BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig1413
         (692 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY088773_1573785 Arabidopsis thaliana clone 948 mRNA, complet...   189   5e-47   
pir|D84690|D84690 hypothetical protein At2g28910 [imported] - Ar...   189   5e-47   Arabidopsis thaliana [mouse-ear cress]
gb:AY163162_1585960 Arabidopsis thaliana CAX-interacting protein...   187   2e-46   
gb:AP005909_1859930 Oryza sativa (japonica cultivar-group) genom...   158   1e-37   
gb:PFA929352_1392989 Plasmodium falciparum strain 3D7, chromosom...    85   1e-15   
gb:AK094073_1914091 Homo sapiens cDNA FLJ36754 fis, clone UTERU2...    57   4e-07   
gb:BC086553_2109680 Rattus norvegicus similar to RIKEN cDNA 3110...    56   7e-07   
gb:AK018357_1159536 Mus musculus 12 days embryo female mullerian...    56   7e-07   
gb:AK014102_1157785 Mus musculus 13 days embryo head cDNA, RIKEN...    56   7e-07   
gb:AC116977_1207021 Dictyostelium discoideum chromosome 2 map 55...    55   1e-06   
gb:AX972485_1487794 Sequence 3288 from Patent EP1104808.               55   2e-06   
gb:AK020113_1160323 Mus musculus 12 days embryo male wolffian du...    55   2e-06   
gb:BC038302_2098233 Mus musculus RIKEN cDNA 3110031B13 gene, mRN...    54   2e-06   
gb:AX886439_1481892 Sequence 2302 from Patent EP1033401.               53   6e-06   
gb:AE014298_1124534 Drosophila melanogaster chromosome X, comple...    49   6e-05   
pir|T28919|T28919 hypothetical protein C13F10.7 - Caenorhabditis...    39   0.067   Caenorhabditis elegans [roundworm]
gb:AP005011_1847243 Oryza sativa (japonica cultivar-group) genom...    35   1.3     
gb:AC149265_1744849 Solanum demissum chromosome 5 clone PGEC858M...    35   1.7     
gb:AB026661_1517392 Arabidopsis thaliana genomic DNA, chromosome...    35   1.7     
pir|A84490|A84490 probable CCHC-type zinc finger protein [import...    35   1.7     Arabidopsis thaliana [mouse-ear cress]
gb:AF125527_2475251 Gallus gallus clone 1C avian endogenous viru...    34   2.2     
gb:AEN292966_2176157 Avian endogenous retrovirus EAV-HP partial ...    34   2.2     
gb:SIV2DCG_2452592 Simian retrovirus 2, complete genome.               33   3.7     
gb:NC94C8_1688814 Neurospora crassa DNA linkage group V cosmid c...    33   3.7     
sp|P51516|GAG_SRV2|GAG_SRV2 Gag polyprotein (Core polyprotein) [Contains:...    33   3.7     Simian retrovirus 2
gb:AJ623289_2278152 Avian endogenous retrovirus EAV-HP partial p...    33   4.8     
gb:AEN238124_2176154 Avian endogenous retrovirus EAV-HP, complet...    33   4.8     
gb:OSJN00082_1694557 Oryza sativa genomic DNA, chromosome 4, BAC...    33   4.8     
gb:AF125529_2475253 Gallus gallus clone 3A avian endogenous viru...    33   6.3     
gb:AF126468_2200120 Simian retrovirus SRV-2 strain D2/RHE/OR/V1,...    33   6.3     
gb:AF126467_2200116 Simian retrovirus 2, complete genome.              33   6.3     
gb:BT010944_1640890 Arabidopsis thaliana At5g49400 gene, complet...    33   6.3     
gb:AK118554_1816524 Arabidopsis thaliana At5g52380 mRNA for unkn...    32   8.2     
gb:AB019226_1514065 Arabidopsis thaliana genomic DNA, chromosome...    32   8.2     
gb:BX640414_805737 Bordetella pertussis strain Tohama I, complet...    32   8.2     


>gb:AY088773_1573785 Arabidopsis thaliana clone 948 mRNA, complete
           sequence.
          Length = 332

 Score =  189 bits (479), Expect = 5e-47
 Identities = 107/184 (58%), Positives = 116/184 (63%)
 Frame = +1

