BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig1412
         (838 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|Q9LRX8|R1AB_ARATH|R1AB_ARATH 60S ribosomal protein L13a-2.>gb:AB028609_1...   379   e-104   Arabidopsis thaliana [mouse-ear cress]
gb:AY080870_1568555 Arabidopsis thaliana putative 60S ribosomal ...   378   e-104   
sp|Q9FKC0|R1AD_ARATH|R1AD_ARATH 60S ribosomal protein L13a-4.>gb:AB012242_1...   375   e-103   Arabidopsis thaliana [mouse-ear cress]
sp|Q9SFU1|R1AA_ARATH|R1AA_ARATH 60S ribosomal protein L13a-1.>gb:ATAC012395...   375   e-103   Arabidopsis thaliana [mouse-ear cress]
sp|Q9SVR0|R1AC_ARATH|R1AC_ARATH 60S ribosomal protein L13a-3.>pir|T07697|T0...   372   e-102   Arabidopsis thaliana [mouse-ear cress]
gb:AC120509_1739834 Oryza sativa chromosome 3 BAC OSJNBb0081K01 ...   365   e-100   
gb:AF503433_1806731 Sorghum bicolor BAC 170F8, complete sequence.     365   e-100   
gb:AY846823_1630724 Triticum aestivum ribosomal protein L13a mRN...   362   4e-99   
gb:AY498745_1178471 Capsicum annuum 60S ribosomal protein L13a (...   359   4e-98   
gb:AP003759_1833035 Oryza sativa (japonica cultivar-group) genom...   358   9e-98   
sp|O49885|R13A_LUPLU|R13A_LUPLU 60S ribosomal protein L13a.>gb:LLAJ3363_168...   347   2e-94   Lupinus luteus
sp|O65055|R13A_PICMA|R13A_PICMA 60S ribosomal protein L13a.>gb:AF051212_176...   345   6e-94   Picea mariana [black spruce]
sp|P93099|R13A_CYAPA|R13A_CYAPA 60S ribosomal protein L13a.>pir|T07166|T071...   249   5e-65   Cyanophora paradoxa
gb:CR859183_1183317 Pongo pygmaeus mRNA; cDNA DKFZp469O181 (from...   235   7e-61   
gb:BC004900_1969426 Homo sapiens ribosomal protein L13a, mRNA (c...   235   9e-61   
pir|S29539|S29539 ribosomal protein L13a, cytosolic - human>gb:A...   235   9e-61   Homo sapiens [man]
sp|P40429|R13A_HUMAN|R13A_HUMAN 60S ribosomal protein L13a (23 kDa highly b...   235   9e-61   Homo sapiens [man]
pir|A44367|A44367 tumor-specific transplantation antigen P198 ho...   234   2e-60   Bos taurus [bovine]
gb:BC043976_2548387 Xenopus laevis ribosomal protein L13a, mRNA ...   234   2e-60   
gb:AF109186_1149801 Homo sapiens FWP004 mRNA, complete cds.           233   3e-60   
pir|A53204|A53204 ribosomal protein L13a, cytosolic [validated] ...   233   4e-60   Rattus norvegicus [brown rat]
sp|P35427|R13A_RAT|R13A_RAT 60S ribosomal protein L13a.                        233   4e-60   Rattus norvegicus [brown rat]
gb:BC086382_2109571 Rattus norvegicus ribosomal protein L13A, mR...   232   6e-60   
gb:AK007609_1154084 Mus musculus 10 day old male pancreas cDNA, ...   231   1e-59   
pir|JL0149|JL0149 transplantation antigen P198 - mouse>gb:MMTUM1...   231   1e-59   Mus musculus [mouse]
sp|P19253|R13A_MOUSE|R13A_MOUSE 60S ribosomal protein L13a (Transplantation...   231   1e-59   Mus musculus [mouse]
gb:AC120509_1739837 Oryza sativa chromosome 3 BAC OSJNBb0081K01 ...   228   1e-58   
gb:AL356120_1924258 Human DNA sequence from clone RP11-365K22 on...   228   1e-58   
gb:BC047855_2549938 Danio rerio ribosomal protein L13a, mRNA (cD...   226   3e-58   
gb:AF401568_2491995 Ictalurus punctatus ribosomal protein L13a m...   224   2e-57   
sp|Q9P720|RL16_NEUCR|RL16_NEUCR 60S ribosomal protein L16.>pir|T48746|T4874...   223   3e-57   
gb:AE017353_1760163 Cryptococcus neoformans var. neoformans JEC2...   222   8e-57   
sp|Q91487|R13A_SALTR|R13A_SALTR 60S ribosomal protein L13a (Transplantation...   220   3e-56   Salmo trutta
gb:AF178537_1774715 Aspergillus nidulans ribosomal protein L16a ...   219   7e-56   
gb:AY232073_1177366 Drosophila yakuba clone yak-ad_CG1475 mRNA s...   217   2e-55   
sp|Q9VNE9|R13A_DROME|R13A_DROME 60S ribosomal protein L13A.>gb:AE014297_113...   217   2e-55   Drosophila melanogaster
gb:XDE291822_1727809 Xanthophyllomyces dendrorhous mRNA for Ribo...   216   4e-55   
sp|Q962U0|R13A_SPOFR|R13A_SPOFR 60S ribosomal protein L13A.>gb:AF400184_126...   213   4e-54   Spodoptera frugiperda
pir|S53911|S53911 ribosomal protein L16.e.B, cytosolic - yeast (...   211   1e-53   Saccharomyces cerevisiae [brewer's yeast]
sp|P26785|R16B_YEAST|R16B_YEAST 60S ribosomal protein L16-B (YL15) (RP23).       211   1e-53   Saccharomyces cerevisiae [brewer's yeast]
sp|Q8MUR4|R13A_CHOPR|R13A_CHOPR 60S ribosomal protein L13A.>gb:AF514334_127...   210   2e-53   Choristoneura parallela
gb:CR382133_1666870 Debaryomyces hansenii chromosome A of strain...   207   2e-52   
gb:AY769283_1350434 Bombyx mori ribosomal protein L13A (RpL13A) ...   207   2e-52   
gb:AY752827_1179970 Culicoides sonorensis clone CsRPL13 ribosoma...   206   3e-52   
pir|S48401|S48401 ribosomal protein L16.e.A, cytosolic - yeast (...   206   3e-52   Saccharomyces cerevisiae [brewer's yeast]
sp|P26784|R16A_YEAST|R16A_YEAST 60S ribosomal protein L16-A (L13A) (RP22).       206   3e-52   Saccharomyces cerevisiae [brewer's yeast]
gb:CR380956_1652429 Candida glabrata strain CBS138 chromosome J ...   206   4e-52   
gb:CR382129_1661690 Yarrowia lipolytica chromosome C of strain C...   205   8e-52   
gb:AE016818_1748511 Ashbya gossypii (= Eremothecium gossypii) AT...   203   3e-51   
gb:AB016008_1512747 Schizosaccharomyces pombe mRNA for ribosomal...   202   6e-51   
pir|T43381|T43381 ribosomal protein L13/L16 - fission yeast  (Sc...   202   6e-51   Schizosaccharomyces pombe
sp|O42991|R16B_SCHPO|R16B_SCHPO 60S ribosomal protein L16-B.>pir|T40720|T40...   202   6e-51   Schizosaccharomyces pombe
sp|O42848|R16A_SCHPO|R16A_SCHPO 60S ribosomal protein L16-A.>pir|T38231|T38...   202   6e-51   Schizosaccharomyces pombe
gb:CR382126_1658555 Kluyveromyces lactis strain NRRL Y-1140 chro...   202   8e-51   
sp|Q27389|R13A_CAEEL|R13A_CAEEL 60S ribosomal protein L13a.>pir|T23654|T236...   202   8e-51   Caenorhabditis elegans [roundworm]
gb:AE014185_937620 Plasmodium falciparum 3D7 chromosome 10 compl...   197   2e-49   
gb:AC115598_1205773 Dictyostelium discoideum chromosome 2 map 58...   191   1e-47   
sp|O43004|R16C_SCHPO|R16C_SCHPO 60S ribosomal protein L16-C.>pir|T40144|T40...   191   1e-47   Schizosaccharomyces pombe
gb:AY650304_1958251 Macaca fascicularis ribosomal protein L13A m...   191   2e-47   
sp|Q95307|R13A_PIG|R13A_PIG 60S ribosomal protein L13a (Fragment).             188   1e-46   Sus scrofa [pigs]
gb:CFA388525_1438336 Canis familiaris mRNA for partial Ribosomal...   184   1e-45   
gb:AB082924_1871815 Homo sapiens RPL13a mRNA for ribosomal prote...   171   2e-41   
gb:AX399872_1467185 Sequence 43 from Patent WO0218424.                161   4e-39   
gb:AF127593_1770551 Picea abies putative 60S ribosomal protein L...   154   2e-36   
gb:AF052595_1236791 Ostertagia ostertagi 60S ribosomal protein L...   151   2e-35   
gb:AF521144_1807881 Kandelia candel 60S ribosomal protein mRNA, ...   146   4e-34   
gb:AF127595_1770553 Picea glauca putative 60S ribosomal protein ...   140   3e-32   
gb:AF127594_1770552 Picea abies putative 60S ribosomal protein L...   140   3e-32   
pir|F90083|F90083 60s ribosomal protein L13A [imported] - Guilla...   137   3e-31   Guillardia theta
gb:AF127598_1770556 Picea mariana putative 60S ribosomal protein...   129   9e-29   
gb:AB049716_1520905 Pisum sativum ssa-6 mRNA for putative senesc...    93   9e-28   
gb:AY606806_1617503 Pseudotsuga menziesii isolate 659 putative 6...   117   2e-25   
gb:AY231755_1177048 Drosophila yakuba clone yak-em_CG1475 mRNA s...   117   3e-25   
gb:SC23CDS_1705074 S.cerevisiae PMS1, TPM1, MKS1, YMK1, MSK1, OD...   116   6e-25   
gb:CNS07EGB_1373210 chromosome IV of strain GB-M1 of Encephalito...   115   1e-24   
gb:BC067891_1987546 Homo sapiens cDNA clone MGC:87657 IMAGE:5271...   109   6e-23   
gb:AF127596_1770554 Picea glauca putative 60S ribosomal protein ...   102   7e-21   
gb:AE010721_265976 Methanosarcina acetivorans str. C2A, section ...    94   4e-18   
gb:AX884906_1480359 Sequence 769 from Patent EP1033401.                92   1e-17   
gb:AE013411_292086 Methanosarcina mazei strain Goe1, section 193...    91   2e-17   
sp|O29137|RL13_ARCFU|RL13_ARCFU 50S ribosomal protein L13P.>pir|G69390|G693...    89   8e-17   Archaeoglobus fulgidus
gb:AP006878_576653 Thermococcus kodakaraensis strain KOD1 DNA, c...    87   5e-16   
gb:AE010438_263108 Methanopyrus kandleri AV19 section 137 of 157...    87   5e-16   
gb:AE010263_261212 Pyrococcus furiosus DSM 3638, section 138 of ...    84   4e-15   
sp|O26146|RLSX_METTH|RLSX_METTH Fused L13/S9 ribosomal protein [Includes: 5...    84   4e-15   Methanothermobacter thermautotrophicus
sp|Q9V196|RL13_PYRAB|RL13_PYRAB 50S ribosomal protein L13P.>pir|G75171|G751...    84   4e-15   Pyrococcus abyssi
sp|O59300|RL13_PYRHO|RL13_PYRHO 50S ribosomal protein L13P.>pir|B71043|B710...    83   6e-15   Pyrococcus horikoshii
gb:AY013245_1558485 Oryza sativa (japonica cultivar-group) chrom...    79   1e-13   
sp|Q9YB50|RL13_AERPE|RL13_AERPE 50S ribosomal protein L13P.>pir|G72557|G725...    79   1e-13   Aeropyrum pernix
sp|P29198|RL13_HALMA|RL13_HALMA 50S ribosomal protein L13P (Hmal13).>pir|B4...    75   1e-12   Haloarcula marismortui
gb:AX400069_1467382 Sequence 240 from Patent WO0218424.                75   2e-12   
gb:BA000023_692747 Sulfolobus tokodaii str. 7 DNA, complete genome.    75   2e-12   
gb:AE009779_255567 Pyrobaculum aerophilum strain IM2 section 34 ...    74   3e-12   
gb:AF020446_1233347 Entamoeba dispar ribosomal protein L13A mRNA...    73   6e-12   
gb:AE017199_403039 Nanoarchaeum equitans Kin4-M, complete genome.      73   6e-12   
sp|P95991|RL13_SULSO|RL13_SULSO 50S ribosomal protein L13P.>pir|S75419|S754...    72   2e-11   Saccharolobus solfataricus
pir|C64324|C64324 ribosomal protein L13 - Methanococcus jannaschii     71   2e-11   Methanocaldococcus jannaschii
sp|P54023|RL13_METJA|RL13_METJA 50S ribosomal protein L13P.>gb:U67475_20628...    71   2e-11   Methanocaldococcus jannaschii
gb:BX957222_844577 Methanococcus maripaludis S2 complete genome;...    71   3e-11   
gb:AY359241_1322630 Crassostrea gigas 60s ribosomal protein mRNA...    69   8e-11   
gb:BA000011_665601 Thermoplasma volcanium GSS1 DNA, complete gen...    68   2e-10   
pir|F84269|F84269 50S ribosomal protein L13P [imported] - Haloba...    67   4e-10   Halobacterium salinarum
gb:AE017261_419340 Picrophilus torridus DSM 9790, complete genome.     66   9e-10   
gb:TACID2_196205 Thermoplasma acidophilum complete genome; segme...    64   4e-09   
gb:AF337889_1263826 Ceratitis capitata putative 60S ribosomal pr...    63   8e-09   
sp|P39473|RL13_SULAC|RL13_SULAC 50S ribosomal protein L13P.>pir|S47025|S470...    61   3e-08   Sulfolobus acidocaldarius
pir|A96815|A96815 hypothetical protein T30F21.4 [imported] - Ara...    59   1e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AP003076_1824653 Oryza sativa (japonica cultivar-group) genom...    56   7e-07   
gb:AE017317_440762 Desulfovibrio vulgaris subsp. vulgaris str. H...    56   1e-06   
gb:BA000045_744493 Gloeobacter violaceus PCC 7421 DNA, complete ...    52   1e-05   
gb:CR522870_100172 Desulfotalea psychrophila LSv54 chromosome.         52   1e-05   
gb:BX248584_763678 Blochmannia floridanus complete genome; segme...    52   2e-05   
gb:AE012556_284169 Xylella fastidiosa Temecula1, section 4 of 9 ...    52   2e-05   
pir|F82669|F82669 50S ribosomal protein L13 XF1537 [imported] - ...    51   2e-05   Xylella fastidiosa
gb:CP000027_79510 Dehalococcoides ethenogenes 195, complete genome.    50   4e-05   
gb:AF019739_1233298 Entamoeba dispar 60S ribosomal protein L13A ...    50   7e-05   
sp|Q9X1G5|RL13_THEMA|RL13_THEMA 50S ribosomal protein L13.>pir|G72250|G7225...    50   7e-05   Thermotoga maritima
gb:AY657292_2146302 Synthetic construct Peudomonas aeruginosa cl...    48   2e-04   
gb:CR382130_1662722 Yarrowia lipolytica chromosome D of strain C...    48   2e-04   
gb:AP006618_557260 Nocardia farcinica IFM 10152 DNA, complete ge...    48   2e-04   
gb:AE013598_297854 Xanthomonas oryzae pv. oryzae KACC10331, comp...    48   2e-04   
pir|A83093|A83093 50S ribosomal protein L13 PA4433 [imported] - ...    48   2e-04   Pseudomonas aeruginosa
sp|P12629|RK13_SPIOL|RK13_SPIOL 50S ribosomal protein L13, chloroplast prec...    48   2e-04   Spinacia oleracea
gb:BX572100_799100 Prochlorococcus marinus MIT9313 complete geno...    48   3e-04   
gb:BX569694_776995 Synechococcus sp. WH8102 complete genome; seg...    48   3e-04   
gb:AE011675_275449 Xanthomonas axonopodis pv. citri str. 306, se...    48   3e-04   
gb:AE011499_273644 Leptospira interrogans serovar lai str. 56601...    48   3e-04   
gb:AE017354_461051 Legionella pneumophila subsp. pneumophila str...    47   4e-04   
gb:AE013170_289826 Thermoanaerobacter tengcongensis MB4, section...    47   4e-04   
gb:CR628337_115840 Legionella pneumophila str. Lens complete gen...    47   4e-04   
gb:CR628336_112879 Legionella pneumophila str. Paris complete ge...    47   4e-04   
pir|AE2329|AE2329 50S ribosomal protein L13 [imported] - Nostoc ...    47   4e-04   Nostoc sp. PCC 7120
sp|Q53874|RL13_STRCO|RL13_STRCO 50S ribosomal protein L13.>pir|T35563|T3556...    47   4e-04   
gb:AF207696_1251010 Limax marginatus ribosomal protein-like prot...    47   6e-04   
gb:AY548459_627484 Fremyella diplosiphon clone 3098E8 30S riboso...    47   6e-04   
pir|B82308|B82308 ribosomal protein L13 VC0570 [imported] - Vibr...    47   6e-04   Vibrio cholerae
sp|Q9RXY1|RL13_DEIRA|RL13_DEIRA 50S ribosomal protein L13.>pir|E75552|E7555...    47   6e-04   Deinococcus radiodurans
gb:AY267641_1314464 Bigelowiella natans ribosomal protein rpL13 ...    46   8e-04   
gb:BA000030_702844 Streptomyces avermitilis MA-4680 genomic DNA,...    46   8e-04   
gb:AE017166_396141 Prochlorococcus marinus subsp. marinus str. C...    46   8e-04   
gb:AP008231_581586 Synechococcus elongatus PCC 6301 DNA, complet...    46   0.001   
gb:AP006840_570228 Symbiobacterium thermophilum DNA, complete ge...    46   0.001   
pir|F86906|F86906 50S ribosomal protein L13 [imported] - Lactoco...    46   0.001   Lactococcus lactis subsp. lactis
gb:AE017180_401165 Geobacter sulfurreducens PCA, complete genome.      45   0.001   
gb:AE016822_340945 Leifsonia xyli subsp. xyli str. CTCB07, compl...    45   0.001   
sp|P38014|RL13_MYCLE|RL13_MYCLE 50S ribosomal protein L13.>pir|S72991|S7299...    45   0.001   Mycobacterium leprae
gb:BX321861_773812 Nitrosomonas europaea ATCC 19718, complete ge...    45   0.002   
gb:BA000039_725893 Thermosynechococcus elongatus BP-1 DNA, compl...    45   0.002   
gb:AE017332_445927 Mycoplasma hyopneumoniae 232, complete genome.      45   0.002   
gb:BX294151_770787 Pirellula sp. strain 1 complete genome; segme...    45   0.002   
gb:AL935254_550956 Lactobacillus plantarum strain WCFS1 complete...    45   0.002   
gb:AE017282_427686 Methylococcus capsulatus str. Bath, complete ...    45   0.002   
gb:AE016923_358658 Chromobacterium violaceum ATCC 12472 section ...    44   0.003   
gb:CR555306_105908 Azoarcus sp. EbN1 complete genome.                  44   0.003   
sp|P73294|RL13_SYNY3|RL13_SYNY3 50S ribosomal protein L13.>pir|S77475|S7747...    44   0.003   Synechocystis sp.
gb:BX572094_797158 Prochlorococcus marinus MED4 complete genome;...    44   0.004   
gb:BX640435_812119 Bordetella parapertussis strain 12822, comple...    44   0.005   
gb:BX640420_807362 Bordetella pertussis strain Tohama I, complet...    44   0.005   
sp|P70974|RL13_BACSU|RL13_BACSU 50S ribosomal protein L13.>pir|G69695|G6969...    44   0.005   Bacillus subtilis
gb:CP000023_874070 Streptococcus thermophilus LMG 18311, complet...    43   0.006   
gb:CP000001_850773 Bacillus cereus ZK, complete genome.                43   0.006   
gb:BX950851_839063 Erwinia carotovora subsp. atroseptica SCRI104...    43   0.006   
gb:BX897699_827401 Bartonella henselae strain Houston-1, complet...    43   0.006   
gb:AE014201_305555 Streptococcus agalactiae 2603V/R section 11 o...    43   0.006   
gb:SAG766844_169737 Streptococcus agalactiae NEM316 complete gen...    43   0.006   
gb:BX842644_822716 Mycoplasma mycoides subsp. mycoides SC genomi...    43   0.008   
gb:BX571872_788870 Photorhabdus luminescens subsp. laumondii TTO...    43   0.008   
gb:AE017340_456179 Idiomarina loihiensis L2TR, complete genome.        43   0.008   
gb:AE017333_446103 Bacillus licheniformis DSM 13, complete genom...    43   0.008   
gb:AE017283_431562 Propionibacterium acnes KPA171202, complete g...    43   0.008   
gb:AE016767_327963 Escherichia coli CFT073 section 13 of 18 of t...    43   0.008   
gb:AE014868_312618 Streptococcus mutans UA159 section 16 of 185 ...    43   0.008   
gb:AE013614_298470 Yersinia pestis KIM section 14 of 415 of the ...    43   0.008   
pir|AD0433|AD0433 50S ribosomal protein L13 [imported] - Yersini...    43   0.008   Yersinia pestis Pestoides F
sp|P02410|RL13_ECOLI|RL13_ECOLI 50S ribosomal protein L13.>pir|A02787|R5EC1...    43   0.008   Escherichia coli [E. coli]
gb:AE016778_330753 Pseudomonas putida KT2440 section 5 of 21 of ...    42   0.011   
gb:CR382139_1672327 Debaryomyces hansenii chromosome G of strain...    42   0.014   
gb:CP000010_866514 Burkholderia mallei ATCC 23344 chromosome 1, ...    42   0.014   
gb:CP000003_861580 Streptococcus pyogenes MGAS10394, complete ge...    42   0.014   
gb:BX897700_828893 Bartonella quintana str. Toulouse, complete g...    42   0.014   
gb:AE017145_390251 Helicobacter hepaticus ATCC 51449 section 2 o...    42   0.014   
gb:AE016750_323441 Staphylococcus epidermidis ATCC 12228, sectio...    42   0.014   
gb:AE010104_259367 Streptococcus pyogenes strain MGAS8232, secti...    42   0.014   
pir|G97905|G97905 50S ribosomal protein L13 [imported] - Strepto...    42   0.014   Streptococcus pneumoniae
gb:BX571965_792709 Burkholderia pseudomallei strain K96243, chro...    42   0.019   
gb:BA000043_736716 Geobacillus kaustophilus HTA426 DNA, complete...    42   0.019   
gb:AE017308_437851 Mycoplasma mobile 163K complete genome.             42   0.019   
gb:AE016998_375200 Bacillus cereus ATCC 14579 section 1 of 18 of...    42   0.019   
gb:AE016995_374590 Chlamydophila caviae GPIC section 2 of 4 of t...    42   0.019   
gb:AE016871_353787 Pseudomonas syringae pv. tomato str. DC3000 s...    42   0.019   
gb:AE014168_305141 Streptococcus pyogenes MGAS315, section 33 of...    42   0.019   
gb:AE006617_220756 Streptococcus pyogenes M1 GAS, section 146 of...    42   0.019   
gb:CR382124_1656443 Kluyveromyces lactis strain NRRL Y-1140 chro...    41   0.024   
gb:BA000040_733223 Bradyrhizobium japonicum USDA 110 DNA, comple...    41   0.024   
gb:BA000031_705898 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    41   0.024   
gb:SME591786_185261 Sinorhizobium meliloti 1021 complete chromos...    41   0.024   
pir|E81294|E81294 50S ribosomal protein L13 Cj1480c [imported] -...    41   0.024   Campylobacter jejuni RM1221
gb:BX572601_802381 Rhodopseudomonas palustris CGA009 complete ge...    41   0.032   
gb:BX251410_764360 Tropheryma whipplei TW08/27, complete genome;...    41   0.032   
gb:AE016965_368933 Coxiella burnetii strain RSA 493, section 6 o...    41   0.032   
gb:AE016850_348668 Tropheryma whipplei str. Twist, section 1 of ...    41   0.032   
gb:CP000029_82390 Staphylococcus epidermidis RP62A, complete gen...    41   0.032   
pir|AB2730|AB2730 50S ribosomal protein L13 [imported] - Agrobac...    41   0.032   Agrobacterium fabrum str. C58
pir|C97511|C97511 50S ribosomal protein L13 [imported] - Agrobac...    41   0.032   Agrobacterium fabrum str. C58
sp|O67722|RL13_AQUAE|RL13_AQUAE 50S ribosomal protein L13.>pir|H70461|H7046...    41   0.032   Aquifex aeolicus
gb:CP000009_862479 Gluconobacter oxydans 621H, complete genome.        40   0.042   
gb:BX571662_779388 Wolinella succinogenes, complete genome; segm...    40   0.042   
gb:BA000012_672625 Mesorhizobium loti MAFF303099 DNA, complete g...    40   0.042   
gb:CR543861_104813 Acinetobacter sp. ADP1 complete genome.             40   0.042   
gb:CR378673_96520 Photobacterium profundum SS9; segment 11/12.         40   0.042   
pir|H83670|H83670 ribosomal protein L13 rplM [imported] - Bacill...    40   0.042   Bacillus halodurans
sp|Q12487|RM23_YEAST|RM23_YEAST 60S ribosomal protein L23, mitochondrial pr...    40   0.042   Saccharomyces cerevisiae [brewer's yeast]
sp|Q9Z8T7|RL13_CHLPN|RL13_CHLPN 50S ribosomal protein L13.>pir|G86521|G8652...    40   0.042   Chlamydia pneumoniae
sp|O46915|RK13_GUITH|RK13_GUITH Chloroplast 50S ribosomal protein L13.>gb:A...    40   0.042   Guillardia theta
gb:AL646059_545418 Ralstonia solanacearum GMI1000 chromosome, co...    40   0.055   
gb:SLMEN3_1715349 S.latifolia mRNA for Men-3 protein.                  40   0.071   
gb:BA000028_694538 Oceanobacillus iheyensis HTE831 DNA, complete...    40   0.071   
gb:CP000033_88630 Lactobacillus acidophilus NCFM, complete genome.     40   0.071   
sp|P56038|RL13_HELPY|RL13_HELPY 50S ribosomal protein L13.>pir|D64530|D6453...    40   0.071   Helicobacter pylori
gb:CR380958_1653254 Candida glabrata strain CBS138 chromosome L ...    39   0.093   
gb:AP008226_578922 Thermus thermophilus HB8 genomic DNA, complet...    39   0.093   
gb:AP006841_574532 Bacteroides fragilis YCH46 DNA, complete genome.    39   0.093   
gb:AP006628_566573 Onion yellows phytoplasma OY-M DNA, complete ...    39   0.093   
gb:AE017304_436735 Thermus thermophilus HB27 section 4 of 7 of t...    39   0.093   
gb:AE014291_308232 Brucella suis 1330 chromosome I, complete seq...    39   0.093   
gb:AE016799_335368 Vibrio vulnificus CMCP6 chromosome I section ...    39   0.12    
gb:CP000031_85728 Silicibacter pomeroyi DSS-3, complete genome.        39   0.12    
gb:BX248355_761854 Corynebacterium diphtheriae gravis NCTC13129,...    39   0.16    
gb:BA000035_715371 Corynebacterium efficiens YS-314 DNA, complet...    39   0.16    
gb:AE017263_421047 Mesoplasma florum L1 complete genome.               39   0.16    
pir|T39596|T39596 50s ribosomal protein - fission yeast (Schizos...    39   0.16    Schizosaccharomyces pombe
pir|E90018|E90018 50S ribosomal protein L13 [imported] - Staphyl...    38   0.21    Staphylococcus aureus subsp. aureus N315
sp|Q9ZMY6|RL13_HELPJ|RL13_HELPJ 50S ribosomal protein L13.>pir|H71975|H7197...    38   0.21    Helicobacter pylori
sp|P31781|RL13_HAESO|RL13_HAESO 50S ribosomal protein L13.>gb:S75161_169034...    38   0.21    Histophilus somni
sp|P44387|RL13_HAEIN|RL13_HAEIN 50S ribosomal protein L13.>pir|G64123|G6412...    38   0.21    Haemophilus influenzae
gb:AE006087_215408 Pasteurella multocida subsp. multocida str. P...    38   0.27    
pir|A43310|A43310 ribosomal protein L13 homolog - Haemophilus so...    38   0.27    Histophilus somni
gb:AF147722_1772306 Kluyveromyces lactis ribosomal protein L23 (...    37   0.35    
sp|O83988|RL13_TREPA|RL13_TREPA 50S ribosomal protein L13.>pir|D71251|D7125...    37   0.35    Treponema pallidum
gb:AE016819_1749238 Ashbya gossypii (= Eremothecium gossypii) AT...    37   0.46    
gb:AP006627_562510 Bacillus clausii KSM-K16 DNA, complete genome.      37   0.46    
gb:AE016827_342912 Mannheimia succiniciproducens MBEL55E, comple...    37   0.46    
sp|Q89AE6|RL13_BUCBP|RL13_BUCBP 50S ribosomal protein L13.>gb:AE014017_3027...    37   0.46    
gb:CP000020_872398 Vibrio fischeri ES114 chromosome I, complete ...    37   0.60    
pir|A87420|A87420 ribosomal protein L13 [imported] - Caulobacter...    37   0.60    Caulobacter vibrioides
sp|Q00990|RL13_STACA|RL13_STACA 50S ribosomal protein L13.>pir|S23063|S2306...    37   0.60    Staphylococcus carnosus
gb:SRGENSPMRN_1722396 Sorghum bicolor endosperm tissue mRNA, com...    36   0.79    
gb:AY566299_1615386 Sorghum bicolor clone MML-07 gamma kafirin p...    36   0.79    
gb:AY566298_1615385 Sorghum bicolor clone MML-06 gamma kafirin p...    36   0.79    
gb:ATH286347_1552276 Arabidopsis thaliana partial mRNA for 60S L...    36   0.79    
gb:CP000023_874403 Streptococcus thermophilus LMG 18311, complet...    36   0.79    
gb:AE012931_287246 Chlorobium tepidum TLS section 152 of 194 of ...    36   0.79    
gb:BC027852_1978963 Homo sapiens ribosomal protein L13A-like, mR...    36   1.0     
gb:AE017173_396722 Porphyromonas gingivalis W83 section 2 of 8 o...    36   1.0     
gb:AE016942_363241 Bacteroides thetaiotaomicron VPI-5482, sectio...    36   1.0     
pir|AB3398|AB3398 LSU ribosomal protein L13P [imported] - Brucel...    36   1.0     Brucella melitensis
pir|AD1775|AD1775 ribosomal protein L13 [imported] - Listeria in...    36   1.0     Listeria innocua
pir|AE1399|AE1399 ribosomal protein L13 [imported] - Listeria mo...    36   1.0     Listeria monocytogenes
gb:DJ534K4_1995573 Homo sapiens S164 gene, partial cds; PS1 and ...    35   1.3     
gb:AY673996_1621429 Gracilaria tenuistipitata var. liui chloropl...    35   1.3     
gb:HSM805525_2017930 Homo sapiens mRNA; cDNA DKFZp762C186 (from ...    35   1.8     
gb:AK024451_1910016 Homo sapiens mRNA for FLJ00043 protein, part...    35   1.8     
gb:AE004969_61661 Neisseria gonorrhoeae FA 1090, complete genome.      35   1.8     
pir|T05071|T05071 hypothetical protein T6K21.30 - Arabidopsis th...    35   1.8     Arabidopsis thaliana [mouse-ear cress]
pir|B81012|B81012 50S ribosomal protein L13 NMB2057 [imported] -...    35   1.8     Neisseria meningitidis serogroup A
pir|G90573|G90573 50S ribosomal protein L13 [imported] - Mycopla...    35   1.8     Mycoplasma pulmonis
gb:AF020312_2051057 Mus musculus proline-rich protein 9-1 mRNA, ...    35   2.3     
gb:BX640423_808559 Bordetella parapertussis strain 12822, comple...    35   2.3     
gb:BX640413_805176 Bordetella pertussis strain Tohama I, complet...    35   2.3     
gb:AE017155_392896 Haemophilus ducreyi strain 35000HP section 5 ...    35   2.3     
gb:AF481102_514462 Candidatus Tremblaya princeps MviN (mviN) gen...    34   3.0     
gb:OSJN00294_1698087 Oryza sativa genomic DNA, chromosome 4, BAC...    34   3.9     
gb:AP004314_1840029 Oryza sativa (japonica cultivar-group) genom...    33   5.1     
gb:SVGKAF_1723234 S.vulgare gene for gamma-kafirin.                    33   5.1     
gb:BX571871_788416 Photorhabdus luminescens subsp. laumondii TTO...    33   5.1     
sp|Q8K9F9|RL13_BUCAP|RL13_BUCAP 50S ribosomal protein L13.>gb:AE014114_3032...    33   5.1     
sp|P57471|RL13_BUCAI|RL13_BUCAI 50S ribosomal protein L13.>pir|F84975|F8497...    33   5.1     
gb:AK000082_1907680 Homo sapiens cDNA FLJ20075 fis, clone COL02542.    33   6.7     
gb:AB073737_1871351 Homo sapiens mRNA for PDZ domain protein GIP...    33   6.7     
gb:CR380953_1651056 Candida glabrata strain CBS138 chromosome G ...    33   6.7     
gb:BT000766_1635037 Arabidopsis thaliana clone RAFL09-36-L12 (R1...    33   6.7     
gb:BX640437_812960 Bordetella bronchiseptica strain RB50, comple...    33   6.7     
pir|T05421|T05421 hypothetical protein F28A23.90 - Arabidopsis t...    33   6.7     
pir|S51798|S51798 gamma-kafirin precursor - sorghum                    33   6.7     
gb:AE017340_456958 Idiomarina loihiensis L2TR, complete genome.        33   8.7     
gb:AE008692_240525 Zymomonas mobilis subsp. mobilis ZM4, complet...    33   8.7     
sp|Q05925|HME1_HUMAN|HME1_HUMAN Homeobox protein engrailed-1 (Hu-En-1).>pir...    33   8.7     
sp|Q99MX7|CES6_MOUSE|CES6_MOUSE Cat eye syndrome critical region protein 6 ...    33   8.7     


