLYI
Sbjct: 177 SEGGFDPDSVATANILEVSTPVVGGKQYYNISVLTRTADGDEGGKHHVISATVTDGKLYI 236

Query: 833 CKAQAGDKRWFKGARKFVE 889
           CKAQAGDKRWFKGA+KFVE
Sbjct: 237 CKAQAGDKRWFKGAKKFVE 255



>sp|P93566|PSBP_SOLTU Oxygen-evolving enhancer protein 2,
           chloroplast precursor (OEE2) (23 kDa subunit of oxygen
           evolving system of photosystem II) (OEC 23 kDa subunit)
           (23 kDa thylakoid membrane
           protein).>gb:STPSBPGEN_1722887 S.tuberosum mRNA for 23
           kDa oxygen evolving protein of photosystem II.
          Length = 260

 Score =  369 bits (947), Expect = e-101
 Identities = 185/257 (71%), Positives = 205/257 (79%)
 Frame = +2

Query: 119 ASTQCFYLHHXXXXXXXXXXXXNRYVPVLKPNQLVCRAQKQXXXXXXXXXXXXXXXXXXX 298
           ASTQCF LH             +  VP  KPNQL+CRAQKQ                   
Sbjct: 3   ASTQCF-LHQYHALRSSPARTSS--VPSPKPNQLICRAQKQDDANNTSNAVSRRLAL--- 56

Query: 299 XXTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEV 478
             T+LIG AA+GSKVSPADAAYGEAANVFGKPK NT+FLP  GDGFKLQ+P+KWNPSKE+
Sbjct: 57  --TLLIGTAAIGSKVSPADAAYGEAANVFGKPKENTDFLPYNGDGFKLQIPAKWNPSKEI 114

Query: 479 EFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSE 658
           EFPGQVLRYEDNFD TSN+ V VTPTDKKSITDYGSPEEFL++VDYLLGKQAY GKTDSE
Sbjct: 115 EFPGQVLRYEDNFDSTSNLMVAVTPTDKKSITDYGSPEEFLSKVDYLLGKQAYFGKTDSE 174

Query: 659 GGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYICK 838
           GGF+  AVATAN+LE S+  VGGKQYY++SVLTRTADGDEGGKHQLITA+V++GKLYICK
Sbjct: 175 GGFESGAVATANLLEASSATVGGKQYYYLSVLTRTADGDEGGKHQLITATVNDGKLYICK 234

Query: 839 AQAGDKRWFKGARKFVE 889
           AQAGDKRWFKGA+KFVE
Sbjct: 235 AQAGDKRWFKGAKKFVE 251



>sp|P16059|PSBP_PEA Oxygen-evolving enhancer protein 2, chloroplast
           precursor (OEE2) (23 kDa subunit of oxygen evolving
           system of photosystem II) (OEC 23 kDa subunit) (23 kDa
           thylakoid membrane protein).>pir|JS0771|JS0771
           photosystem II oxygen-evolving complex protein 2
           precursor - garden pea>gb:PEAPSBP_1699730 Pisum sativum
           mRNA for precursor for 23-kDa protein of photosystem II,
           complete cds.>gb:PS23KDAP_1701889 Pea mRNA for 23kDa
           polypeptide of the oxygen evolving complex of
           photosystem II.
          Length = 259

 Score =  368 bits (945), Expect = e-100
 Identities = 188/258 (72%), Positives = 203/258 (78%)
 Frame = +2

Query: 116 MASTQCFYLHHXXXXXXXXXXXXNRYVPVLKPNQLVCRAQKQXXXXXXXXXXXXXXXXXX 295
           MASTQCF LHH             R V   KPN +VC+AQKQ                  
Sbjct: 1   MASTQCF-LHHQYAITTPTRTLSQRQVVTTKPNHIVCKAQKQDDVVDAVVSRRLAL---- 55

Query: 296 XXXTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE 475
              +VLIGAAAVGSKVSPADAAYGEAANVFGK KTNT++LP  GDGFKL VP+KWNPSKE
Sbjct: 56  ---SVLIGAAAVGSKVSPADAAYGEAANVFGKAKTNTDYLPYNGDGFKLLVPAKWNPSKE 112

Query: 476 VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDS 655
            EFPGQVLRYEDNFD TSN+ VLV  TDKKSITDYGSPEEFL++VDYLLGKQA+ G+TDS
Sbjct: 113 REFPGQVLRYEDNFDATSNVSVLVQTTDKKSITDYGSPEEFLSKVDYLLGKQAFFGQTDS 172

Query: 656 EGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYIC 835
           EGGFD NAVA ANILE+S PV+GGKQYY ISVLTRTADGDEGGKHQLITA+V +GKLYIC
Sbjct: 173 EGGFDTNAVAVANILESSAPVIGGKQYYNISVLTRTADGDEGGKHQLITATVKDGKLYIC 232

Query: 836 KAQAGDKRWFKGARKFVE 889
           KAQAGDKRWFKGARKFVE
Sbjct: 233 KAQAGDKRWFKGARKFVE 250



>gb:NTOEE2AR_1691657 N.tabacum mRNA for photosystem II oxygen
           evolving complex 23 kDa polypeptide.
          Length = 261

 Score =  366 bits (940), Expect = e-100
 Identities = 183/234 (78%), Positives = 196/234 (83%)
 Frame = +2

Query: 188 RYVPVLKPNQLVCRAQKQXXXXXXXXXXXXXXXXXXXXXTVLIGAAAVGSKVSPADAAYG 367
           RYV  LKPNQLVCRAQKQ                     TVLIGAAA+GSKVSPADAAYG
Sbjct: 21  RYVSSLKPNQLVCRAQKQSSPQEDDGNSVVVSRRLAL--TVLIGAAAIGSKVSPADAAYG 78

Query: 368 EAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV 547
           EAANVFGKPK NT+FL   GDGFKLQVP+KWNPSKEVEFPGQVLRYEDNFD TSN+ V V
Sbjct: 79  EAANVFGKPKENTDFLAYNGDGFKLQVPAKWNPSKEVEFPGQVLRYEDNFDSTSNLIVTV 138

Query: 548 TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGG 727
           TPTDKKSITDYGSPEEFL QVD+LLGKQAY GKTDSEGGF+  AVATAN+LETS+  VGG
Sbjct: 139 TPTDKKSITDYGSPEEFLTQVDFLLGKQAYFGKTDSEGGFESGAVATANLLETSSSTVGG 198

Query: 728 KQYYFISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE 889
           K+YY +SVLTRTADGDEGGKHQLI+A+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct: 199 KEYYILSVLTRTADGDEGGKHQLISATVNGGKLYICKAQAGDKRWFKGARKFVE 252



>sp|P18212|PSBP_TOBAC Oxygen-evolving enhancer protein 2,
           chloroplast precursor (OEE2) (23 kDa subunit of oxygen
           evolving system of photosystem II) (OEC 23 kDa subunit)
           (23 kDa thylakoid membrane protein).>gb:NTPHII_1691682
           N. tabacum mRNA for a photosystem II 23kDa polypeptide.
          Length = 265

 Score =  366 bits (939), Expect = e-100
 Identities = 185/259 (71%), Positives = 208/259 (80%), Gaps = 1/259 (0%)
 Frame = +2

Query: 116 MASTQCFYLHHXXXXXXXXXXXXNRYVPVLKPNQL-VCRAQKQXXXXXXXXXXXXXXXXX 292
           MASTQCF LHH               VP LKPNQL VCRAQKQ                 
Sbjct: 1   MASTQCF-LHHHALSTPARTPLVRSIVPSLKPNQLLVCRAQKQSAPQEDNVNSVSVSRRL 59

Query: 293 XXXXTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSK 472
               TVLIGAAAVGSKVSPADAAYGEAANVFGKPKT+T+F    GDGFKLQ+PSKWNP+K
Sbjct: 60  AL--TVLIGAAAVGSKVSPADAAYGEAANVFGKPKTDTDFQTYNGDGFKLQIPSKWNPNK 117

Query: 473 EVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTD 652
           EVE+PGQVLR+EDNFD TSN+ V +TPTDKKSITD+GSPE+FL+QVDYLLG+QAYSGKTD
Sbjct: 118 EVEYPGQVLRFEDNFDATSNVIVAITPTDKKSITDFGSPEQFLSQVDYLLGRQAYSGKTD 177

Query: 653 SEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYI 832
           SEGGF+ +AVA AN+LETS+  VGGK YY++SVLTRTADG+EGGKHQLITA+V++GKLYI
Sbjct: 178 SEGGFESDAVAIANVLETSSAEVGGKPYYYLSVLTRTADGNEGGKHQLITATVNDGKLYI 237

Query: 833 CKAQAGDKRWFKGARKFVE 889
           CKAQAGDKRWFKGA+KFVE
Sbjct: 238 CKAQAGDKRWFKGAKKFVE 256



>sp|P12302|PSBP_SPIOL Oxygen-evolving enhancer protein 2,
           chloroplast precursor (OEE2) (23 kDa subunit of oxygen
           evolving system of photosystem II) (OEC 23 kDa subunit)
           (23 kDa thylakoid membrane protein).>pir|S00005|S00005
           photosystem II oxygen-evolving complex protein 2
           precursor - spinach>gb:SOOEC23_1715829 Spinach mRNA 23
           kDa protein of the photosynthetic oxygen-evolving
           complex (OEC).
          Length = 267

 Score =  366 bits (939), Expect = e-100
 Identities = 187/261 (71%), Positives = 203/261 (77%), Gaps = 3/261 (1%)
 Frame = +2

Query: 116 MASTQCFYLHHXXXXXXXXX--XXXNRYVPV-LKPNQLVCRAQKQXXXXXXXXXXXXXXX 286
           MAST CF  HH               RY  V +KPNQ+VC+AQKQ               
Sbjct: 1   MASTACFLHHHAAISSPAAGRGSAAQRYQAVSIKPNQIVCKAQKQDDNEANVLNSGVSRR 60