Query: 136 MPATAGRVRMPANNRVHSSAALQTHGIWQSAIGYDPYAXXXXXXXXXXXXXXXXXXNPYA 315
           MPATAGRVRMPANNRVHSSAALQTHGIWQSAIGYDPYA                  N YA
Sbjct: 1   MPATAGRVRMPANNRVHSSAALQTHGIWQSAIGYDPYAPTSKEEPKTTQQKTEDPENSYA 60

Query: 316 NFQGLLALARITGSNADEARGSCKKCGRVGHLTYQCRNFLSVKEDSGKDKDEEGIDAAVL 495
           +FQGLLALARITGSN DEARGSCKKCGRVGHLT+QCRNFLS KED  K+KD   I+AAVL
Sbjct: 61  SFQGLLALARITGSNNDEARGSCKKCGRVGHLTFQCRNFLSTKED--KEKDPGAIEAAVL 118

Query: 496 SRLEKWKGNRDKKXXXXXXXXXXXXXXXXXXXXXXXXIERAIAEKYGKNTKKISRKVKSS 675
           S LEK +     K                        +ER IAE++GK     S K  SS
Sbjct: 119 SGLEKIRRGVG-KGEVEEVSSEEEEESESSDSDVDSEMERIIAERFGKKKGGSSVKKTSS 177

Query: 676 GKSK 687
            + K
Sbjct: 178 VRKK 181



>pir|D84690|D84690 hypothetical protein At2g28910 [imported] -
           Arabidopsis thaliana>gb:AC005727_1532981 Arabidopsis
           thaliana chromosome 2 clone F8N16 map mi54, complete
           sequence.>gb:AY142061_1582898 Arabidopsis thaliana
           At2g28910/F8N16.20 mRNA, complete
           cds.>gb:AF428457_1799387 Arabidopsis thaliana
           At2g28910/F8N16.20 mRNA, complete cds.
          Length = 332

 Score =  189 bits (479), Expect = 5e-47
 Identities = 107/184 (58%), Positives = 116/184 (63%)
 Frame = +1

Query: 136 MPATAGRVRMPANNRVHSSAALQTHGIWQSAIGYDPYAXXXXXXXXXXXXXXXXXXNPYA 315
           MPATAGRVRMPANNRVHSSAALQTHGIWQSAIGYDPYA                  N YA
Sbjct: 1   MPATAGRVRMPANNRVHSSAALQTHGIWQSAIGYDPYAPTSKEEPKTTQQKTEDPENSYA 60

Query: 316 NFQGLLALARITGSNADEARGSCKKCGRVGHLTYQCRNFLSVKEDSGKDKDEEGIDAAVL 495
           +FQGLLALARITGSN DEARGSCKKCGRVGHLT+QCRNFLS KED  K+KD   I+AAVL
Sbjct: 61  SFQGLLALARITGSNNDEARGSCKKCGRVGHLTFQCRNFLSTKED--KEKDPGAIEAAVL 118

Query: 496 SRLEKWKGNRDKKXXXXXXXXXXXXXXXXXXXXXXXXIERAIAEKYGKNTKKISRKVKSS 675
           S LEK +     K                        +ER IAE++GK     S K  SS
Sbjct: 119 SGLEKIRRGVG-KGEVEEVSSEEEEESESSDSDVDSEMERIIAERFGKKKGGSSVKKTSS 177

Query: 676 GKSK 687
            + K
Sbjct: 178 VRKK 181



>gb:AY163162_1585960 Arabidopsis thaliana CAX-interacting protein 4
           mRNA, complete cds.
          Length = 332

 Score =  187 bits (474), Expect = 2e-46
 Identities = 106/184 (57%), Positives = 115/184 (62%)
 Frame = +1

Query: 136 MPATAGRVRMPANNRVHSSAALQTHGIWQSAIGYDPYAXXXXXXXXXXXXXXXXXXNPYA 315
           MP TAGRVRMPANNRVHSSAALQTHGIWQSAIGYDPYA                  N YA
Sbjct: 1   MPRTAGRVRMPANNRVHSSAALQTHGIWQSAIGYDPYAPTSKEEPKTTQQKTEDPENSYA 60