>sp|Q9LRX8|R1AB_ARATH 60S ribosomal protein
           L13a-2.>gb:AB028609_1517921 Arabidopsis thaliana genomic
           DNA, chromosome 3, TAC clone:K7P8.>gb:AY150392_1584957
           Arabidopsis thaliana putative 60S ribosomal protein
           (At3g24830) mRNA, complete cds.
          Length = 206

 Score =  379 bits (972), Expect = e-104
 Identities = 184/206 (89%), Positives = 197/206 (95%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH 244
           MVSGSGIC++RVVVDARHHM GRLASI+AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct: 1   MVSGSGICSKRVVVDARHHMCGRLASIIAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM 60

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
           RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct: 61  RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV 120

Query: 425 KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT 604
           KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQLT
Sbjct: 121 KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEVKRKERSQALYERKKQLT 180

Query: 605 KLRVKAEKAAEERLGTQLDILSSVKY 682
           KLR KAEK AEE+LG+QLD+L+S+KY
Sbjct: 181 KLRAKAEKVAEEKLGSQLDVLASIKY 206



>gb:AY080870_1568555 Arabidopsis thaliana putative 60S ribosomal
           protein (At3g24830) mRNA, complete cds.
          Length = 206

 Score =  378 bits (971), Expect = e-104
 Identities = 183/206 (88%), Positives = 197/206 (95%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH 244
           MVSGSGIC++RVVVDARHHM GRLASI+AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct: 1   MVSGSGICSKRVVVDARHHMCGRLASIIAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM 60

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
           RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct: 61  RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV 120

Query: 425 KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT 604
           KRMV+PDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QA YER+KQLT
Sbjct: 121 KRMVVPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEVKRKERSQALYERKKQLT 180

Query: 605 KLRVKAEKAAEERLGTQLDILSSVKY 682
           KLR KAEK AEE+LG+QLD+L+S+KY
Sbjct: 181 KLRAKAEKVAEEKLGSQLDVLASIKY 206



>sp|Q9FKC0|R1AD_ARATH 60S ribosomal protein
           L13a-4.>gb:AB012242_1511714 Arabidopsis thaliana genomic
           DNA, chromosome 5, TAC clone:K24G6.>gb:AY088191_1573213
           Arabidopsis thaliana clone 4275 mRNA, complete
           sequence.>gb:AY090359_1574108 Arabidopsis thaliana
           AT5g48760/K24G6_9 mRNA, complete
           cds.>gb:AY122902_1579780 Arabidopsis thaliana
           At5g48760/K24G6_9 mRNA, complete cds.
          Length = 206

 Score =  375 bits (964), Expect = e-103
 Identities = 183/206 (88%), Positives = 193/206 (93%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH 244
           MVSGSGIC++RVVVDARHHMLGRLASI AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct: 1   MVSGSGICSKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM 60

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
           RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKVYEGVP PYDK+
Sbjct: 61  RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVYEGVPTPYDKI 120

Query: 425 KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT 604
           KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKERA   YER+KQL 
Sbjct: 121 KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELETKRKERAHVVYERKKQLN 180

Query: 605 KLRVKAEKAAEERLGTQLDILSSVKY 682
           KLRVKAEK AEE+LG QLDIL+ VKY
Sbjct: 181 KLRVKAEKVAEEKLGAQLDILAPVKY 206



>sp|Q9SFU1|R1AA_ARATH 60S ribosomal protein
           L13a-1.>gb:ATAC012395_1543480 Arabidopsis thaliana
           chromosome III BAC T1B9 genomic sequence, complete
           sequence.>gb:AY057551_1563968 Arabidopsis thaliana
           AT3g07110/T1B9_24 mRNA, complete
           cds.>gb:AY062793_1565449 Arabidopsis thaliana putative
           60S ribosomal protein L13A (At3g07110; T1B9.24) mRNA,
           complete cds.>gb:AY114589_1578631 Arabidopsis thaliana
           putative 60S ribosomal protein L13A (At3g07110) mRNA,
           complete cds.>gb:AF325041_1786495 Arabidopsis thaliana
           AT3g07110 (AT3g07110/T1B9_24) mRNA, complete cds.
          Length = 206

 Score =  375 bits (964), Expect = e-103
 Identities = 180/206 (87%), Positives = 196/206 (95%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH 244
           MVSGSGICA+RVVVDARHHMLGRLAS++AK+LLNGQ +VVVRCEEICLSGGLVRQKMKY 
Sbjct: 1   MVSGSGICAKRVVVDARHHMLGRLASVVAKDLLNGQNIVVVRCEEICLSGGLVRQKMKYM 60

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
           RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGA ALARLKV+EGVP PYDK+
Sbjct: 61  RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPTPYDKI 120

Query: 425 KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT 604
           KRMV+PDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LENKRKERAQA YER+KQL+
Sbjct: 121 KRMVVPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELENKRKERAQAVYERKKQLS 180

Query: 605 KLRVKAEKAAEERLGTQLDILSSVKY 682
           KLR KAEK AEE+LG+QLD+L+ VKY
Sbjct: 181 KLRAKAEKVAEEKLGSQLDVLAPVKY 206



>sp|Q9SVR0|R1AC_ARATH 60S ribosomal protein
           L13a-3.>pir|T07697|T07697 ribosomal protein L13a,
           cytosolic - Arabidopsis thaliana>gb:ATCHRIV35_1545081
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 35.>gb:ATF17N18_1549037 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F17N18 (ESSA
           project).>gb:AY052263_1562636 Arabidopsis thaliana
           AT4g13170/F17N18_60 mRNA, complete
           cds.>gb:AY060518_1564827 Arabidopsis thaliana
           AT4g13170/F17N18_60 mRNA, complete cds.
          Length = 206

 Score =  372 bits (955), Expect = e-102
 Identities = 180/206 (87%), Positives = 192/206 (93%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH 244
           MVSGSGICA+RVVVD RHHMLGRLAS  AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct: 1   MVSGSGICAKRVVVDGRHHMLGRLASNTAKELLNGQEVVVVRCEEICLSGGLVRQKMKYM 60

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
           RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EG+PPPYDK+
Sbjct: 61  RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGIPPPYDKI 120

Query: 425 KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT 604
           KRMVIPDALKVLRLQ+GHKYCLLG+LSSEVGWNHYDTIK LE KRKER+Q  YER+KQL 
Sbjct: 121 KRMVIPDALKVLRLQSGHKYCLLGRLSSEVGWNHYDTIKELETKRKERSQVMYERKKQLN 180

Query: 605 KLRVKAEKAAEERLGTQLDILSSVKY 682
           KLR KAEK AEERLG+QLD+L+ VKY
Sbjct: 181 KLRTKAEKVAEERLGSQLDVLAPVKY 206



>gb:AC120509_1739834 Oryza sativa chromosome 3 BAC OSJNBb0081K01
           genomic sequence, complete sequence.
          Length = 206

 Score =  365 bits (938), Expect = e-100
 Identities = 176/206 (85%), Positives = 193/206 (93%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH 244
           MVSGSG+CA RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct: 1   MVSGSGVCAPRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICMSGGLVRQKMKYL 60

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
           RFLRKRMNTKPSHGPIHFR+P+KILWRT+RGMIPHKTKRG AALARLK YEGVPPPYD+ 
Sbjct: 61  RFLRKRMNTKPSHGPIHFRSPAKILWRTVRGMIPHKTKRGEAALARLKAYEGVPPPYDRT 120

Query: 425 KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT 604
           KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN+YDTI+ LE KRKE+A+ AY+RRKQL 
Sbjct: 121 KRMVIPDALKVLRLQPGHKYCLLGQLSKEVGWNYYDTIRELEEKRKEKAKVAYDRRKQLA 180

Query: 605 KLRVKAEKAAEERLGTQLDILSSVKY 682
           KLRVKAEKAAEE+LG QL+IL+ +KY
Sbjct: 181 KLRVKAEKAAEEKLGPQLEILAPIKY 206



>gb:AF503433_1806731 Sorghum bicolor BAC 170F8, complete sequence.
          Length = 206

 Score =  365 bits (937), Expect = e-100
 Identities = 175/206 (84%), Positives = 194/206 (94%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH 244
           MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct: 1   MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL 60

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
           RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct: 61  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT 120

Query: 425 KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT 604
           KR+VIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+ LE KRKE+A+ AYERRKQL 
Sbjct: 121 KRVVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTIRELEEKRKEKAKVAYERRKQLA 180

Query: 605 KLRVKAEKAAEERLGTQLDILSSVKY 682
           KLRVKAEK AEE+LG+QL+IL+ +KY
Sbjct: 181 KLRVKAEKTAEEKLGSQLEILAPIKY 206



>gb:AY846823_1630724 Triticum aestivum ribosomal protein L13a mRNA,
           complete cds.
          Length = 206

 Score =  362 bits (930), Expect = 4e-99
 Identities = 175/206 (84%), Positives = 193/206 (93%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH 244
           MVSGSG+CA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct: 1   MVSGSGVCAKRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGGLVRQKMKYL 60

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
           RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKT RG AALARLK YEGVPPPYD+ 
Sbjct: 61  RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTARGEAALARLKAYEGVPPPYDRT 120

Query: 425 KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT 604
           KRMVIPDALKVLRLQ GH+YCLLG+LS EVGWN+ DTI+ LE KRKE+A+ +Y+RRKQL 
Sbjct: 121 KRMVIPDALKVLRLQPGHRYCLLGQLSKEVGWNYADTIRELEEKRKEKAKVSYDRRKQLA 180

Query: 605 KLRVKAEKAAEERLGTQLDILSSVKY 682
           KLRVKAEKAAEE+LGTQL+IL+ +KY
Sbjct: 181 KLRVKAEKAAEEKLGTQLEILAPIKY 206



>gb:AY498745_1178471 Capsicum annuum 60S ribosomal protein L13a
           (RpL13a) mRNA, complete cds.
          Length = 220

 Score =  359 bits (921), Expect = 4e-98
 Identities = 177/188 (94%), Positives = 182/188 (96%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH 244
           MVSGSGI ARR+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct: 1   MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL 60

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
           RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct: 61  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI 120

Query: 425 KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT 604
           KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIK LE+KRKERAQ  YERRKQL 
Sbjct: 121 KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKELEDKRKERAQVTYERRKQLA 180

Query: 605 KLRVKAEK 628
           KLRVKAE+
Sbjct: 181 KLRVKAER 188



>gb:AP003759_1833035 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1567_G09.>gb:AP004342_1840527 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0585H11.
          Length = 206

 Score =  358 bits (918), Expect = 9e-98
 Identities = 169/206 (82%), Positives = 192/206 (93%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH 244
           MVSGSG+C RRVVVDARHHMLGRLAS++AKELLNGQRVVVVRCEE+C+SGGLVRQKMKY 
Sbjct: 1   MVSGSGLCTRRVVVDARHHMLGRLASLVAKELLNGQRVVVVRCEEMCISGGLVRQKMKYL 60

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
           RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIPHKT RG AALA LK ++GVPPPYD+ 
Sbjct: 61  RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIPHKTPRGEAALANLKAFDGVPPPYDRT 120

Query: 425 KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT 604
           KRMV+PDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+ LE KRKE+A+ AYERRKQLT
Sbjct: 121 KRMVVPDALKVLRLQPGHKYCLLGQLSKEVGWNYHDTIRELEEKRKEKAKVAYERRKQLT 180

Query: 605 KLRVKAEKAAEERLGTQLDILSSVKY 682
           +LRVKAEKAAEE+LG+Q+DIL+ +KY
Sbjct: 181 RLRVKAEKAAEEKLGSQIDILAPIKY 206



>sp|O49885|R13A_LUPLU 60S ribosomal protein
           L13a.>gb:LLAJ3363_1685068 Lupinus luteus mRNA for
           ribosomal protein L13a.
          Length = 205

 Score =  347 bits (889), Expect = 2e-94
 Identities = 170/206 (82%), Positives = 189/206 (91%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH 244
           MVSGSGI A+RVVVDARHHMLGRLASI+AKELLNGQ+VV+VR EEIC+SGGLVRQKMKY 
Sbjct: 1   MVSGSGIAAKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRSEEICISGGLVRQKMKYL 60

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
           RFLRKRMNTKPSHGPIH  APSKI WRT+RGMIPHKTKRG  ALARLKVYEG+PPP+DK 
Sbjct: 61  RFLRKRMNTKPSHGPIHC-APSKIFWRTVRGMIPHKTKRGEHALARLKVYEGIPPPFDKQ 119

Query: 425 KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT 604
           KR+V+PDALKVLRLQ GHKYCLLG+LSSEVGWN+YDTIK LE KRKER+Q  YER+KQL 
Sbjct: 120 KRLVVPDALKVLRLQKGHKYCLLGQLSSEVGWNYYDTIKELEKKRKERSQVVYERKKQLN 179

Query: 605 KLRVKAEKAAEERLGTQLDILSSVKY 682
           KLRVKAE+ A+E+LG+QLDIL+ VKY
Sbjct: 180 KLRVKAEQVAQEKLGSQLDILAPVKY 205



>sp|O65055|R13A_PICMA 60S ribosomal protein
           L13a.>gb:AF051212_1764205 Picea mariana probable 60s
           ribosomal protein L13a (Sb16) mRNA, complete cds.
          Length = 206

 Score =  345 bits (885), Expect = 6e-94
 Identities = 167/206 (81%), Positives = 188/206 (91%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH 244
           MVSGSGICA+ VVVDARHHMLGRLASILAKELL+GQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct: 1   MVSGSGICAKEVVVDARHHMLGRLASILAKELLHGQRVVVVRCEEICMSGGLVRQKMKYL 60

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
           RFLRKRMNTKPSHGPIHFRAPS+ILWRTIRGMIPHKTKRGAAALA L+ +EGVPPPYD+ 
Sbjct: 61  RFLRKRMNTKPSHGPIHFRAPSRILWRTIRGMIPHKTKRGAAALATLRAFEGVPPPYDRK 120

Query: 425 KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLT 604
           KRMVIPDALKVLRLQ GHKYCLLG+LS EVGW+H+DTI  LE KRK +AQ +YERRKQL 
Sbjct: 121 KRMVIPDALKVLRLQPGHKYCLLGRLSKEVGWHHFDTITELEEKRKAKAQVSYERRKQLA 180

Query: 605 KLRVKAEKAAEERLGTQLDILSSVKY 682
           KLR KA + AE++L  ++++L+S+KY
Sbjct: 181 KLRSKAVELAEKQLAPEMELLASLKY 206



>sp|P93099|R13A_CYAPA 60S ribosomal protein L13a.>pir|T07166|T07166
           ribosomal protein L13a - Cyanophora
           paradoxa>gb:CPRPL13A_1648710 C.paradoxa mRNA for
           ribosomal protein L13a.
          Length = 200

 Score =  249 bits (636), Expect = 5e-65
 Identities = 120/182 (65%), Positives = 143/182 (78%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           VVVD R H+LGRLA+ LAKELLNGQRVV VR EEI +SG L R K+K+H FL+KRMNT P
Sbjct: 6   VVVDCRGHLLGRLAATLAKELLNGQRVVAVRTEEINISGSLFRNKLKFHAFLKKRMNTNP 65

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
             GP HFR+P++ILWRTIRGMIPHKT RGAAAL RLK +EGVPPPYDK+KRMVIP AL+V
Sbjct: 66  RRGPFHFRSPARILWRTIRGMIPHKTPRGAAALERLKAFEGVPPPYDKMKRMVIPQALRV 125

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE 637
           LRL+ G K+C+LG+L++EVGW H D +  LE KRK ++ A Y R+K L  LR KA  A  
Sbjct: 126 LRLKPGRKFCVLGRLATEVGWRHSDLVTRLEEKRKTKSAAFYARKKTLVNLRAKAAVAVA 185

Query: 638 ER 643
            +
Sbjct: 186 SK 187



>gb:CR859183_1183317 Pongo pygmaeus mRNA; cDNA DKFZp469O181 (from
           clone DKFZp469O181).
          Length = 203

 Score =  235 bits (600), Expect = 7e-61
 Identities = 111/192 (57%), Positives = 147/192 (76%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTSP 66

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE 637
           +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLVRLRKQAEKNVE 186

Query: 638 ERLGTQLDILSS 673
           +++    ++L +
Sbjct: 187 KKIDKYTEVLKT 198



>gb:BC004900_1969426 Homo sapiens ribosomal protein L13a, mRNA (cDNA
           clone IMAGE:3545758), partial cds.
          Length = 201

 Score =  235 bits (599), Expect = 9e-61
 Identities = 111/192 (57%), Positives = 147/192 (76%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct: 5   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 64

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct: 65  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 124

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE 637
           +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct: 125 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 184

Query: 638 ERLGTQLDILSS 673
           +++    ++L +
Sbjct: 185 KKIDKYTEVLKT 196



>pir|S29539|S29539 ribosomal protein L13a, cytosolic -
           human>gb:AB028893_1865789 Homo sapiens RPL13A, U32, U33,
           U34, U35, RPS11, U35 genes for ribosomal protein L13a
           and S11, U32, U33, U34, U35, and U35 snoRNA, complete
           cds and sequence.>gb:BC000514_1966790 Homo sapiens
           ribosomal protein L13a, mRNA (cDNA clone MGC:8547
           IMAGE:2822802), complete cds.>gb:BC001675_1967764 Homo
           sapiens ribosomal protein L13a, mRNA (cDNA clone
           MGC:2546 IMAGE:2961667), complete
           cds.>gb:BC001836_1967892 Homo sapiens ribosomal protein
           L13a, mRNA (cDNA clone MGC:4241 IMAGE:2961667), complete
           cds.>gb:BC062537_1985915 Homo sapiens ribosomal protein
           L13a, mRNA (cDNA clone MGC:71249 IMAGE:4908022),
           complete cds.>gb:BC065236_1986771 Homo sapiens ribosomal
           protein L13a, mRNA (cDNA clone MGC:70840 IMAGE:6161599),
           complete cds.>gb:BC070223_1988517 Homo sapiens ribosomal
           protein L13a, mRNA (cDNA clone MGC:88204 IMAGE:6736442),
           complete cds.>gb:BC071929_1988888 Homo sapiens ribosomal
           protein L13a, mRNA (cDNA clone MGC:88614 IMAGE:5808487),
           complete cds.>gb:HS23KDHBP_1997709 H.sapiens mRNA for 23
           kD highly basic protein.
          Length = 203

 Score =  235 bits (599), Expect = 9e-61
 Identities = 111/192 (57%), Positives = 147/192 (76%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE 637
           +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 186

Query: 638 ERLGTQLDILSS 673
           +++    ++L +
Sbjct: 187 KKIDKYTEVLKT 198



>sp|P40429|R13A_HUMAN 60S ribosomal protein L13a (23 kDa highly
           basic protein).
          Length = 202

 Score =  235 bits (599), Expect = 9e-61
 Identities = 111/192 (57%), Positives = 147/192 (76%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct: 6   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 65

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct: 66  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 125

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE 637
           +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct: 126 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 185

Query: 638 ERLGTQLDILSS 673
           +++    ++L +
Sbjct: 186 KKIDKYTEVLKT 197



>pir|A44367|A44367 tumor-specific transplantation antigen P198
           homolog p23 - bovine (fragment)
          Length = 202

 Score =  234 bits (597), Expect = 2e-60
 Identities = 111/192 (57%), Positives = 147/192 (76%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct: 6   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 65

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct: 66  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKV 125

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE 637
           +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct: 126 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNIE 185

Query: 638 ERLGTQLDILSS 673
           +++    ++L +
Sbjct: 186 KKIDKFTEVLKT 197



>gb:BC043976_2548387 Xenopus laevis ribosomal protein L13a, mRNA
           (cDNA clone MGC:54018 IMAGE:5571546), complete cds.
          Length = 231

 Score =  234 bits (596), Expect = 2e-60
 Identities = 114/200 (57%), Positives = 149/200 (74%), Gaps = 1/200 (0%)
 Frame = +2

Query: 71  SGSGICARRV-VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHR 247
           SG    AR+V ++D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  
Sbjct: 25  SGGFKNARQVLIIDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLA 84

Query: 248 FLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVK 427
           FLRKRMNT PS GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK K
Sbjct: 85  FLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRK 144

Query: 428 RMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTK 607
           RMV+P ALK++RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++K + K
Sbjct: 145 RMVVPAALKIVRLKPTRKFAFLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYNKKKIIGK 204

Query: 608 LRVKAEKAAEERLGTQLDIL 667
           LR +AEK  E ++    D+L
Sbjct: 205 LRRQAEKNVESKISKYTDVL 224



>gb:AF109186_1149801 Homo sapiens FWP004 mRNA, complete cds.
          Length = 203

 Score =  233 bits (594), Expect = 3e-60
 Identities = 110/192 (57%), Positives = 146/192 (76%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           +V+D R H+LGRL +I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct: 7   LVLDGRGHLLGRLRAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 126

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE 637
           +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 186

Query: 638 ERLGTQLDILSS 673
           +++    ++L +
Sbjct: 187 KKIDKYTEVLKT 198



>pir|A53204|A53204 ribosomal protein L13a, cytosolic [validated] -
           rat>gb:RNRPL13A_2136364 R.norvegicus mRNA for ribosomal
           protein L13a.
          Length = 203

 Score =  233 bits (593), Expect = 4e-60
 Identities = 111/192 (57%), Positives = 146/192 (76%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct: 7   LVLDGRSHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV +G+PPPYDK KRMV+P ALKV
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVVPAALKV 126

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE 637
           +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLLRLRKQAEKNVE 186

Query: 638 ERLGTQLDILSS 673
           +++    ++L +
Sbjct: 187 KKICKFTEVLKT 198



>sp|P35427|R13A_RAT 60S ribosomal protein L13a.
          Length = 202

 Score =  233 bits (593), Expect = 4e-60
 Identities = 111/192 (57%), Positives = 146/192 (76%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct: 6   LVLDGRSHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 65

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV +G+PPPYDK KRMV+P ALKV
Sbjct: 66  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVVPAALKV 125

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE 637
           +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct: 126 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLLRLRKQAEKNVE 185

Query: 638 ERLGTQLDILSS 673
           +++    ++L +
Sbjct: 186 KKICKFTEVLKT 197



>gb:BC086382_2109571 Rattus norvegicus ribosomal protein L13A, mRNA
           (cDNA clone MGC:105295 IMAGE:7301486), complete cds.
          Length = 203

 Score =  232 bits (592), Expect = 6e-60
 Identities = 111/192 (57%), Positives = 146/192 (76%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV +G+PPPYDK KRMV+P ALKV
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVVPAALKV 126

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE 637
           +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLLRLRKQAEKNVE 186

Query: 638 ERLGTQLDILSS 673
           +++    ++L +
Sbjct: 187 KKICKFTEVLKT 198



>gb:AK007609_1154084 Mus musculus 10 day old male pancreas cDNA,
           RIKEN full-length enriched library, clone:1810026N22
           product:ribosomal protein L13a, full insert
           sequence.>gb:BC082289_2108356 Mus musculus ribosomal
           protein L13a, mRNA (cDNA clone MGC:102485
           IMAGE:6486177), complete cds.>gb:BC086896_2109828 Mus
           musculus ribosomal protein L13a, mRNA (cDNA clone
           MGC:107571 IMAGE:6776320), complete
           cds.>gb:BC086250_2564826 Xenopus laevis hypothetical
           LOC495818, mRNA (cDNA clone MGC:98767 IMAGE:7201534),
           complete cds.
          Length = 203

 Score =  231 bits (590), Expect = 1e-59
 Identities = 110/192 (57%), Positives = 146/192 (76%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV +G+PPPYDK KRMV+P ALKV
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVVPAALKV 126

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE 637
           +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQ+ +LR +AEK  E
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQILRLRKQAEKNVE 186

Query: 638 ERLGTQLDILSS 673
           +++    ++L +
Sbjct: 187 KKICKFTEVLKT 198



>pir|JL0149|JL0149 transplantation antigen P198 -
           mouse>gb:MMTUM198_2117835 Mouse gene for tum-
           transplantation antigen P198.
          Length = 203

 Score =  231 bits (590), Expect = 1e-59
 Identities = 110/192 (57%), Positives = 146/192 (76%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV +G+PPPYDK KRMV+P ALKV
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVVPAALKV 126

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE 637
           +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQ+ +LR +AEK  E
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTTTLEEKRKEKAKMHYRKKKQILRLRKQAEKNVE 186

Query: 638 ERLGTQLDILSS 673
           +++    ++L +
Sbjct: 187 KKICKFTEVLKT 198



>sp|P19253|R13A_MOUSE 60S ribosomal protein L13a (Transplantation
           antigen P198) (Tum-P198 antigen).
          Length = 202