Query: 287 XXXXXXTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNP 466
                 TVLIGAAAVGSKVSPADAAYGEAANVFGKPK NTEF+P  GDGFKL VPSKWNP
Sbjct: 61  LAL---TVLIGAAAVGSKVSPADAAYGEAANVFGKPKKNTEFMPYNGDGFKLLVPSKWNP 117

Query: 467 SKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGK 646
           SKE EFPGQVLRYEDNFD TSN+ VLV PTDKKSITD+GSPE+FL+QVDYLLGKQAY GK
Sbjct: 118 SKEKEFPGQVLRYEDNFDATSNLSVLVQPTDKKSITDFGSPEDFLSQVDYLLGKQAYFGK 177

Query: 647 TDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKL 826
           TDSEGGFD   VA+AN+LE+STPVV GKQYY I+VLTRTADGDEGGKHQ+I A+V +GKL
Sbjct: 178 TDSEGGFDSGVVASANVLESSTPVVDGKQYYSITVLTRTADGDEGGKHQVIAATVKDGKL 237

Query: 827 YICKAQAGDKRWFKGARKFVE 889
           YICKAQAGDKRWFKGA+KFVE
Sbjct: 238 YICKAQAGDKRWFKGAKKFVE 258



>gb:NT23WOP2A_1691234 N.tabacum mRNA for 23 kDa polypeptide of
           water-oxidizing complex of photosystem II.
          Length = 268

 Score =  365 bits (936), Expect = 1e-99
 Identities = 190/263 (72%), Positives = 203/263 (77%), Gaps = 5/263 (1%)
 Frame = +2

Query: 116 MASTQCFYLHHXXXXXXXXXXXX---NRYVPVLKPNQLVCRAQKQXXXXXXXXXXXXXXX 286
           MASTQCF   H                RYV  LKPNQLVCRAQKQ               
Sbjct: 1   MASTQCFLHQHALSSSAARTTSSVSSQRYVSSLKPNQLVCRAQKQSSPQEDDGNSVVVSR 60

Query: 287 XXXXXXTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNP 466
                 TVLIGAAA+GSKVSPADAAYGEAANVFGKPK NT+FL   GDGFKLQVP+KWNP
Sbjct: 61  RLAL--TVLIGAAAIGSKVSPADAAYGEAANVFGKPKKNTDFLAYNGDGFKLQVPAKWNP 118

Query: 467 SKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGK 646
           SKEVEFPGQVLRYEDNFD TSN+ V VTPTDKKSITDYGSPEEFL QVD+LLGKQAY  K
Sbjct: 119 SKEVEFPGQVLRYEDNFDSTSNLIVTVTPTDKKSITDYGSPEEFLTQVDFLLGKQAY--K 176

Query: 647 TDSEGGFDPNAV--ATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNG 820
           TDSEGGF+  AV  ATAN+LETS+  VGGK+YY +SVLTRTADGDEGGKHQLI+A+V+ G
Sbjct: 177 TDSEGGFESGAVATATANLLETSSSTVGGKEYYILSVLTRTADGDEGGKHQLISATVNGG 236

Query: 821 KLYICKAQAGDKRWFKGARKFVE 889
           KLYICKAQAGDKRWFKGARKFVE
Sbjct: 237 KLYICKAQAGDKRWFKGARKFVE 259



>sp|P29795|PSBP_LYCES Oxygen-evolving enhancer protein 2,
           chloroplast precursor (OEE2) (23 kDa subunit of oxygen
           evolving system of photosystem II) (OEC 23 kDa subunit)
           (23 kDa thylakoid membrane protein).>pir|S20872|F2TOX2
           photosystem II oxygen-evolving complex protein 2
           precursor - tomato>gb:LEPSBXMR_1684415 L.esculentum psbX
           mRNA for photosystem II 23 kDa protein.
          Length = 258

 Score =  363 bits (932), Expect = 4e-99
 Identities = 183/257 (71%), Positives = 203/257 (78%)
 Frame = +2

Query: 119 ASTQCFYLHHXXXXXXXXXXXXNRYVPVLKPNQLVCRAQKQXXXXXXXXXXXXXXXXXXX 298
           ASTQCF LH             +   P  KPNQL+CRAQKQ                   
Sbjct: 3   ASTQCF-LHQYHALRSSPARTSSVSSP--KPNQLICRAQKQDDASNAAVSRRLAL----- 54

Query: 299 XXTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEV 478
             T+LIG AA+GSKVSPADAAYGEAANVFGKPK NT+FLP  GDGFKLQVP+KWNPSKEV
Sbjct: 55  --TLLIGTAAIGSKVSPADAAYGEAANVFGKPKENTDFLPYNGDGFKLQVPAKWNPSKEV 112

Query: 479 EFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSE 658
           E+PGQVLRYEDNFD TSN+ V VTPTDKKSITDYGSPEEFL++VDYLLGKQAY GKTDSE
Sbjct: 113 EYPGQVLRYEDNFDSTSNLIVAVTPTDKKSITDYGSPEEFLSKVDYLLGKQAYFGKTDSE 172

Query: 659 GGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYICK 838
           GGF+  AVAT N+LE S+  VGGK+YY++SVLTRTADGDEGGKHQLITA+V++GKLYICK
Sbjct: 173 GGFESGAVATRNLLEASSATVGGKEYYYLSVLTRTADGDEGGKHQLITATVNDGKLYICK 232

Query: 839 AQAGDKRWFKGARKFVE 889
           AQAGDKRWFKGA+KFVE
Sbjct: 233 AQAGDKRWFKGAKKFVE 249



>gb:NTT232AF_1691784 N.tabacum mRNA (T23-2AF) for PSII 23-kDa
           polypeptide.
          Length = 266

 Score =  362 bits (928), Expect = 1e-98
 Identities = 181/259 (69%), Positives = 207/259 (79%), Gaps = 1/259 (0%)
 Frame = +2

Query: 116 MASTQCFYLHHXXXXXXXXXXXXNRYVPVLKPNQL-VCRAQKQXXXXXXXXXXXXXXXXX 292
           MASTQCF LHH               VP LK NQL VCRAQ +                 
Sbjct: 1   MASTQCF-LHHHALSTPARTSLVRGIVPSLKSNQLLVCRAQNKQSAPQQDNVNSVSVSRR 59

Query: 293 XXXXTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSK 472
               T+LIGAAAVGSKVSPADAAYGEAANVFGKPKT+T+F    GDGFKLQ+PSKWNP+K
Sbjct: 60  LAL-TLLIGAAAVGSKVSPADAAYGEAANVFGKPKTDTDFQTYNGDGFKLQIPSKWNPNK 118

Query: 473 EVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTD 652
           EVE+PGQVLR+EDNFD TSN+ V +TPTDKKSITD+GSPE+FL+QVDYLLG+QAYSGKTD
Sbjct: 119 EVEYPGQVLRFEDNFDATSNVIVAITPTDKKSITDFGSPEQFLSQVDYLLGRQAYSGKTD 178

Query: 653 SEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYI 832
           SEGGF+ +AVA AN+LETST  VGGKQYY++S+LTRTADG+EGGKHQL+TA+V++GKLYI
Sbjct: 179 SEGGFESDAVAIANVLETSTAEVGGKQYYYLSILTRTADGNEGGKHQLVTATVNDGKLYI 238

Query: 833 CKAQAGDKRWFKGARKFVE 889
           CKAQAGDKRWFKGA+KFVE
Sbjct: 239 CKAQAGDKRWFKGAKKFVE 257



>sp|Q9SLQ8|PSBP_CUCSA Oxygen-evolving enhancer protein 2,
           chloroplast precursor (OEE2) (23 kDa subunit of oxygen
           evolving system of photosystem II) (OEC 23 kDa subunit)
           (23 kDa thylakoid membrane protein)
           (OEC23).>gb:AB032245_1518660 Cucumis sativus psbP mRNA
           for 23kDa polypeptide of the oxygen-evolving complex of
           photosystem II, complete cds.
          Length = 263

 Score =  356 bits (914), Expect = 5e-97
 Identities = 178/258 (68%), Positives = 197/258 (76%)
 Frame = +2

Query: 116 MASTQCFYLHHXXXXXXXXXXXXNRYVPVLKPNQLVCRAQKQXXXXXXXXXXXXXXXXXX 295
           MAST CF  HH             +      P  LVCRAQKQ                  
Sbjct: 1   MASTSCFLHHHALTAAARSSSSPRQAALPKSPQLLVCRAQKQQPAQEEEGGVVSRRLAL- 59

Query: 296 XXXTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE 475
              TVLIGAAA+GSKVSPADAAYGEAANVFGKPK+NT++LP +GDGFKL +PSKWNPSKE
Sbjct: 60  ---TVLIGAAALGSKVSPADAAYGEAANVFGKPKSNTDYLPYSGDGFKLSIPSKWNPSKE 116

Query: 476 VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDS 655
            EFPGQVLRYEDNFD  SN+ V++ PTDKKSI D+GSPEEFL++VDYLLGKQAY GKT S
Sbjct: 117 REFPGQVLRYEDNFDSNSNLSVIINPTDKKSIKDFGSPEEFLSKVDYLLGKQAYFGKTAS 176

Query: 656 EGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYIC 835
           EGGFDP+AVATANILE +   V GK YYF+SVLTRTADGDEGGKHQLITA+V++GKLYIC
Sbjct: 177 EGGFDPDAVATANILEATASNVNGKDYYFVSVLTRTADGDEGGKHQLITATVNDGKLYIC 236