Query: 316 NFQGLLALARITGSNADEARGSCKKCGRVGHLTYQCRNFLSVKEDSGKDKDEEGIDAAVL 495
           +FQGLLALARITGSN DEARGSCKKCGRVGHLT+QCRNFLS KED  K+KD   I+AAVL
Sbjct: 61  SFQGLLALARITGSNNDEARGSCKKCGRVGHLTFQCRNFLSTKED--KEKDPGAIEAAVL 118

Query: 496 SRLEKWKGNRDKKXXXXXXXXXXXXXXXXXXXXXXXXIERAIAEKYGKNTKKISRKVKSS 675
           S LEK +     K                        +ER IAE++GK     S K  SS
Sbjct: 119 SGLEKIRRGVG-KGEVEEVSSEEEEESESSDSDVDSEMERIIAERFGKKKGGSSVKKTSS 177

Query: 676 GKSK 687
            + K
Sbjct: 178 VRKK 181



>gb:AP005909_1859930 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC
           clone:OSJNBa0006G10.>gb:AP006061_1860717 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, PAC
           clone:P0414D03.
          Length = 377

 Score =  158 bits (399), Expect = 1e-37
 Identities = 84/144 (58%), Positives = 91/144 (63%), Gaps = 26/144 (18%)
 Frame = +1

Query: 136 MPATAGRVRMPANNRVHSSAALQTHGIWQSAIGYDPYA---------------------- 249
           MPATAGRVRMPANNRVHSSAALQTHGIWQSAIGYDPYA                      
Sbjct: 1   MPATAGRVRMPANNRVHSSAALQTHGIWQSAIGYDPYAPENNKHQPPSSSVSANAAAANA 60

Query: 250 ---XXXXXXXXXXXXXXXXXXNPYANFQGLLALARITGSNADEARGSCKKCGRVGHLTYQ 420
                                N Y +FQGLLALARITGSN+DE RG+C+KCGRVGHLT+Q
Sbjct: 61  AAASAPSASAPSSSSAAASSDNAYTSFQGLLALARITGSNSDETRGACRKCGRVGHLTFQ 120

Query: 421 CRNFLSVKEDSGKDKD-EEGIDAA 489
           CRNFLSVKED   + D + GI AA
Sbjct: 121 CRNFLSVKEDLDMEDDIDAGIRAA 144



>gb:PFA929352_1392989 Plasmodium falciparum strain 3D7, chromosome
           5, segment 2/4.
          Length = 262

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 41/104 (39%), Positives = 61/104 (58%)
 Frame = +1

Query: 136 MPATAGRVRMPANNRVHSSAALQTHGIWQSAIGYDPYAXXXXXXXXXXXXXXXXXXNPYA 315
           MP+ +GRVRMPA+NR+  SA+L+T  IW++++GYDPYA                      
Sbjct: 1   MPSKSGRVRMPADNRLPVSASLKTSEIWKNSVGYDPYASYEEINKKKEKKDEDINEKA-- 58

Query: 316 NFQGLLALARITGSNADEARGSCKKCGRVGHLTYQCRNFLSVKE 447
             + L  L+R+TG  +    G+C  C  +GHL YQCRNF+S+++
Sbjct: 59  --KNLFNLSRLTGITSTTIPGACTVCNHIGHLPYQCRNFISLEK 100



>gb:AK094073_1914091 Homo sapiens cDNA FLJ36754 fis, clone
           UTERU2018127.
          Length = 155

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 36/123 (29%), Positives = 50/123 (40%), Gaps = 14/123 (11%)
 Frame = +1

Query: 346 ITGSNADEARGSCKKCGRVGHLTYQCRNF----------LSVKEDSGKDKDEEGIDAAVL 495
           + G N D  R  CKKCG  GHLT++CRNF          L V   S +D DEE  +   L
Sbjct: 3   VPGCNKDSVRAGCKKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKL 62

Query: 496 SRLEKWKGNRDKKXXXXXXXXXXXXXXXXXXXXXXXXIERAIA----EKYGKNTKKISRK 663
             L++ + N +++                         E   +    +KY K  KK  +K
Sbjct: 63  QALQEKRINEEEEKKKEKSKEKIKLKKKRKRSYSSSSTEEDTSKQKKQKYQKKEKKKEKK 122