 Score =  231 bits (590), Expect = 1e-59
 Identities = 110/192 (57%), Positives = 146/192 (76%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct: 6   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 65

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV +G+PPPYDK KRMV+P ALKV
Sbjct: 66  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVVPAALKV 125

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE 637
           +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQ+ +LR +AEK  E
Sbjct: 126 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQILRLRKQAEKNVE 185

Query: 638 ERLGTQLDILSS 673
           +++    ++L +
Sbjct: 186 KKICKFTEVLKT 197



>gb:AC120509_1739837 Oryza sativa chromosome 3 BAC OSJNBb0081K01
           genomic sequence, complete sequence.
          Length = 172

 Score =  228 bits (581), Expect = 1e-58
 Identities = 114/160 (71%), Positives = 125/160 (78%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH 244
           MVSGSG+CA RVVVDARHHML RLASI+AKELLNG+RVV                     
Sbjct: 1   MVSGSGVCAPRVVVDARHHMLSRLASIIAKELLNGKRVV--------------------- 39

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
                RMNTKPSHGPIHFR+P+KILWRT+RGMIPHKTKRG AALARLK YE V PPYD+ 
Sbjct: 40  -----RMNTKPSHGPIHFRSPAKILWRTVRGMIPHKTKRGEAALARLKAYEVVTPPYDRT 94

Query: 425 KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKV 544
           KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN+YDTI++
Sbjct: 95  KRMVIPDALKVLRLQPGHKYCLLGQLSKEVGWNYYDTIRI 134



>gb:AL356120_1924258 Human DNA sequence from clone RP11-365K22 on
           chromosome 13 Contains a novel gene similar to ribosomal
           protein L13a (RPL13A), complete sequence.
          Length = 203

 Score =  228 bits (580), Expect = 1e-58
 Identities = 108/192 (56%), Positives = 144/192 (75%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           +V+D R H+LGRLA+I+AK++L G++VVVV CE I +SG   R K+ Y  FLRKRMNT P
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVCCEGINISGNFYRNKLNYLAFLRKRMNTSP 66

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           S GP HFRAPS++ WRT+RGM+PHKTKRG AAL RLKV +G+PPPYDK KRMV+P ALKV
Sbjct: 67  SRGPYHFRAPSRVFWRTVRGMLPHKTKRGQAALDRLKVSDGIPPPYDKKKRMVVPAALKV 126

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE 637
           +RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E
Sbjct: 127 VRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVE 186

Query: 638 ERLGTQLDILSS 673
           +++    ++L +
Sbjct: 187 KKIDKYTEVLKT 198



>gb:BC047855_2549938 Danio rerio ribosomal protein L13a, mRNA (cDNA
           clone MGC:56275 IMAGE:5602342), complete cds.
          Length = 205

 Score =  226 bits (577), Expect = 3e-58
 Identities = 106/190 (55%), Positives = 141/190 (74%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           +++D R H+LGRL++I+AK++L G ++VVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct: 9   LIIDGRGHLLGRLSAIVAKQVLLGHKIVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 68

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           S G  HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALK+
Sbjct: 69  SRGSYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKRKRMVVPAALKI 128

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE 637
           +RL+   K+ LLG+L+ EVGW +      LE KRKE+A+  Y ++K   KL  +AEK  E
Sbjct: 129 VRLKPTRKFALLGRLAHEVGWKYQAITATLEEKRKEKAKLRYSKKKVEMKLTKQAEKNVE 188

Query: 638 ERLGTQLDIL 667
            ++    D+L
Sbjct: 189 SKIAVYTDVL 198



>gb:AF401568_2491995 Ictalurus punctatus ribosomal protein L13a
           mRNA, partial cds.
          Length = 201

 Score =  224 bits (571), Expect = 2e-57
 Identities = 106/190 (55%), Positives = 141/190 (74%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           +V+D R H+LGRL++I+AK++L G +VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct: 5   LVIDGRGHLLGRLSAIVAKQVLLGHKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 64

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KR+V+P ALK+
Sbjct: 65  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRVVVPAALKI 124

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE 637
           +RL+   K+ LLG+L+ EVGW +      LE  RKE+A+  Y+++K   KL  +AEK   
Sbjct: 125 VRLKPTRKFALLGRLAHEVGWKYQAITGTLEEARKEKAKMYYKKKKVQIKLTKQAEKNVA 184

Query: 638 ERLGTQLDIL 667
            ++    D+L
Sbjct: 185 SKIAKYTDVL 194



>sp|Q9P720|RL16_NEUCR 60S ribosomal protein L16.>pir|T48746|T48746
           probable ribosomal protein l13a [imported] - Neurospora
           crassa>gb:NC8D4_1688779 Neurospora crassa DNA linkage
           group V Cosmid contig 8D4.
          Length = 202

 Score =  223 bits (569), Expect = 3e-57
 Identities = 106/181 (58%), Positives = 139/181 (76%), Gaps = 1/181 (0%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           VV+D + H+LGRLASI+AK+LLNGQ++VVVRCE + +SG   R K+KYH +LRK     P
Sbjct: 8   VVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHSYLRKMTRYNP 67

Query: 278 SHG-PIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALK 454
           + G P HFRAPS+I ++ +RGMIPHKT RGAAAL RLKV+EGVPPPYDK K+MV+P AL+
Sbjct: 68  TRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKMVVPQALR 127

Query: 455 VLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAA 634
           VLRLQ G K+C +G+LSSEVGW + D +  LE +RK +  A YER+K   +   +A+K+A
Sbjct: 128 VLRLQPGRKFCTVGRLSSEVGWKYEDVVSRLEERRKAKGAAYYERKKVAARQLSEAKKSA 187

Query: 635 E 637
           +
Sbjct: 188 K 188



>gb:AE017353_1760163 Cryptococcus neoformans var. neoformans JEC21
           chromosome 13, complete sequence.
          Length = 199

 Score =  222 bits (565), Expect = 8e-57
 Identities = 106/187 (56%), Positives = 141/187 (75%), Gaps = 1/187 (0%)
 Frame = +2

Query: 77  SGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLR 256
           S   A+ +V+D + H+LGRLAS++AK++L GQ+V VVRCEEI +SG   R K+KYH +L 
Sbjct: 2   SAFSAQPIVIDGKGHLLGRLASVVAKQILTGQKVTVVRCEEINISGSFFRNKVKYHNYLH 61

Query: 257 KRMNTKP-SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRM 433
           KR    P   GP HFRAPS+IL++ IRGMIPHK+ RGAAAL RL++YEGVPP  D+VK+M
Sbjct: 62  KRHIVNPRKSGPFHFRAPSRILYKAIRGMIPHKSSRGAAALKRLELYEGVPPAQDRVKKM 121

Query: 434 VIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLR 613
           V+P AL+VLRL+ G KYC + ++S+EVGWN+ D +  LE KRK + QA +ER++   KLR
Sbjct: 122 VVPAALRVLRLKPGRKYCTVKRISAEVGWNYKDVVDRLEEKRKVKGQAYFERKQAALKLR 181

Query: 614 VKAEKAA 634
            KAE +A
Sbjct: 182 AKAEASA 188



>sp|Q91487|R13A_SALTR 60S ribosomal protein L13a (Transplantation
           antigen P198 homolog) (Fragment).>gb:STU18488_2580369
           Salmo trutta transplantation antigen mRNA, partial cds.
          Length = 189

 Score =  220 bits (560), Expect = 3e-56
 Identities = 107/182 (58%), Positives = 134/182 (73%)
 Frame = +2

Query: 122 MLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFR 301
           +LGRLA+I+A E+L G +VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFR
Sbjct: 1   LLGRLAAIVANEVLLGHKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFR 60

Query: 302 APSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHK 481
           APS+I WRT+RGM+PHKTKRG AAL RLKV++GVPPPYDK KRMV+P ALK++RL+   K
Sbjct: 61  APSRIFWRTVRGMLPHKTKRGQAALERLKVFDGVPPPYDKRKRMVVPAALKIVRLKPTRK 120

Query: 482 YCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLD 661
           + LLG+L+ EVGW +      LE KRKE+A+  Y ++K +TKL   AEK  E  +     
Sbjct: 121 FALLGRLAHEVGWKYQAITATLEEKRKEKAKIRYAKKKTVTKLSKLAEKNVESTISKYTA 180

Query: 662 IL 667
           +L
Sbjct: 181 VL 182



>gb:AF178537_1774715 Aspergillus nidulans ribosomal protein L16a
           (rpl16a) gene, complete cds.
          Length = 202

 Score =  219 bits (557), Expect = 7e-56
 Identities = 104/180 (57%), Positives = 136/180 (75%), Gaps = 1/180 (0%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           VV+D + H+LGRLAS +AK+LLNGQ++VVVRCE + +SG   R K+KYH +LRK     P
Sbjct: 8   VVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKITRYNP 67

Query: 278 SHG-PIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALK 454
           + G P HFRAPS+I ++ +RGMIPHKT RGAAAL RLKV+EGVPPPYDK KR+V+P AL+
Sbjct: 68  TRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKRVVVPQALR 127

Query: 455 VLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAA 634
           VLRL+ G KYC +G+LS EVGW + D +  LE +RK ++ A YER+K   +    A+K+A
Sbjct: 128 VLRLRPGRKYCTVGRLSHEVGWKYQDVVARLEERRKVKSSAYYERKKAARRQLAHAQKSA 187



>gb:AY232073_1177366 Drosophila yakuba clone yak-ad_CG1475 mRNA
           sequence.
          Length = 200

 Score =  217 bits (552), Expect = 2e-55
 Identities = 105/191 (54%), Positives = 141/191 (73%), Gaps = 4/191 (2%)
 Frame = +2

Query: 77  SGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLR 256
           +G+  R VV+D R H+LGRLAS++AK LL G +V VVRCEE+ LSG   R K+K+  +LR
Sbjct: 2   TGLTNRTVVIDGRGHLLGRLASVVAKYLLQGGKVAVVRCEELNLSGHFYRNKIKFLAYLR 61

Query: 257 KRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMV 436
           KR N  P+ GP HFRAPS+I ++ +RGMIPHKTKRG AALARL+V++G+P PYDK +R+V
Sbjct: 62  KRCNVNPARGPFHFRAPSRIFYKAVRGMIPHKTKRGQAALARLRVFDGIPSPYDKRRRVV 121

Query: 437 IPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRV 616
           +P A++VL L++  KYC +G+LS EVGW++ D IK LE KRK + +   +  ++L KL V
Sbjct: 122 VPIAMRVLTLRSDRKYCQVGRLSHEVGWHYQDVIKSLERKRKAKLRVTLKHNRELKKLTV 181

Query: 617 KAE----KAAE 637
           KA     KAAE
Sbjct: 182 KARENIAKAAE 192



>sp|Q9VNE9|R13A_DROME 60S ribosomal protein
           L13A.>gb:AE014297_1138030 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003602_1217418
           Drosophila melanogaster chromosome 3R, section 6 of 118
           of the complete sequence.>gb:AY051640_1290234 Drosophila
           melanogaster GM13948 full length cDNA.
          Length = 205

 Score =  217 bits (552), Expect = 2e-55
 Identities = 105/191 (54%), Positives = 141/191 (73%), Gaps = 4/191 (2%)
 Frame = +2

Query: 77  SGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLR 256
           +G+  R VV+D R H+LGRLAS++AK LL G +V VVRCEE+ LSG   R K+K+  +LR
Sbjct: 2   TGLTNRTVVIDGRGHLLGRLASVVAKYLLQGGKVAVVRCEELNLSGHFYRNKIKFLAYLR 61

Query: 257 KRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMV 436
           KR N  P+ GP HFRAPS+I ++ +RGMIPHKTKRG AALARL+V++G+P PYDK +R+V
Sbjct: 62  KRCNVNPARGPFHFRAPSRIFYKAVRGMIPHKTKRGQAALARLRVFDGIPSPYDKRRRVV 121

Query: 437 IPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRV 616
           +P A++VL L++  KYC +G+LS EVGW++ D IK LE KRK + +   +  ++L KL V
Sbjct: 122 VPIAMRVLTLRSDRKYCQVGRLSHEVGWHYQDVIKSLERKRKAKLRVTLKHNRELKKLTV 181

Query: 617 KAE----KAAE 637
           KA     KAAE
Sbjct: 182 KARENIAKAAE 192



>gb:XDE291822_1727809 Xanthophyllomyces dendrorhous mRNA for
           Ribosomal protein L13A (rpL13A gene).
          Length = 199

 Score =  216 bits (550), Expect = 4e-55
 Identities = 104/182 (57%), Positives = 133/182 (73%), Gaps = 1/182 (0%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           ++VD + H+LGRLASILAK++LNGQ+V VVRCEEI +SG   R K++YH +L KR    P
Sbjct: 9   IIVDGKAHLLGRLASILAKQILNGQKVTVVRCEEINISGSFFRNKLRYHNYLHKRHLVNP 68

Query: 278 SH-GPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALK 454
              GP H RAPS+IL++ IRGM+ HKT RG AAL RLK+YEG+PPPYD+ K+MV+P AL+
Sbjct: 69  KKSGPFHHRAPSRILYKAIRGMVAHKTSRGKAALERLKLYEGMPPPYDRKKKMVVPQALR 128

Query: 455 VLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAA 634
           VLRL+ G KYC L +LS EVGW + D +  LE KRK +A A +ER+    KLR KA  + 
Sbjct: 129 VLRLKPGRKYCTLKRLSHEVGWGYKDIVDTLEEKRKVKAVAYHERKTAAVKLRTKAAASL 188

Query: 635 EE 640
            E
Sbjct: 189 PE 190



>sp|Q962U0|R13A_SPOFR 60S ribosomal protein
           L13A.>gb:AF400184_1268283 Spodoptera frugiperda
           ribosomal protein L13A mRNA, complete cds.
          Length = 204

 Score =  213 bits (542), Expect = 4e-54
 Identities = 100/180 (55%), Positives = 136/180 (75%), Gaps = 3/180 (1%)
 Frame = +2

Query: 77  SGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLR 256
           +G   + +V+D R H+LGRLA+++AK LL G +VVVVRCE+I +SG   R K+K+  FLR
Sbjct: 2   TGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKFMSFLR 61

Query: 257 KRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMV 436
           KR N  P+ GP HFRAPSKILW+T+RGMIPHKT+RG +AL RL+ Y+G PPPYD  +R+V
Sbjct: 62  KRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKSALRRLRAYDGCPPPYDNRRRVV 121

Query: 437 IPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERA--QAAYERR-KQLTK 607
           +P AL+V  L+ G KYC +G+LS EVGW + D ++ LENKRK ++    AYE++ K++TK
Sbjct: 122 VPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLENKRKVKSVKLMAYEKKLKRITK 181



>pir|S53911|S53911 ribosomal protein L16.e.B, cytosolic - yeast
           (Saccharomyces cerevisiae)>gb:SC23CDS_1705073
           S.cerevisiae PMS1, TPM1, MKS1, YMK1, MSK1, ODP2, YL9A &
           FKH2 genes.>gb:SCYNL069C_1713665 S.cerevisiae chromosome
           XIV reading frame ORF YNL069c.
          Length = 198

 Score =  211 bits (537), Expect = 1e-53
 Identities = 101/181 (55%), Positives = 132/181 (72%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           VV+DA+ H+LGRLAS +AK++LNGQ++VVVR E + +SG   R K+KYH FLRK      
Sbjct: 6   VVIDAKDHLLGRLASTIAKQVLNGQKIVVVRAEALNISGEFFRNKLKYHDFLRKATAFNK 65

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           + GP HFRAPS+IL++ IRGM+ HKT RG AAL RLK++EG+PPPYDK KR+V+P AL+V
Sbjct: 66  TRGPFHFRAPSRILYKAIRGMVSHKTARGKAALERLKIFEGIPPPYDKKKRVVVPQALRV 125

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE 637
           LRL+ G KY  LGKLS+ VGW + D +  LE+KRK R+   Y +++  TK    A  AA 
Sbjct: 126 LRLKPGRKYTTLGKLSTSVGWKYEDVVAKLEDKRKVRSAEYYAKKRAFTKKVSSASAAAS 185

Query: 638 E 640
           E
Sbjct: 186 E 186



>sp|P26785|R16B_YEAST 60S ribosomal protein L16-B (YL15) (RP23).
          Length = 197

 Score =  211 bits (537), Expect = 1e-53
 Identities = 101/181 (55%), Positives = 132/181 (72%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           VV+DA+ H+LGRLAS +AK++LNGQ++VVVR E + +SG   R K+KYH FLRK      
Sbjct: 5   VVIDAKDHLLGRLASTIAKQVLNGQKIVVVRAEALNISGEFFRNKLKYHDFLRKATAFNK 64

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           + GP HFRAPS+IL++ IRGM+ HKT RG AAL RLK++EG+PPPYDK KR+V+P AL+V
Sbjct: 65  TRGPFHFRAPSRILYKAIRGMVSHKTARGKAALERLKIFEGIPPPYDKKKRVVVPQALRV 124

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE 637
           LRL+ G KY  LGKLS+ VGW + D +  LE+KRK R+   Y +++  TK    A  AA 
Sbjct: 125 LRLKPGRKYTTLGKLSTSVGWKYEDVVAKLEDKRKVRSAEYYAKKRAFTKKVSSASAAAS 184

Query: 638 E 640
           E
Sbjct: 185 E 185



>sp|Q8MUR4|R13A_CHOPR 60S ribosomal protein
           L13A.>gb:AF514334_1278634 Choristoneura parallela
           ribosomal protein L13A mRNA, complete cds.
          Length = 204

 Score =  210 bits (535), Expect = 2e-53
 Identities = 99/180 (55%), Positives = 136/180 (75%), Gaps = 3/180 (1%)
 Frame = +2

Query: 77  SGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLR 256
           +G   + +V+D R H+LGRLA+++AK LL G +VVVVRCE++ +SG   R K+K+  FLR
Sbjct: 2   TGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFLR 61

Query: 257 KRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMV 436
           KR N  P+ GP HFRAPSKILW+T+RGMIPHKT+RG  AL RL+ Y+G PPPYD  +R+V
Sbjct: 62  KRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLRSYDGCPPPYDNRRRVV 121

Query: 437 IPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERA--QAAYERR-KQLTK 607
           +P AL+V  L+ G KYC +G+LS EVGW + + ++ LE+KRK +A  + AYER+ K++TK
Sbjct: 122 VPAALRVFCLKPGRKYCHVGRLSHEVGWKYREVVRKLEDKRKFKAVHKVAYERKLKKITK 181



>gb:CR382133_1666870 Debaryomyces hansenii chromosome A of strain
           CBS767 of Debaryomyces hansenii.
          Length = 200

 Score =  207 bits (528), Expect = 2e-52
 Identities = 101/179 (56%), Positives = 131/179 (73%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           VV+D + H+LGRLASI+AK+LLNGQ++ VVRCE + +SG   R K+KYH +LRK      
Sbjct: 8   VVIDGKGHLLGRLASIVAKQLLNGQKITVVRCEAMNISGEFFRNKLKYHDYLRKATRYNK 67

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           + GP HFRAPS+I ++ IRGM+PHKT RG AAL RLKV+EGVPPPYDK KR+V+P AL++
Sbjct: 68  TKGPFHFRAPSRIFYKAIRGMMPHKTARGKAALERLKVFEGVPPPYDKKKRVVVPQALRI 127

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAA 634
           LRL+ G KY  +G+LSS VGW +   +  LE KRK +    Y ++K L K +V A KAA
Sbjct: 128 LRLKPGRKYTTVGRLSSAVGWKYESVVDKLEEKRKLQNAEYYAKKKALAK-KVNAAKAA 185



>gb:AY769283_1350434 Bombyx mori ribosomal protein L13A (RpL13A)
           mRNA, complete cds.
          Length = 204

 Score =  207 bits (527), Expect = 2e-52
 Identities = 97/180 (53%), Positives = 134/180 (74%), Gaps = 3/180 (1%)
 Frame = +2

Query: 77  SGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLR 256
           +G   + +V+D R H+LGRLA+++AK LL G +VVVVRCE+I +SG   R K+K   FLR
Sbjct: 2   TGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLR 61

Query: 257 KRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMV 436
           KR N  P+ GP HFRAPSKILW+T+RGMIPHKT+RG  AL RL+ Y+G PPP+D  +R+V
Sbjct: 62  KRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKNALRRLRTYDGCPPPFDNRRRVV 121

Query: 437 IPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERA--QAAYERR-KQLTK 607
           +P AL+V  L+ G  YC +G+LS E+GW + D ++ LE+KRK +A  + AYE++ K++TK
Sbjct: 122 VPAALRVFCLKPGRNYCHVGRLSHEIGWKYRDVVRKLEDKRKGKAVKRVAYEKKLKRITK 181



>gb:AY752827_1179970 Culicoides sonorensis clone CsRPL13 ribosomal
           protein L13 mRNA, partial cds.
          Length = 212

 Score =  206 bits (525), Expect = 3e-52
 Identities = 96/202 (47%), Positives = 141/202 (69%)
 Frame = +2

Query: 77  SGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLR 256
           +G   + +V+D R H+LGRLAS++AK+LLNG  VVVVRCE++  SG   R K+K+  +LR
Sbjct: 5   TGFTNKAIVIDGRGHLLGRLASVIAKQLLNGDHVVVVRCEDLQQSGHFFRNKIKFLSYLR 64

Query: 257 KRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMV 436
           KR N  P+ GP HFRAPS++L++ ++GM+PH+T+RG  AL RLKV+EG PPPYD VKR+ 
Sbjct: 65  KRCNVNPARGPFHFRAPSRMLYKAVKGMVPHQTQRGKNALKRLKVFEGCPPPYDNVKRLC 124

Query: 437 IPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRV 616
           +P A+KVL L++  K+C +G+++ EVGW + D +  LE KRK +++ AY  +K+L  L  
Sbjct: 125 VPIAMKVLCLRSDRKFCKVGRVAHEVGWQYKDVVANLEAKRKIKSRLAYLHKKKLKTLTR 184

Query: 617 KAEKAAEERLGTQLDILSSVKY 682
           KA     +++  Q  +L    Y
Sbjct: 185 KARTTIAKKIEPQNAVLKQYGY 206



>pir|S48401|S48401 ribosomal protein L16.e.A, cytosolic - yeast
           (Saccharomyces cerevisiae)>gb:SC4357_1705278
           S.cerevisiae chromosome IX lambda clones 4357-3717.
          Length = 199

 Score =  206 bits (525), Expect = 3e-52
 Identities = 102/191 (53%), Positives = 134/191 (70%), Gaps = 1/191 (0%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           VV+D + H++GRLAS++AK+LLNGQ++VVVR EE+ +SG   R K+KYH FLRK      
Sbjct: 7   VVIDGKGHLVGRLASVVAKQLLNGQKIVVVRAEELNISGEFFRNKLKYHDFLRKATAFNK 66

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           + GP HFRAPS+I ++ +RGM+ HKT RG AAL RLKV+EG+PPPYDK KR+V+P AL+V
Sbjct: 67  TRGPFHFRAPSRIFYKALRGMVSHKTARGKAALERLKVFEGIPPPYDKKKRVVVPQALRV 126

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAE-KAA 634
           LRL+ G KY  LGKLS+ VGW + D +  LE KRK  +   Y +++  TK    A   AA
Sbjct: 127 LRLKPGRKYTTLGKLSTSVGWKYEDVVAKLEAKRKVSSAEYYAKKRAFTKKVASANATAA 186

Query: 635 EERLGTQLDIL 667
           E  +  QL  L
Sbjct: 187 ESDVAKQLAAL 197



>sp|P26784|R16A_YEAST 60S ribosomal protein L16-A (L13A) (RP22).
          Length = 198

 Score =  206 bits (525), Expect = 3e-52
 Identities = 102/191 (53%), Positives = 134/191 (70%), Gaps = 1/191 (0%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           VV+D + H++GRLAS++AK+LLNGQ++VVVR EE+ +SG   R K+KYH FLRK      
Sbjct: 6   VVIDGKGHLVGRLASVVAKQLLNGQKIVVVRAEELNISGEFFRNKLKYHDFLRKATAFNK 65

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           + GP HFRAPS+I ++ +RGM+ HKT RG AAL RLKV+EG+PPPYDK KR+V+P AL+V
Sbjct: 66  TRGPFHFRAPSRIFYKALRGMVSHKTARGKAALERLKVFEGIPPPYDKKKRVVVPQALRV 125

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAE-KAA 634
           LRL+ G KY  LGKLS+ VGW + D +  LE KRK  +   Y +++  TK    A   AA
Sbjct: 126 LRLKPGRKYTTLGKLSTSVGWKYEDVVAKLEAKRKVSSAEYYAKKRAFTKKVASANATAA 185

Query: 635 EERLGTQLDIL 667
           E  +  QL  L
Sbjct: 186 ESDVAKQLAAL 196



>gb:CR380956_1652429 Candida glabrata strain CBS138 chromosome J
           complete sequence.
          Length = 200

 Score =  206 bits (524), Expect = 4e-52
 Identities = 100/181 (55%), Positives = 130/181 (71%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           VV+DA+ H++GRLASI+AK+LLNGQ++VVVR E + +SG   R K+KYH FLRK      
Sbjct: 8   VVIDAKGHLVGRLASIVAKQLLNGQKIVVVRAEALNISGEFFRNKLKYHDFLRKATAFNK 67

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           + GP HFRAPS+I ++ +RGMI HKT RG AAL RLKV+EGVPPPYDK KR+V+P+AL+V
Sbjct: 68  TRGPFHFRAPSRIFYKAVRGMISHKTARGKAALERLKVFEGVPPPYDKKKRVVVPEALRV 127

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE 637
           LRL+ G KY  L KLS+ VGW + D +  LE KRK R+   Y +++   K    A  +A 
Sbjct: 128 LRLKPGRKYTTLAKLSTSVGWKYEDVVAKLEEKRKVRSAEYYAKKRAFNKKVTAATASAA 187

Query: 638 E 640
           E
Sbjct: 188 E 188



>gb:CR382129_1661690 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 200

 Score =  205 bits (522), Expect = 8e-52
 Identities = 97/178 (54%), Positives = 130/178 (73%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           VV+D + H+LGRLAS +AK++L+GQ +VVVRCE + +S    R K+KY  +LRK      
Sbjct: 8   VVIDGKGHLLGRLASTVAKQILDGQNIVVVRCEALNISQEFFRSKLKYAAYLRKATRFNR 67

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           +HGP HFRAPS+I ++ +RGMIPHKT RG AAL RLKV+EG+PPPYDK KRMV+P AL+V
Sbjct: 68  THGPFHFRAPSRIFYKAVRGMIPHKTARGKAALERLKVFEGIPPPYDKKKRMVVPQALRV 127

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKA 631
           LRL+ G KYC +G++S E GW + D +  LE KRK ++ A Y ++  L+K + KA  A
Sbjct: 128 LRLKPGRKYCTVGRVSHEFGWKYQDVVANLEEKRKVKSAAYYAKKSALSK-KTKAAHA 184



>gb:AE016818_1748511 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 200

 Score =  203 bits (517), Expect = 3e-51
 Identities = 98/189 (51%), Positives = 134/189 (70%), Gaps = 2/189 (1%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           V++D + H+LGRLAS +AK+LLNGQ++VVVR E + +SG L R K+KYH +LRK      
Sbjct: 7   VIIDGKGHLLGRLASTVAKQLLNGQQIVVVRAESLNVSGELFRNKLKYHDYLRKATRFNK 66

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           + GP HFRAPS+I ++ +RGM+ HKT RG AA+ RLKV+EGVPPPYDK+KR+V+P AL+V
Sbjct: 67  TRGPFHFRAPSRIFYKAVRGMVAHKTARGKAAMERLKVFEGVPPPYDKLKRVVVPQALRV 126

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTK--LRVKAEKA 631
           LRL+ G K+  LGKLSS VGW + + +  LE KRK R+   Y +++   K    VKA+  
Sbjct: 127 LRLKPGRKFTTLGKLSSTVGWKYENVVAKLEEKRKVRSAEYYSKKRAFNKTAAAVKAKYD 186

Query: 632 AEERLGTQL 658
           A+  +   L
Sbjct: 187 AKSEIAEDL 195



>gb:AB016008_1512747 Schizosaccharomyces pombe mRNA for ribosomal
           protein rp22 homolog, partial cds.
          Length = 193

 Score =  202 bits (514), Expect = 6e-51
 Identities = 96/179 (53%), Positives = 130/179 (72%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           VV+DA+ H+LGRLAS++AK+LL GQ+VVVVRCEE+ +SG   R K+KY  +LRK     P
Sbjct: 4   VVIDAKGHLLGRLASVVAKQLLGGQKVVVVRCEELNISGHFFRNKLKYLAYLRKACRYNP 63

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           S G  HFRAPS+I  + +RGM+PHKT RG AAL  L+  EG+PPP+DK KR+V+P AL+V
Sbjct: 64  SRGAFHFRAPSRIFQKAVRGMLPHKTARGQAALEHLQAVEGIPPPFDKQKRVVVPAALRV 123

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAA 634
           LRL+ G KYC +G+LSSEVGW + D +  LE +RK ++ A Y+ +    K    A++A+
Sbjct: 124 LRLKPGRKYCTVGRLSSEVGWKYNDIVAKLEERRKVKSAAFYQAKLAKQKKIASAKEAS 182