Query: 836 KAQAGDKRWFKGARKFVE 889
           KAQAGDKRWFKGARKFVE
Sbjct: 237 KAQAGDKRWFKGARKFVE 254



>sp|Q42029|PSP1_ARATH Oxygen-evolving enhancer protein 2-1,
           chloroplast precursor (OEE2) (23 kDa subunit of oxygen
           evolving system of photosystem II) (OEC 23 kDa subunit)
           (23 kDa thylakoid membrane protein).>pir|JC5271|JC5271
           oxygen-evolving complex 23K protein - Arabidopsis
           thaliana>gb:AC007592_1535981 Genomic sequence for
           Arabidopsis thaliana BAC F12K11 from chromosome I,
           complete sequence.>gb:ATPSPB_1553915 A.thaliana psbP
           gene.>gb:AY056416_1563724 Arabidopsis thaliana
           At1g06680/F4H5_18 mRNA, complete
           cds.>gb:AY070469_1566852 Arabidopsis thaliana
           At1g06680/F4H5_18 mRNA, complete
           cds.>gb:AY074308_1567466 Arabidopsis thaliana putative
           23 kDa polypeptide of oxygen-evolving comlex protein
           (At1g06680) mRNA, complete cds.>gb:AY087305_1572338
           Arabidopsis thaliana clone 33922 mRNA, complete
           sequence.>gb:AY096487_1576031 Arabidopsis thaliana
           putative 23 kDa polypeptide of oxygen-evolving complex
           (OEC) (At1g06680) mRNA, complete cds.
          Length = 263

 Score =  355 bits (911), Expect = 1e-96
 Identities = 179/262 (68%), Positives = 206/262 (78%), Gaps = 4/262 (1%)
 Frame = +2

Query: 116 MASTQCFYLHHXXXXXXXXXXXXN----RYVPVLKPNQLVCRAQKQXXXXXXXXXXXXXX 283
           MA + CF LH             +    R+V + KP Q++C+AQ+               
Sbjct: 1   MAYSACF-LHQSALASSAARSSSSSSSQRHVSLSKPVQIICKAQQSHEDDNSAVSRRLAL 59

Query: 284 XXXXXXXTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWN 463
                  T+L+GAAAVGSKVSPADAAYGEAANVFGKPKTNT+FLP  GDGFK+QVP+KWN
Sbjct: 60  -------TLLVGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFLPYNGDGFKVQVPAKWN 112

Query: 464 PSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSG 643
           PSKE+E+PGQVLR+EDNFD TSN+ V+VTPTDKKSITDYGSPEEFL+QV+YLLGKQAY G
Sbjct: 113 PSKEIEYPGQVLRFEDNFDATSNLNVMVTPTDKKSITDYGSPEEFLSQVNYLLGKQAYFG 172

Query: 644 KTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGK 823
           +T SEGGFD NAVATANILE+S+  VGGK YY++SVLTRTADGDEGGKHQLITA+V+ GK
Sbjct: 173 ETASEGGFDNNAVATANILESSSQEVGGKPYYYLSVLTRTADGDEGGKHQLITATVNGGK 232

Query: 824 LYICKAQAGDKRWFKGARKFVE 889
           LYICKAQAGDKRWFKGARKFVE
Sbjct: 233 LYICKAQAGDKRWFKGARKFVE 254



>sp|O49344|PSP2_ARATH Oxygen-evolving enhancer protein 2-2,
           chloroplast precursor (OEE2) (23 kDa subunit of oxygen
           evolving system of photosystem II) (OEC 23 kDa subunit)
           (23 kDa thylakoid membrane protein).
          Length = 265

 Score =  347 bits (890), Expect = 3e-94
 Identities = 170/235 (72%), Positives = 197/235 (83%), Gaps = 1/235 (0%)
 Frame = +2

Query: 188 RYVPVLKPNQLVCRAQKQXXXXXXXXXXXXXXXXXXXXXTVLIGAAAVGSKVSPAD-AAY 364
           R+V + +P  LVCRAQ+                      T+L+GAAA+GSKVSPA  AAY
Sbjct: 29  RHVSLSRPVHLVCRAQQSQENNNSAVFRRLAL-------TLLVGAAAIGSKVSPAPXAAY 81

Query: 365 GEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVL 544
           GEAANVFGKPK NT+FLP TG+GFK+Q+PSKWNPSKE+E+PGQVLR+EDNFD TSN+ V+
Sbjct: 82  GEAANVFGKPKKNTDFLPYTGEGFKIQIPSKWNPSKEIEYPGQVLRFEDNFDATSNVSVM 141

Query: 545 VTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVG 724
           +TPTDKKSITDYGSPE+FL+QV+YLLGKQAY G+T SEGGFD NAVATANILETST  +G
Sbjct: 142 ITPTDKKSITDYGSPEQFLSQVNYLLGKQAYVGETASEGGFDANAVATANILETSTQEIG 201

Query: 725 GKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE 889
           GK+YY++SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct: 202 GKEYYYLSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVE 256



>sp|Q40407|PSBP_NARPS Oxygen-evolving enhancer protein 2,
           chloroplast precursor (OEE2) (23 kDa subunit of oxygen
           evolving system of photosystem II) (OEC 23 kDa subunit)
           (23 kDa thylakoid membrane protein).>pir|S63532|S63532
           NAD(P)H-quinone oxidoreductase, 23K, precursor -
           Narcissus pseudonarcissus>gb:NPOEC23_1691102
           N.pseudonarcissus mRNA for OEC 23.
          Length = 265

 Score =  341 bits (874), Expect = 2e-92
 Identities = 176/258 (68%), Positives = 193/258 (74%)
 Frame = +2

Query: 116 MASTQCFYLHHXXXXXXXXXXXXNRYVPVLKPNQLVCRAQKQXXXXXXXXXXXXXXXXXX 295
           MAST CF LHH             R        Q    A+ Q                  
Sbjct: 1   MASTACF-LHHHAPSPATSNLSRTRSATNRDEQQQEHSARLQSPEADCATENDALLSRRL 59

Query: 296 XXXTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE 475
              T+LIG AA+GS+VS ADAAYGE+ANVFGKPKTNT+F  +TGDGFK+ +PSKWNPSKE
Sbjct: 60  AL-TILIGGAALGSRVSAADAAYGESANVFGKPKTNTDFQTVTGDGFKILIPSKWNPSKE 118

Query: 476 VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDS 655
           VEFPGQVLRYEDNFD TSN+ V+V PTDKKSI DYGSPE+FL+QVDYLLGKQAY GKT S
Sbjct: 119 VEFPGQVLRYEDNFDTTSNVGVMVNPTDKKSIKDYGSPEQFLSQVDYLLGKQAYFGKTIS 178

Query: 656 EGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYIC 835
           EGGF+PNAV TANILETSTPVVGGK YY I VLTRTADGDEGGKH LITA+VS+GKLYIC
Sbjct: 179 EGGFEPNAVRTANILETSTPVVGGKDYYSIHVLTRTADGDEGGKHLLITATVSDGKLYIC 238

Query: 836 KAQAGDKRWFKGARKFVE 889
           KAQAGDKRWFKGA+KFVE
Sbjct: 239 KAQAGDKRWFKGAKKFVE 256



>sp|P11594|PSBP_SINAL Oxygen-evolving enhancer protein 2,
           chloroplast precursor (OEE2) (23 kDa subunit of oxygen
           evolving system of photosystem II) (OEC 23 kDa subunit)
           (23 kDa thylakoid membrane protein).>pir|S10016|S10016
           photosystem II oxygen-evolving complex protein 2 - white
           mustard>gb:SA23KDP2_1704663 S.alba psbP gene for 23 kDa
           polypeptide of the oxygen-evolving complex of
           photosystem II.
          Length = 260

 Score =  340 bits (871), Expect = 5e-92
 Identities = 176/262 (67%), Positives = 199/262 (75%), Gaps = 4/262 (1%)
 Frame = +2

Query: 116 MASTQCFYLHHXXXXXXXX----XXXXNRYVPVLKPNQLVCRAQKQXXXXXXXXXXXXXX 283
           MA + CF LH                  RYV + K   LVC+AQ+               
Sbjct: 1   MAYSACF-LHQSALASSTARSSPSSSSQRYVSISK---LVCKAQQ-------THEEDNST 49

Query: 284 XXXXXXXTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWN 463
                  T+L+GAAAVGSKVSPADAAYGEAANVFGKPK NT+F   +GDGF++QVP+KWN
Sbjct: 50  VSRRLALTLLVGAAAVGSKVSPADAAYGEAANVFGKPKKNTDFTAYSGDGFQVQVPAKWN 109

Query: 464 PSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSG 643
           PS+EVE+PGQVLRYEDNFD TSN+ V+VTPTDKKSITDYGSPEEFL+QV+YLLGKQAY G
Sbjct: 110 PSREVEYPGQVLRYEDNFDATSNLNVMVTPTDKKSITDYGSPEEFLSQVNYLLGKQAYFG 169

Query: 644 KTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGK 823
           +T SEGGFD NAVATANILET+   VGGK YY++SVLTRTADGDEGGKHQLITA+V+ GK
Sbjct: 170 ETASEGGFDNNAVATANILETNIQDVGGKPYYYLSVLTRTADGDEGGKHQLITATVNGGK 229

Query: 824 LYICKAQAGDKRWFKGARKFVE 889
           LYICKAQAGDKRWFKGA KFVE
Sbjct: 230 LYICKAQAGDKRWFKGANKFVE 251



>pir|T02873|T02873 probable photosystem II oxygen-evolving complex
           protein 2 precursor - rice>gb:AF052203_1764329 Oryza
           sativa 23 kDa polypeptide of photosystem II mRNA,
           complete cds.>gb:AP004010_1836320 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OJ1351_C05.
          Length = 254

 Score =  339 bits (869), Expect = 8e-92
 Identities = 175/259 (67%), Positives = 199/259 (76%), Gaps = 1/259 (0%)
 Frame = +2