Query: 664 VKS 672
            KS
Sbjct: 123 SKS 125



>gb:BC086553_2109680 Rattus norvegicus similar to RIKEN cDNA
           3110031B13 (predicted), mRNA (cDNA clone MGC:105985
           IMAGE:7303262), complete cds.
          Length = 153

 Score = 55.8 bits (133), Expect = 7e-07
 Identities = 36/122 (29%), Positives = 49/122 (40%), Gaps = 13/122 (10%)
 Frame = +1

Query: 346 ITGSNADEARGSCKKCGRVGHLTYQCRNF----------LSVKEDSGKDKDEEGIDAAVL 495
           + G N D  R  C+KCG  GHLT++CRNF          L V   S +D DEE  +   L
Sbjct: 3   VPGCNKDNVRAGCRKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEESEELNKL 62

Query: 496 SRLEKWKGNRD---KKXXXXXXXXXXXXXXXXXXXXXXXXIERAIAEKYGKNTKKISRKV 666
             L++ + N +   KK                          +   +KY K  KK  +K 
Sbjct: 63  QALQEKRINEEEEKKKEKSREKIKLKKKRKRSNSSTTEEDSSKQKKQKYQKKEKKKEKKN 122

Query: 667 KS 672
           KS
Sbjct: 123 KS 124



>gb:AK018357_1159536 Mus musculus 12 days embryo female mullerian
           duct includes surrounding region cDNA, RIKEN full-length
           enriched library, clone:6820402F12 product:hypothetical
           Lysine-rich region/Zn-finger CCHC type containing
           protein, full insert sequence.
          Length = 133

 Score = 55.8 bits (133), Expect = 7e-07
 Identities = 34/124 (27%), Positives = 50/124 (40%), Gaps = 10/124 (8%)
 Frame = +1

Query: 346 ITGSNADEARGSCKKCGRVGHLTYQCRNF----------LSVKEDSGKDKDEEGIDAAVL 495
           + G N D  R  C+KCG  GHLT++CRNF          L V   S +D DEE  +   L
Sbjct: 3   VPGCNKDNVRAGCRKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKL 62

Query: 496 SRLEKWKGNRDKKXXXXXXXXXXXXXXXXXXXXXXXXIERAIAEKYGKNTKKISRKVKSS 675
             L++ + N +++                         E +  +K  K  KK  +K K +
Sbjct: 63  QALQEKRINEEEEKKKEKSREKIKLKKRRKRSYSSATEEDSAKQKKQKYQKKEKKKEKKN 122

Query: 676 GKSK 687
              K
Sbjct: 123 KSKK 126



>gb:AK014102_1157785 Mus musculus 13 days embryo head cDNA, RIKEN
           full-length enriched library, clone:3110031B13
           product:hypothetical Lysine-rich region/Zn-finger CCHC
           type containing protein, full insert sequence.
          Length = 151

 Score = 55.8 bits (133), Expect = 7e-07
 Identities = 34/124 (27%), Positives = 50/124 (40%), Gaps = 10/124 (8%)
 Frame = +1

Query: 346 ITGSNADEARGSCKKCGRVGHLTYQCRNF----------LSVKEDSGKDKDEEGIDAAVL 495
           + G N D  R  C+KCG  GHLT++CRNF          L V   S +D DEE  +   L
Sbjct: 3   VPGCNKDNVRAGCRKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKL 62

Query: 496 SRLEKWKGNRDKKXXXXXXXXXXXXXXXXXXXXXXXXIERAIAEKYGKNTKKISRKVKSS 675
             L++ + N +++                         E +  +K  K  KK  +K K +
Sbjct: 63  QALQEKRINEEEEKKKEKSREKIKLKKRRKRSYSSATEEDSAKQKKQKYQKKEKKKEKKN 122

Query: 676 GKSK 687
              K
Sbjct: 123 KSKK 126



>gb:AC116977_1207021 Dictyostelium discoideum chromosome 2 map
           5515173-5817331 strain AX4, complete sequence.
          Length = 323