>pir|T43381|T43381 ribosomal protein L13/L16 - fission yeast
           (Schizosaccharomyces pombe) (fragment)
          Length = 193

 Score =  202 bits (514), Expect = 6e-51
 Identities = 96/179 (53%), Positives = 130/179 (72%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           VV+DA+ H+LGRLAS++AK+LL GQ+VVVVRCEE+ +SG   R K+KY  +LRK     P
Sbjct: 4   VVIDAKGHLLGRLASVVAKQLLGGQKVVVVRCEELNISGHFFRNKLKYLAYLRKACRYNP 63

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           S G  HFRAPS+I  + +RGM+PHKT RG AAL  L+  EG+PPP+DK KR+V+P AL+V
Sbjct: 64  SRGAFHFRAPSRIFQKAVRGMLPHKTARGQAALEHLQAVEGIPPPFDKQKRVVVPAALRV 123

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAA 634
           LRL+ G KYC +G+LSSEVGW + D +  LE +RK ++ A Y+ +    K    A++A+
Sbjct: 124 LRLKPGRKYCTVGRLSSEVGWKYNDIVAKLEERRKVKSAAFYQAKLAKQKKIASAKEAS 182



>sp|O42991|R16B_SCHPO 60S ribosomal protein L16-B.>pir|T40720|T40720
           ribosomal protein L13/L16 - fission yeast
           (Schizosaccharomyces pombe)>gb:SPBC839_1720468 S.pombe
           chromosome II cosmid c839.
          Length = 197

 Score =  202 bits (514), Expect = 6e-51
 Identities = 96/179 (53%), Positives = 130/179 (72%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           VV+DA+ H+LGRLAS++AK+LL GQ+VVVVRCEE+ +SG   R K+KY  +LRK     P
Sbjct: 8   VVIDAKGHLLGRLASVVAKQLLGGQKVVVVRCEELNISGHFFRNKLKYLAYLRKACRYNP 67

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           S G  HFRAPS+I  + +RGM+PHKT RG AAL  L+  EG+PPP+DK KR+V+P AL+V
Sbjct: 68  SRGAFHFRAPSRIFQKAVRGMLPHKTARGQAALEHLQAVEGIPPPFDKQKRVVVPAALRV 127

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAA 634
           LRL+ G KYC +G+LSSEVGW + D +  LE +RK ++ A Y+ +    K    A++A+
Sbjct: 128 LRLKPGRKYCTVGRLSSEVGWKYNDIVAKLEERRKVKSAAFYQAKLAKQKKIASAKEAS 186



>sp|O42848|R16A_SCHPO 60S ribosomal protein L16-A.>pir|T38231|T38231
           ribosomal protein L16-A - fission yeast
           (Schizosaccharomyces pombe)>gb:SPAC23A1_1717245 S.pombe
           chromosome I cosmid c23A1.
          Length = 197

 Score =  202 bits (514), Expect = 6e-51
 Identities = 97/179 (54%), Positives = 131/179 (73%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           VV+DA+ H+LGRLAS++AK+LL GQ+VVVVRCEE+ +SG   R K+KY  +LRK     P
Sbjct: 8   VVIDAKGHLLGRLASVVAKQLLGGQKVVVVRCEELNISGHFFRNKLKYLAYLRKACRYNP 67

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           S G  HFRAPS+I  + +RGM+PHKT RG AAL  L+  EG+PPP+DK KR+V+P AL+V
Sbjct: 68  SRGAFHFRAPSRIFQKAVRGMLPHKTARGQAALEHLQAVEGIPPPFDKQKRVVVPAALRV 127

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAA 634
           LRL+ G KYC +G+LSSEVGW + D +  LE +RK ++ A Y+ +    K ++ + KAA
Sbjct: 128 LRLKPGRKYCTVGRLSSEVGWKYSDIVSKLEERRKVKSAAFYQAKLAKQK-KIASAKAA 185



>gb:CR382126_1658555 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 199

 Score =  202 bits (513), Expect = 8e-51
 Identities = 102/187 (54%), Positives = 133/187 (71%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           VV+D + H+LGRLAS +AK+LLNGQ++VVVR E + +SG   R K+KYH +LRK      
Sbjct: 8   VVIDGKGHLLGRLASTVAKQLLNGQKIVVVRAEALNISGEFFRNKLKYHDYLRKATAFNK 67

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           + GP HFRAPS+I ++ +RGMI HKT RG AAL RLKV+EGVPPPYDK KR+V+P AL+V
Sbjct: 68  TRGPFHFRAPSRIFYKAVRGMISHKTARGKAALERLKVFEGVPPPYDKKKRVVVPQALRV 127

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAE 637
           LRL+ G KY  LGKLS+ VGW + D +  LE KRK R+   Y ++K      V A K+A 
Sbjct: 128 LRLKPGRKYTTLGKLSTSVGWKYEDVVAKLEEKRKARSAEYYLKKKAYN--AVVANKSA- 184

Query: 638 ERLGTQL 658
             +GT++
Sbjct: 185 -TVGTEV 190



>sp|Q27389|R13A_CAEEL 60S ribosomal protein L13a.>pir|T23654|T23654
           hypothetical protein M01F1.2 - Caenorhabditis
           elegans>gb:CEM01F1_1366125 Caenorhabditis elegans cosmid
           M01F1, complete sequence.>gb:CEU31528_1368489
           Caenorhabditis elegans 60S ribosomal protein L13A mRNA,
           complete cds.
          Length = 202

 Score =  202 bits (513), Expect = 8e-51
 Identities = 97/201 (48%), Positives = 135/201 (67%)
 Frame = +2

Query: 80  GICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRK 259
           G+  R +++D ++H+LGRLASI+AK+LL G +VVV+R EEI +SG   R K+KY  FLRK
Sbjct: 2   GLSNRAIIIDGKNHLLGRLASIVAKKLLQGDKVVVLRAEEIVISGNFHRSKLKYMSFLRK 61

Query: 260 RMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVI 439
           R N  P+ G  H+RAP KI WRT+RGM+PHKT RG  AL  L+ YEGVP  Y K K +  
Sbjct: 62  RCNINPARGAFHYRAPGKIFWRTVRGMLPHKTNRGNEALKNLRAYEGVPAKYQKTKSLHA 121

Query: 440 PDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVK 619
           P A +  RLQ   K+C++G+LS EVGW   D +  LE KRK +  A +E++K++ KL V+
Sbjct: 122 PSASR-FRLQPRRKFCVVGRLSHEVGWQFQDVVAKLEAKRKVKGAAYFEQKKKMDKLAVQ 180

Query: 620 AEKAAEERLGTQLDILSSVKY 682
           A+K A  ++     I+ ++ Y
Sbjct: 181 AKKNAAPKIAQYQKIIEALGY 201



>gb:AE014185_937620 Plasmodium falciparum 3D7 chromosome 10 complete
           sequence.>gb:AE014829_1228354 Plasmodium falciparum 3D7
           chromosome 10 section 1 of 7 of the complete sequence.
          Length = 202

 Score =  197 bits (501), Expect = 2e-49
 Identities = 97/182 (53%), Positives = 126/182 (69%)
 Frame = +2

Query: 92  RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNT 271
           +  V+D + H+LGRLAS++AKELLNGQR+V VRCE+I +SG L R K+KY  FLR R NT
Sbjct: 4   KEYVIDCKGHLLGRLASLIAKELLNGQRIVAVRCEDINISGSLYRNKLKYQEFLRLRTNT 63

Query: 272 KPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDAL 451
            P  GP+H R PSKILWR +RGM+PHKT +G  AL +LKV  G+P PYDK K+ V+P AL
Sbjct: 64  NPKKGPLHLREPSKILWRCVRGMLPHKTYKGQLALKKLKVCVGMPYPYDKKKKYVLPSAL 123

Query: 452 KVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKA 631
           +  RL+   +YC LG LSS VGWN+   +K  E  RK+ ++A Y  +K++  L  K E  
Sbjct: 124 RAFRLKKHRRYCRLGTLSSRVGWNYDTLVKKNEVLRKQVSKAYY--KKKVNNLNEKKEIK 181

Query: 632 AE 637
            E
Sbjct: 182 TE 183



>gb:AC115598_1205773 Dictyostelium discoideum chromosome 2 map
           581427-735498 strain AX4, complete sequence.
          Length = 184

 Score =  191 bits (485), Expect = 1e-47
 Identities = 91/179 (50%), Positives = 126/179 (70%)
 Frame = +2

Query: 92  RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNT 271
           + +V+D + H+LGRLAS++AK LL+GQ++VVVRCEE+ +SG L R K+K+  FL   MNT
Sbjct: 2   KAIVIDGKGHLLGRLASVVAKSLLSGQKIVVVRCEELNISGPLSRNKLKWADFLNLTMNT 61

Query: 272 KPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDAL 451
             + G  H R+PSKI WR +RGM+PHKT RG AAL  +KV+EGVP PYDKVKR+V+P AL
Sbjct: 62  NHARGHRHGRSPSKIFWRAVRGMLPHKTPRGQAALDNMKVFEGVPAPYDKVKRVVVPSAL 121

Query: 452 KVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEK 628
           +V++L    KY +L +LS EVGW +   +  LE +RK+R+   Y +   +   R +A K
Sbjct: 122 RVVKLNTTRKYTVLSRLSQEVGWKYRAVVAKLEVQRKQRSSTYYRKAALVKAYRTQALK 180



>sp|O43004|R16C_SCHPO 60S ribosomal protein L16-C.>pir|T40144|T40144
           60s ribosomal protein l16-c - fission yeast
           (Schizosaccharomyces pombe)>gb:SPBC2G2_1719811 S.pombe
           chromosome II cosmid c2G2.
          Length = 197

 Score =  191 bits (485), Expect = 1e-47
 Identities = 88/165 (53%), Positives = 121/165 (73%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           V++DA+ H++GRLAS +AK+LL GQ+VVVVRCEE+ +SG   R K+KY  +LRK     P
Sbjct: 8   VIIDAKGHLMGRLASTVAKQLLAGQKVVVVRCEELNISGHFFRNKLKYLAYLRKACRYNP 67

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           S G  HFRAPS+I  + +RGM+PHKT RG  AL  L+  EG+PPP+DK KR+V+P AL+V
Sbjct: 68  SRGAFHFRAPSRIFTKAVRGMLPHKTTRGNIALKNLQALEGIPPPFDKQKRLVVPAALRV 127

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERR 592
           LRL+   KYC +G+LSSEVGW + + +  LE +RK ++ A Y+ +
Sbjct: 128 LRLKPSRKYCTIGRLSSEVGWKYKNIVSKLEERRKIKSAAFYQAK 172



>gb:AY650304_1958251 Macaca fascicularis ribosomal protein L13A
           mRNA, partial cds.
          Length = 154

 Score =  191 bits (484), Expect = 2e-47
 Identities = 89/153 (58%), Positives = 113/153 (73%)
 Frame = +2

Query: 209 SGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLK 388
           SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLK
Sbjct: 1   SGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLK 60

Query: 389 VYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKER 568
           V++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ EVGW +      LE KRKE+
Sbjct: 61  VFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEK 120

Query: 569 AQAAYERRKQLTKLRVKAEKAAEERLGTQLDIL 667
           A+  Y ++KQL +LR +AEK  E+++     +L
Sbjct: 121 AKIHYRKKKQLMRLRKQAEKNVEKKIDKYTQVL 153



>sp|Q95307|R13A_PIG 60S ribosomal protein L13a (Fragment).
          Length = 137

 Score =  188 bits (477), Expect = 1e-46
 Identities = 89/135 (65%), Positives = 111/135 (82%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct: 3   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 62

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct: 63  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 122

Query: 458 LRLQAGHKYCLLGKL 502
           +RL+   K+  LG+L
Sbjct: 123 VRLKLTGKFXYLGRL 137



>gb:CFA388525_1438336 Canis familiaris mRNA for partial Ribosomal
           protein L13A (rpL13 gene).
          Length = 142

 Score =  184 bits (468), Expect = 1e-45
 Identities = 87/136 (63%), Positives = 110/136 (80%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+ Y  FLRKRMNT P
Sbjct: 6   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLNYLAFLRKRMNTNP 65

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
           S GP  FRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV
Sbjct: 66  SRGPYDFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKV 125

Query: 458 LRLQAGHKYCLLGKLS 505
           +RL+   K+  LG+L+
Sbjct: 126 VRLKPTRKFAYLGRLA 141



>gb:AB082924_1871815 Homo sapiens RPL13a mRNA for ribosomal protein
           L13a, complete cds.
          Length = 142

 Score =  171 bits (433), Expect = 2e-41
 Identities = 78/137 (56%), Positives = 103/137 (75%)
 Frame = +2

Query: 263 MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIP 442
           MNT PS GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P
Sbjct: 1   MNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVP 60

Query: 443 DALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKA 622
            ALKV+RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +LR +A
Sbjct: 61  AALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQA 120

Query: 623 EKAAEERLGTQLDILSS 673
           EK  E+++    ++L +
Sbjct: 121 EKNVEKKIDKYTEVLKT 137



>gb:AX399872_1467185 Sequence 43 from Patent WO0218424.
          Length = 135

 Score =  161 bits (408), Expect(2) = 4e-39
 Identities = 74/108 (68%), Positives = 91/108 (84%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           +V+D R H+LGRLA+I+AK++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNP 66

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK 421
           S GP HFRAPS+I WRT+RGM+PHKTKRG AAL RLKV++G+PPPYDK
Sbjct: 67  SRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDK 114



 Score = 23.1 bits (48), Expect(2) = 4e-39
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = +3

Query: 420 R*SGWLFLMPSR 455
           R SGW FL+PSR
Sbjct: 121 RKSGWWFLLPSR 132



>gb:AF127593_1770551 Picea abies putative 60S ribosomal protein L13a
           (Sb16) gene, Sb16-A allele, partial
           cds.>gb:AF127597_1770555 Picea mariana putative 60S
           ribosomal protein L13a (Sb16) gene, Sb16-A allele,
           partial cds.
          Length = 105

 Score =  154 bits (389), Expect = 2e-36
 Identities = 73/105 (69%), Positives = 89/105 (84%)
 Frame = +2

Query: 368 AALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVL 547
           AALARL  +EGVPPPYD+ KRMVIPDALKVLRLQ GHKYCLLG+LS EVGW+H+DTI  L
Sbjct: 1   AALARLXAFEGVPPPYDRKKRMVIPDALKVLRLQPGHKYCLLGRLSKEVGWHHFDTITEL 60

Query: 548 ENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY 682
           E KRK +AQ +YERRKQL KLR KA + AE++L  ++++L+S+KY
Sbjct: 61  EEKRKAKAQVSYERRKQLAKLRSKAVELAEKQLAPEMELLASLKY 105



>gb:AF052595_1236791 Ostertagia ostertagi 60S ribosomal protein L13a
           mRNA, partial cds.
          Length = 150

 Score =  151 bits (381), Expect = 2e-35
 Identities = 72/149 (48%), Positives = 98/149 (65%)
 Frame = +2

Query: 236 KYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
           KY  FLRKRMN  PS GP H RAPSKI WRT+RGM+PHKT  G  AL  L+VYEGVP PY
Sbjct: 1   KYLSFLRKRMNVNPSRGPFHLRAPSKIFWRTVRGMLPHKTPHGNKALKNLRVYEGVPQPY 60

Query: 416 DKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRK 595
           D   +  +P A + L L+   K+CL+G+LS EVGW + D ++ LE KRK +  A +E++K
Sbjct: 61  DHQTKFNVPSANRHLGLKPRRKFCLVGRLSHEVGWKYQDIVEKLETKRKVKGAAYFEQKK 120

Query: 596 QLTKLRVKAEKAAEERLGTQLDILSSVKY 682
           ++  L  +A+K   +++     I+ S+ Y
Sbjct: 121 KVLSLTEQAKKNIAKQIAPFQAIIESMGY 149



>gb:AF521144_1807881 Kandelia candel 60S ribosomal protein mRNA,
           partial cds.
          Length = 79

 Score =  146 bits (369), Expect = 4e-34
 Identities = 72/77 (93%), Positives = 75/77 (97%)
 Frame = +2

Query: 89  ARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMN 268
           A+ VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMN
Sbjct: 2   AKVVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYLRFLRKRMN 61

Query: 269 TKPSHGPIHFRAPSKIL 319
           TKPSHGPIHFRAPSKIL
Sbjct: 62  TKPSHGPIHFRAPSKIL 78



>gb:AF127595_1770553 Picea glauca putative 60S ribosomal protein
           L13a (Sb16) gene, Sb16-A allele, partial cds.
          Length = 96

 Score =  140 bits (353), Expect = 3e-32
 Identities = 66/96 (68%), Positives = 81/96 (84%)
 Frame = +2

Query: 395 EGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQ 574
           EGVP PYD+ KRMVIPDALKVLRLQ GHKYCLLG+LS EVGW+H+DTI  LE KRK +AQ
Sbjct: 1   EGVPXPYDRKKRMVIPDALKVLRLQPGHKYCLLGRLSKEVGWHHFDTITELEEKRKAKAQ 60

Query: 575 AAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY 682
            +YERRKQL KLR KA + AE++L  ++++L+S+KY
Sbjct: 61  VSYERRKQLAKLRSKAVELAEKQLAPEMELLASLKY 96



>gb:AF127594_1770552 Picea abies putative 60S ribosomal protein L13a
           (Sb16) gene, Sb16-B allele, partial cds.
          Length = 89

 Score =  140 bits (353), Expect = 3e-32
 Identities = 67/89 (75%), Positives = 76/89 (85%)
 Frame = +2

Query: 371 ALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLE 550
           ALARL+ +EGVPPPYD+ KRMVIPDALKVLRLQ GHKYCLLG+LS EVGW+H+DTI  LE
Sbjct: 1   ALARLRAFEGVPPPYDRKKRMVIPDALKVLRLQPGHKYCLLGRLSKEVGWHHFDTITELE 60

Query: 551 NKRKERAQAAYERRKQLTKLRVKAEKAAE 637
            KRK +AQ +YERRKQL KLR KA + AE
Sbjct: 61  EKRKAKAQVSYERRKQLAKLRSKAVELAE 89



>pir|F90083|F90083 60s ribosomal protein L13A [imported] -
           Guillardia theta nucleomorph>gb:AF165818_1773751
           Guillardia theta nucleomorph chromosome 1, complete
           sequence.
          Length = 194

 Score =  137 bits (345), Expect = 3e-31
 Identities = 64/172 (37%), Positives = 109/172 (63%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPS 280
           V+DA++H+LGR+ASI AK++L G +++++R E   ++G L R   KY    +K+ NT P 
Sbjct: 5   VLDAKNHLLGRMASICAKKILQGDKIIIIRSELTSITGKLGRNVNKYKSIFKKKTNTNPR 64

Query: 281 HGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVL 460
            GP HF++PSKIL++TI+ MIPHKT RG+ AL  LK++EG+P  + K+K+    +A +  
Sbjct: 65  RGPFHFKSPSKILYQTIKRMIPHKTMRGSKALKNLKIFEGLPRIFSKIKKEKFFEAFRYK 124

Query: 461 RLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRV 616
            ++   K   LGK+   +GW +   I+   ++     +   +++K++ K R+
Sbjct: 125 VIKNYRKTVNLGKVCEVLGWKNRKFIEQKSDQLAALGKVVLKKKKEIKKFRI 176



>gb:AF127598_1770556 Picea mariana putative 60S ribosomal protein
           L13a (Sb16) gene, Sb16-B allele, partial cds.
          Length = 78

 Score =  129 bits (323), Expect = 9e-29
 Identities = 60/78 (76%), Positives = 67/78 (85%)
 Frame = +2

Query: 374 LARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLEN 553
           LARL  +EGVPPPYD+ KRMVIPDALKVLRLQ GHKYCLLG+LS EVGW+H+DTI  LE 
Sbjct: 1   LARLXAFEGVPPPYDRKKRMVIPDALKVLRLQPGHKYCLLGRLSKEVGWHHFDTITELEE 60

Query: 554 KRKERAQAAYERRKQLTK 607
           KRK +AQ +YERRKQL K
Sbjct: 61  KRKAKAQVSYERRKQLAK 78



>gb:AB049716_1520905 Pisum sativum ssa-6 mRNA for putative
           senescence-associated protein, complete cds.
          Length = 255

 Score = 93.2 bits (230), Expect(2) = 9e-28
 Identities = 46/59 (77%), Positives = 51/59 (86%)
 Frame = +2

Query: 122 MLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHF 298
           MLGRLASI+AKEL   +R  +VRCEEIC+SGGL RQKMKY RFLR+RMNTKPSHGPI F
Sbjct: 1   MLGRLASIVAKELSMVRRSFLVRCEEICISGGLGRQKMKYMRFLRRRMNTKPSHGPITF 59



 Score = 53.5 bits (127), Expect(2) = 9e-28
 Identities = 29/56 (51%), Positives = 33/56 (58%)
 Frame = +3

Query: 396 RVFLRRMIR*SGWLFLMPSRY*GSRLGTSTACWVSFHLRLAGTTMIPSRF*RIRGR 563
           R FL  M R  GW +LM  RY G +  T+TAC  S+HLR  G T  PSR  R RGR
Sbjct: 92  REFLHHMTRSKGWWYLMHLRYCGFQRATNTACLGSYHLRWDGITTTPSRSWRRRGR 147



>gb:AY606806_1617503 Pseudotsuga menziesii isolate 659 putative 60S
           ribosomal protein L13a (Sb16) gene, Sb16-A allele,
           partial cds.>gb:AY606807_1617504 Picea abies isolate
           9028 putative 60S ribosomal protein L13a (Sb16) gene,
           Sb16-C allele, partial cds.>gb:AY606808_1617505 Picea
           glauca isolate 7736 putative 60S ribosomal protein L13a
           (Sb16) gene, partial cds.>gb:AY606809_1617506 Picea
           glauca isolate 8849 putative 60S ribosomal protein L13a
           (Sb16) gene, Sb16-A allele, partial
           cds.>gb:AY606810_1617507 Picea glauca isolate 9250
           putative 60S ribosomal protein L13a (Sb16) gene, Sb16-B
           allele, partial cds.>gb:AY606811_1617508 Picea glauca
           isolate 9245 putative 60S ribosomal protein L13a (Sb16)
           gene, partial cds.>gb:AY606812_1617509 Picea glauca
           isolate 875 putative 60S ribosomal protein L13a (Sb16)
           gene, Sb16-C allele, partial cds.>gb:AY606813_1617510
           Picea mariana isolate 8956 putative 60S ribosomal
           protein L13a (Sb16) gene, Sb16-A allele, partial
           cds.>gb:AY606814_1617511 Picea mariana isolate 197
           putative 60S ribosomal protein L13a (Sb16) gene, Sb16-B
           allele, partial cds.>gb:AY606815_1617512 Tsuga
           canadensis isolate 659 putative 60S ribosomal protein
           L13a (Sb16) gene, Sb16-B allele, partial cds.
          Length = 82

 Score =  117 bits (294), Expect = 2e-25
 Identities = 55/82 (67%), Positives = 69/82 (84%)
 Frame = +2

Query: 437 IPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRV 616
           IPDALKVLRLQ GHKYCLLG+LS EVGW+H+DTI  LE KRK +AQ +YERRKQL KLR 
Sbjct: 1   IPDALKVLRLQPGHKYCLLGRLSKEVGWHHFDTITELEEKRKAKAQVSYERRKQLAKLRS 60

Query: 617 KAEKAAEERLGTQLDILSSVKY 682
           KA + AE++L  ++++L+S+KY
Sbjct: 61  KAVELAEKQLAPEMELLASLKY 82



>gb:AY231755_1177048 Drosophila yakuba clone yak-em_CG1475 mRNA
           sequence.
          Length = 105

 Score =  117 bits (293), Expect = 3e-25
 Identities = 57/104 (54%), Positives = 77/104 (74%), Gaps = 4/104 (3%)
 Frame = +2

Query: 338 MIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVG 517
           MIPHKTKRG AALARL+V++G+P PYDK +R+V+P A++VL L++  KYC +G+LS EVG
Sbjct: 1   MIPHKTKRGQAALARLRVFDGIPSPYDKRRRVVVPIAMRVLTLRSDRKYCQVGRLSHEVG 60

Query: 518 WNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAE----KAAE 637
           W++ D IK LE KRK + +   +  ++L KL VKA     KAAE
Sbjct: 61  WHYQDVIKSLERKRKAKLRVTLKHNRELKKLTVKARENIAKAAE 104



>gb:SC23CDS_1705074 S.cerevisiae PMS1, TPM1, MKS1, YMK1, MSK1, ODP2,
           YL9A & FKH2 genes.
          Length = 113

 Score =  116 bits (290), Expect = 6e-25
 Identities = 55/101 (54%), Positives = 71/101 (70%)
 Frame = +2

Query: 338 MIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVG 517
           M+ HKT RG AAL RLK++EG+PPPYDK KR+V+P AL+VLRL+ G KY  LGKLS+ VG
Sbjct: 1   MVSHKTARGKAALERLKIFEGIPPPYDKKKRVVVPQALRVLRLKPGRKYTTLGKLSTSVG 60

Query: 518 WNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEE 640
           W + D +  LE+KRK R+   Y +++  TK    A  AA E
Sbjct: 61  WKYEDVVAKLEDKRKVRSAEYYAKKRAFTKKVSSASAAASE 101



>gb:CNS07EGB_1373210 chromosome IV of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 198

 Score =  115 bits (288), Expect = 1e-24
 Identities = 73/193 (37%), Positives = 102/193 (52%), Gaps = 2/193 (1%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           V++DA   + G+LA+ +AK LL G RV VV  EE    G L R   K+ ++L KR    P
Sbjct: 7   VIIDATGQVAGKLAAKVAKLLLEGVRVTVVCAEEAVFVGSLERAMDKFKQYLNKRCLVNP 66

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
             GP HFR P   L + IR MI +K  RG AA++RL  YEG+P   +   R  +  A  V
Sbjct: 67  RRGPFHFREPRMHLAKIIRRMISYKKPRGKAAMSRLATYEGIPRELEGQPRYKVTCAF-V 125

Query: 458 LRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKL--RVKAEKA 631
                 ++Y  LGKL S  GW H +  K L ++ KER   A  ++K L K    +K +K 
Sbjct: 126 KYTGNPNRYVTLGKLLSMFGWKHAEAAKSLTDELKERESLASLQKKDLDKKIEELKTDKN 185

Query: 632 AEERLGTQLDILS 670
            E  +  +L +L+
Sbjct: 186 FENEVNRRLAMLA 198



>gb:BC067891_1987546 Homo sapiens cDNA clone MGC:87657
           IMAGE:5271409, complete cds.
          Length = 102

 Score =  109 bits (273), Expect = 6e-23
 Identities = 53/97 (54%), Positives = 71/97 (73%)
 Frame = +2

Query: 338 MIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVG 517
           M+ HKTKRG A+L  LKV++G+PPPYDK KRMV+P ALKV+RL+   K+ LLG+ + EV 
Sbjct: 1   MLRHKTKRGHASLDCLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFALLGRQAQEVR 60

Query: 518 WNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEK 628
           W +      LE KRKE+A+  Y ++KQL +LR +AEK
Sbjct: 61  WKYQAVTATLEEKRKEKAKIHYWKKKQLMRLRKQAEK 97



>gb:AF127596_1770554 Picea glauca putative 60S ribosomal protein
           L13a (Sb16) gene, Sb16-B allele, partial cds.
          Length = 59

 Score =  102 bits (255), Expect = 7e-21
 Identities = 46/57 (80%), Positives = 51/57 (89%)
 Frame = +2

Query: 392 YEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRK 562
           +EGVPPPYD+ KRMVIPDALKVLRLQ GHKYCLLG+LS EVGW+H+DTI  LE KRK
Sbjct: 2   FEGVPPPYDRKKRMVIPDALKVLRLQPGHKYCLLGRLSKEVGWHHFDTITELEEKRK 58



>gb:AE010721_265976 Methanosarcina acetivorans str. C2A, section 66
           of 534 of the complete genome.>gb:AE010299_906535
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 143

 Score = 93.6 bits (231), Expect = 4e-18
 Identities = 58/143 (40%), Positives = 89/143 (62%), Gaps = 1/143 (0%)
 Frame = +2

Query: 92  RRVVVDARHHMLGRLASILAKELLNG-QRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMN 268
           +  V+DA+  +LGRLAS +AK+LL+G ++V ++  E+  +SG       +Y R  R+R  
Sbjct: 3   KMTVIDAKGLILGRLASSVAKQLLSGDEKVYIINAEQAIISGSRAATLREY-RETRERGA 61

Query: 269 TKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDA 448
           T+   GP   + P +IL RTIRGM+P+K  RG  A++RLKVY GVP      + + IPDA
Sbjct: 62  TE--FGPYFPKRPDRILKRTIRGMLPYKRARGRDAMSRLKVYVGVPYELKGAETVTIPDA 119

Query: 449 LKVLRLQAGHKYCLLGKLSSEVG 517
              +RL +  +Y  LG++S ++G
Sbjct: 120 --DMRLLSSSRYVELGEVSQKMG 140



>gb:AX884906_1480359 Sequence 769 from Patent EP1033401.
          Length = 73

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 46/82 (56%), Positives = 58/82 (70%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           +V+D R H+LGRLA+I+AK++L G++VVVVRCE I                LRKRMNT P
Sbjct: 7   LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGI---------------ILRKRMNTNP 51