Query: 116 MASTQCFYLHHXXXXXXXXXXXXNRYVPVLKPNQLVCRAQKQXXXXXXXXXXXXXXXXXX 295
           MAST CF LH             +   P  + + LVCRAQKQ                  
Sbjct: 1   MASTSCF-LHQSTARVAARVASPS---PATRTHLLVCRAQKQDDADVSRRAALA------ 50

Query: 296 XXXTVLIGA-AAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSK 472
               +L GA AAVG KV+PA AAYGEAANVFGKPKTNTEF+  +G+GFKL +PSKWNPSK
Sbjct: 51  ----LLAGATAAVGVKVAPAAAAYGEAANVFGKPKTNTEFIAYSGEGFKLLIPSKWNPSK 106

Query: 473 EVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTD 652
           E EFPGQVLRYEDNFD  SN+ V++ PT KK+IT++GSPEEFLAQVD+LLGKQAYSGKTD
Sbjct: 107 EREFPGQVLRYEDNFDANSNVSVIINPTTKKTITEFGSPEEFLAQVDFLLGKQAYSGKTD 166

Query: 653 SEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYI 832
           SEGGF+ +AVATANILE+S PVVGGKQYY ++VLTRTADGDEGGKHQLITA+V++GKLYI
Sbjct: 167 SEGGFESDAVATANILESSAPVVGGKQYYSVTVLTRTADGDEGGKHQLITATVNDGKLYI 226

Query: 833 CKAQAGDKRWFKGARKFVE 889
           CKAQAGDKRWFKGARKFVE
Sbjct: 227 CKAQAGDKRWFKGARKFVE 245



>gb:SAOES23_1704743 Sinapis alba mRNA fragment for 23kD subunit of
           oxygen evolving system of photosystem II.
          Length = 248

 Score =  337 bits (865), Expect = 2e-91
 Identities = 170/234 (72%), Positives = 192/234 (82%)
 Frame = +2

Query: 188 RYVPVLKPNQLVCRAQKQXXXXXXXXXXXXXXXXXXXXXTVLIGAAAVGSKVSPADAAYG 367
           RYV + K   LVC+AQ+                      T+L+GAAAVGSKVSPADAAYG
Sbjct: 16  RYVSISK---LVCKAQQ-------THEEDNSTVSRRLALTLLVGAAAVGSKVSPADAAYG 65

Query: 368 EAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV 547
           EAANVFGKPK NT+F   +GDGF++QVP+KWNPS+EVE+PGQVLRYEDNFD TSN+ V+V
Sbjct: 66  EAANVFGKPKKNTDFTAYSGDGFQVQVPAKWNPSREVEYPGQVLRYEDNFDATSNLNVMV 125

Query: 548 TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGG 727
           TPTDKKSITDYGSPEEFL+QV+YLLGKQAY G+T SEGGFD NAVATANILET+   VGG
Sbjct: 126 TPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILETNIQDVGG 185

Query: 728 KQYYFISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE 889
           K YY++SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGA KFVE
Sbjct: 186 KPYYYLSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGANKFVE 239



>pir|S03888|S03888 photosystem II oxygen-evolving complex protein 2
           precursor - white mustard (fragment)
          Length = 248

 Score =  337 bits (865), Expect = 2e-91
 Identities = 170/234 (72%), Positives = 192/234 (82%)
 Frame = +2

Query: 188 RYVPVLKPNQLVCRAQKQXXXXXXXXXXXXXXXXXXXXXTVLIGAAAVGSKVSPADAAYG 367
           RYV + K   LVC+AQ+                      T+L+GAAAVGSKVSPADAAYG
Sbjct: 16  RYVSISK---LVCKAQQ-------THEEDNSTVSRRLALTLLVGAAAVGSKVSPADAAYG 65

Query: 368 EAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV 547
           EAANVFGKPK NT+F   +GDGF++QVP+KWNPS+EVE+PGQVLRYEDNFD TSN+ V+V
Sbjct: 66  EAANVFGKPKKNTDFTAYSGDGFQVQVPAKWNPSREVEYPGQVLRYEDNFDATSNLNVMV 125

Query: 548 TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGG 727
           TPTDKKSITDYGSPEEFL+QV+YLLGKQAY G+T SEGGFD NAVATANILET+   VGG
Sbjct: 126 TPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILETNIQDVGG 185

Query: 728 KQYYFISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE 889
           K YY++SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGA KFVE
Sbjct: 186 KPYYYLSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGANKFVE 239



>sp|Q96334|PSBP_BRAJU Oxygen-evolving enhancer protein 2,
           chloroplast precursor (OEE2) (23 kDa subunit of oxygen
           evolving system of photosystem II) (OEC 23 kDa subunit)
           (23 kDa thylakoid membrane protein)
           (Fragment).>gb:BJ23OESP2_1633017 B.juncea mRNA for 23 kD
           protein of oxygen evolving system of photosystem II.
          Length = 217

 Score =  333 bits (854), Expect = 4e-90
 Identities = 161/195 (82%), Positives = 179/195 (91%)
 Frame = +2

Query: 305 TVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEF 484
           T+L+GAAAVGSKVSPADAAYGEAANVFGKPKTNT+F  I GDGF++QVP+KWNPS+EVE+
Sbjct: 14  TLLVGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFTAINGDGFQVQVPAKWNPSREVEY 73

Query: 485 PGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGG 664
           PGQVLRYEDNFD TSN+ V+VTPTDKKSITDYGSPEEFL+QV+YLLGKQAY G+T  EGG
Sbjct: 74  PGQVLRYEDNFDATSNLNVMVTPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGETACEGG 133

Query: 665 FDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYICKAQ 844
           FD NAVATANILET+   VGGK YY++SVLTRTAD DEGGKHQLITA+V+ GKLYICKAQ
Sbjct: 134 FDNNAVATANILETNIQDVGGKPYYYLSVLTRTADEDEGGKHQLITATVNGGKLYICKAQ 193

Query: 845 AGDKRWFKGARKFVE 889
           AGDKRWFKGA KFVE
Sbjct: 194 AGDKRWFKGANKFVE 208



>gb:NT23WOP2B_1691235 N.tabacum mRNA for 23 kDa polypeptide of
           water-oxidizing complex of photosystem II.
          Length = 205

 Score =  332 bits (850), Expect = 1e-89
 Identities = 156/195 (80%), Positives = 181/195 (92%)
 Frame = +2

Query: 305 TVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEF 484
           T+LIG+AA+GSKVSPADAAYGEAANVFGK KTNT+F    GDGFKLQ+PSKWNP+KEVE+
Sbjct: 2   TLLIGSAAIGSKVSPADAAYGEAANVFGKAKTNTDFQTYNGDGFKLQIPSKWNPNKEVEY 61

Query: 485 PGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGG 664
           PGQVLR+EDNFD TSN+ V +TPTDKKSITD+GSPE+FL+QVDYLLG+QAYSGKTDSEGG
Sbjct: 62  PGQVLRFEDNFDATSNVIVAITPTDKKSITDFGSPEQFLSQVDYLLGRQAYSGKTDSEGG 121

Query: 665 FDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYICKAQ 844
           F+ +AVA AN+LETS+  VGGK YY++SVLTRTADG+EGGKHQLITA+V++GKLYICKAQ
Sbjct: 122 FESDAVAIANVLETSSAEVGGKPYYYLSVLTRTADGNEGGKHQLITATVNDGKLYICKAQ 181

Query: 845 AGDKRWFKGARKFVE 889
           AGDKRW KGA+KFVE
Sbjct: 182 AGDKRWLKGAKKFVE 196



>gb:AF545584_1810529 Xerophyta humilis PsbP mRNA, partial cds.
          Length = 244

 Score =  327 bits (838), Expect = 3e-88
 Identities = 166/253 (65%), Positives = 186/253 (73%)
 Frame = +2

Query: 116 MASTQCFYLHHXXXXXXXXXXXXNRYVPVLKPNQLVCRAQKQXXXXXXXXXXXXXXXXXX 295
           MAST CF   H             R  P  +  Q+VC+AQ                    
Sbjct: 1   MASTACFL--HLAPSTAVSRASSQRLAPSFRTTQVVCKAQNHDDENNAVISRRLTL---- 54

Query: 296 XXXTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE 475
              TVL+GAAAVG+KV+PADAAYGEAANVFG+PKTNT+FL   GDGFK+ +PSKWN SKE
Sbjct: 55  ---TVLVGAAAVGAKVNPADAAYGEAANVFGRPKTNTDFLTYAGDGFKVLIPSKWNFSKE 111

Query: 476 VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDS 655
           VE+PGQVLRYEDNFD  SN+ V+V PTDKKSITD+GSPEEFL++VDYLLGKQAY GKT S
Sbjct: 112 VEYPGQVLRYEDNFDANSNLAVMVQPTDKKSITDFGSPEEFLSKVDYLLGKQAYFGKTAS 171

Query: 656 EGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYIC 835
           EGGFD + VATANILE S   VGGK YY ISVLTRTADGDEGGKHQ+I A+VS+GKLYIC
Sbjct: 172 EGGFDKDVVATANILEASATEVGGKPYYNISVLTRTADGDEGGKHQIIAATVSDGKLYIC 231

Query: 836 KAQAGDKRWFKGA 874
           K QAGDKRWFKGA
Sbjct: 232 KVQAGDKRWFKGA 244



>gb:NTOEE2AG_1691656 N.tabacum gene for photosystem II oxygen
           evolving complex 23 kDa polypeptide.
          Length = 229

 Score =  321 bits (823), Expect = 2e-86
 Identities = 165/231 (71%), Positives = 175/231 (75%), Gaps = 3/231 (1%)
 Frame = +2