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +1

Query: 172 NNRVHSSAALQTHGIWQSAIG-YDPYAXXXXXXXXXXXXXXXXXXNPYANFQGLLALARI 348
           NNR++S+ +L++H IW+S    YD                         N++G+LA+AR+
Sbjct: 13  NNRLYSNNSLKSHNIWKSIDQPYDDDRDDDKDVKPKTTNTAGPTEQTQDNYRGMLAIARL 72

Query: 349 TGSNADEARGSCKKCGRVGHLTYQC 423
           TG + + +R +CK+C   GHLT+QC
Sbjct: 73  TGLS-EGSRSTCKRCKGNGHLTFQC 96



>gb:AX972485_1487794 Sequence 3288 from Patent EP1104808.
          Length = 86

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 28/73 (38%), Positives = 37/73 (50%), Gaps = 10/73 (13%)
 Frame = +1

Query: 346 ITGSNADEARGSCKKCGRVGHLTYQCRNF----------LSVKEDSGKDKDEEGIDAAVL 495
           + G N D  R  CKKCG  GHLT++CRNF          L V   S +D DEE  +   L
Sbjct: 3   VPGCNKDSVRAGCKKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKL 62

Query: 496 SRLEKWKGNRDKK 534
             L++ + N  +K
Sbjct: 63  QALQEKRINXKRK 75



>gb:AK020113_1160323 Mus musculus 12 days embryo male wolffian duct
           includes surrounding region cDNA, RIKEN full-length
           enriched library, clone:6720422A05 product:hypothetical
           Lysine-rich region/Zn-finger CCHC type containing
           protein, full insert sequence.
          Length = 123

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 33/120 (27%), Positives = 49/120 (40%), Gaps = 10/120 (8%)
 Frame = +1

Query: 346 ITGSNADEARGSCKKCGRVGHLTYQCRNF----------LSVKEDSGKDKDEEGIDAAVL 495
           + G N D  R  C+KCG  GHLT++CRNF          L V   S +D DEE  +   L
Sbjct: 3   VPGCNKDNVRAGCRKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKL 62

Query: 496 SRLEKWKGNRDKKXXXXXXXXXXXXXXXXXXXXXXXXIERAIAEKYGKNTKKISRKVKSS 675
             L++ + N +++                         E +  +K  K  KK  +K K +
Sbjct: 63  QALQEKRINEEEEKKKEKSREKIKLKKRRKRSYSSATEEDSAKQKKQKYQKKEKKKEKKN 122



>gb:BC038302_2098233 Mus musculus RIKEN cDNA 3110031B13 gene, mRNA
           (cDNA clone IMAGE:1495234), partial cds.
          Length = 120

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 33/118 (27%), Positives = 48/118 (40%), Gaps = 10/118 (8%)
 Frame = +1

Query: 346 ITGSNADEARGSCKKCGRVGHLTYQCRNF----------LSVKEDSGKDKDEEGIDAAVL 495
           + G N D  R  C+KCG  GHLT++CRNF          L V   S +D DEE  +   L
Sbjct: 3   VPGCNKDNVRAGCRKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKL 62

Query: 496 SRLEKWKGNRDKKXXXXXXXXXXXXXXXXXXXXXXXXIERAIAEKYGKNTKKISRKVK 669
             L++ + N +++                         E +  +K  K  KK  +K K
Sbjct: 63  QALQEKRINEEEEKKKEKSREKIKLKKRRKRSYSSATEEDSAKQKKQKYQKKEKKKKK 120



>gb:AX886439_1481892 Sequence 2302 from Patent EP1033401.
          Length = 72

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 27/69 (39%), Positives = 35/69 (50%), Gaps = 10/69 (14%)
 Frame = +1

Query: 346 ITGSNADEARGSCKKCGRVGHLTYQCRNF----------LSVKEDSGKDKDEEGIDAAVL 495
           + G N D  R  CKKCG  GHLT++CRNF          L V   S +D DEE  +   L
Sbjct: 3   VPGCNKDSVRAGCKKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKL 62

Query: 496 SRLEKWKGN 522
             L++ + N
Sbjct: 63  QALQEKRIN 71



>gb:AE014298_1124534 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003437_1209716 Drosophila melanogaster
           chromosome X, section 21 of 74 of the complete
           sequence.>gb:AY061188_1292991 Drosophila melanogaster
           LD15209 full length cDNA.
          Length = 321