Query: 278 SHGPIHFRAPSKILWRTIRGMI 343
           S GP HFRAPS+I WRT+RGM+
Sbjct: 52  SRGPYHFRAPSRIFWRTVRGML 73



>gb:AE013411_292086 Methanosarcina mazei strain Goe1, section 193 of
           379 of the complete genome.>gb:AE008384_966195
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 162

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 62/152 (40%), Positives = 91/152 (59%), Gaps = 2/152 (1%)
 Frame = +2

Query: 68  VSG-SGICARRVVVDARHHMLGRLASILAKELLNG-QRVVVVRCEEICLSGGLVRQKMKY 241
           VSG S    +  V+DA+  +LGRLAS +AK+LL+G ++V ++  E+  +SG       +Y
Sbjct: 13  VSGYSAEVTKMTVIDAKGLILGRLASSVAKQLLSGDEKVYIINAEKAIISGSRAATLREY 72

Query: 242 HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK 421
            R  R R  T+   GP   + P +IL RTIRGM+P+K  RG  A++RLKVY GVP     
Sbjct: 73  -RETRDRGATE--FGPYFPKRPDRILKRTIRGMLPYKRARGRDAMSRLKVYVGVPYELKG 129

Query: 422 VKRMVIPDALKVLRLQAGHKYCLLGKLSSEVG 517
            +   I DA   +RL + +KY  LG++S ++G
Sbjct: 130 AETTTIADA--DMRLLSSNKYVELGEVSQKMG 159



>sp|O29137|RL13_ARCFU 50S ribosomal protein L13P.>pir|G69390|G69390
           LSU ribosomal protein L13P (rpl13P) homolog -
           Archaeoglobus fulgidus>gb:AE001026_30778 Archaeoglobus
           fulgidus DSM 4304 section 81 of 172 of the complete
           genome.>gb:AE000782_975014 Archaeoglobus fulgidus DSM
           4304 complete genome.
          Length = 156

 Score = 89.4 bits (220), Expect = 8e-17
 Identities = 54/140 (38%), Positives = 80/140 (57%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPS 280
           V+DA  H+LGRL+S +AK LLNG+R+VVV  E+  ++G    + M + R+  K       
Sbjct: 18  VIDASGHILGRLSSKIAKRLLNGERIVVVNAEKAVITGD---KYMVFERYKEKYDRGSKE 74

Query: 281 HGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVL 460
            GP   R P +I  RT+RGM+P K+ RG  A  RL+V+ GVP      +   I DAL + 
Sbjct: 75  KGPYFPRHPERIFKRTVRGMLPWKSSRGRDAYRRLRVFMGVPEELQGREFEKIEDAL-LE 133

Query: 461 RLQAGHKYCLLGKLSSEVGW 520
           ++    KY  L ++S  +G+
Sbjct: 134 KVSKTDKYVTLAEVSRYLGF 153



>gb:AP006878_576653 Thermococcus kodakaraensis strain KOD1 DNA,
           complete genome.
          Length = 142

 Score = 86.7 bits (213), Expect = 5e-16
 Identities = 53/139 (38%), Positives = 80/139 (57%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPS 280
           +++A   +LGRLAS +AK LL G+ VV+V  E+  ++G       KY +    R  T P 
Sbjct: 3   IINAEGLILGRLASKVAKMLLEGEEVVIVNAEKAIITGNREDIFAKYKQRTELRTRTNPR 62

Query: 281 HGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVL 460
            GP + +   +I+ RT+RGM+P KT RG  A  RLKVY GVP  ++  +   I +A  + 
Sbjct: 63  RGPFYPKRSDEIVRRTVRGMLPWKTDRGRKAFKRLKVYVGVPKEFEGKEFETISEA-HMS 121

Query: 461 RLQAGHKYCLLGKLSSEVG 517
           RL A  KY  +G+++  +G
Sbjct: 122 RL-ATPKYVTVGEVAKFLG 139



>gb:AE010438_263108 Methanopyrus kandleri AV19 section 137 of 157 of
           the complete genome.>gb:AE009439_903889 Methanopyrus
           kandleri AV19, complete genome.
          Length = 159

 Score = 86.7 bits (213), Expect = 5e-16
 Identities = 51/142 (35%), Positives = 81/142 (57%), Gaps = 2/142 (1%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPS 280
           V+DA + +LGRLAS++AK +L G+R+ V+  E+  ++G   ++      +L+K     P 
Sbjct: 17  VIDAENAVLGRLASVVAKRILKGERIAVINTEKAIITG---KKNTIKEEWLQKIQRGDPK 73

Query: 281 HGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVL 460
            GP + R P  I  R +RGM+P KTKRG  A  RL+ Y G P   ++    + P+ +   
Sbjct: 74  KGPFYPRRPDLIFRRVVRGMLPWKTKRGREAFKRLRAYIGTPRWVEEAN--IEPERVAEA 131

Query: 461 RL-QAGHK-YCLLGKLSSEVGW 520
            + + GH  Y  LG+LS E+G+
Sbjct: 132 DMSRLGHLWYVTLGELSEELGY 153



>gb:AE010263_261212 Pyrococcus furiosus DSM 3638, section 138 of 173
           of the complete genome.>gb:AE009950_901993 Pyrococcus
           furiosus DSM 3638, complete genome.
          Length = 142

 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 53/139 (38%), Positives = 79/139 (56%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPS 280
           +++A   +LGRLAS +AK LL G+ VV+V  E+  ++G       KY +    R  T P 
Sbjct: 3   IINAEGLILGRLASKVAKMLLEGEEVVIVNAEKAVITGNRDVIFKKYKQRTELRTLTNPR 62

Query: 281 HGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVL 460
            GP + +   +I+ RTIRGM+P KT RG  A  RLKVY G+P  +   +   I +A  V 
Sbjct: 63  RGPFYPKRSDEIVRRTIRGMLPWKTDRGRKAFKRLKVYVGIPKEFQGKELETIIEA-HVS 121

Query: 461 RLQAGHKYCLLGKLSSEVG 517
           RL +  KY  +G+++  +G
Sbjct: 122 RL-SRPKYVTVGEVAKFLG 139



>sp|O26146|RLSX_METTH Fused L13/S9 ribosomal protein [Includes: 50S
           ribosomal protein L13P; 30S ribosomal protein
           S9P].>pir|E69150|E69150 ribosomal protein S9 -
           Methanobacterium thermoautotrophicum  (strain Delta
           H)>gb:AE000796_27743 Methanobacterium
           thermoautotrophicum from bases 10151 to 26221 (section 2
           of 148) of the complete genome.>gb:AE000666_924825
           Methanobacterium thermoautotrophicum str. Delta H
           complete genome.
          Length = 282

 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 48/141 (34%), Positives = 82/141 (58%), Gaps = 1/141 (0%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           ++++   H+LGRLAS+++K+LL G+ V+V+  E+I ++G       KY + + +   + P
Sbjct: 4   MIINGEGHILGRLASVVSKKLLEGEEVIVLNAEKILITGSKEWAYGKYKQRIDRASISNP 63

Query: 278 SH-GPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALK 454
              GP + R P  I  RT+RGM+P+K  +G  A   LK Y G+P  +   + + IPDA K
Sbjct: 64  RRMGPKYPRRPDDIFRRTVRGMLPYKKSKGREAFKGLKAYVGIPREFKDEEMVEIPDA-K 122

Query: 455 VLRLQAGHKYCLLGKLSSEVG 517
              ++ G +   LG++S  +G
Sbjct: 123 AGSIKKGME---LGEISELLG 140



>sp|Q9V196|RL13_PYRAB 50S ribosomal protein L13P.>pir|G75171|G75171
           lsu ribosomal protein l13p (rpl13p) PAB0365 - Pyrococcus
           abyssi (strain Orsay)>gb:CNSPAX02_849295 Pyrococcus
           abyssi complete genome; segment 2/6.
          Length = 142

 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 53/139 (38%), Positives = 79/139 (56%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPS 280
           +++A   +LGRLAS +AK LL G+ VV+V  E+  ++G       KY +    R  T P 
Sbjct: 3   IINAEGLILGRLASRVAKMLLEGEEVVIVNAEKAVITGNREVIFSKYKQRTGLRTLTNPR 62

Query: 281 HGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVL 460
            GP + +   +I+ RTIRGM+P KT RG  A  RLKVY G+P  +   +   I +A  V 
Sbjct: 63  RGPFYPKRSDEIVRRTIRGMLPWKTDRGRKAFKRLKVYVGIPKEFKDKQLETIVEA-HVS 121

Query: 461 RLQAGHKYCLLGKLSSEVG 517
           RL +  KY  +G+++  +G
Sbjct: 122 RL-SRPKYVTVGEVAKFLG 139



>sp|O59300|RL13_PYRHO 50S ribosomal protein L13P.>pir|B71043|B71043
           probable ribosomal protein L13 - Pyrococcus
           horikoshii>gb:BA000001_650308 Pyrococcus horikoshii OT3
           DNA, complete genome.
          Length = 142

 Score = 83.2 bits (204), Expect = 6e-15
 Identities = 53/139 (38%), Positives = 79/139 (56%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPS 280
           +++A   +LGRLAS +AK LL G+ VV+V  E+  ++G       KY +    R  T P 
Sbjct: 3   IINADGLILGRLASRVAKMLLEGEEVVIVNAEKAVITGNREVIFSKYKQRTGLRTLTNPR 62

Query: 281 HGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVL 460
            GP + +   +I+ RTIRGM+P KT RG  A  RLKVY G+P  +   +   I +A  V 
Sbjct: 63  RGPFYPKRSDEIVRRTIRGMLPWKTDRGRKAFRRLKVYVGIPKEFQDKQLETIVEA-HVS 121

Query: 461 RLQAGHKYCLLGKLSSEVG 517
           RL +  KY  +G+++  +G
Sbjct: 122 RL-SRPKYVTVGEVAKFLG 139



>gb:AY013245_1558485 Oryza sativa (japonica cultivar-group)
           chromosome 3 BAC 36I5, partial sequence.
          Length = 43

 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 38/43 (88%), Positives = 41/43 (95%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRC 193
           MVSGSG+CA RVVVDARHHML RLASI+AKELLNG+RVVVVRC
Sbjct: 1   MVSGSGVCAPRVVVDARHHMLSRLASIIAKELLNGKRVVVVRC 43



>sp|Q9YB50|RL13_AERPE 50S ribosomal protein L13P.>pir|G72557|G72557
           probable ribosomal protein L13 APE1747 - Aeropyrum
           pernix  (strain K1)>gb:BA000002_652492 Aeropyrum pernix
           K1 DNA, complete genome.
          Length = 155

 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 56/146 (38%), Positives = 80/146 (54%), Gaps = 2/146 (1%)
 Frame = +2

Query: 89  ARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMN 268
           AR +VVD    ++GRLAS++AK LL G RV VV  E+I LSG   R  ++ +R     + 
Sbjct: 8   AREIVVDGSGMIMGRLASVVAKLLLAGWRVNVVNAEKIVLSGD-PRMVVESYRTTVLGVK 66

Query: 269 TKPSH--GPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIP 442
           +  SH   P   R P ++    +RGM+P    RG  ALARL+VY GVP      + +  P
Sbjct: 67  SHFSHKWRPKRPRTPQRLFKHAVRGMLPKNKARGRRALARLRVYVGVPDELKGREFVRFP 126

Query: 443 DALKVLRLQAGHKYCLLGKLSSEVGW 520
           +A    RL +   Y  LG ++ ++GW
Sbjct: 127 EA-DASRLSS--HYIELGAVARQLGW 149



>sp|P29198|RL13_HALMA 50S ribosomal protein L13P
           (Hmal13).>pir|B41715|B41715 ribosomal protein L13
           [similarity] - Haloarcula
           marismortui>gb:HALHMAENOA_136616 H.marismortui tRNA-Leu,
           HL29, HmaL13, HmaS9, OrfMMV, OrfMNA, 2-phosphoglycerate
           dehydratase (HmaEno), and OrfMSG genes, complete
           cds.>gb:AY596297_631609 Haloarcula marismortui ATCC
           43049 chromosome I, complete sequence.
          Length = 145

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 51/142 (35%), Positives = 81/142 (57%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           V+VDAR  ++GR+AS +A++ L+G+ V VV  E   ++G   +   KY     KR++   
Sbjct: 10  VIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYE----KRVDIGN 65

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
            +G  + + P  I  RTIRGM+PHK +RG  A   ++VY G   PYD+   ++  D   +
Sbjct: 66  DNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLG--NPYDEDGEVL--DGTSL 121

Query: 458 LRLQAGHKYCLLGKLSSEVGWN 523
            RL +  K+  LG++S  +G N
Sbjct: 122 DRL-SNIKFVTLGEISETLGAN 142



>gb:AX400069_1467382 Sequence 240 from Patent WO0218424.
          Length = 86

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 35/81 (43%), Positives = 54/81 (66%)
 Frame = +2

Query: 431 MVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKL 610
           MV+P ALKV+RL+   K+  LG+L+ EVGW +      LE KRKE+A+  Y ++KQL +L
Sbjct: 1   MVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRL 60

Query: 611 RVKAEKAAEERLGTQLDILSS 673
           R +AEK  E+++    ++L +
Sbjct: 61  RKQAEKNVEKKIDKYTEVLKT 81



>gb:BA000023_692747 Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 146

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 54/141 (38%), Positives = 76/141 (53%), Gaps = 1/141 (0%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           VVV+A + +LGR+A+ +AK L+ G+RVVVV  E+  +SG   R    Y      R    P
Sbjct: 6   VVVNAENQILGRMATHIAKLLIQGKRVVVVNAEKAIISGPRARVVRGYSLIFSVRKFQNP 65

Query: 278 SHGPI-HFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALK 454
               I   R P  I+ RT+RGM+P K K G      L V+ G+P  Y K K+M+  +   
Sbjct: 66  EKNTIKRPRTPINIVKRTVRGMLP-KNKSGKMMFKNLIVFIGIPAEY-KDKQMIRFEDAD 123

Query: 455 VLRLQAGHKYCLLGKLSSEVG 517
           V RL+   KY  +G+LS  +G
Sbjct: 124 VKRLKG--KYITVGELSKLLG 142



>gb:AE009779_255567 Pyrobaculum aerophilum strain IM2 section 34 of
           201 of the complete genome.>gb:AE009441_898193
           Pyrobaculum aerophilum strain IM2 complete genome.
          Length = 187

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 52/135 (38%), Positives = 76/135 (56%), Gaps = 10/135 (7%)
 Frame = +2

Query: 89  ARRVVVDARHHMLGRLASILAKELLN--GQRVVVVRCEEICLSGGLVRQKMKYHRFLRK- 259
           A  V+VDA  H+ GRLA+ +AK LL     R+VVV  E++ ++G    +KM    F RK 
Sbjct: 16  AGEVIVDAEGHVAGRLATYIAKALLERPNLRIVVVNAEKLVITGD---EKMVIEWFKRKI 72

Query: 260 ---RMNTKPSH-GPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVK 427
              R +  P   GP   R P ++  R +RGM+P K++ G +AL RL+VY  +P    + K
Sbjct: 73  SEWRTHYNPEKAGPKVPRRPDRVFKRIVRGMLPKKSETGRSALKRLRVYMSIPIEIMQRK 132

Query: 428 RMV---IPDALKVLR 463
           R+V   +P+A   LR
Sbjct: 133 RLVLYEVPEAKLRLR 147



>gb:AF020446_1233347 Entamoeba dispar ribosomal protein L13A mRNA,
           partial cds.
          Length = 87

 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 31/73 (42%), Positives = 54/73 (73%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPS 280
           V+D   H+LGR+AS++AK LL GQ++V+VRCE++ + G L  + +++  + RKR+NT P+
Sbjct: 13  VIDCHGHVLGRVASVVAKHLLLGQKIVLVRCEDLQVCGTLKMRLVQWELYQRKRVNTNPT 72

Query: 281 HGPIHFRAPSKIL 319
            G  H R+P++++
Sbjct: 73  RGAFHHRSPAEMV 85



>gb:AE017199_403039 Nanoarchaeum equitans Kin4-M, complete genome.
          Length = 162

 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 56/155 (36%), Positives = 78/155 (50%), Gaps = 15/155 (9%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           ++ DA   +LGRLASI+A+ L  G RV +V  E+  ++G      M    +L+K      
Sbjct: 7   LIYDAEGLVLGRLASIVARNLKRGYRVKIVNAEKAIITGD---PNMVKKEWLQKVKRGDY 63

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY-DKVK--------- 427
             GP + + P  IL R IRGM+P KT RG   L  +KVY GVP    DK K         
Sbjct: 64  YKGPFYPKRPDNILKRVIRGMLPRKTARGRELLKNVKVYIGVPEELKDKPKLGLNLENAK 123

Query: 428 ---RMVIPDALKVL-RLQAGH-KYCLLGKLSSEVG 517
                +I + LK   + + G+ KY  LG+LS  +G
Sbjct: 124 GYPEALIKEVLKAKPKFERGNIKYIELGELSKYLG 158



>sp|P95991|RL13_SULSO 50S ribosomal protein L13P.>pir|S75419|S75419
           ribosomal protein L13 - Sulfolobus
           solfataricus>gb:SS56KBFR_190397 S.solfataricus 56 kbp
           DNA fragment.>gb:AE006647_221029 Sulfolobus solfataricus
           P2 section 6 of 272 of the complete
           genome.>gb:AE006641_1106877 Sulfolobus solfataricus P2,
           complete genome.
          Length = 149

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 48/143 (33%), Positives = 79/143 (55%), Gaps = 1/143 (0%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           V+++A   +LGR+AS + + L  G++V++V  E+  +SG   R    Y   L  +    P
Sbjct: 10  VIINAEGQILGRMASNVVRLLKEGKKVIIVNGEKAVISGEKNRVIESYKLLLTVKTLFNP 69

Query: 278 SHGPIHF-RAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALK 454
               I   R+P  I+ RTIRGM+P K+ +G   L  +K+Y GVP  ++  + +  PD+  
Sbjct: 70  YRNGIRRPRSPINIVKRTIRGMLP-KSSKGRRMLKNVKIYVGVPKEFEGRQFIKFPDS-D 127

Query: 455 VLRLQAGHKYCLLGKLSSEVGWN 523
           V RL+   KY  +  +S E+GW+
Sbjct: 128 VSRLKG--KYVTVEVVSKELGWS 148



>pir|C64324|C64324 ribosomal protein L13 - Methanococcus jannaschii
          Length = 140

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 49/140 (35%), Positives = 70/140 (50%), Gaps = 1/140 (0%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPS 280
           V+DA   +LGRLAS +AK +L G+ +V+V  E + ++G        Y     K+    P 
Sbjct: 6   VIDAEGAILGRLASEVAKRVLRGEEIVIVNAEMVVITGNKDWIIKTYQEEREKKNVANPR 65

Query: 281 H-GPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
             GP   R P  IL RTIR M+P+K  +G  A  R+KVY G P      K + + +  K+
Sbjct: 66  RFGPKFPRRPDDILRRTIRKMLPYKKPKGREAFKRVKVYVGNP------KNLTVDE--KI 117

Query: 458 LRLQAGHKYCLLGKLSSEVG 517
                  KY  L +LS  +G
Sbjct: 118 SHKLNTTKYITLAELSKHLG 137



>sp|P54023|RL13_METJA 50S ribosomal protein L13P.>gb:U67475_206283
           Methanocaldococcus jannaschii DSM 2661 section 17 of 150
           of the complete genome.>gb:L77117_1099041
           Methanocaldococcus jannaschii DSM 2661, complete genome.
          Length = 137

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 49/140 (35%), Positives = 70/140 (50%), Gaps = 1/140 (0%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPS 280
           V+DA   +LGRLAS +AK +L G+ +V+V  E + ++G        Y     K+    P 
Sbjct: 3   VIDAEGAILGRLASEVAKRVLRGEEIVIVNAEMVVITGNKDWIIKTYQEEREKKNVANPR 62

Query: 281 H-GPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
             GP   R P  IL RTIR M+P+K  +G  A  R+KVY G P      K + + +  K+
Sbjct: 63  RFGPKFPRRPDDILRRTIRKMLPYKKPKGREAFKRVKVYVGNP------KNLTVDE--KI 114

Query: 458 LRLQAGHKYCLLGKLSSEVG 517
                  KY  L +LS  +G
Sbjct: 115 SHKLNTTKYITLAELSKHLG 134



>gb:BX957222_844577 Methanococcus maripaludis S2 complete genome;
           segment 4/5.
          Length = 137

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 40/104 (38%), Positives = 61/104 (58%), Gaps = 1/104 (0%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRF-LRKRMNTK 274
           VVV+A + ++GRLAS +AK  L+G+ + VV  E+  ++G       KY +   RK ++  
Sbjct: 2   VVVNAENAVVGRLASYVAKLALSGEEITVVNAEKAIMTGNKEYIFQKYVQLRTRKSISNP 61

Query: 275 PSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVP 406
              GP + R P  I+ R IRGM+P+K  RG  A  ++K+  GVP
Sbjct: 62  KKMGPKYPRRPDDIVRRVIRGMLPYKKPRGVEAFKKIKIEVGVP 105



>gb:AY359241_1322630 Crassostrea gigas 60s ribosomal protein mRNA,
           partial cds.
          Length = 51

 Score = 69.3 bits (168), Expect = 8e-11
 Identities = 30/47 (63%), Positives = 36/47 (76%)
 Frame = +2

Query: 251 LRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKV 391
           LR R N KPS GP HFRAPSK+ ++ +RGM+PHKT RGA A+ RL V
Sbjct: 4   LRLRCNVKPSRGPFHFRAPSKMFYKAVRGMVPHKTSRGAEAMERLMV 50



>gb:BA000011_665601 Thermoplasma volcanium GSS1 DNA, complete
           genome.
          Length = 136

 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 45/141 (31%), Positives = 74/141 (52%), Gaps = 2/141 (1%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPS 280
           ++DA + + GRL++ +AK+LLNG+ VV+V   +  ++G    +K    +F ++       
Sbjct: 3   IIDASNTVYGRLSAYVAKQLLNGEEVVIVNASKAVITGD---RKFIIDKFKQRLDIGSVR 59

Query: 281 HGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDAL--K 454
            GP + + P  IL R+I  M+P K  RG  AL+R KVY  +P      K   + D +  K
Sbjct: 60  KGPYYPKTPENILRRSIGDMLPKKITRGKEALSRCKVYRNLPKNVSSEKIEKVDDVMTDK 119

Query: 455 VLRLQAGHKYCLLGKLSSEVG 517
           V+ +        L +LS E+G
Sbjct: 120 VVGI------ITLEELSKELG 134



>pir|F84269|F84269 50S ribosomal protein L13P [imported] -
           Halobacterium sp. NRC-1>gb:AE005043_62682 Halobacterium
           sp. NRC-1 section 74 of 170 of the complete
           genome.>gb:AE004437_887601 Halobacterium sp. NRC-1
           complete genome.
          Length = 145

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 50/142 (35%), Positives = 71/142 (50%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           VVVDAR  ++GR+AS +A+  L G RV VV  E+  ++G        Y    R R N   
Sbjct: 10  VVVDARDCIMGRVASNVAERALAGDRVAVVNAEQAVITGTEDDVFSTY----RTRANLGS 65

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV 457
             GP + + P  I  R IRGM+P+K   G  AL  ++VY G P   D      + D   +
Sbjct: 66  DRGPYYPKRPDGIFKRAIRGMLPYKQDDGREALDSVRVYVGNPMDEDG----DVLDGTSL 121

Query: 458 LRLQAGHKYCLLGKLSSEVGWN 523
            RL    ++  L ++S E+G N
Sbjct: 122 DRLST-IRFVTLSEVSEELGAN 142



>gb:AE017261_419340 Picrophilus torridus DSM 9790, complete genome.
          Length = 138

 Score = 65.9 bits (159), Expect = 9e-10
 Identities = 35/103 (33%), Positives = 57/103 (55%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP 277
           + +DA +H+ GRL+S +AK+LLNG+ + +V   ++ ++G   R++    +F   R     
Sbjct: 2   IYIDASNHIYGRLSSYVAKKLLNGESITIVNASKVVITG---RKEFIIDKFNNLRNTGSI 58

Query: 278 SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVP 406
             GP + +   +IL R+I  M+P K   G  AL R  VY  VP
Sbjct: 59  RKGPYYPKTADRILKRSIGDMLPKKKTHGMEALKRCMVYANVP 101



>gb:TACID2_196205 Thermoplasma acidophilum complete genome; segment
           2/5.
          Length = 136

 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 35/109 (32%), Positives = 57/109 (52%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPS 280
           V+DA   + GRL++ +AK LL G+ + +V   +  ++G    ++    +F  +       
Sbjct: 3   VIDASGAIYGRLSAYVAKRLLEGEEITIVNASKAVITGN---KEFIIEKFKERLDIGSVR 59

Query: 281 HGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVK 427
            GP + + P  IL R+I  M+P K  +G  ALAR +VY   PP  +K K
Sbjct: 60  KGPYYPKTPENILRRSIGDMLPKKITKGKEALARCRVYRNTPPDIEKEK 108



>gb:AF337889_1263826 Ceratitis capitata putative 60S ribosomal
           protein L13a mRNA, partial cds.
          Length = 36

 Score = 62.8 bits (151), Expect = 8e-09
 Identities = 26/36 (72%), Positives = 33/36 (91%)
 Frame = +2

Query: 332 RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVI 439
           RGMIPHKTKRG AALARL+V++G+PPPYDK +R+ +
Sbjct: 1   RGMIPHKTKRGQAALARLRVFDGIPPPYDKRRRVCV 36



>sp|P39473|RL13_SULAC 50S ribosomal protein L13P.>pir|S47025|S47025
           ribosomal protein L13 - Sulfolobus
           acidocaldarius>gb:SARPSO_171872 S.acidocaldarius rps13,
           rps4, rps11, rpoD, rpH129e, rps9, rpl13, rpoN and nsp1
           genes.
          Length = 145

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 50/141 (35%), Positives = 72/141 (51%), Gaps = 1/141 (0%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH-RFLRKRMNTK 274
           V+VDA + +LGR+++ +AK L +G++V VV  E+  +SG   R    Y   F  K M   
Sbjct: 8   VIVDATNQILGRMSTHIAKLLKSGKKVYVVNAEKAIISGPRSRVLEGYSLLFTVKTMQNP 67

Query: 275 PSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALK 454
              G    R P  I+ RT+RGM+P K K G      LK Y G+     + K M+  D   
Sbjct: 68  YRQGIRRPRNPINIVKRTVRGMLP-KNKLGKQIYRNLKAYIGIL----EGKSMIRFDDAD 122

Query: 455 VLRLQAGHKYCLLGKLSSEVG 517
           V RL+   KY  + +LS  +G
Sbjct: 123 VSRLKG--KYITVAELSRLLG 141



>pir|A96815|A96815 hypothetical protein T30F21.4 [imported] -
           Arabidopsis thaliana>gb:AE005173_895381 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC007260_1535701 Arabidopsis thaliana
           chromosome I BAC T30F21 genomic sequence, complete
           sequence.>gb:ATRPL13GE_1554090 A.thaliana rpl13
           gene.>gb:AY063105_1565680 Arabidopsis thaliana putative
           ribosomal protein L13 (At1g78630) mRNA, complete
           cds.>gb:AF370318_1792201 Arabidopsis thaliana putative
           ribosomal protein L13 (At1g78630) mRNA, complete cds.
          Length = 241

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 43/135 (31%), Positives = 65/135 (48%), Gaps = 12/135 (8%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA   +LGRLAS +A  +              G  V+VV  E++ +SG    QK+   
Sbjct: 107 VVDATDKILGRLASTIANHIRGKNLASYTPSVDMGAFVIVVNAEKVAVSGKKRNQKLYRR 166

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
              R    T  +   +  R P +I+   +RGM+P K + G A    LKVY+G   P++  
Sbjct: 167 HSGRPGGMTVETFDQLQQRIPERIVEHAVRGMLP-KGRLGRALFNHLKVYKGPDHPHEAQ 225

Query: 425 KRMVIPDALKVLRLQ 469
           K + +P   K ++LQ
Sbjct: 226 KPLDLPIRDKRIQLQ 240



>gb:AP003076_1824653 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0481E12.
          Length = 233

 Score = 56.2 bits (134), Expect = 7e-07
 Identities = 43/139 (30%), Positives = 65/139 (46%), Gaps = 12/139 (8%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA   +LGRLAS +A  +              G  VVVV  E++ +SG    QK+   
Sbjct: 98  VVDATDKILGRLASTIAVHIRGKNEATYTPSVDMGAFVVVVNAEKVAVSGKKRSQKLYRR 157

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
              R     + +   +  R P +I+   +RGM+P K + G      LKVY+G   P++  
Sbjct: 158 HSGRPGGMKEETFDQLQKRIPERIIEHAVRGMLP-KGRLGRRLFTHLKVYKGAEHPHEAQ 216

Query: 425 KRMVIPDALKVLRLQAGHK 481
           K + +P  +K  R+Q   K
Sbjct: 217 KPVPLP--IKDKRIQKSEK 233



>gb:AE017317_440762 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 9 of 12 of the complete
           genome.>gb:AE017285_1073923 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 144

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 39/117 (33%), Positives = 59/117 (50%), Gaps = 12/117 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA   +LGRLA+ +A  L             NG  +VVV CE+I ++G  + QK  Y+
Sbjct: 17  VVDAEDKILGRLATQIAHRLRGKHKPEFAPHMDNGDFIVVVNCEKIKVTGKKLDQKKYYN 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
                    + S   +    P ++L + +RGM+P + + G A L +LKVY G   P+
Sbjct: 77  HSGYVGGLRETSLEKLLASKPEEVLLKAVRGMLP-RNRLGRAMLTKLKVYRGTEHPH 132