Query: 116 MASTQCFYLHHXXXXXXXXXXXX---NRYVPVLKPNQLVCRAQKQXXXXXXXXXXXXXXX 286
           MASTQCF   H                RYV  LKPNQLVCRAQKQ               
Sbjct: 1   MASTQCFLHQHALSSSAARTTSSVSSQRYVSSLKPNQLVCRAQKQSSPQEDDGNSVVVSR 60

Query: 287 XXXXXXTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNP 466
                 TVLIGAAA+GSKVSPADAAYGEAANVFGKPK NT+FL   GDGFKLQVP+KWNP
Sbjct: 61  RLAL--TVLIGAAAIGSKVSPADAAYGEAANVFGKPKENTDFLAYNGDGFKLQVPAKWNP 118

Query: 467 SKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGK 646
           SKEVEFPGQVLRYEDNFD TSN+ V VTPTDKKSITDYGSPEEFL QVD+LLGKQAY GK
Sbjct: 119 SKEVEFPGQVLRYEDNFDSTSNLIVTVTPTDKKSITDYGSPEEFLTQVDFLLGKQAYFGK 178

Query: 647 TDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLI 799
           TDSEGGF+  AVATAN+LETS+  VGGK+YY +SVLTRTADGDEGGKHQLI
Sbjct: 179 TDSEGGFESGAVATANLLETSSSTVGGKEYYILSVLTRTADGDEGGKHQLI 229



>pir|G84712|G84712 hypothetical protein At2g30790 [imported] -
           Arabidopsis thaliana>gb:AC002340_1530537 Arabidopsis
           thaliana chromosome 2 BAC T11J7 genomic sequence,
           complete sequence.
          Length = 257

 Score =  320 bits (819), Expect = 5e-86
 Identities = 158/234 (67%), Positives = 186/234 (79%)
 Frame = +2

Query: 188 RYVPVLKPNQLVCRAQKQXXXXXXXXXXXXXXXXXXXXXTVLIGAAAVGSKVSPADAAYG 367
           R+V + +P  LVCRAQ+                      T+L+GAAA+GSKVSPA     
Sbjct: 29  RHVSLSRPVHLVCRAQQSQENNNSAVFRRLAL-------TLLVGAAAIGSKVSPAPP--- 78

Query: 368 EAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV 547
               +   PK NT+FLP TG+GFK+Q+PSKWNPSKE+E+PGQVLR+EDNFD TSN+ V++
Sbjct: 79  ----MVKPPKKNTDFLPYTGEGFKIQIPSKWNPSKEIEYPGQVLRFEDNFDATSNVSVMI 134

Query: 548 TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGG 727
           TPTDKKSITDYGSPE+FL+QV+YLLGKQAY G+T SEGGFD NAVATANILETST  +GG
Sbjct: 135 TPTDKKSITDYGSPEQFLSQVNYLLGKQAYVGETASEGGFDANAVATANILETSTQEIGG 194

Query: 728 KQYYFISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE 889
           K+YY++SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct: 195 KEYYYLSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVE 248



>pir|T02078|T02078 photosystem II oxygen-evolving complex protein -
           rice>gb:AF022732_1762007 Oryza sativa 23kDa polypeptide
           of photosystem II mRNA, complete cds.
          Length = 254

 Score =  315 bits (808), Expect = 1e-84
 Identities = 160/258 (62%), Positives = 188/258 (72%)
 Frame = +2

Query: 116 MASTQCFYLHHXXXXXXXXXXXXNRYVPVLKPNQLVCRAQKQXXXXXXXXXXXXXXXXXX 295
           MAST CF LH             +   P  + + LVCRAQKQ                  
Sbjct: 1   MASTSCF-LHQSTARVAARVASPS---PATRTHLLVCRAQKQDDADFSRRAALALLAGTT 56

Query: 296 XXXTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKE 475
                    AAVG  V+P  AAYGEAANVFGKPKTNTEF+P +G+GFKL +PSKWNPSKE
Sbjct: 57  ---------AAVGVNVAPPAAAYGEAANVFGKPKTNTEFIPYSGEGFKLLIPSKWNPSKE 107

Query: 476 VEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDS 655
            EFPGQVLRY++NF   SN+ V++ P  KK++ ++GSP+EFL QVD+LLGKQAYSGKTDS
Sbjct: 108 REFPGQVLRYKENFHADSNVSVIINPPTKKTVAEFGSPQEFLPQVDFLLGKQAYSGKTDS 167

Query: 656 EGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYIC 835
           EGGF+ +AVATANILE+S PVVGGKQY+ ++VLTRTADGDEGGKHQLITA+V++GKL IC
Sbjct: 168 EGGFESDAVATANILESSAPVVGGKQYHSVTVLTRTADGDEGGKHQLITATVNDGKLNIC 227

Query: 836 KAQAGDKRWFKGARKFVE 889
           KAQ GDKRWFKGARKFVE
Sbjct: 228 KAQPGDKRWFKGARKFVE 245



>sp|Q00434|PSBP_WHEAT Oxygen-evolving enhancer protein 2,
           chloroplast precursor (OEE2) (23 kDa subunit of oxygen
           evolving system of photosystem II) (OEC 23 kDa subunit)
           (23 kDa thylakoid membrane protein).>pir|S22763|S22763
           photosystem II oxygen-evolving complex protein 2
           precursor - wheat>gb:TAPPSBP_1724616 Wheat PsbP mRNA for
           23 kDa oxygen evolving protein of photosystem II.
          Length = 258

 Score =  315 bits (808), Expect = 1e-84
 Identities = 163/259 (62%), Positives = 192/259 (74%), Gaps = 1/259 (0%)
 Frame = +2

Query: 116 MASTQCFYLHHXXXXXXXXXXXXNRYVPVLKPNQL-VCRAQKQXXXXXXXXXXXXXXXXX 292
           MAST CF LH              R  P +   QL VC+AQK                  
Sbjct: 1   MASTSCF-LHQSTARLAASA----RPAPAVGRTQLFVCKAQKNDEAASDAAVVTSRRAAL 55

Query: 293 XXXXTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSK 472
               ++L GAAA+  KVSPA AAYGEAANVFGK K NT+F+  +G+GFKL +P+KWNPSK
Sbjct: 56  ----SLLAGAAAIAVKVSPAAAAYGEAANVFGKAKKNTDFVAYSGEGFKLMIPAKWNPSK 111

Query: 473 EVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTD 652
           E EFPGQVLRYEDNFD TSN+ V++ PT KK+ITDYGSPEEFL+QV +LLG+Q+Y GKTD
Sbjct: 112 EREFPGQVLRYEDNFDATSNLSVIINPTTKKTITDYGSPEEFLSQVGFLLGQQSYGGKTD 171

Query: 653 SEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYI 832
           SEGGF+ +AVATAN+LE+S PVV GKQYY I+VLTRTADGDEGGKHQLITA+V++GKLY+
Sbjct: 172 SEGGFESDAVATANVLESSAPVVDGKQYYSITVLTRTADGDEGGKHQLITATVADGKLYV 231

Query: 833 CKAQAGDKRWFKGARKFVE 889
           CKAQ  DKRWFKGA+KFVE
Sbjct: 232 CKAQR-DKRWFKGAKKFVE 249



>gb:AB043961_1520042 Bruguiera gymnorhiza mRNA for oxygen evolving
           enhancer protein 2, partial cds.
          Length = 160

 Score =  292 bits (747), Expect = 1e-77
 Identities = 133/160 (83%), Positives = 152/160 (95%)
 Frame = +2

Query: 386 GKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKK 565
           GKPK NT+FLP  GDGFKLQ+PSKWNPSKEVEFPGQVLRYEDNFD  S++ V++TPTDKK
Sbjct: 1   GKPKENTDFLPYDGDGFKLQIPSKWNPSKEVEFPGQVLRYEDNFDSNSSVSVIITPTDKK 60

Query: 566 SITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFI 745
           SITDYGSPE+FL+QVD+LLGKQAY+GKT++EGGFDP+ VATANILE++TPV+GGKQYYF+
Sbjct: 61  SITDYGSPEQFLSQVDFLLGKQAYAGKTEAEGGFDPDVVATANILESATPVIGGKQYYFL 120

Query: 746 SVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWF 865
           SVLTRTADGDEGGKHQLITA+V +GKLYICKAQAGDKRWF
Sbjct: 121 SVLTRTADGDEGGKHQLITAAVKDGKLYICKAQAGDKRWF 160



>pir|T03873|T03873 photosystem II oxygen-evolving complex protein 2
           precursor - rice>gb:RICOSEE2_1703702 Rice OSOEE2 gene
           for 23 kDa polypeptide of photosystem II, complete cds.
          Length = 252

 Score =  288 bits (736), Expect = 2e-76
 Identities = 147/200 (73%), Positives = 168/200 (84%), Gaps = 6/200 (3%)
 Frame = +2

Query: 308 VLIGA-AAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEF 484
           +L GA AAVG KV+PA AAYGEAANVFGKPKTNTEF+  +G+GFKL +PSKWNPSKE EF
Sbjct: 50  LLAGATAAVGVKVAPAAAAYGEAANVFGKPKTNTEFIAYSGEGFKLLIPSKWNPSKEREF 109

Query: 485 PGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGG 664
           PGQVLRYEDNFD  SN+ V++ PT KK+IT++GSPEEFLAQVD+LLGKQAYSGKTDSEGG
Sbjct: 110 PGQVLRYEDNFDANSNVSVIINPTTKKTITEFGSPEEFLAQVDFLLGKQAYSGKTDSEGG 169

Query: 665 FDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGG-----KHQLITASVSNGKLY 829
           F+ +AVATANILE+S PVV G      SVL R    ++GG     KHQLITA+V++GKLY
Sbjct: 170 FESDAVATANILESSAPVVEG------SVLQRNGADEDGGRRRGRKHQLITATVNDGKLY 223