 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 20/28 (71%), Positives = 21/28 (75%)
 Frame = +1

Query: 358 NADEARGSCKKCGRVGHLTYQCRNFLSV 441
           N D  R +CKKCG  GHLTYQCRNFL V
Sbjct: 9   NKDTLRAACKKCGYAGHLTYQCRNFLKV 36



>pir|T28919|T28919 hypothetical protein C13F10.7 - Caenorhabditis
           elegans>gb:U97006_1407038 Caenorhabditis elegans cosmid
           C13F10, complete sequence.
          Length = 222

 Score = 39.3 bits (90), Expect = 0.067
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 9/75 (12%)
 Frame = +1

Query: 334 ALARITGS--NADEARGSCKKCGRVGHLTYQCRNFLSVKE-------DSGKDKDEEGIDA 486
           A   I+G+  +A    G+CK+CG  GHL +QCRN + V+        +      E   D 
Sbjct: 60  AFVDISGAAISAPAVTGACKRCGYPGHLYFQCRNHIEVRPNVSTKAYEVSSTSSESSDDE 119

Query: 487 AVLSRLEKWKGNRDK 531
             L  LEK +    K
Sbjct: 120 TPLIALEKQRKKEKK 134



>gb:AP005011_1847243 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0622F08.>gb:AP005778_1857715 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBb0042G06.
          Length = 213

 Score = 35.0 bits (79), Expect = 1.3
 Identities = 23/61 (37%), Positives = 29/61 (47%), Gaps = 1/61 (1%)
 Frame = +2

Query: 110 PRVLDKISKCRRQQEEFACRRTIGCTVVLPYRPMVSG-KVQLGMTHMHPTRMIRRSLRQN 286
           PRV   I+ CRR QE  A R+T GC+  +  R  + G K Q     MHP       LR  
Sbjct: 72  PRVASTIATCRRVQE--AIRKTEGCSSQVNDRASIQGAKAQAAPQKMHPQLATTIGLRST 129

Query: 287 L 289
           +
Sbjct: 130 M 130



>gb:AC149265_1744849 Solanum demissum chromosome 5 clone PGEC858M02
           map MAP_LOC, complete sequence.
          Length = 1415

 Score = 34.7 bits (78), Expect = 1.7
 Identities = 15/51 (29%), Positives = 28/51 (54%)
 Frame = +1

Query: 355 SNADEARGSCKKCGRVGHLTYQCRNFLSVKEDSGKDKDEEGIDAAVLSRLE 507
           S  ++ +G+C  CG+ GH +  CR   + ++D  KDK +    A ++  +E
Sbjct: 344 SRQEKFKGNCYNCGKAGHKSSDCR---APRKDKDKDKGKGKSQANIVEEME 391



>gb:AB026661_1517392 Arabidopsis thaliana genomic DNA, chromosome 5,
           BAC clone:T30G6.
          Length = 254

 Score = 34.7 bits (78), Expect = 1.7
 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 2/36 (5%)
 Frame = +1

Query: 364 DEARGSCKKCGRVGHLTYQCRNFLSV--KEDSGKDK 465
           D    SC  CGR GH  +QC N  SV   EDS +D+
Sbjct: 98  DSVSPSCFICGREGHFEHQCHNSFSVCFPEDSSEDE 133



>pir|A84490|A84490 probable CCHC-type zinc finger protein [imported]
           - Arabidopsis thaliana>gb:AC006586_1534535 Arabidopsis
           thaliana chromosome 2 clone F7B19 map mi421, complete
           sequence.
          Length = 120

 Score = 34.7 bits (78), Expect = 1.7
 Identities = 16/48 (33%), Positives = 28/48 (58%)
 Frame = +1

Query: 322 QGLLALARITGSNADEARGSCKKCGRVGHLTYQCRNFLSVKEDSGKDK 465
           Q    L + +G N  +  G+C K G+ GH +++CR+    K+DS K++
Sbjct: 35  QNTQKLKKKSGENTSKFTGTCYKFGKEGHKSFECRS----KKDSNKNE 78



>gb:AF125527_2475251 Gallus gallus clone 1C avian endogenous virus
           ev/J, complete sequence.
          Length = 1103

 Score = 34.3 bits (77), Expect = 2.2
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +1