>gb:BA000045_744493 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 152

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 42/141 (29%), Positives = 64/141 (45%), Gaps = 12/141 (8%)
 Frame = +2

Query: 92  RRVVVDARHHMLGRLASILAK------------ELLNGQRVVVVRCEEICLSGGLVRQKM 235
           R +VVDA    LGRLAS++A              L  G  V+VV  E++ ++G    QK+
Sbjct: 16  RWLVVDAAGQHLGRLASVVANLIRGKHRPNFTPHLDTGDFVIVVNAEKVEVTGKKSSQKL 75

Query: 236 KYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
                 R       +   +  R P +I+ + I GM+PH T+ G     +LKVY+G   P+
Sbjct: 76  YRRSSGRPGGMKVETFSHLQARLPERIVEKAIWGMLPH-TRLGRQQFTKLKVYKGPAHPH 134

Query: 416 DKVKRMVIPDALKVLRLQAGH 478
              K    P+   +  +  GH
Sbjct: 135 AAQK----PEVFDLSTVLGGH 151



>gb:CR522870_100172 Desulfotalea psychrophila LSv54 chromosome.
          Length = 142

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 39/117 (33%), Positives = 56/117 (47%), Gaps = 12/117 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA + +LGRLAS +A  L             NG  +VV   E+I L+G     K  Y 
Sbjct: 17  VVDAENKVLGRLASEIASRLRGKHKPTFSSFIDNGDFIVVTNAEKIALTGKKWDDKTYYR 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
                    + S   +  + P+ ++ + +RGM+P K K G A L +LKVY G   P+
Sbjct: 77  HTGYIGGIKETSAKELLEKHPTDLITKAVRGMLP-KNKMGRAQLKKLKVYVGAAHPH 132



>gb:BX248584_763678 Blochmannia floridanus complete genome; segment
           1/3.
          Length = 139

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 32/112 (28%), Positives = 57/112 (50%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           +VDA++ +LGRL+S +AK L+             G  ++V+  +++C++G   + K+ Y 
Sbjct: 13  IVDAKNKVLGRLSSNIAKYLIGKHKVEYAPYVDVGDYIIVINSKDVCVTGRKYKDKIYYR 72

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
                    K +   +    P+K++  ++RGM+P K   G     RLKVY G
Sbjct: 73  HTGYVGGIKKLTFKQMIMSYPNKVIESSVRGMLP-KNSLGRMMFKRLKVYSG 123



>gb:AE012556_284169 Xylella fastidiosa Temecula1, section 4 of 9 of
           the complete genome.>gb:AE009442_960745 Xylella
           fastidiosa Temecula1, complete genome.
          Length = 142

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 42/126 (33%), Positives = 61/126 (48%), Gaps = 13/126 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           +VDA    LGRLA+ LA+ LL             G  +VV+  E++ ++G  +  K  YH
Sbjct: 17  LVDAEGKTLGRLATELARRLLGKTKPVYTPHVDTGDYLVVINAEKVVVTGKKLTDKY-YH 75

Query: 245 RFLRKRMNTK-PSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK 421
           RF     N K  S G    R P ++L   ++GM+P K   G A   +LKVY G   P+  
Sbjct: 76  RFTGYVGNLKSESLGQALQRHPERVLEIAVKGMLP-KGPLGRAMYRKLKVYTGSKHPHTA 134

Query: 422 VKRMVI 439
            +  V+
Sbjct: 135 QQPQVL 140



>pir|F82669|F82669 50S ribosomal protein L13 XF1537 [imported] -
           Xylella fastidiosa (strain 9a5c)>gb:AE003983_49175
           Xylella fastidiosa 9a5c, section 129 of 229 of the
           complete genome.>gb:AE003849_1116385 Xylella fastidiosa
           9a5c, complete genome.
          Length = 142

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 41/118 (34%), Positives = 58/118 (49%), Gaps = 13/118 (11%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           +VDA    LGRLA+ LA+ LL             G  +VV+  E++ ++G  +  K  YH
Sbjct: 17  LVDAEGKTLGRLATELARRLLGKTKPVYTTHVDTGDYLVVINAEKVVVTGKKLTDKY-YH 75

Query: 245 RFLRKRMNTK-PSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
           RF     N K  S G    R P ++L   ++GM+P K   G A   +LKVY G   P+
Sbjct: 76  RFTGYVGNLKSESLGQALQRHPERVLEIAVKGMLP-KGPLGRAMYRKLKVYTGSKHPH 132



>gb:CP000027_79510 Dehalococcoides ethenogenes 195, complete genome.
          Length = 143

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 31/117 (26%), Positives = 57/117 (48%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH 244
           ++  SG     V  +A  +++G+   +  + L  G  VV++  +++ ++G  + QK+ Y 
Sbjct: 17  VIDASGRVLGEVAAEAAKYLMGKHKPMFCRNLDCGDYVVIINAKKVTVTGNKLDQKIYYR 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
                    +   G +    P  ++   ++GMIP  T  GA  LA+LKVYEG   P+
Sbjct: 77  HSGFPGGFRQEKLGDLLKTKPLFVIEHAVKGMIPRNTL-GAQILAKLKVYEGEEHPH 132



>gb:AF019739_1233298 Entamoeba dispar 60S ribosomal protein L13A
           mRNA, partial cds.
          Length = 54

 Score = 49.7 bits (117), Expect = 7e-05
 Identities = 22/43 (51%), Positives = 33/43 (76%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQ 229
           V+D   H+LGR+AS++AK LL GQ++V+VRCE++ + G L  Q
Sbjct: 8   VIDCHGHVLGRVASVVAKHLLLGQKIVLVRCEDLQVCGTLKMQ 50



>sp|Q9X1G5|RL13_THEMA 50S ribosomal protein L13.>pir|G72250|G72250
           ribosomal protein L13 - Thermotoga maritima (strain
           MSB8)>gb:AE001797_39350 Thermotoga maritima MSB8 section
           109 of 136 of the complete genome.>gb:AE000512_1113823
           Thermotoga maritima MSB8, complete genome.
          Length = 149

 Score = 49.7 bits (117), Expect = 7e-05
 Identities = 36/122 (29%), Positives = 61/122 (50%), Gaps = 13/122 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKY- 241
           VVDA   +LGRLA+ +AK L+             G  V+VV  +++ L+G  + QK+ Y 
Sbjct: 24  VVDASGKVLGRLATRIAKILMGKHKPNYTPHVDTGDYVIVVNADKVVLTGKKLDQKVYYW 83

Query: 242 HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK 421
           H      + +  +   +  + P +++W  ++ M+P K ++G   L RLKVY     P+  
Sbjct: 84  HSGYPGGLKSLTARQMLE-KHPERLIWLAVKRMLP-KNRKGRKMLKRLKVYASPEHPHQA 141

Query: 422 VK 427
            K
Sbjct: 142 QK 143



>gb:AY657292_2146302 Synthetic construct Peudomonas aeruginosa clone
           FLH043489.01F PA4433 gene, partial cds.
          Length = 143

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 12/117 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLA+ +A+ L              G  +VV+  E++ ++G     KM YH
Sbjct: 17  VVDAAGRTLGRLATEIARRLRGKHKPEYTPHVDTGDYIVVINAEQVRVTGAKTTDKMYYH 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
                      +   +  +AP +++   ++GM+P K   G     +LKVY+G   P+
Sbjct: 77  HSGFPGGIKSINFEKLIAKAPERVIETAVKGMLP-KNPLGRDMYRKLKVYKGASHPH 132



>gb:CR382130_1662722 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 147

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 41/126 (32%), Positives = 62/126 (49%), Gaps = 20/126 (15%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKY 241
           V V      LGRLA+ +A+ L              G  VVVV  +++  SG  ++QK  +
Sbjct: 12  VDVAKEQRTLGRLATSIAQTLQGKHKPVYNTGHDCGDYVVVVNADKLRFSGSKLQQKEYF 71

Query: 242 HRFLRKRMNTKPSHGP-------IHFRAPSKILWRTIRGMIP-HKTKRGAAALARLKVYE 397
            +      +++P H         I  +  S++L RT+ GM+P +K KRG   +ARLKV+E
Sbjct: 72  VQ------SSQPGHSHHVAVKRVIENQGVSEVLRRTVAGMLPRNKLKRGR--IARLKVFE 123

Query: 398 GVPPPY 415
           G   PY
Sbjct: 124 GTEHPY 129



>gb:AP006618_557260 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 147

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 34/118 (28%), Positives = 57/118 (48%), Gaps = 13/118 (11%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLNGQR-------------VVVVRCEEICLSGGLVRQKMKY 241
           V+DA   +LGRLA + A  LL G+              V+++  E++ +SG   + K+ +
Sbjct: 17  VIDATDVVLGRLA-VQAANLLRGKNKPTYAPHVDGGDFVIIINAEKVAISGNKRQDKLIH 75

Query: 242 HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
           H           + G +    P +++ + ++GMIP K K G A   +LKVY G   P+
Sbjct: 76  HHSGHPGGLKSRTVGQVLETRPERLVEKAVKGMIP-KNKLGNAIAGKLKVYAGPNHPH 132



>gb:AE013598_297854 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 142

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 38/118 (32%), Positives = 57/118 (48%), Gaps = 13/118 (11%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           +VDA    LGRL++ LA+ L              G  +VV+  E+I ++G  ++ K KYH
Sbjct: 17  LVDAAGKTLGRLSTELARRLRGKHKPVYTPHVDTGDYLVVINAEKIVVTGNKLKDK-KYH 75

Query: 245 RFLRKRMNTK-PSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
           RF     N K  S      R P +++   ++GM+P K   G     +LKVY G   P+
Sbjct: 76  RFTGYIGNLKTESLEQALQRHPERVIEIAVKGMLP-KGPMGRTMYRKLKVYSGAEHPH 132



>pir|A83093|A83093 50S ribosomal protein L13 PA4433 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004857_58668
           Pseudomonas aeruginosa PAO1, section 418 of 529 of the
           complete genome.>gb:AE004091_972768 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 142

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 12/117 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLA+ +A+ L              G  +VV+  E++ ++G     KM YH
Sbjct: 17  VVDAAGQTLGRLATEIARRLRGKHKPEYTPHVDTGDYIVVINAEQVRVTGAKTTDKMYYH 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
                      +   +  +AP +++   ++GM+P K   G     +LKVY+G   P+
Sbjct: 77  HSGFPGGIKSINFEKLIAKAPERVIETAVKGMLP-KNPLGRDMYRKLKVYKGASHPH 132



>sp|P12629|RK13_SPIOL 50S ribosomal protein L13, chloroplast
           precursor (CL13).>pir|A32033|A32033 ribosomal protein
           L13 precursor, chloroplast - spinach>gb:SPIRPL13_1721887
           Spinach chloroplast ribosomal protein L13 mRNA, complete
           cds.
          Length = 250

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 39/135 (28%), Positives = 65/135 (48%), Gaps = 12/135 (8%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILA-----KELLN-------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA   +LGR+AS +A     K L +       G  V+VV  +++ +SG    QK+   
Sbjct: 116 VVDATDLILGRMASTIAIHIRGKNLASYTPSVDMGAFVIVVNADKVAVSGKKRTQKLYRR 175

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
              R     + +   +  R P +I+   +RGM+P K + G      LKVY+G   P+   
Sbjct: 176 HSGRPGGLKEETFDQLQKRIPERIIEHAVRGMLP-KGRLGRYLFNHLKVYKGAEHPHQAQ 234

Query: 425 KRMVIPDALKVLRLQ 469
           + + +P   K +R++
Sbjct: 235 QPIDLPLRDKRIRVE 249



>gb:BX572100_799100 Prochlorococcus marinus MIT9313 complete genome;
           segment 6/7.
          Length = 150

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 36/117 (30%), Positives = 53/117 (45%), Gaps = 12/117 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           +VDA +  LGRLA+ +A  L              G  VVVV  ++I +SG    QK+   
Sbjct: 18  LVDAENQTLGRLATEVASVLRGKNKPSFTPHLDTGDFVVVVNADKIRVSGNKANQKLYRR 77

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
              R       +   +  R P +I+ + I+GM+PH    G     +LKVY G   P+
Sbjct: 78  HSGRPGGMKVETFQALQDRLPERIVEKAIKGMLPHNA-LGRQLFRKLKVYRGPEHPH 133



>gb:BX569694_776995 Synechococcus sp. WH8102 complete genome;
           segment 6/7.
          Length = 150

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 37/117 (31%), Positives = 54/117 (46%), Gaps = 12/117 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           +VDA +  LGRLA+ +A  L              G  VVVV  E+I +SG    QK+   
Sbjct: 18  LVDAENKTLGRLATEVAAVLRGKNNPSFTPHLDTGDFVVVVNAEKIRVSGSKPTQKLYRR 77

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
              R       +   +  R P +I+ + I+GM+PH    G     +LKVY+G   P+
Sbjct: 78  HSGRPGGMKTETFEALQDRIPERIVEKAIKGMLPHNA-LGRQMFRKLKVYKGSEHPH 133



>gb:AE011675_275449 Xanthomonas axonopodis pv. citri str. 306,
           section 53 of 469 of the complete
           genome.>gb:AE012145_279750 Xanthomonas campestris pv.
           campestris str. ATCC 33913, section 53 of 460 of the
           complete genome.>gb:AE008922_913032 Xanthomonas
           campestris pv. campestris str. ATCC 33913, complete
           genome.>gb:AE008923_917224 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 142

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 38/118 (32%), Positives = 57/118 (48%), Gaps = 13/118 (11%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           +VDA    LGRL++ LA+ L              G  +VV+  E+I ++G  ++ K KYH
Sbjct: 17  LVDAAGKTLGRLSTELARRLRGKHKPVYTPHVDTGDYLVVINAEKIVVTGNKLKDK-KYH 75

Query: 245 RFLRKRMNTK-PSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
           RF     N K  S      R P +++   ++GM+P K   G     +LKVY G   P+
Sbjct: 76  RFTGYIGNLKTESLEQALQRHPERVIEIAVKGMLP-KGPLGRTMYRKLKVYSGAEHPH 132



>gb:AE011499_273644 Leptospira interrogans serovar lai str. 56601
           chromosome I, section 308 of 397 of the complete
           sequence.>gb:AE017290_432987 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           section 4 of 14 of the complete
           sequence.>gb:AE010300_1007043 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete
           sequence.>gb:AE016823_1065998 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           complete sequence.
          Length = 149

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 31/112 (27%), Positives = 51/112 (45%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLAS +A  L              G  ++V+   ++ ++G    QK  YH
Sbjct: 24  VVDAEGKTLGRLASGIAARLRGKHKATFTPNQDCGDNIIVINASKVKVTGNKETQKKYYH 83

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
                   T+     +  + P K+++  ++GM+P K+K G   L   K++ G
Sbjct: 84  HSRYPGGMTETVFKDLIAKQPEKVIYEAVKGMLP-KSKLGDKMLTHCKIFSG 134



>gb:AE017354_461051 Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1, complete genome.
          Length = 152

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 12/117 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA   +LGRLA+ +A+ L              G  ++V   E++ ++G   + KM +H
Sbjct: 25  VVDASEKVLGRLATEIARRLRGKHKAEYTPHVDTGDYIIVTNAEKVIVTGRKFKNKMYHH 84

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
                      S   +  + P+KI+   ++GM+P K   G     +LKVY G   P+
Sbjct: 85  HTGFPGGIKSASFEKLQDKNPTKIIELAVKGMLP-KNPLGREMYRKLKVYAGSEHPH 140



>gb:AE013170_289826 Thermoanaerobacter tengcongensis MB4, section
           197 of 244 of the complete genome.>gb:AE008691_1111891
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 143

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 38/136 (27%), Positives = 62/136 (45%), Gaps = 24/136 (17%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICL 208
           M   S +  +  V+DA   +LGRLAS +AK L+             G  VVV+  +++ L
Sbjct: 5   MAKPSDVERKWFVIDAEGKVLGRLASQIAKILMGKHKPTYTPHVDTGDFVVVINADKVVL 64

Query: 209 SGGLVRQKMKYHRF------------LRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHK 352
           +G  +    KY+++             +K M TKP            +++  ++GM+P K
Sbjct: 65  TGKKLED--KYYKYYTGYPGGLKQIQYKKLMQTKPEF----------VIYHAVKGMLP-K 111

Query: 353 TKRGAAALARLKVYEG 400
            + G   + RLKVY G
Sbjct: 112 NRLGRRMIKRLKVYRG 127



>gb:CR628337_115840 Legionella pneumophila str. Lens complete
           genome.
          Length = 144

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 12/117 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA   +LGRLA+ +A+ L              G  ++V   E++ ++G   + KM +H
Sbjct: 17  VVDASEKVLGRLATEIARRLRGKHKAEYTPHVDTGDYIIVTNAEKVIVTGRKFKNKMYHH 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
                      S   +  + P+KI+   ++GM+P K   G     +LKVY G   P+
Sbjct: 77  HTGFPGGIKSASFEKLQDKNPTKIIELAVKGMLP-KNPLGREMYRKLKVYAGSEHPH 132



>gb:CR628336_112879 Legionella pneumophila str. Paris complete
           genome.
          Length = 144

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 12/117 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA   +LGRLA+ +A+ L              G  ++V   E++ ++G   + KM +H
Sbjct: 17  VVDASEKVLGRLATEIARRLRGKHKAEYTPHVDTGDYIIVTNAEKVVVTGRKFKNKMYHH 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
                      S   +  + P+KI+   ++GM+P K   G     +LKVY G   P+
Sbjct: 77  HTGFPGGIKSASFEKLQDKNPTKIIELAVKGMLP-KNPLGREMYRKLKVYAGSEHPH 132



>pir|AE2329|AE2329 50S ribosomal protein L13 [imported] - Nostoc sp.
           (strain PCC 7120)>gb:BA000019_685177 Nostoc sp. PCC 7120
           DNA, complete genome.
          Length = 151

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 36/121 (29%), Positives = 53/121 (43%), Gaps = 12/121 (9%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAK------------ELLNGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLAS +A              L  G  V+VV  +++ ++G    QK+   
Sbjct: 18  VVDATDKRLGRLASEIAMILRGKNKAHYTPHLDTGDFVIVVNAKKVAVTGKKRTQKLYRR 77

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
              R       +   +  R P +I+   ++GM+P K   G     +LKVY G   P+D  
Sbjct: 78  HSGRPGGMKTETFAKLQQRLPERIVEHAVKGMLP-KNSLGKQLFTKLKVYAGPTHPHDAQ 136

Query: 425 K 427
           K
Sbjct: 137 K 137



>sp|Q53874|RL13_STRCO 50S ribosomal protein L13.>pir|T35563|T35563
           ribosomal protein L13 - Streptomyces
           coelicolor>gb:SCO939121_178406 Streptomyces coelicolor
           A3(2) complete genome; segment 18/29.>gb:SCU43429_181727
           Streptomyces coelicolor ribosomal protein L13 (rplM) and
           S9 (rpsI) genes, complete cds.
          Length = 147

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 34/117 (29%), Positives = 56/117 (47%), Gaps = 12/117 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLAS------------ILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH 244
           V+DA+  +LGRLA+            I A  +  G  V+++  +++ LSG    QKM Y 
Sbjct: 17  VIDAQDVVLGRLATTAASILRGKHKPIYAPHVDTGDFVIIINADKVHLSGNKRTQKMAYR 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
                       +  +  + P K + + I+GM+P K   G   L++LKVY+G   P+
Sbjct: 77  HSGYPGGLRSVRYDELLDKNPEKAVEKAIKGMLP-KNSLGRQMLSKLKVYKGDQHPH 132



>gb:AF207696_1251010 Limax marginatus ribosomal protein-like protein
           mRNA, partial cds.
          Length = 63

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 23/60 (38%), Positives = 35/60 (58%)
 Frame = +2

Query: 497 KLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSV 676
           +LS EVGW +   +  LE KRK +++  YER+K L  LR +A+K    ++     ILS +
Sbjct: 2   RLSHEVGWKYQRVVATLEAKRKVKSKHFYERKKHLLNLREQAKKNVATKIAPYQKILSEL 61



>gb:AY548459_627484 Fremyella diplosiphon clone 3098E8 30S ribosomal
           subunit S9, 50S ribosomal subunit L13, putative t-RNA
           pseudouridine synthase I, putative 50S ribosomal subunit
           L17, and putative RNA polymerase alpha subunit genes,
           complete cds.
          Length = 158

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 39/131 (29%), Positives = 56/131 (42%), Gaps = 12/131 (9%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILA------------KELLNGQRVVVVRCEEICLSGGLVRQKMKYH 244
           +VDA    LGRLAS +A              L  G  V+V+  E+I ++G    QK+   
Sbjct: 25  IVDATDQRLGRLASEIAMVLRGKKKAEYTPHLDTGDFVIVINAEKIAVTGKKRTQKLYRR 84

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
              R       +   +  R P +I+   ++GM+P K   G     +LKVY G   P+   
Sbjct: 85  HSGRPGGMKTETFAKLQQRIPERIVEHAVKGMLP-KNSLGKQLFTKLKVYAGPTHPHAAQ 143

Query: 425 KRMVIPDALKV 457
           K    P  LKV
Sbjct: 144 K----PKELKV 150



>pir|B82308|B82308 ribosomal protein L13 VC0570 [imported] - Vibrio
           cholerae  (strain N16961 serogroup O1)>gb:AE004142_50968
           Vibrio cholerae O1 biovar eltor str. N16961 chromosome
           I, section 50 of 251 of the complete
           chromosome.>gb:AE003852_1051742 Vibrio cholerae O1
           biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 142

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 38/113 (33%), Positives = 52/113 (46%), Gaps = 13/113 (11%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLAS +A  L              G  ++VV  E++ ++G   + KM YH
Sbjct: 17  VVDAEGKTLGRLASEIASRLRGKHKAEYTPHVDTGDYIIVVNAEKVTVTGNKAKNKM-YH 75

Query: 245 RFLRKRMNTKP-SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
           R        K  S   +  R P  +L   ++GM+P K   G A   +LKVY G
Sbjct: 76  RHSEFPGGLKSFSFEKLIERKPEMVLELAVKGMLP-KGPLGRAMYRKLKVYAG 127



>sp|Q9RXY1|RL13_DEIRA 50S ribosomal protein L13.>pir|E75552|E75552
           ribosomal protein L13 - Deinococcus radiodurans (strain
           R1)>gb:AE001879_40459 Deinococcus radiodurans R1 section
           16 of 229 of the complete chromosome
           1.>gb:AE000513_881354 Deinococcus radiodurans R1
           complete chromosome 1.
          Length = 174

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 37/128 (28%), Positives = 64/128 (50%), Gaps = 14/128 (10%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKEL------------LNGQRVVVVRCEEICLSGGLVRQKMKY 241
           VVVDA    LGRLA+++A  +            + G  VVV+   ++ L+G  +  K+ Y
Sbjct: 42  VVVDASGVPLGRLATLIASRIRGKHRPDFTPNMIQGDFVVVINAAQVALTGKKLDDKV-Y 100

Query: 242 HRF--LRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
            R+   +  + T+ +   +  + P +++   + GM+P K ++G A   RLKVY G   P+
Sbjct: 101 TRYTGYQGGLKTETAREALS-KHPERVIEHAVFGMLP-KGRQGRAMHTRLKVYAGETHPH 158

Query: 416 DKVKRMVI 439
              K  V+
Sbjct: 159 SAQKPQVL 166



>gb:AY267641_1314464 Bigelowiella natans ribosomal protein rpL13
           mRNA, complete cds; nuclear gene for plastid product.
          Length = 273

 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 34/124 (27%), Positives = 60/124 (48%), Gaps = 14/124 (11%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKY 241
           +V+DA+  +LGRLAS+ A  ++             G  VV++  +++ ++G     K+ Y
Sbjct: 127 IVLDAQDQILGRLASLAATLVMGKWHPLYHPAMNMGAHVVIINADKVRVTGRKYTDKL-Y 185

Query: 242 HRFLRKRMNTKPSHG--PIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
            R +  R  +  S     +  R P +I+   I+GM+P KT+ G     +L +Y G   P+
Sbjct: 186 KRHVTGRPGSMKSEAFRDLQARIPERIVEVAIKGMLP-KTRLGREQFKQLHIYAGDENPH 244

Query: 416 DKVK 427
              K
Sbjct: 245 TSQK 248



>gb:BA000030_702844 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 147

 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 34/117 (29%), Positives = 54/117 (46%), Gaps = 12/117 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           V+DA+  +LGRLA+  A  L              G  V+++  +++ LSG    QK+ Y 
Sbjct: 17  VIDAQDVVLGRLATTAANILRGKHKPIYAPHVDAGDFVIIINADKVHLSGNKKTQKLAYR 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
                       +  +  + P K + + I+GMIP K   G   L++LKVY G   P+
Sbjct: 77  HSGYPGGLRSVRYDELLAKNPEKAVEKAIKGMIP-KNTLGRQVLSKLKVYSGDQHPH 132



>gb:AE017166_396141 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 6 of 6 of the complete
           genome.>gb:AE017126_1031810 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 150

 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 35/125 (28%), Positives = 56/125 (44%), Gaps = 12/125 (9%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           +VDA +  LGRLA+ +A  L              G  V++V  E+I ++G    QK+   
Sbjct: 18  LVDAENQTLGRLATEVASVLRGKNKPSFTPHLDTGDFVIIVNAEKIKVTGKKGMQKLYRR 77

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
              R       +   +  R P +I+ + I+GM+PH    G     +LKVY+G   P+   
Sbjct: 78  HSGRPGGMKVETFNSLQERIPERIVEKAIKGMLPHNA-LGRQLFRKLKVYKGSEHPHSAQ 136

Query: 425 KRMVI 439
              V+
Sbjct: 137 NPQVL 141



>gb:AP008231_581586 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 151

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 32/117 (27%), Positives = 53/117 (45%), Gaps = 12/117 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLA+ +A+ L              G  V+V+  +++ ++G    QK+   
Sbjct: 18  VVDAADQRLGRLATEIARVLRGKHKPTYTPHMDTGDFVIVINADKVTVTGRKASQKLYRR 77

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
              R       +   +  R P +I+ + ++GM+P K   G     +LKVY G   P+
Sbjct: 78  HSGRPGGMKVETFAHLQQRLPERIIEQAVKGMLP-KNALGRQLFTKLKVYRGAEHPH 133



>gb:AP006840_570228 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 143

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 40/131 (30%), Positives = 58/131 (44%), Gaps = 12/131 (9%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLAS +A  L              G  V++V  E+I ++G  V  K+ Y 
Sbjct: 18  VVDAEGKTLGRLASKVAAILRGKHKPTFTPHVDCGDFVIIVNAEKIQVTGKKVTDKVYYR 77

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
                      +   +  R P ++L   I+GM+PH  + G     +LKVY G   P+   
Sbjct: 78  HSGYPGGQKATTFEQMIARRPERVLELAIKGMLPH-NRLGRQMYRKLKVYAGPEHPHAAQ 136

Query: 425 KRMVIPDALKV 457
           K    P+ L+V
Sbjct: 137 K----PEPLEV 143



>pir|F86906|F86906 50S ribosomal protein L13 [imported] -
           Lactococcus lactis subsp. lactis (strain
           IL1403)>gb:AE006454_219156 Lactococcus lactis subsp.
           lactis IL1403 section 216 of 218 of the complete
           genome.>gb:AE005176_1096229 Lactococcus lactis subsp.
           lactis IL1403, complete genome.
          Length = 148

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 36/137 (26%), Positives = 62/137 (45%), Gaps = 12/137 (8%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICL 208
           M +   +  +  VVDA    LGRL++++A  L              G  V+VV  E+I L
Sbjct: 7   MANAQNVDRKWYVVDATDVPLGRLSAVVASVLRGKNKPTYTPHTDTGDFVIVVNAEKIKL 66

Query: 209 SGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLK 388
           +G     K+ Y   L        + G +  +   +++ ++++GM+PH T  G A   +LK
Sbjct: 67  TGKKATDKVYYSHSLHPGGLKSVTAGELREKNAVRLIEKSVKGMLPHNT-LGRAQGMKLK 125

Query: 389 VYEGVPPPYDKVKRMVI 439
           V+ G    +   K  V+
Sbjct: 126 VFVGAEHTHTAQKPEVL 142



>gb:AE017180_401165 Geobacter sulfurreducens PCA, complete genome.
          Length = 143

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 34/118 (28%), Positives = 56/118 (47%), Gaps = 12/118 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           +VDA + +LGR+A+ +A  L              G  VVVV   ++ L+G  +  KM YH
Sbjct: 18  LVDADNKVLGRMATEIANILRGKKKPIYTPSVDTGDFVVVVNAAKLQLTGNKLADKMYYH 77

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYD 418
                      + G +  + P  ++ + ++GM+P K K     L +LKVY G   P++
Sbjct: 78  HTGFPGGIKSITAGKLIEKKPEDLIRKAVKGMLP-KNKLARHMLKKLKVYAGPEHPHE 134



>gb:AE016822_340945 Leifsonia xyli subsp. xyli str. CTCB07, complete
           genome.
          Length = 148

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 33/118 (27%), Positives = 54/118 (45%), Gaps = 12/118 (10%)
 Frame = +2