Query: 830 ICKAQAGDKRWFKGARKFVE 889
           ICKAQAGDKRWFKGARKFVE
Sbjct: 224 ICKAQAGDKRWFKGARKFVE 243



>sp|P11471|PSBP_CHLRE Oxygen-evolving enhancer protein 2,
           chloroplast precursor (OEE2).>pir|S00413|S00413
           photosystem II oxygen-evolving complex protein 2
           precursor - Chlamydomonas
           reinhardtii>gb:CREOEE2A_1673384 C.reinhardtii
           oxygen-evolving enhancer protein 2 (OEE2) mRNA, complete
           cds.
          Length = 245

 Score =  230 bits (586), Expect = 5e-59
 Identities = 116/190 (61%), Positives = 144/190 (75%), Gaps = 2/190 (1%)
 Frame = +2

Query: 317 GAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQV 496
           GAAA+ S  SPA+AAYG++ANVFGK    + F+P  GDGF L +P+KWNPSKE +FPG +
Sbjct: 45  GAAALVSS-SPANAAYGDSANVFGKVTNKSGFVPYAGDGFALLLPAKWNPSKENDFPGVI 103

Query: 497 LRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPN 676
           LRYEDNFD  +N+ V+   TDKK+I D+GS ++FL  V YLLGKQAYSG+T SEGGF PN
Sbjct: 104 LRYEDNFDAVNNLVVIAQDTDKKAIADFGSQDKFLESVSYLLGKQAYSGETQSEGGFAPN 163

Query: 677 AVATANILETSTPV-VGGKQYYFISVLTRTADGDEGGKHQLITASV-SNGKLYICKAQAG 850
            V+ A++L+ ST     GK YY   +L R+ADGDEGG+HQLI A+V S+ KLYI K Q G
Sbjct: 164 RVSAASLLDVSTTTDKKGKTYYKYELLVRSADGDEGGRHQLIGATVGSDNKLYIIKIQIG 223

Query: 851 DKRWFKGARK 880
           DKRWFKGA+K
Sbjct: 224 DKRWFKGAKK 233



>gb:NTRNATNM3_1691749 N.tabacum mRNA (TNM3) for PSII 23-kDa
           polypeptide.
          Length = 166

 Score =  213 bits (542), Expect = 7e-54
 Identities = 113/168 (67%), Positives = 117/168 (69%), Gaps = 3/168 (1%)
 Frame = +2

Query: 116 MASTQCFYLHHXXXXXXXXXXXX---NRYVPVLKPNQLVCRAQKQXXXXXXXXXXXXXXX 286
           MASTQCF   H                RYV  LKPNQLVCRAQKQ               
Sbjct: 1   MASTQCFLHQHALSSSAARTTSSVSSQRYVSSLKPNQLVCRAQKQSSAQEDDGNSVAVSR 60

Query: 287 XXXXXXTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNP 466
                 TVLIGAAAV SKVSPADAAYGEAANVFGKPK NT+FL   GDGFKLQVP+KWNP
Sbjct: 61  RLAL--TVLIGAAAVVSKVSPADAAYGEAANVFGKPKQNTDFLAYNGDGFKLQVPAKWNP 118

Query: 467 SKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQV 610
           SKEVEFPGQVLRYEDNFD TSN+ V VTPTDKKSIT YGSPEEFL+QV
Sbjct: 119 SKEVEFPGQVLRYEDNFDSTSNLIVTVTPTDKKSITGYGSPEEFLSQV 166



>gb:AK175738_1817726 Arabidopsis thaliana mRNA for putative
           photosystem II oxygen-evolving complex 23K protein,
           complete cds, clone: RAFL22-28-H07.>gb:AK175821_1817809
           Arabidopsis thaliana mRNA for putative photosystem II
           oxygen-evolving complex 23K protein, complete cds,
           clone: RAFL22-42-D16.>gb:AK175934_1817922 Arabidopsis
           thaliana mRNA for putative photosystem II
           oxygen-evolving complex 23K protein, complete cds,
           clone: RAFL22-60-I02.
          Length = 125

 Score =  207 bits (528), Expect = 3e-52
 Identities = 98/116 (84%), Positives = 110/116 (94%)
 Frame = +2

Query: 542 LVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVV 721
           ++TPTDKKSITDYGSPE+FL+QV+YLLGKQAY G+T SEGGFD NAVATANILETST  +
Sbjct: 1   MITPTDKKSITDYGSPEQFLSQVNYLLGKQAYVGETASEGGFDANAVATANILETSTQEI 60

Query: 722 GGKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE 889
           GGK+YY++SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct: 61  GGKEYYYLSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVE 116



>gb:AY267696_1314519 Bigelowiella natans photosystem II protein PsbP
           mRNA, complete cds; nuclear gene for plastid product.
          Length = 288

 Score =  170 bits (430), Expect = 7e-41
 Identities = 87/189 (46%), Positives = 120/189 (63%), Gaps = 2/189 (1%)
 Frame = +2

Query: 320 AAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVL 499
           AA +  +++ A A YG+ ANVFGK   +  F+P   D +   +PSKW  S E +F   V 
Sbjct: 88  AAGLFGQLNKASAEYGDPANVFGKVTNSKGFIPTKRDEYSFLLPSKWLYSTERDFDNIVE 147

Query: 500 RYEDNFDQTSNICVLVTPTD-KKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPN 676
           RY+DNFD  +   ++    D K S+   GSPEEFL   D+L GKQA++G+T SEGGF P 
Sbjct: 148 RYQDNFDAVNFAAIIKKKVDGKTSVDQLGSPEEFLKSCDFLFGKQAWTGETKSEGGFKPG 207

Query: 677 AVATANILETSTPV-VGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGD 853
           +V+  ++L+        G +YY   +L+RTADGDEGG+H+L++A+V NG+LYI   Q GD
Sbjct: 208 SVSALSLLDIDERTDKKGTKYYNYELLSRTADGDEGGRHKLVSAAVKNGQLYIVFIQVGD 267

Query: 854 KRWFKGARK 880
           KRWFKG  K
Sbjct: 268 KRWFKGTDK 276



>gb:AY222741_1590592 Vitis vinifera probable oxygen-evolving
           enhancer protein 2 (psbP1) mRNA, partial cds.
          Length = 98

 Score =  144 bits (364), Expect = 3e-33
 Identities = 71/90 (78%), Positives = 80/90 (88%)
 Frame = +2

Query: 620 LGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLI 799
           LGKQA+ G  + EGGFD +AVATANILE+ST  VGGK YY I+VLTRTADGDEGGKHQLI
Sbjct: 1   LGKQAFFGNAN-EGGFDADAVATANILESSTTTVGGKPYYTITVLTRTADGDEGGKHQLI 59

Query: 800 TASVSNGKLYICKAQAGDKRWFKGARKFVE 889
           TA+V++GKLYICK QAGDKRWFKGARK+VE
Sbjct: 60  TAAVADGKLYICKVQAGDKRWFKGARKYVE 89



>pir|AE2190|AE2190 hypothetical protein all3076 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_684065 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 246

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 44/150 (29%), Positives = 72/150 (48%), Gaps = 1/150 (0%)
 Frame = +2

Query: 422 TGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEF 598
           T DG++   P+ W   K    P  V  + D  + + NI V+++P  D KS+ + G+P E 
Sbjct: 99  TADGYEFSYPNGWLQVKVANGPDVV--FHDLIEISENISVVISPVPDDKSLQELGTPTE- 155

Query: 599 LAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDE 778
              V Y LGK A +          P++  +A ++  S     G+ YY +  L +  +  E
Sbjct: 156 ---VGYKLGKAALA---------PPDSGRSAELVNASEYESEGRTYYHLEYLVKLPNQQE 203

Query: 779 GGKHQLITASVSNGKLYICKAQAGDKRWFK 868
             +H + + +VS GKL+   A   +KRW K
Sbjct: 204 --RHNIASVAVSRGKLFTFNASIPEKRWRK 231



>pir|PS0187|PS0187 photosystem II oxygen-evolving complex protein 2
           - rice  (fragment)
          Length = 37

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 27/36 (75%), Positives = 31/36 (86%)
 Frame = +2

Query: 359 AYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNP 466
           AYGEAANVFGKPKTNTEF+  +G+GFKL +P K NP
Sbjct: 1   AYGEAANVFGKPKTNTEFIAYSGEGFKLLIPKKXNP 36



>gb:AY535078_1612312 Beta vulgaris SNP marker MP_oec genomic
           sequence.
          Length = 62

 Score = 57.8 bits (138), Expect = 5e-07
 Identities = 35/63 (55%), Positives = 38/63 (60%), Gaps = 1/63 (1%)
 Frame = +2

Query: 188 RYVPV-LKPNQLVCRAQKQXXXXXXXXXXXXXXXXXXXXXTVLIGAAAVGSKVSPADAAY 364
           RY  V +KP Q+VC+AQKQ                     TVLIGAAAVGSKVSPADAAY
Sbjct: 4   RYQAVSIKPTQIVCKAQKQDDEANVLNASVSRRLAL----TVLIGAAAVGSKVSPADAAY 59

Query: 365 GEA 373
           GEA
Sbjct: 60  GEA 62



>gb:AP004396_1841140 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0404D10.
          Length = 257

 Score = 54.3 bits (129), Expect = 5e-06
 Identities = 50/189 (26%), Positives = 74/189 (39%), Gaps = 2/189 (1%)
 Frame = +2

Query: 308 VLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITG--DGFKLQVPSKWNPSKEVE 481
           +L+ A A      P  AAY   A           FLP+T   DG+    P  W   +EV 
Sbjct: 67  MLLAAGAAMFLSWPNPAAYAAEAK--------KGFLPVTDKKDGYSFLYPFGW---QEVV 115