Query: 328 LLALARITGSNADEARGSCKKCGRVGHLTYQCR 426
           ++A       +AD   G C KCG+VGH+  QCR
Sbjct: 462 MMACREADHRSADRQLGPCFKCGQVGHIRAQCR 494



>gb:AEN292966_2176157 Avian endogenous retrovirus EAV-HP partial
           proviral genome, clone EAV-JF1.
          Length = 671

 Score = 34.3 bits (77), Expect = 2.2
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +1

Query: 328 LLALARITGSNADEARGSCKKCGRVGHLTYQCR 426
           ++A       +AD   G C KCG+VGH+  QCR
Sbjct: 458 MMACREADHRSADRQLGPCFKCGQVGHIRAQCR 490



>gb:SIV2DCG_2452592 Simian retrovirus 2, complete genome.
          Length = 659

 Score = 33.5 bits (75), Expect = 3.7
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 7/51 (13%)
 Frame = +1

Query: 322 QGLLALARITG-------SNADEARGSCKKCGRVGHLTYQCRNFLSVKEDS 453
           QGL   A  +G       +N ++ RG C KCG+ GH    CR+  +   +S
Sbjct: 524 QGLAMAAAFSGQTVKDLLNNKNKDRGGCFKCGKKGHFAKDCRDHSNKNPES 574



>gb:NC94C8_1688814 Neurospora crassa DNA linkage group V cosmid
           contig 94C8.
          Length = 607

 Score = 33.5 bits (75), Expect = 3.7
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = +1

Query: 328 LLALARITGSNADEARGSCKKCGRVGHLTYQC 423
           L  LA + G+  D+   +C+ CG++GH  Y C
Sbjct: 303 LRELAALNGTLRDDENQACQNCGQIGHRKYDC 334



>sp|P51516|GAG_SRV2 Gag polyprotein (Core polyprotein) [Contains:
           Core protein p10; Core phosphoprotein p18; Core protein
           p12; Core protein p27; Core protein p14; Core protein
           p4].
          Length = 654

 Score = 33.5 bits (75), Expect = 3.7
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 7/51 (13%)
 Frame = +1

Query: 322 QGLLALARITG-------SNADEARGSCKKCGRVGHLTYQCRNFLSVKEDS 453
           QGL   A  +G       +N ++ RG C KCG+ GH    CR+  +   +S
Sbjct: 519 QGLAMAAAFSGQTVKDLLNNKNKDRGGCFKCGKKGHFAKDCRDHSNKNPES 569



>gb:AJ623289_2278152 Avian endogenous retrovirus EAV-HP partial
           proviral genome, clone EAV-15I.
          Length = 680

 Score = 33.1 bits (74), Expect = 4.8
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = +1

Query: 328 LLALARITGSNADEARGSCKKCGRVGHLTYQCR 426
           ++A       +AD   G C KCG++GH+  QCR
Sbjct: 467 MMACREADHRSADRQLGPCFKCGQLGHIRAQCR 499



>gb:AEN238124_2176154 Avian endogenous retrovirus EAV-HP, complete
           genome, specific host: Gallus gallus
           domesticus(Chicken,line N).
          Length = 1125

 Score = 33.1 bits (74), Expect = 4.8
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = +1

Query: 328 LLALARITGSNADEARGSCKKCGRVGHLTYQCR 426
           ++A       +AD   G C KCG++GH+  QCR
Sbjct: 454 MMACREADHRSADRQLGPCFKCGQLGHIRAQCR 486



>gb:OSJN00082_1694557 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0061C06, complete sequence.
          Length = 209

 Score = 33.1 bits (74), Expect = 4.8
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 3/42 (7%)
 Frame = +1

Query: 364 DEARGSCKKCGRVGHLTYQCRNFLSVKED---SGKDKDEEGI 480
           D+ R  CK CGR+GH    CR      E     G+++D+E +
Sbjct: 135 DQGRDKCKNCGRLGHWEKDCRQPKKQAEAHAVQGEEEDDEPV 176



>gb:AF125529_2475253 Gallus gallus clone 3A avian endogenous virus
           ev/J gag/env fusion protein gene, partial cds.
          Length = 692

 Score = 32.7 bits (73), Expect = 6.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = +1