Query: 98  VVVDARHHMLGRLAS------------ILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 241
           VV+DA + +LGRLAS              A  +  G  V++V  +++  +G  V QK  Y
Sbjct: 17  VVIDATNVVLGRLASHTAALLRGKHKATFAPHMDTGDFVIIVNADKVAFTGQKVAQKKAY 76

Query: 242 HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
                       ++  +  + P + + + +RGM+P K   G A   +LKVY G   P+
Sbjct: 77  RHSGYPGGLKAVTYAELLEKNPVRAVEKAVRGMLP-KNSIGRAQFRKLKVYTGSEHPH 133



>sp|P38014|RL13_MYCLE 50S ribosomal protein L13.>pir|S72991|S72991
           ribosomal protein L13 - Mycobacterium
           leprae>gb:MLEPRTN2_146164 Mycobacterium leprae strain TN
           complete genome; segment 2/10.>gb:U00020_199026
           Mycobacterium leprae cosmid B229.
          Length = 147

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 12/117 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           V+DA   +LGRLA++ A  L              G  V+V+  +++ +SG  V+ KM Y 
Sbjct: 17  VIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDGGDFVIVINADKVAISGDKVQHKMVYR 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
                    K + G +  + P +++ + I GM+P K K       +L+VY G   P+
Sbjct: 77  HSGYPGGLRKRTIGELMQKHPDRVVEKAIVGMLP-KNKLSRQIQRKLRVYAGPDHPH 132



>gb:BX321861_773812 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 6/10.
          Length = 144

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 32/117 (27%), Positives = 55/117 (47%), Gaps = 12/117 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA   +LGRLA+ +A  L              G  +VV+  +++ ++G     K  Y 
Sbjct: 17  VVDATDKVLGRLAAAIAHRLRGKHKPIYTPHVDTGDYIVVINADKLRVTGNKAEDKKYYR 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
                    + +   +H R P++ L + ++GM+P K   G A + +LK+Y G   P+
Sbjct: 77  HSGYPGGIYETTFKKMHERFPTRPLEKAVKGMLP-KGPLGYAMIKKLKIYAGDTHPH 132



>gb:BA000039_725893 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 152

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 35/122 (28%), Positives = 56/122 (45%), Gaps = 13/122 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           V+DA    LGRLA+ +A+ L              G  V+V+  E++ ++G    QK+ Y 
Sbjct: 21  VIDAADQRLGRLAAEIARILRGKNKAIYTPHMDTGDFVIVINAEKVTVTGKKRSQKL-YR 79

Query: 245 RFLRKRMNTK-PSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK 421
           R   +    K  +   +  R P +I+   ++GM+P K   G     +LKVY G   P+  
Sbjct: 80  RHSGRPGGMKIETFDQLQARIPERIIEHAVKGMLP-KNSLGRKLFTKLKVYAGPEHPHQA 138

Query: 422 VK 427
            K
Sbjct: 139 QK 140



>gb:AE017332_445927 Mycoplasma hyopneumoniae 232, complete genome.
          Length = 144

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 35/118 (29%), Positives = 54/118 (45%), Gaps = 13/118 (11%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKY- 241
           V+DA   +LGRLA+ +A  L              G +++++  E+I L+     QK+ Y 
Sbjct: 18  VIDAESKILGRLAAFVASRLRGKHYPHFTPNVDMGDKIIIINAEKILLTAKKEDQKLYYN 77

Query: 242 HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
           H      +  + +   +  + P  +L R I GMIPH TK G      L VY G   P+
Sbjct: 78  HSGYPGGLRVRTAR-EMRAKKPIALLERAIYGMIPH-TKLGDKQRKNLYVYSGSEHPH 133



>gb:BX294151_770787 Pirellula sp. strain 1 complete genome; segment
           19/24.
          Length = 151

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 35/117 (29%), Positives = 55/117 (47%), Gaps = 12/117 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA   +LGRLAS +A  L+             G  V+V   ++I ++G  +R +  Y 
Sbjct: 20  VVDASDEVLGRLASDIAVVLMGKHRPEYTPHVDCGDFVIVTNADKIGMTGNKMRDR-HYT 78

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
            +         S+   H R P  +L+  +R M+P K K     L++LK+Y G   P+
Sbjct: 79  WYTGYPGLRLESYQDRHDRKPEYLLYHAVRRMLP-KNKLARQMLSKLKIYAGPEHPH 134



>gb:AL935254_550956 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 3/11.
          Length = 147

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 30/112 (26%), Positives = 53/112 (47%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRL++++A  L              G  V+V+   ++ L+G    +K+ YH
Sbjct: 18  VVDATDVPLGRLSTVVASILRGKNKPTFTPNVDTGDNVIVINASKVALTGKKAERKIYYH 77

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
                    + + G    + P+K++  +++GM+PH +      L +L VY G
Sbjct: 78  HTAYAGGLKERTAGDFLAKEPTKLIETSVKGMLPHNSLGHKMGL-KLHVYAG 128



>gb:AE017282_427686 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 142

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 36/113 (31%), Positives = 55/113 (48%), Gaps = 13/113 (11%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRL++ +A+ L              G  +VVV  E++ ++G   + K+ Y+
Sbjct: 17  VVDAEGKTLGRLSTEIARRLRGKHKPEYTPHVDTGDYIVVVNAEKVRVTGNKEQDKI-YY 75

Query: 245 RFLRKRMNTKP-SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
           +      N K  S G +  R P  I+   ++GM+P K   G A   +LKVY G
Sbjct: 76  KHTGYIGNMKSISLGKLRDRRPELIIETAVKGMLP-KNPLGRAMFRKLKVYAG 127



>gb:AE016923_358658 Chromobacterium violaceum ATCC 12472 section 14
           of 16 of the complete genome.>gb:AE016825_1043812
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 142

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 33/117 (28%), Positives = 56/117 (47%), Gaps = 12/117 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA   +LGRLA+ +A+ L              G  +VVV  E++ ++G   + K  Y 
Sbjct: 17  VVDAADKVLGRLAAEIARRLRGKHKPEFTPHVDTGDFIVVVNVEKLRVTGTKAQDKKYYR 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
                    + +   +  + P ++L + ++GM+P K   G A + +LKVY G   P+
Sbjct: 77  HSGYPGGIYERTFTELQNQFPERVLEKAVKGMLP-KGPLGYAMIKKLKVYSGSEHPH 132



>gb:CR555306_105908 Azoarcus sp. EbN1 complete genome.
          Length = 142

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 35/125 (28%), Positives = 57/125 (45%), Gaps = 12/125 (9%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA   +LGRLA+ +A+ L              G  +VVV  E++ ++G     K  Y 
Sbjct: 17  VVDASDKVLGRLAAEVARRLRGKHKAIYTPHVDTGDFIVVVNVEKLRVTGNKALDKKYYR 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
                    + +   +  R P ++L + ++GM+P K   G A L +LK Y G   P+   
Sbjct: 77  HTGYPGGIYETNFTKLQQRFPERVLEKAVKGMLP-KGPLGYAMLKKLKCYAGGEHPHSAQ 135

Query: 425 KRMVI 439
           +  V+
Sbjct: 136 QPQVL 140



>sp|P73294|RL13_SYNY3 50S ribosomal protein L13.>pir|S77475|S77475
           ribosomal protein L13 - Synechocystis sp. (strain PCC
           6803)>gb:BA000022_688101 Synechocystis sp. PCC 6803 DNA,
           complete genome.
          Length = 151

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 37/137 (27%), Positives = 60/137 (43%), Gaps = 12/137 (8%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           V+DA    LGRLA+ +A  L              G  V+++  E+I ++G    QK+   
Sbjct: 18  VIDAEGQRLGRLATEVATILRGKNKPTFTPHMDTGDFVIIINAEKIEVTGRKREQKLYRR 77

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
              R     + +   +  R P +I+   +RGM+P K   G     +LKVY G   P+   
Sbjct: 78  HSGRPGGMKEETFEKLQVRLPERIVESAVRGMLP-KNSLGRKLFTKLKVYAGPSHPHAAQ 136

Query: 425 KRMVIPDALKVLRLQAG 475
           +    P+ L +  + AG
Sbjct: 137 Q----PETLVINTIPAG 149



>gb:BX572094_797158 Prochlorococcus marinus MED4 complete genome;
           segment 5/5.
          Length = 143

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 12/117 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           +VDA+   LGRL++ +A  L              G  V+VV  E++ ++G    QK+   
Sbjct: 18  LVDAKDKTLGRLSTEIAAVLRGKNKPTFTPHLDTGDFVIVVNAEKVEVTGKKASQKLYRR 77

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
              R           +  R P +I+ + ++GM+PH +  G     +LKVY+G   P+
Sbjct: 78  HSGRPGGMKVEKFESLQERIPERIIEQAVKGMLPHNS-LGRQQFKKLKVYKGSDHPH 133



>gb:BX640435_812119 Bordetella parapertussis strain 12822, complete
           genome; segment 13/14.>gb:BX640450_817005 Bordetella
           bronchiseptica strain RB50, complete genome; segment
           14/16.
          Length = 155

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 29/117 (24%), Positives = 54/117 (46%), Gaps = 12/117 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           V+DA+  +LGR+AS +A  L              G  +V++   +I ++G   + K  + 
Sbjct: 30  VIDAKGKVLGRVASEVAHRLRGKHKPEFTPHVDTGDYIVIINAADIVVTGNKAQDKKYFR 89

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
                    + +   +  R P + + + ++GM+P K   G A + +LKVY G   P+
Sbjct: 90  HTTYPGGIRETNFEKMQQRFPGRAIQKAVKGMLP-KGPLGYAMIKKLKVYAGAEHPH 145



>gb:BX640420_807362 Bordetella pertussis strain Tohama I, complete
           genome; segment 10/12.
          Length = 142

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 29/117 (24%), Positives = 54/117 (46%), Gaps = 12/117 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           V+DA+  +LGR+AS +A  L              G  +V++   +I ++G   + K  + 
Sbjct: 17  VIDAKGKVLGRVASEVAHRLRGKHKPEFTPHVDTGDYIVIINAADIVVTGNKAQDKKYFR 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
                    + +   +  R P + + + ++GM+P K   G A + +LKVY G   P+
Sbjct: 77  HTTYPGGIRETNFEKMQQRFPGRAIQKAVKGMLP-KGPLGYAMIKKLKVYAGAEHPH 132



>sp|P70974|RL13_BACSU 50S ribosomal protein L13.>pir|G69695|G69695
           ribosomal protein L13 rplM - Bacillus
           subtilis>gb:D64126_120269 Bacillus subtilis genes for
           ribosomal proteins L13 and S9, putative cell wall
           hydrolase CwlD, gerD protein, 16S ribosomal RNA and 23S
           ribosomal RNA.>gb:BSUB0001_752114 Bacillus subtilis
           complete genome (section 1 of 21): from 1 to 213080.
          Length = 145

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 41/135 (30%), Positives = 62/135 (45%), Gaps = 14/135 (10%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICL 208
           M + S I  + +VVDA    LGRL+S +A  L              G  V+++  E+I L
Sbjct: 6   MANASTIERKCLVVDAAGKTLGRLSSEVAAILRGKHKPTYTPHVDTGDHVIIINAEKIEL 65

Query: 209 SGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRA--PSKILWRTIRGMIPHKTKRGAAALAR 382
           +G  +  K+ Y+R  +     K S   +  R   P K+L   I+GM+P K   G     +
Sbjct: 66  TGKKLTDKI-YYRHTQHPGGLK-SRTALEMRTNYPEKMLELAIKGMLP-KGSLGRQMFKK 122

Query: 383 LKVYEGVPPPYDKVK 427
           L VY G   P++  K
Sbjct: 123 LNVYRGSEHPHEAQK 137



>gb:CP000023_874070 Streptococcus thermophilus LMG 18311, complete
           genome.>gb:CP000024_875957 Streptococcus thermophilus
           CNRZ1066, complete genome.
          Length = 148

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/112 (27%), Positives = 55/112 (49%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRL++++A  L              G  V+V+  E++ L+G     K+ Y 
Sbjct: 19  VVDATDVPLGRLSAVVASVLRGKNKPTFTPHTDTGDFVIVINAEKVKLTGKKATDKIYYT 78

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
             +      + S G +  +   +++ ++++GM+PH T  G A   +LKV+ G
Sbjct: 79  HSMYPGGLKQISAGELRSKNAVRLIEKSVKGMLPHNT-LGRAQGMKLKVFVG 129



>gb:CP000001_850773 Bacillus cereus ZK, complete genome.
          Length = 145

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 35/121 (28%), Positives = 52/121 (42%), Gaps = 12/121 (9%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLAS +A  L              G  V+++  E+I L+G  +  KM Y 
Sbjct: 18  VVDAEGQTLGRLASEVASILRGKNKPTFTPHVDTGDHVIIINAEKIHLTGNKLNDKMYYR 77

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
                    + +   +    P ++L   I+GM+P K + G     +L VY G   P+   
Sbjct: 78  HTNHPGGLKQRTALVLRTNYPVQMLELAIKGMLP-KGRLGRQVSKKLNVYAGAEHPHQAQ 136

Query: 425 K 427
           K
Sbjct: 137 K 137



>gb:BX950851_839063 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 142

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/112 (27%), Positives = 52/112 (46%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLA+ LA+ L              G  ++V+  +++ ++G     K+ YH
Sbjct: 17  VVDANGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVLNADKVAVTGNKRTDKIYYH 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
                    + +   +  R P +++   ++GM+P K   G A   +LKVY G
Sbjct: 77  HTGHIGGIKQATFEEMIARRPERVIEIAVKGMLP-KGPLGRAMFRKLKVYAG 127



>gb:BX897699_827401 Bartonella henselae strain Houston-1, complete
           genome.
          Length = 154

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 37/141 (26%), Positives = 64/141 (45%), Gaps = 13/141 (9%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKY 241
           V++DA + +LGRLA+ +A  L             +G  V+V+  ++I L+G     K  Y
Sbjct: 16  VIIDAENLVLGRLAAFVANRLRGKHKATFTPHVDDGDNVIVINADKISLTGKKYTDKKYY 75

Query: 242 -HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYD 418
            H      +  + +   +  R P +++ + +  MIP +   G   L  L+VY G   P+ 
Sbjct: 76  WHTGYIGGIKKRTARQILEGRFPERVVEKAVERMIP-RGPLGRRQLKNLRVYAGSQHPHA 134

Query: 419 KVKRMVIPDALKVLRLQAGHK 481
             +    P+AL V  L   +K
Sbjct: 135 AQQ----PEALDVGALNRKNK 151



>gb:AE014201_305555 Streptococcus agalactiae 2603V/R section 11 of
           100 of the complete genome.>gb:AE009948_935668
           Streptococcus agalactiae 2603V/R complete genome.
          Length = 148

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/112 (27%), Positives = 55/112 (49%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRL++++A  L              G  V+V+  E++ L+G     K+ Y 
Sbjct: 19  VVDAADVPLGRLSAVVASVLRGKNKPTFTPHTDTGDFVIVINAEKVKLTGKKASDKIYYT 78

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
             +      + S G +  +   +++ ++++GM+PH T  G A   +LKV+ G
Sbjct: 79  HSMYPGGLKQISAGELRSKNAVRLIEKSVKGMLPHNT-LGRAQGMKLKVFVG 129



>gb:SAG766844_169737 Streptococcus agalactiae NEM316 complete
           genome, segment 2.
          Length = 148

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/112 (27%), Positives = 55/112 (49%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRL++++A  L              G  V+V+  E++ L+G     K+ Y 
Sbjct: 19  VVDATDVPLGRLSAVVASVLRGKNKPTFTPHTDTGDFVIVINAEKVKLTGKKASDKIYYT 78

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
             +      + S G +  +   +++ ++++GM+PH T  G A   +LKV+ G
Sbjct: 79  HSMYPGGLKQISAGELRSKNAVRLIEKSVKGMLPHNT-LGRAQGMKLKVFVG 129



>gb:BX842644_822716 Mycoplasma mycoides subsp. mycoides SC genomic
           DNA, complete sequence; segment 3/4.
          Length = 151

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 39/142 (27%), Positives = 60/142 (42%), Gaps = 12/142 (8%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICL 208
           M+S      +  +VDA +  +GRLA+ +A  L             NG  V+++  E+   
Sbjct: 6   MISAKDTNKKWYIVDAENKTVGRLATQVALVLRGKHKVDFTPHINNGDHVIIINAEKAIF 65

Query: 209 SGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLK 388
           SG     K  YH  +      K S         +KIL R IR M+P K  +G+     L 
Sbjct: 66  SGKKESNKFYYHHSMHPGGLKKRSVEVQRELDATKILERAIRLMLP-KNVQGSNQYRALH 124

Query: 389 VYEGVPPPYDKVKRMVIPDALK 454
           V++G   P+   K  V+  + K
Sbjct: 125 VFKGSNHPFAAQKPEVLEISTK 146



>gb:BX571872_788870 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 14/17.
          Length = 142

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 31/112 (27%), Positives = 52/112 (46%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLA+ +A+ L              G  +++V  E++ ++G     K+ YH
Sbjct: 17  VVDADGKTLGRLATEVARRLRGKHKAEYTPHVDTGDYIIIVNAEKVAVTGNKRSDKIYYH 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
                    + +   +  R P +++   ++GM+P K   G A   +LKVY G
Sbjct: 77  HTGHIGGIKQATFEEMIARRPERVIEIAVKGMLP-KGPLGRAMYRKLKVYAG 127



>gb:AE017340_456179 Idiomarina loihiensis L2TR, complete genome.
          Length = 142

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 31/112 (27%), Positives = 51/112 (45%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLA+ +A+ L              G  +VV+  E++ ++G   + KM Y 
Sbjct: 17  VVDAEGKTLGRLATEIARRLRGKHKPEYTPHVDTGDYIVVINAEKVAVTGNKAQGKMYYS 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
                      S   +  + P  ++ + ++GM+P +   G A   +LKVY G
Sbjct: 77  HTGFPGGIKSISFEKLIAKKPEMVIQKAVKGMLP-RGPLGRAMFRKLKVYAG 127



>gb:AE017333_446103 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_855925 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 145

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 40/135 (29%), Positives = 61/135 (45%), Gaps = 14/135 (10%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICL 208
           M + S I  + +VVDA    LGRL++ +A  L              G  V+++  E+I L
Sbjct: 6   MANASNIERKWLVVDAAGKTLGRLSTEVASILRGKHKPTYTPHVDTGDHVIIINAEKIEL 65

Query: 209 SGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRA--PSKILWRTIRGMIPHKTKRGAAALAR 382
           +G  +  K+ Y+R  +     K S   +  R   P K+L   I+GM+P K   G     +
Sbjct: 66  TGKKLTDKI-YYRHTQHPGGLK-SRTALEMRTNYPEKMLELAIKGMLP-KGSLGRQMFKK 122

Query: 383 LKVYEGVPPPYDKVK 427
           L VY G   P+   K
Sbjct: 123 LNVYRGSEHPHQAQK 137



>gb:AE017283_431562 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 147

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 36/117 (30%), Positives = 51/117 (43%), Gaps = 12/117 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           V+DA   +LGRLA+  A  L              G  VVVV   +I L+G      ++Y 
Sbjct: 17  VIDAEDIVLGRLATTAANLLRGKHKPQYAPHIDTGDFVVVVNASKIALTGKKATDSLRYD 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
              R       S G +  + P + + R + GM+P K K     L +LKVY G   P+
Sbjct: 77  HSGRPGGLRVTSIGEMLAKNPRRAVERAVWGMMP-KNKLSRQQLKKLKVYGGPEHPH 132



>gb:AE016767_327963 Escherichia coli CFT073 section 13 of 18 of the
           complete genome.>gb:AE014075_958547 Escherichia coli
           CFT073 complete genome.
          Length = 167

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 31/112 (27%), Positives = 52/112 (46%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLA+ LA+ L              G  ++V+  +++ ++G     K+ YH
Sbjct: 42  VVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVLNADKVAVTGNKRTDKVYYH 101

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
                    + +   +  R P +++   ++GM+P K   G A   +LKVY G
Sbjct: 102 HTGHIGGIKQATFEEMIARRPERVIEIAVKGMLP-KGPLGRAMFRKLKVYAG 152



>gb:AE014868_312618 Streptococcus mutans UA159 section 16 of 185 of
           the complete genome.>gb:AE014133_939619 Streptococcus
           mutans UA159 complete genome.
          Length = 148

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 30/112 (26%), Positives = 55/112 (49%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           +VDA    LGRL++++A  L              G  V+V+  E++ L+G     K+ Y 
Sbjct: 19  IVDATDVPLGRLSAVVASVLRGKNKPTFTPHTDTGDFVIVINAEKVKLTGKKAANKIYYT 78

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
             +      + S G +  +   +++ ++++GM+PH T  G A   +LKV+ G
Sbjct: 79  HSMYPGGLKQISAGELRSKNAVRLIEKSVKGMLPHNT-LGRAQGMKLKVFVG 129



>gb:AE013614_298470 Yersinia pestis KIM section 14 of 415 of the
           complete genome.>gb:AE017141_389542 Yersinia pestis
           biovar Medievalis str. 91001 section 15 of 16 of the
           complete genome.>gb:AE009952_928653 Yersinia pestis KIM
           complete genome.>gb:AE017042_1146108 Yersinia pestis
           biovar Medievalis str. 91001 complete genome.
          Length = 147

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 32/112 (28%), Positives = 52/112 (46%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLA+ LA+ L              G  ++V+  E++ ++G     K+ YH
Sbjct: 22  VVDASGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVLNAEKVAVTGNKRTDKIYYH 81

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
                    + +   +  R P +++   ++GM+P K   G A   +LKVY G
Sbjct: 82  HTGFVGGIKQATFEEMIARRPERVIEIAVKGMLP-KGPLGRAMYRKLKVYAG 132



>pir|AD0433|AD0433 50S ribosomal protein L13 [imported] - Yersinia
           pestis  (strain CO92)>gb:AJ414157_525321 Yersinia pestis
           strain CO92 complete genome; segment
           17/20.>gb:BX936398_838151 Yersinia pseudotuberculosis
           IP32953 genome, complete sequence.
          Length = 142

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 32/112 (28%), Positives = 52/112 (46%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLA+ LA+ L              G  ++V+  E++ ++G     K+ YH
Sbjct: 17  VVDASGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVLNAEKVAVTGNKRTDKIYYH 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
                    + +   +  R P +++   ++GM+P K   G A   +LKVY G
Sbjct: 77  HTGFVGGIKQATFEEMIARRPERVIEIAVKGMLP-KGPLGRAMYRKLKVYAG 127



>sp|P02410|RL13_ECOLI 50S ribosomal protein L13.>pir|A02787|R5EC13
           ribosomal protein L13 [validated] - Escherichia coli
           (strain K-12)>pir|AG0908|AG0908 ribosomal protein L13
           [similarity] - Salmonella enterica subsp. enterica
           serovar Typhi (strain CT18)>pir|C85987|C85987 ribosomal
           protein L13 [similarity] - Escherichia coli  (strain
           O157:H7, substrain EDL933)>pir|H91141|H91141 ribosomal
           protein L13 [similarity] - Escherichia coli  (strain
           O157:H7, substrain RIMD 0509952)>gb:AE005174_68358
           Escherichia coli O157:H7 EDL933, complete
           genome.>gb:AE005674_72855 Shigella flexneri 2a str. 301,
           complete genome.>gb:CP000026_77920 Salmonella enterica
           subsp. enterica serovar Paratypi A str. ATCC
           9150.>gb:ECOUW67_130793 Escherichia coli K-12
           chromosomal region from 67.4 to 76.0
           minutes.>gb:ECRPSI_132591 E. coli genes rpsI and rplM
           for ribosomal proteins S9 and L13.>gb:U00096_202240
           Escherichia coli K-12 MG1655 complete
           genome.>gb:AE008854_244986 Salmonella typhimurium LT2,
           section 158 of 220 of the complete
           genome.>gb:AE016845_347252 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, section 12 of 16 of the
           complete genome.>gb:AE016989_372993 Shigella flexneri 2a
           str. 2457T section 12 of 16 of the complete
           genome.>gb:AL627278_543583 Salmonella enterica serovar
           Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 14/20.>gb:BA000007_662116
           Escherichia coli O157:H7 DNA, complete
           genome.>gb:AE014613_984584 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, complete
           genome.>gb:AE014073_997743 Shigella flexneri 2a str.
           2457T complete genome.>gb:AE006468_1002068 Salmonella
           typhimurium LT2, complete genome.
          Length = 142

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 31/112 (27%), Positives = 52/112 (46%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLA+ LA+ L              G  ++V+  +++ ++G     K+ YH
Sbjct: 17  VVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVLNADKVAVTGNKRTDKVYYH 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
                    + +   +  R P +++   ++GM+P K   G A   +LKVY G
Sbjct: 77  HTGHIGGIKQATFEEMIARRPERVIEIAVKGMLP-KGPLGRAMFRKLKVYAG 127



>gb:AE016778_330753 Pseudomonas putida KT2440 section 5 of 21 of the
           complete genome.>gb:AE015451_945830 Pseudomonas putida
           KT2440 complete genome.
          Length = 142

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 32/117 (27%), Positives = 52/117 (44%), Gaps = 12/117 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLA+ +A  L              G  +VV+  E++ ++G     KM Y 
Sbjct: 17  VVDAAGQTLGRLATEIATRLRGKHKPEYTPHVDTGDYIVVINAEQVRVTGAKSSDKMYYS 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
                    + +   +  +AP +++   ++GM+P K   G     +LKVY G   P+
Sbjct: 77  HSGFPGGIKEINFEKLIAKAPERVIETAVKGMLP-KNPLGRDMYRKLKVYAGAAHPH 132



>gb:CR382139_1672327 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 174

 Score = 42.0 bits (97), Expect = 0.014
 Identities = 37/135 (27%), Positives = 61/135 (45%), Gaps = 13/135 (9%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKY 241
           V V A    LGR+AS +A  L             +G  VVV  C  + ++G  ++ +  +
Sbjct: 19  VDVAADERTLGRIASSIALTLQGKHKPTFSPNRDHGDYVVVTNCAHLKVTGNKLQDRTYW 78

Query: 242 HRFLRK-RMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYD 418
               R   +   P    I  +  +++L R ++GMIP K K     + RLK+Y+G   PY 
Sbjct: 79  SHSTRPGSLKLVPMERMIANKGYAEVLRRAVKGMIP-KNKLRLIRMDRLKLYDGDEHPY- 136

Query: 419 KVKRMVIPDALKVLR 463
           K   +   D +K ++
Sbjct: 137 KQNLIAYADEMKEMK 151



>gb:CP000010_866514 Burkholderia mallei ATCC 23344 chromosome 1,
           complete sequence.
          Length = 142

 Score = 42.0 bits (97), Expect = 0.014
 Identities = 33/131 (25%), Positives = 59/131 (45%), Gaps = 12/131 (9%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           V+DA   +LGR+AS +A+ L              G  ++V+   ++ ++G     K  Y 
Sbjct: 17  VIDATDKVLGRVASEVARRLRGKHKPEFTPHVDTGDFIIVINASKLKVTGNKTLDKKYYR 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
                    + + G +  R P + L + ++GM+P K   G A + +LKVY     P+   
Sbjct: 77  HSGYPGGIYETTFGKMQERFPGRALEKAVKGMLP-KCPLGYAMIKKLKVYAEATHPHSAQ 135

Query: 425 KRMVIPDALKV 457
           +    P AL++
Sbjct: 136 Q----PKALEI 142



>gb:CP000003_861580 Streptococcus pyogenes MGAS10394, complete
           genome.
          Length = 183

 Score = 42.0 bits (97), Expect = 0.014
 Identities = 31/112 (27%), Positives = 54/112 (48%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRL++++A  L              G  V+V+  E+I L+G     K+ Y 
Sbjct: 54  VVDATDVPLGRLSAVVASVLRGKNKPTFTPHTDTGDFVIVINAEKIKLTGKKATDKVYYT 113

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
             +        + G +  +   +++ ++++GM+PH T  G A   +LKV+ G
Sbjct: 114 HSMYPGGLKSITAGELRSKNAVRLIEKSVKGMLPHNT-LGRAQGMKLKVFVG 164



>gb:BX897700_828893 Bartonella quintana str. Toulouse, complete
           genome.
          Length = 154

 Score = 42.0 bits (97), Expect = 0.014
 Identities = 37/141 (26%), Positives = 63/141 (44%), Gaps = 13/141 (9%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKY 241
           V++DA + +LGRLA+ +A  L             +G  V+V+  ++I L+G     K  Y
Sbjct: 16  VIIDAENLVLGRLAAFVANRLRGKHKATFTPHVDDGDNVIVINADKIVLTGKKYTDKKYY 75

Query: 242 -HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYD 418
            H      +  + +   +  R P +++ + +  MIP +   G   L  L VY G   P+ 
Sbjct: 76  WHTGYIGGIKERTARQILEGRFPERVVEKAVERMIP-RGPLGRRQLRNLHVYAGSQNPHA 134

Query: 419 KVKRMVIPDALKVLRLQAGHK 481
             +    P+AL V  L   +K
Sbjct: 135 AQQ----PEALDVGALNRKNK 151



>gb:AE017145_390251 Helicobacter hepaticus ATCC 51449 section 2 of 6
           of the complete genome.>gb:AE017125_1024513 Helicobacter
           hepaticus ATCC 51449 complete genome.
          Length = 142

 Score = 42.0 bits (97), Expect = 0.014
 Identities = 35/134 (26%), Positives = 61/134 (45%), Gaps = 13/134 (9%)
 Frame = +2