Query: 482 FPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEG 661
             GQ   Y+D  +   ++ V   PT K+ I + G P+    QV   L ++  +  T    
Sbjct: 116 VQGQDKVYKDVIEPLESVSVNTIPTSKQDIRELGPPD----QVAEALIRKVLAAPTQK-- 169

Query: 662 GFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYICKA 841
                      ++E     V G+ YY       TA      +H L   +++NGK Y    
Sbjct: 170 ---------TKLIEAKENDVDGRTYYTFEF---TAQAPNFTRHALGAIAIANGKFYTLTT 217

Query: 842 QAGDKRWFK 868
            A ++RW K
Sbjct: 218 GANERRWEK 226



>gb:AE016959_1022951 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE016959_1022957
           Oryza sativa (japonica cultivar-group) chromosome 10,
           complete sequence.>gb:AC068951_1540582 Oryza sativa
           chromosome 10 BAC OSJNBa0042E19 genomic sequence,
           complete sequence.>gb:AC068951_1540588 Oryza sativa
           chromosome 10 BAC OSJNBa0042E19 genomic sequence,
           complete sequence.>gb:AE017102_1752770 Oryza sativa
           (japonica cultivar-group) chromosome 10, section 56 of
           77 of the complete sequence.>gb:AE017102_1752776 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           56 of 77 of the complete sequence.
          Length = 178

 Score = 53.5 bits (127), Expect = 9e-06
 Identities = 42/155 (27%), Positives = 64/155 (41%), Gaps = 2/155 (1%)
 Frame = +2

Query: 410 FLPITG--DGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYG 583
           FLP+T   DG+    P  W   +EV   GQ   Y+D  +   ++ V   PT K+ I + G
Sbjct: 27  FLPVTDKKDGYSFLYPFGW---QEVVVQGQDKVYKDVIEPLESVSVNTIPTSKQDIRELG 83

Query: 584 SPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRT 763
            P+    QV   L ++  +  T               ++E     V G+ YY       T
Sbjct: 84  PPD----QVAEALIRKVLAAPTQK-----------TKLIEAKENDVDGRTYYTFEF---T 125

Query: 764 ADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFK 868
           A      +H L   +++NGK Y     A ++RW K
Sbjct: 126 AQAPNFTRHALGAIAIANGKFYTLTTGANERRWEK 160



>pir|B60484|B60484 photosystem II oxygen-evolving complex protein 1
           - western white pine (fragment)
          Length = 35

 Score = 50.4 bits (119), Expect = 8e-05
 Identities = 22/35 (62%), Positives = 26/35 (74%)
 Frame = +2

Query: 359 AYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWN 463
           AYGEAANVFG PK NT+F+  +G GF LQ+P   N
Sbjct: 1   AYGEAANVFGAPKKNTDFITYSGPGFTLQIPXGXN 35



>gb:BA000039_727859 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 183

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 41/155 (26%), Positives = 72/155 (46%), Gaps = 3/155 (1%)
 Frame = +2

Query: 428 DGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV-TPTDKKSITDYGSPEEFLA 604
           DG++   P  W    +VE P  V+ + D  + T N+ V+V T    KS+ + GSPEE   
Sbjct: 34  DGYEFLYPRGW-VQVQVEDPVDVV-FHDIIETTENVSVVVNTVASTKSLEELGSPEEVGD 91

Query: 605 QVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFIS-VLTRTADGDEG 781
           ++   +   + SG++ +             ++  ++     K YY +   +T   DG+  
Sbjct: 92  RLLRNIIAPSESGRSSA-------------LIAATSQKADDKTYYILEYAVTLPGDGNTA 138

Query: 782 G-KHQLITASVSNGKLYICKAQAGDKRWFKGARKF 883
             +H L + +VS GK+Y     A ++RW K   +F
Sbjct: 139 QQRHNLSSIAVSRGKVYTLSVSAPEERWPKVEDQF 173



>sp|P82538|TL26_ARATH Thylakoid lumenal 25.6 kDa protein,
           chloroplast precursor.>pir|T47672|T47672 hypothetical
           protein T26I12.210 - Arabidopsis
           thaliana>gb:ATT26I12_1555490 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T26I12.>gb:AY087663_1572692
           Arabidopsis thaliana clone 3747 mRNA, complete
           sequence.>gb:AY097338_1576333 Arabidopsis thaliana
           AT3g55330/T26I12_210 mRNA, complete
           cds.>gb:AF419553_1798415 Arabidopsis thaliana
           AT3g55330/T26I12_210 mRNA, complete cds.
          Length = 230

 Score = 48.1 bits (113), Expect = 4e-04
 Identities = 40/147 (27%), Positives = 62/147 (42%)
 Frame = +2

Query: 428 DGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQ 607
           D +    P  W   +EV   GQ   Y+D  +   ++ V + PT K++I ++G P+    Q
Sbjct: 89  DAYAFLYPFGW---QEVVIEGQDKVYKDVIEPLESVSVNLVPTSKQTIKEFGPPK----Q 141

Query: 608 VDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGK 787
           +   L K+  +          PN   T  +++ S   V GK YY       T       +
Sbjct: 142 IAETLIKKVLA---------PPNQKTT--LIDASEHDVDGKTYYQFEF---TVQARNYTR 187

Query: 788 HQLITASVSNGKLYICKAQAGDKRWFK 868
           H L T +V NG  Y     A ++RW K
Sbjct: 188 HALGTITVFNGNFYTLTTGANERRWEK 214



>gb:AY233206_1591684 Vitis vinifera putative oxygen evolving
           enhancer protein (PsbP2) mRNA, partial cds.
          Length = 133

 Score = 43.5 bits (101), Expect = 0.009
 Identities = 34/134 (25%), Positives = 56/134 (41%), Gaps = 1/134 (0%)
 Frame = +2

Query: 470 KEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFL-AQVDYLLGKQAYSGK 646
           +EV   GQ   ++D  +   ++ V + PT K+ I + GSP+E   A +  +L   +   K
Sbjct: 2   QEVVIDGQDKVFKDVIEPLESVSVNMIPTVKQDIRELGSPQEVAEALIKKVLAPPSQKTK 61

Query: 647 TDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKL 826
                           ++E     V GK YY      + A+     +H L   ++ NGK 
Sbjct: 62  ----------------LVEAVEHDVDGKAYYTFEFTVQAANFT---RHALSAITIGNGKF 102

Query: 827 YICKAQAGDKRWFK 868
           Y     A ++RW K
Sbjct: 103 YTVTTGANERRWEK 116



>gb:AY072442_1567259 Arabidopsis thaliana unknown protein
           (At2g28605) mRNA, complete cds.>gb:AY128884_1580964
           Arabidopsis thaliana unknown protein (At2g28605) mRNA,
           complete cds.
          Length = 232

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 39/146 (26%), Positives = 66/146 (45%), Gaps = 1/146 (0%)
 Frame = +2

Query: 422 TGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFL 601
           + +GF L +PS +    +VE  G    +E+  + ++NI V+V+P   KS+  +GSP +F+
Sbjct: 81  SNNGFTLLIPSSYT---KVEKAGANALFEELNNGSNNIGVVVSPVRIKSLDQFGSP-QFV 136

Query: 602 AQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEG 781
           A  D L+  +     T             A ++        G+Q Y         D   G
Sbjct: 137 A--DKLINAEKRKESTKE-----------AEVVSVGERAGLGQQVYEFEY---KIDSTRG 180

Query: 782 GKHQLITAS-VSNGKLYICKAQAGDK 856
           G  ++ +A+ VS+ KLY+      DK
Sbjct: 181 GIKRVFSAAFVSSNKLYLLNVVHSDK 206



>gb:AC007171_1535469 Arabidopsis thaliana chromosome 2 clone T8O18
           map mi54, complete sequence.
          Length = 161

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 39/146 (26%), Positives = 66/146 (45%), Gaps = 1/146 (0%)
 Frame = +2

Query: 422 TGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFL 601
           + +GF L +PS +    +VE  G    +E+  + ++NI V+V+P   KS+  +GSP +F+
Sbjct: 10  SNNGFTLLIPSSYT---KVEKAGANALFEELNNGSNNIGVVVSPVRIKSLDQFGSP-QFV 65

Query: 602 AQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEG 781
           A  D L+  +     T             A ++        G+Q Y         D   G
Sbjct: 66  A--DKLINAEKRKESTKE-----------AEVVSVGERAGLGQQVYEFEY---KIDSTRG 109

Query: 782 GKHQLITAS-VSNGKLYICKAQAGDK 856
           G  ++ +A+ VS+ KLY+      DK
Sbjct: 110 GIKRVFSAAFVSSNKLYLLNVVHSDK 135



>pir|C24166|C24166 photosystem II extrinsic membrane protein -
           spinach  (fragment)
          Length = 17

 Score = 37.7 bits (86), Expect = 0.51
 Identities = 16/17 (94%), Positives = 16/17 (94%)
 Frame = +2

Query: 362 YGEAANVFGKPKTNTEF 412
           YGEAANVFGKPK NTEF
Sbjct: 1   YGEAANVFGKPKKNTEF 17



>sp|P83687|PSBP_EUGGR Oxygen-evolving enhancer protein 2 (OEE2) (23
           kDa subunit of oxygen evolving system of photosystem II)
           (OEC 23 kDa subunit) (23 kDa thylakoid membrane protein)
           (Fragment).
          Length = 30

 Score = 37.4 bits (85), Expect = 0.66
 Identities = 16/26 (61%), Positives = 19/26 (73%)
 Frame = +2

Query: 359 AYGEAANVFGKPKTNTEFLPITGDGF 436
           AYGE ANVFGK K   +F  I+GDG+
Sbjct: 1   AYGEGANVFGKRKETDQFFEISGDGW 26



>gb:AC135418_1742227 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0035J16, complete sequence.
          Length = 253