Query: 328 LLALARITGSNADEARGSCKKCGRVGHLTYQCR 426
           ++A       +AD   G C KCG+ GH+  QCR
Sbjct: 454 MMACREADHRSADRQLGPCFKCGQAGHIRAQCR 486



>gb:AF126468_2200120 Simian retrovirus SRV-2 strain D2/RHE/OR/V1,
           complete genome.
          Length = 654

 Score = 32.7 bits (73), Expect = 6.3
 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 7/43 (16%)
 Frame = +1

Query: 322 QGLLALARITG-------SNADEARGSCKKCGRVGHLTYQCRN 429
           QGL   A  +G       +N ++ RG C KCG+ GH    CR+
Sbjct: 519 QGLAMAAAFSGQTVKDFLNNKNKDRGGCFKCGKRGHFAKDCRD 561



>gb:AF126467_2200116 Simian retrovirus 2, complete genome.
          Length = 654

 Score = 32.7 bits (73), Expect = 6.3
 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 7/43 (16%)
 Frame = +1

Query: 322 QGLLALARITG-------SNADEARGSCKKCGRVGHLTYQCRN 429
           QGL   A  +G       +N ++ RG C KCG+ GH    CR+
Sbjct: 519 QGLAMAAAFSGQTVKDFLNNKNKDRGGCFKCGKRGHFAKDCRD 561



>gb:BT010944_1640890 Arabidopsis thaliana At5g49400 gene, complete
           cds.>gb:BT011657_1641179 Arabidopsis thaliana At5g49400
           mRNA, complete cds.
          Length = 275

 Score = 32.7 bits (73), Expect = 6.3
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = +1

Query: 340 ARITGSNADEARGSCKKCGRVGHLTYQCRN 429
           A   GS+A  A   C+KC + GH TY+C+N
Sbjct: 87  ASAVGSSASAA-SQCQKCFQAGHWTYECKN 115



>gb:AK118554_1816524 Arabidopsis thaliana At5g52380 mRNA for unknown
           protein, complete cds, clone: RAFL19-78-D10.
          Length = 268

 Score = 32.3 bits (72), Expect = 8.2
 Identities = 16/49 (32%), Positives = 23/49 (46%)
 Frame = +1

Query: 376 GSCKKCGRVGHLTYQCRNFLSVKEDSGKDKDEEGIDAAVLSRLEKWKGN 522
           G CK CG V HL   C +     ++S + K     DA    +L K+ G+
Sbjct: 179 GCCKVCGSVAHLVKDCPD--KFNQESAQPKKTSRFDATPRGKLTKFSGD 225



>gb:AB019226_1514065 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K24M7.
          Length = 268

 Score = 32.3 bits (72), Expect = 8.2
 Identities = 16/49 (32%), Positives = 23/49 (46%)
 Frame = +1

Query: 376 GSCKKCGRVGHLTYQCRNFLSVKEDSGKDKDEEGIDAAVLSRLEKWKGN 522
           G CK CG V HL   C +     ++S + K     DA    +L K+ G+
Sbjct: 179 GCCKVCGSVAHLVKDCPD--KFNQESAQPKKTSRFDATPRGKLTKFSGD 225



>gb:BX640414_805737 Bordetella pertussis strain Tohama I, complete
           genome; segment 4/12.>gb:BX640431_811151 Bordetella
           parapertussis strain 12822, complete genome; segment
           9/14.>gb:BX640445_815522 Bordetella bronchiseptica
           strain RB50, complete genome; segment 9/16.
          Length = 295

 Score = 32.3 bits (72), Expect = 8.2
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = -1

Query: 293 AADFGADFFESSLLGAYGSYPIALCQIPWVCRAALLCTRLFAGMRTLPAVA 141
           AAD GA  +   LL    S+P   C IP   RAA +   L AGM   P ++
Sbjct: 239 AADIGATSWAQVLLKFVLSHPAVTCAIPGTGRAAHMRDNLAAGMAAPPPLS 289


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 601,000,537
Number of Sequences: 1806583
Number of extensions: 10992459
Number of successful extensions: 40612
Number of sequences better than 10.0: 35
Number of HSP's better than 10.0 without gapping: 35079
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 40571
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 40164081650
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)