 Score = 37.0 bits (84), Expect = 0.87
 Identities = 49/208 (23%), Positives = 79/208 (37%), Gaps = 27/208 (12%)
 Frame = +2

Query: 320 AAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITG-------------DGFKLQVPSKW 460
           +AAV   V PA AA  +     G+P  N +  P+ G              GF ++VP  +
Sbjct: 47  SAAVAVSVRPATAAAADEEAPPGEPSQNKKGSPLLGGIANTKSWSQYYGSGFSIRVPPSF 106

Query: 461 NPSKEVE-FPGQVLRYEDNF------------DQTSNICVLVTPTDKKSITDYGSPEEFL 601
           +   E E F   +  Y D              D++  + V++ P+++  IT       FL
Sbjct: 107 DDILEPEEFNVGMTYYGDKAKPRTYAARFASPDRSELVSVVIKPSNQLKIT-------FL 159

Query: 602 AQVDYL-LGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDE 778
              D   LG    + K    GG    +  T  + +        + YYF            
Sbjct: 160 EAKDITDLGTLKEASKIFVPGGAKLYSARTIKVKDEDDI----RTYYFYEF-------GV 208

Query: 779 GGKHQLITASVSNGKLYICKAQAGDKRW 862
             +H  + A+V++GK YI  A A + +W
Sbjct: 209 DKEHVAVMATVNSGKTYIAGATAPETKW 236



>pir|A60484|A60484 photosystem II oxygen-evolving complex protein 2
           - western white pine (fragment)
          Length = 24

 Score = 36.6 bits (83), Expect = 1.1
 Identities = 15/19 (78%), Positives = 17/19 (89%)
 Frame = +2

Query: 359 AYGEAANVFGKPKTNTEFL 415
           AYGEAANVFG PK NT+F+
Sbjct: 1   AYGEAANVFGAPKKNTDFI 19



>gb:AE017164_395553 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 4 of 6 of the complete
           genome.>gb:AE017126_1031222 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 185

 Score = 36.2 bits (82), Expect = 1.5
 Identities = 30/117 (25%), Positives = 47/117 (40%)
 Frame = +2

Query: 512 NFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATA 691
           N D+T ++ +     D + + + GSP E        +G++  +      GG        A
Sbjct: 68  NSDETLSLVISDISADVE-LENMGSPSE--------VGEKLMNNLLAPNGG-----EREA 113

Query: 692 NILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRW 862
            +L+  + V     +Y I  L    D D   +H+L T  V  G LY   A   D RW
Sbjct: 114 ELLDAKSRVADNHTFYDIEYLIHLPDKD---RHELATVVVDRGSLYTFAAGTNDSRW 167



>pir|S75458|S75458 hypothetical protein sll1418 - Synechocystis sp.
           (strain PCC 6803)>gb:BA000022_688798 Synechocystis sp.
           PCC 6803 DNA, complete genome.
          Length = 188

 Score = 36.2 bits (82), Expect = 1.5
 Identities = 33/150 (22%), Positives = 62/150 (41%), Gaps = 3/150 (2%)
 Frame = +2

Query: 422 TGDGFKLQVPSKW-NPSKEVEFPGQVLRYEDNFDQTSNICVLVT--PTDKKSITDYGSPE 592
           T DG++   P+ W     +   PG  + + D  ++  N+ V+++  P+DK ++TD G+  
Sbjct: 38  TKDGYEFLYPNGWIGVDVKGASPGVDVVFRDLIERDENLSVIISEIPSDK-TLTDLGTAT 96

Query: 593 EFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADG 772
           +        +G +      D+  G        A ++        G+ YY +    R   G
Sbjct: 97  D--------VGYRFMKTVNDASQGD-----RQAELINAEARDEDGQVYYTLEY--RVLVG 141

Query: 773 DEGGKHQLITASVSNGKLYICKAQAGDKRW 862
           D   +H L + + + GKL        + RW
Sbjct: 142 DNVERHDLASVTTNRGKLITFDLSTAEDRW 171



>gb:AP003232_1825830 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0034E02.
          Length = 272

 Score = 35.0 bits (79), Expect = 3.3
 Identities = 33/132 (25%), Positives = 54/132 (40%), Gaps = 6/132 (4%)
 Frame = +2

Query: 485 PGQVLRYEDNFDQTSNICVLVTPTDK------KSITDYGSPEEFLAQVDYLLGKQAYSGK 646
           P   +++ED  D+   + V+ +P  +       +I D GSPE  +A     LG       
Sbjct: 145 PWVEVKFED--DKQGKVQVVASPLIRLTNRPNATIEDIGSPERLIAS----LGPFVTGNT 198

Query: 647 TDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKL 826
            DS+            +++TS   + G+ YY   + T  A     G H L  A+     +
Sbjct: 199 FDSD-----------ELVDTSVEKIDGQTYYSYVLETPLA---LTGSHNLAKATAKGNTV 244

Query: 827 YICKAQAGDKRW 862
            +  A A DK+W
Sbjct: 245 VLFVASASDKQW 256



>pir|T21689|T21689 hypothetical protein F33A8.3 - Caenorhabditis
           elegans>gb:CEF33A8_1363326 Caenorhabditis elegans cosmid
           F33A8, complete sequence.
          Length = 208

 Score = 34.3 bits (77), Expect = 5.6
 Identities = 21/44 (47%), Positives = 23/44 (52%), Gaps = 4/44 (9%)
 Frame = -1

Query: 361 GGVGRGNLRANSG----SADEDGESQSARDGDRRGGVVFMSRGG 242
           GG GRG  R NSG    + D DG  +  R G RRGG     RGG
Sbjct: 153 GGGGRGGGRTNSGGEETARDTDGGERGGRGGGRRGG---RGRGG 193



>sp|P80660|PSP1_PHYPA Oxygen-evolving enhancer protein 2 (OEE2) (20
           kDa subunit of oxygen evolving system of photosystem II)
           (Fragments).
          Length = 43

 Score = 34.3 bits (77), Expect = 5.6
 Identities = 19/49 (38%), Positives = 24/49 (48%)
 Frame = +2

Query: 395 KTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICV 541
           K  T F P  G+GF L VP        +   G   + EDNFD T+N+ V
Sbjct: 1   KKQTGFTPFIGNGFSLDVPX------SITEYGPXEKXEDNFDATNNLFV 43



>gb:AY449461_1327379 Oikopleura dioica clone BACOIKO005 4xj24,
           complete sequence.
          Length = 533

 Score = 33.5 bits (75), Expect = 9.6
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +2

Query: 506 EDNFDQTSNICVLVTPTDKKSITDYGSPEEFL 601
           + NF QTSN  V V P+   SITDY   + FL
Sbjct: 334 DTNFKQTSNFKVSVRPSQHGSITDYDGEDNFL 365



>gb:BX569691_775829 Synechococcus sp. WH8102 complete genome;
           segment 3/7.
          Length = 167

 Score = 33.5 bits (75), Expect = 9.6
 Identities = 17/61 (27%), Positives = 26/61 (42%)
 Frame = +2

Query: 686 TANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWF 865
           TA ++E     + G  +Y +       D D   +H+L T  V  G+LY       + RW 
Sbjct: 94  TAELVEAQEREMNGHTFYDLEYAVHLEDRD---RHELATVVVDRGRLYTLATSVNEDRWE 150

Query: 866 K 868
           K
Sbjct: 151 K 151



>gb:AF072135_476277 Caulobacter crescentus hook associated protein I
           homolog (flaN), flagellar operon, complete sequence and
           II.1 protein (II.1) genes, complete cds.
          Length = 397

 Score = 33.5 bits (75), Expect = 9.6
 Identities = 24/106 (22%), Positives = 44/106 (41%), Gaps = 4/106 (3%)
 Frame = +2

Query: 314 IGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQ 493
           + AA+   + S   +    A  +FG P   T F  +  D +     ++ +PS  +     
Sbjct: 73  LNAASESGRASIVASTLNSAQQLFGDPSGETSFFTVLDDVYAAFSSAQDDPSSSLLRTQA 132

Query: 494 VLRYEDNFDQTSNICVLVTPTDKKSIT----DYGSPEEFLAQVDYL 619
           + R +D    +S I   ++   K + T    D G   + L+Q+D L
Sbjct: 133 LTRLDDFLSGSSRITASLSKLGKDADTRIAADVGRVNDLLSQIDAL 178



>pir|H87360|H87360 hypothetical protein CC0899 [imported] -
           Caulobacter crescentus>gb:AE005766_74914 Caulobacter
           crescentus CB15 section 92 of 359 of the complete
           genome.>gb:AE005673_921946 Caulobacter crescentus CB15
           complete genome.
          Length = 703

 Score = 33.5 bits (75), Expect = 9.6
 Identities = 24/106 (22%), Positives = 44/106 (41%), Gaps = 4/106 (3%)
 Frame = +2

Query: 314 IGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQ 493
           + AA+   + S   +    A  +FG P   T F  +  D +     ++ +PS  +     
Sbjct: 73  LNAASESGRASIVASTLNSAQQLFGDPSGETSFFTVLDDVYAAFSSAQDDPSSSLLRTQA 132

Query: 494 VLRYEDNFDQTSNICVLVTPTDKKSIT----DYGSPEEFLAQVDYL 619
           + R +D    +S I   ++   K + T    D G   + L+Q+D L
Sbjct: 133 LTRLDDFLSGSSRITASLSKLGKDADTRIAADVGRVNDLLSQIDAL 178


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,233,143,444
Number of Sequences: 1806583
Number of extensions: 25202808
Number of successful extensions: 57347
Number of sequences better than 10.0: 57
Number of HSP's better than 10.0 without gapping: 54510
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 57269
length of database: 581,917,975
effective HSP length: 127
effective length of database: 352,481,934
effective search space used: 104687134398
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)