Query: 53  DAAKMVSGSGICARRVVVDARHHMLGRLASILAKELLN------------GQRVVVVRCE 196
           +  K+ + + I  + +V+DA+  + GRL + +A  L              G  VV++   
Sbjct: 2   ELTKIATQNDINRQWIVLDAKDKVFGRLITEIATLLRGKHKPCFTPHIDCGDFVVIINAT 61

Query: 197 EICLSGGLVRQKMKY-HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAA 373
           E+  +G  ++ K  + H        +K     +  + P K+    +RGM+P K K G A 
Sbjct: 62  EVKFTGMKLKDKEYFTHSGYFGSTKSKTLQEMLE-KTPEKLYHLAVRGMLP-KNKLGRAM 119

Query: 374 LARLKVYEGVPPPY 415
           L +LKVY G   P+
Sbjct: 120 LKKLKVYRGSEHPH 133



>gb:AE016750_323441 Staphylococcus epidermidis ATCC 12228, section 7
           of 9 of the complete genome.>gb:AE015929_1148110
           Staphylococcus epidermidis ATCC 12228, complete genome.
          Length = 145

 Score = 42.0 bits (97), Expect = 0.014
 Identities = 38/130 (29%), Positives = 58/130 (44%), Gaps = 13/130 (10%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICL 208
           M + S I  +  V+DA    LGRL+S +A  L              G  V+++   +I  
Sbjct: 6   MANESNIERKWYVIDAEGQTLGRLSSEVAAILRGKNKVTYTPHVDTGDYVIIINASKIEF 65

Query: 209 SGGLVRQKMKYHRFLRKRMNTKP-SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARL 385
           +G   + KM YHR        K  S G +    P ++L  +I+GM+P  T+ G     +L
Sbjct: 66  TGNKEQDKM-YHRHSNHPGGLKSISAGELKRTNPERLLETSIKGMLP-STRLGEKQGKKL 123

Query: 386 KVYEGVPPPY 415
            VY G   P+
Sbjct: 124 FVYGGAEHPH 133



>gb:AE010104_259367 Streptococcus pyogenes strain MGAS8232, section
           152 of 173 of the complete genome.>gb:AE009949_905749
           Streptococcus pyogenes strain MGAS8232, complete genome.
          Length = 142

 Score = 42.0 bits (97), Expect = 0.014
 Identities = 31/112 (27%), Positives = 54/112 (48%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRL++++A  L              G  V+V+  E+I L+G     K+ Y 
Sbjct: 13  VVDATDVPLGRLSAVVASVLRGKNKPTFTPHTDTGDFVIVINAEKIKLTGKKATDKVYYT 72

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
             +        + G +  +   +++ ++++GM+PH T  G A   +LKV+ G
Sbjct: 73  HSMYPGGLKSITAGELRSKNAVRLIEKSVKGMLPHNT-LGRAQGMKLKVFVG 123



>pir|G97905|G97905 50S ribosomal protein L13 [imported] -
           Streptococcus pneumoniae (strain R6)>pir|G95034|G95034
           ribosomal protein L13 [imported] - Streptococcus
           pneumoniae  (strain TIGR4)>gb:AE007342_225533
           Streptococcus pneumoniae TIGR4 section 25 of 194 of the
           complete genome.>gb:AE008408_236592 Streptococcus
           pneumoniae R6 section 24 of 184 of the complete
           genome.>gb:AE007317_942750 Streptococcus pneumoniae R6,
           complete genome.>gb:AE005672_1103301 Streptococcus
           pneumoniae TIGR4, complete genome.
          Length = 148

 Score = 42.0 bits (97), Expect = 0.014
 Identities = 31/112 (27%), Positives = 54/112 (48%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRL++++A  L              G  V+V+  E++ L+G     K+ Y 
Sbjct: 19  VVDATDVPLGRLSAVVASVLRGKNKPTFTPHTDTGDFVIVINAEKVKLTGKKATDKIYYT 78

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
                    + S G +  +   +++ ++++GM+PH T  G A   +LKV+ G
Sbjct: 79  HSNHPGGLKQISAGELRSKNAVRLIEKSVKGMLPHNT-LGRAQGMKLKVFVG 129



>gb:BX571965_792709 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.
          Length = 142

 Score = 41.6 bits (96), Expect = 0.019
 Identities = 33/131 (25%), Positives = 59/131 (45%), Gaps = 12/131 (9%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           V+DA   +LGR+AS +A+ L              G  ++V+   ++ ++G     K  Y 
Sbjct: 17  VIDATDKVLGRVASEVARRLRGKHKPEFTPHVDTGDFIIVINASKLKVTGNKTLDKKYYR 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
                    + + G +  R P + L + ++GM+P K   G A + +LKVY     P+   
Sbjct: 77  HSGYPGGIYETTFGKMQERFPGRALEKAVKGMLP-KGPLGYAMIKKLKVYAEATHPHSAQ 135

Query: 425 KRMVIPDALKV 457
           +    P AL++
Sbjct: 136 Q----PKALEI 142



>gb:BA000043_736716 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 145

 Score = 41.6 bits (96), Expect = 0.019
 Identities = 34/121 (28%), Positives = 53/121 (43%), Gaps = 12/121 (9%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLAS +A  L              G  V+V+  +++ L+G  + +K+ Y 
Sbjct: 18  VVDAAGKTLGRLASEVAALLRGKHKPTFTPHVDCGDHVIVINADKVELTGKKLTKKLYYR 77

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
             L        +   +    P +++ R +RGM+P K   G     +L VY G   P+   
Sbjct: 78  HSLYPGGLKVRTALEMRTNYPEQMIERAVRGMLP-KGSLGRQMFKKLHVYRGSEHPHQAQ 136

Query: 425 K 427
           K
Sbjct: 137 K 137



>gb:AE017308_437851 Mycoplasma mobile 163K complete genome.
          Length = 144

 Score = 41.6 bits (96), Expect = 0.019
 Identities = 36/135 (26%), Positives = 61/135 (45%), Gaps = 16/135 (11%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKY- 241
           VVDA   +LGRLAS++A  L              G  ++V+  +++ L+      K+ Y 
Sbjct: 18  VVDAEGQVLGRLASVVASYLRGKNKPTFTPNVDMGDNIIVINADKVVLTAKKEDDKIYYS 77

Query: 242 ---HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPP 412
              +    K +N +     +  + P  ++ + ++GMIPH TK G      L VY G    
Sbjct: 78  SSGYNGGLKAINAR----DLRAKKPFALVEKAVKGMIPH-TKLGRKQFGNLYVYAGREHN 132

Query: 413 YDKVKRMVIPDALKV 457
           ++  K    P+ L+V
Sbjct: 133 HEAQK----PEVLEV 143



>gb:AE016998_375200 Bacillus cereus ATCC 14579 section 1 of 18 of
           the complete genome.>gb:AE017024_380438 Bacillus
           anthracis str. Ames section 1 of 18 of the complete
           genome.>gb:AE017225_405556 Bacillus anthracis str.
           Sterne, complete genome.>gb:AE017264_421378 Bacillus
           cereus ATCC 10987, section 1 of 18 of the complete
           genome.>gb:AE017334_450287 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE017355_461470 Bacillus
           thuringiensis serovar konkukian str. 97-27, complete
           genome.>gb:AE016879_1010143 Bacillus anthracis str. Ames
           complete genome.>gb:AE016877_1015450 Bacillus cereus
           ATCC 14579 complete genome.>gb:AE017194_1059797 Bacillus
           cereus ATCC 10987, complete genome.
          Length = 145

 Score = 41.6 bits (96), Expect = 0.019
 Identities = 34/121 (28%), Positives = 52/121 (42%), Gaps = 12/121 (9%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLAS +A  L              G  V+++  E+I L+G  +  K+ Y 
Sbjct: 18  VVDAEGQTLGRLASEVASILRGKNKPTFTPHVDTGDHVIIINAEKIHLTGNKLNDKIYYR 77

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
                    + +   +    P ++L   I+GM+P K + G     +L VY G   P+   
Sbjct: 78  HTNHPGGLKQRTALEMRTNYPVQMLELAIKGMLP-KGRLGRQVSKKLNVYAGAEHPHQAQ 136

Query: 425 K 427
           K
Sbjct: 137 K 137



>gb:AE016995_374590 Chlamydophila caviae GPIC section 2 of 4 of the
           complete genome.>gb:AE015925_994269 Chlamydophila caviae
           GPIC complete genome.
          Length = 150

 Score = 41.6 bits (96), Expect = 0.019
 Identities = 34/113 (30%), Positives = 55/113 (48%), Gaps = 13/113 (11%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAK------------ELLNGQRVVVVRCEEICLSGGLVRQKM-KY 241
           V+DA    LGRL+S +AK             +  G  V+V+  E++ L+G    QK+ +Y
Sbjct: 24  VIDATGKTLGRLSSEVAKILRGKHKVTYTPHIAMGDGVIVINAEKVHLTGAKKGQKIYRY 83

Query: 242 HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
           +      M   P    +  + PS I+   I+GM+P KT+ G   L  L++ +G
Sbjct: 84  YTGYISGMREIPFENML-AKKPSYIIEHAIKGMMP-KTRLGKRQLKSLRILKG 134



>gb:AE016871_353787 Pseudomonas syringae pv. tomato str. DC3000
           section 16 of 21 of the complete
           genome.>gb:AE016853_1038962 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 142

 Score = 41.6 bits (96), Expect = 0.019
 Identities = 32/117 (27%), Positives = 51/117 (43%), Gaps = 12/117 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLA+ +A  L              G  +VV+  E+I ++G     K+ Y 
Sbjct: 17  VVDAAGQTLGRLATEIASRLRGKHKPEYTPHVDTGDYIVVINAEQIRVTGAKTTDKIYYS 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
                      +   +  +AP +++   ++GM+P K   G     +LKVY G   P+
Sbjct: 77  HSGFPGGIKSINFEKLIAKAPERVIETAVKGMLP-KNPLGRDMYRKLKVYAGAVHPH 132



>gb:AE014168_305141 Streptococcus pyogenes MGAS315, section 33 of 37
           of the complete genome.>gb:BA000034_714589 Streptococcus
           pyogenes SSI-1 DNA, complete genome.>gb:AE014074_928320
           Streptococcus pyogenes MGAS315, complete genome.
          Length = 148

 Score = 41.6 bits (96), Expect = 0.019
 Identities = 30/112 (26%), Positives = 54/112 (48%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRL++++A  L              G  V+V+  E++ L+G     K+ Y 
Sbjct: 19  VVDATDVPLGRLSAVVASVLRGKNKPTFTPHTDTGDFVIVINAEKVKLTGKKATDKVYYT 78

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
             +        + G +  +   +++ ++++GM+PH T  G A   +LKV+ G
Sbjct: 79  HSMYPGGLKSITAGELRSKNAVRLIEKSVKGMLPHNT-LGRAQGMKLKVFVG 129



>gb:AE006617_220756 Streptococcus pyogenes M1 GAS, section 146 of
           167 of the complete genome.>gb:AE004092_1106602
           Streptococcus pyogenes M1 GAS, complete genome.
          Length = 148

 Score = 41.6 bits (96), Expect = 0.019
 Identities = 30/112 (26%), Positives = 54/112 (48%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRL++++A  L              G  V+V+  E++ L+G     K+ Y 
Sbjct: 19  VVDAADVPLGRLSAVVASVLRGKNKPTFTPHTDTGDFVIVINAEKVKLTGKKATDKVYYT 78

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
             +        + G +  +   +++ ++++GM+PH T  G A   +LKV+ G
Sbjct: 79  HSMYPGGLKSITAGELRSKNAVRLIEKSVKGMLPHNT-LGRAQGMKLKVFVG 129



>gb:CR382124_1656443 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.>gb:KLA243960_1683510 Kluyveromyces lactis
           YOR289W, MPD1, MRP-L23 and CRN1 (partial) genes.
          Length = 155

 Score = 41.2 bits (95), Expect = 0.024
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 13/110 (11%)
 Frame = +2

Query: 125 LGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYHRFLRK-RM 265
           LGR+AS +A  L+             G  VVV  C+ + ++G  + QK  +    R   +
Sbjct: 28  LGRVASQVALALMGKHKPVYHPSADCGDYVVVTNCQALRVTGNKMTQKTYWSHTSRPGSL 87

Query: 266 NTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
                   I  +  S++L + + GM+P K K     LARLK+++G   PY
Sbjct: 88  KLTTMEDMISNKGYSEVLKKAVSGMLP-KNKLRKIRLARLKIFDGSEHPY 136



>gb:BA000040_733223 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 154

 Score = 41.2 bits (95), Expect = 0.024
 Identities = 29/120 (24%), Positives = 55/120 (45%), Gaps = 13/120 (10%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKY 241
           V++DA+  ++GRLA+I+A  L              G  V+++  +   L+G    QK  Y
Sbjct: 16  VLIDAKGLVVGRLATIVAMRLRGKHLPTYTPHVDCGDNVIIINAQHAVLTGRKREQKTYY 75

Query: 242 -HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYD 418
            H      +  + +   +  + P ++L + +  MIP +   G   +  L+VY G   P++
Sbjct: 76  KHTGYVGHVKERTARQILEGKHPERVLEKAVERMIP-RGPLGRVQMGNLRVYGGADHPHE 134



>gb:BA000031_705898 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 142

 Score = 41.2 bits (95), Expect = 0.024
 Identities = 31/112 (27%), Positives = 49/112 (43%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLAS +A  L              G  ++V+  E++ ++G   + K+ Y 
Sbjct: 17  VVDAEGKTLGRLASEIASRLRGKHKAEYTPHVDAGDYIIVINAEKVAVTGNKAKDKVYYR 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
                      +   +  R P  +L   ++GM+P +   G A   +LKVY G
Sbjct: 77  HSEFPGGLKSITFEKLIDRKPEMVLELAVKGMLP-RGPLGRAMYRKLKVYAG 127



>gb:SME591786_185261 Sinorhizobium meliloti 1021 complete
           chromosome; segment 5/12.
          Length = 154

 Score = 41.2 bits (95), Expect = 0.024
 Identities = 30/127 (23%), Positives = 58/127 (45%), Gaps = 13/127 (10%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKY 241
           +++DA   ++GRLAS++A  L             +G  V+V+  E+  L+G     K  Y
Sbjct: 16  ILIDAEGLVVGRLASLIANRLRGKHKATYTPHVDDGDNVIVINAEKAVLTGKKYTDKKYY 75

Query: 242 -HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYD 418
            H      +  + +   I  R P +++ + +  M+P +   G   +  L+VY G   P++
Sbjct: 76  WHTGYPGGIKERTARQIIEGRFPERVIEKAVERMVP-RGPLGRRQMKNLRVYAGSNHPHE 134

Query: 419 KVKRMVI 439
             +  V+
Sbjct: 135 AQQPAVL 141



>pir|E81294|E81294 50S ribosomal protein L13 Cj1480c [imported] -
           Campylobacter jejuni (strain NCTC
           11168)>gb:CJ11168X5_847847 Campylobacter jejuni subsp.
           jejuni NCTC 11168 complete genome; segment
           5/6.>gb:CP000025_879387 Campylobacter jejuni RM1221,
           complete genome.
          Length = 141

 Score = 41.2 bits (95), Expect = 0.024
 Identities = 32/119 (26%), Positives = 52/119 (43%), Gaps = 13/119 (10%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKY 241
           +V+DA     GRL + +A  L              G  V+++   +   +G    +   Y
Sbjct: 15  IVLDAEGKRFGRLLTEVATILRGKNKPCFTPNVDCGDYVIIINASKAVFTGANKAEDKLY 74

Query: 242 HRFLRKRMNTKPSH-GPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
           HR      + K    G +  + P+K+    +RGM+P KT  G A L +LK+Y G   P+
Sbjct: 75  HRHSGYFGSVKSEKFGDLLEKNPAKLYKLAVRGMLP-KTNLGRAMLKKLKIYAGSEHPH 132



>gb:BX572601_802381 Rhodopseudomonas palustris CGA009 complete
           genome; segment 9/16.
          Length = 154

 Score = 40.8 bits (94), Expect = 0.032
 Identities = 28/120 (23%), Positives = 55/120 (45%), Gaps = 13/120 (10%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKY 241
           V++DA   ++GRLA+++A  L              G  V+++   ++ L+G     K+ Y
Sbjct: 16  VIIDATGLVVGRLATLVAMRLRGKHLPTYTPHVDCGDNVIIINASKVVLTGRKRDNKVYY 75

Query: 242 HRF-LRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYD 418
           H       +  + +   +  R P +++ + I  MIP +   G   +  L+VY G   P++
Sbjct: 76  HHTGFIGGIKERSAKAILEGRFPERVVEKAIERMIP-RGPLGRVQMGNLRVYPGAEHPHE 134



>gb:BX251410_764360 Tropheryma whipplei TW08/27, complete genome;
           segment 1/3.
          Length = 141

 Score = 40.8 bits (94), Expect = 0.032
 Identities = 34/125 (27%), Positives = 56/125 (44%), Gaps = 12/125 (9%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILA------------KELLNGQRVVVVRCEEICLSGGLVRQKMKY 241
           V+VDA+  +LGRLA+ +A              L  G  V+VV    I ++     +K+ Y
Sbjct: 7   VLVDAKDMVLGRLATQVAVLLRGKHRPTYEPHLDTGDCVIVVNAALIRVTSNKHAKKVFY 66

Query: 242 HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK 421
                     K     +  ++P ++L + ++GM+P K K G +    L+VY G   P+  
Sbjct: 67  THSGYPGGLKKRGFSDVFQKSPERVLEKAVKGMLP-KNKLGRSVFRNLRVYPGQDHPHAA 125

Query: 422 VKRMV 436
            K  V
Sbjct: 126 QKPSV 130



>gb:AE016965_368933 Coxiella burnetii strain RSA 493, section 6 of 7
           of the complete genome.>gb:AE016828_1009669 Coxiella
           burnetii strain RSA 493, complete genome.
          Length = 142

 Score = 40.8 bits (94), Expect = 0.032
 Identities = 34/132 (25%), Positives = 57/132 (43%), Gaps = 12/132 (9%)
 Frame = +2

Query: 56  AAKMVSGSGICARRVVVDARHHMLGRLASILAKELLN------------GQRVVVVRCEE 199
           A  M +   +  R ++V+A    LGRLAS +A  L              G  VVV+  ++
Sbjct: 2   ATYMANAKTVSPRWLLVNAEGKTLGRLASRIAAILRGKHKAEFTPHVDAGDFVVVINVDK 61

Query: 200 ICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALA 379
           + ++G   + K  +H           +   +  + P +IL   I+GM+P K   G     
Sbjct: 62  LKVTGNKTQDKQYHHHSGYPGGLKTINFADLQAKKPQRILELAIKGMLP-KGPLGRQLYR 120

Query: 380 RLKVYEGVPPPY 415
           +LK+Y G   P+
Sbjct: 121 KLKIYAGDQHPH 132



>gb:AE016850_348668 Tropheryma whipplei str. Twist, section 1 of 3
           of the complete genome.>gb:AE014184_1028864 Tropheryma
           whipplei str. Twist, complete genome.
          Length = 142

 Score = 40.8 bits (94), Expect = 0.032
 Identities = 34/125 (27%), Positives = 56/125 (44%), Gaps = 12/125 (9%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILA------------KELLNGQRVVVVRCEEICLSGGLVRQKMKY 241
           V+VDA+  +LGRLA+ +A              L  G  V+VV    I ++     +K+ Y
Sbjct: 8   VLVDAKDMVLGRLATQVAVLLRGKHRPTYEPHLDTGDCVIVVNAALIRVTSNKHAKKVFY 67

Query: 242 HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK 421
                     K     +  ++P ++L + ++GM+P K K G +    L+VY G   P+  
Sbjct: 68  THSGYPGGLKKRGFSDVFQKSPERVLEKAVKGMLP-KNKLGRSVFRNLRVYPGQDHPHAA 126

Query: 422 VKRMV 436
            K  V
Sbjct: 127 QKPSV 131



>gb:CP000029_82390 Staphylococcus epidermidis RP62A, complete
           genome.
          Length = 145

 Score = 40.8 bits (94), Expect = 0.032
 Identities = 35/129 (27%), Positives = 55/129 (42%), Gaps = 12/129 (9%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICL 208
           M + S I  +  V+DA    LGRL+S +A  L              G  V+++   +I  
Sbjct: 6   MANESNIERKWYVIDAEGQTLGRLSSEVAAILRGKNKVTYTPHVDTGDYVIIINASKIEF 65

Query: 209 SGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLK 388
           +G   + KM Y            S G +    P ++L  +I+GM+P  T+ G     +L 
Sbjct: 66  TGNKEQDKMYYRHSNHPGGLKSISAGELKRTNPERLLETSIKGMLP-STRLGEKQGKKLF 124

Query: 389 VYEGVPPPY 415
           VY G   P+
Sbjct: 125 VYGGAEHPH 133



>pir|AB2730|AB2730 50S ribosomal protein L13 [imported] -
           Agrobacterium tumefaciens (strain C58,
           Dupont)>gb:AE009087_248283 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 113 of 256 of the
           complete sequence.>gb:AE008688_1086126 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 154

 Score = 40.8 bits (94), Expect = 0.032
 Identities = 31/127 (24%), Positives = 58/127 (45%), Gaps = 13/127 (10%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKY 241
           +++DA   ++GRLA+I+A  L             +G  V+V+  E++  +G     K  Y
Sbjct: 16  IIIDAEGLVVGRLATIVATRLRGKHKATFTPHVDDGDNVIVINAEKVAFTGKKYSDKKYY 75

Query: 242 -HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYD 418
            H      +  + +   I  R P +++ + I  MIP +   G   +  L+VY G   P++
Sbjct: 76  WHTGHPGGIKERTARQIIEGRFPERVVEKAIERMIP-RGPLGRRQMKNLRVYAGSNHPHE 134

Query: 419 KVKRMVI 439
             +  V+
Sbjct: 135 AQQPTVL 141



>pir|C97511|C97511 50S ribosomal protein L13 [imported] -
           Agrobacterium tumefaciens (strain C58,
           Cereon)>gb:AE008052_232984 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 110 of 254 of the
           complete sequence.>gb:AE007869_1082653 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 157

 Score = 40.8 bits (94), Expect = 0.032
 Identities = 31/127 (24%), Positives = 58/127 (45%), Gaps = 13/127 (10%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKY 241
           +++DA   ++GRLA+I+A  L             +G  V+V+  E++  +G     K  Y
Sbjct: 19  IIIDAEGLVVGRLATIVATRLRGKHKATFTPHVDDGDNVIVINAEKVAFTGKKYSDKKYY 78

Query: 242 -HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYD 418
            H      +  + +   I  R P +++ + I  MIP +   G   +  L+VY G   P++
Sbjct: 79  WHTGHPGGIKERTARQIIEGRFPERVVEKAIERMIP-RGPLGRRQMKNLRVYAGSNHPHE 137

Query: 419 KVKRMVI 439
             +  V+
Sbjct: 138 AQQPTVL 144



>sp|O67722|RL13_AQUAE 50S ribosomal protein L13.>pir|H70461|H70461
           ribosomal protein L13 - Aquifex
           aeolicus>gb:AE000761_27077 Aquifex aeolicus VF5 section
           93 of 109 of the complete genome.>gb:AE000657_977608
           Aquifex aeolicus VF5 complete genome.
          Length = 144

 Score = 40.8 bits (94), Expect = 0.032
 Identities = 38/131 (29%), Positives = 56/131 (42%), Gaps = 22/131 (16%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKY- 241
           VVDA    LGRLAS +AK L              G  V+V+  E+I ++G  + QK  Y 
Sbjct: 17  VVDATGKTLGRLASEIAKILRGKHKPYYQPDVDCGDFVIVINAEKIRVTGKKLEQKKYYW 76

Query: 242 ---------HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVY 394
                     R L+  +  K          P +++   ++ M+P K + G   L +LKVY
Sbjct: 77  HSRYPGGLKERTLKWMLENK----------PEEVIRLAVKRMLP-KNRLGHRMLKKLKVY 125

Query: 395 EGVPPPYDKVK 427
            G   P+   K
Sbjct: 126 RGPEHPHQAQK 136



>gb:CP000009_862479 Gluconobacter oxydans 621H, complete genome.
          Length = 202

 Score = 40.4 bits (93), Expect = 0.042
 Identities = 36/127 (28%), Positives = 60/127 (47%), Gaps = 17/127 (13%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKM-K 238
           V++DA   +LGRLA+I+A  L              G  +VV+  E++ L+G  V QK+  
Sbjct: 62  VLIDAEGLVLGRLATIIATRLRGKHKPQFTPHVDCGDNIVVINAEKVVLTGNKVGQKLFH 121

Query: 239 YHR----FLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVP 406
           YH      +++R  T+   G    + P +++ + +  MI     +  A +  L VY G  
Sbjct: 122 YHTGHPGGIKERTITQRLTG----KNPGEVVEKAVERMITRGPLQ-RAQMKHLYVYAGSE 176

Query: 407 PPYDKVK 427
            P+D  K
Sbjct: 177 HPHDGQK 183



>gb:BX571662_779388 Wolinella succinogenes, complete genome; segment
           6/7.
          Length = 139

 Score = 40.4 bits (93), Expect = 0.042
 Identities = 37/130 (28%), Positives = 53/130 (40%), Gaps = 12/130 (9%)
 Frame = +2

Query: 62  KMVSGSGICARRVVVDARHHMLGRLASILAKELLNGQR------------VVVVRCEEIC 205
           KM   + I    VV+DA     GRL + +A  L    R            VV+V   ++ 
Sbjct: 5   KMAKANEIKREWVVLDAEGKTFGRLMTQVATLLRGKHRPDYTPHVDCGDFVVIVNASKVV 64

Query: 206 LSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARL 385
            SG  +  K  +            +   +  + P K+     RGM+P KTK G A L +L
Sbjct: 65  FSGLKLEAKEYFTHSGYFGSTKSQTLQELLEKNPEKLFRLAARGMLP-KTKLGRAMLKKL 123

Query: 386 KVYEGVPPPY 415
           KVY G   P+
Sbjct: 124 KVYAGAEHPH 133



>gb:BA000012_672625 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 154

 Score = 40.4 bits (93), Expect = 0.042
 Identities = 30/141 (21%), Positives = 65/141 (46%), Gaps = 13/141 (9%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKY 241
           +++DA   ++GRLA+++A  L             +G  V+V+  +++  +G     K+ Y
Sbjct: 16  ILIDAEGLVVGRLATVIANHLRGKHKPTFTPHVDDGDNVIVINADKVVFTGKKFTDKVYY 75

Query: 242 -HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYD 418
            H      +  + +   +  R P +++ + +  M+P +   G   +  L+VY G   P+ 
Sbjct: 76  WHTGHPGGIKERTARQLLEGRFPERVVEKAVERMVP-RGPLGRRQMKNLRVYAGAEHPHV 134

Query: 419 KVKRMVIPDALKVLRLQAGHK 481
             +    P+ L V +L + +K
Sbjct: 135 AQQ----PEVLDVAKLNSKNK 151



>gb:CR543861_104813 Acinetobacter sp. ADP1 complete genome.
          Length = 142

 Score = 40.4 bits (93), Expect = 0.042
 Identities = 31/117 (26%), Positives = 52/117 (44%), Gaps = 12/117 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLA+ +A+ L              G  +VV+  E++ ++G     K  Y 
Sbjct: 17  VVDASGKTLGRLATEIARRLRGKHKTSYTPHVDTGDYIVVINAEQVQVTGKKSLDKKYYR 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
                    + +   +    P  +L + ++GM+P K   G A + ++KVY G   P+
Sbjct: 77  HTGFPGGIRETNFEKLIAHKPEAVLEKAVKGMLP-KGPLGYAMIKKMKVYAGTEHPH 132



>gb:CR378673_96520 Photobacterium profundum SS9; segment 11/12.
          Length = 142

 Score = 40.4 bits (93), Expect = 0.042
 Identities = 32/112 (28%), Positives = 49/112 (43%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLA+ +A  L              G  +VV+  E++ ++G     KM +H
Sbjct: 17  VVDAEGKTLGRLATQIASRLRGKHKPEYTPHVDTGDYIVVINAEKVAVTGAKRTDKMYHH 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
                      S   +  + P  ++   ++GM+P K   G A   +LKVY G
Sbjct: 77  HTGFIGGLKSISFEKLIDKKPEMVIETAVKGMLP-KGPLGRAMYRKLKVYAG 127



>pir|H83670|H83670 ribosomal protein L13 rplM [imported] - Bacillus
           halodurans  (strain C-125)>gb:BA000004_654114 Bacillus
           halodurans C-125 DNA, complete genome.
          Length = 145

 Score = 40.4 bits (93), Expect = 0.042
 Identities = 33/112 (29%), Positives = 48/112 (42%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLAS +A  L              G  V+++  E+I L+G  ++ K+ Y 
Sbjct: 18  VVDAEGQTLGRLASEVASILRGKHKPTYTPHVDTGDHVIIINAEKIHLTGNKLQDKIYYR 77

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
                    +     +    P K+L   I+GM+P K   G     +L VY G
Sbjct: 78  HSGHPGGLKETRAADMRANKPEKMLELAIKGMLP-KNTLGRKQGMKLHVYAG 128



>sp|Q12487|RM23_YEAST 60S ribosomal protein L23, mitochondrial
           precursor.>pir|S67038|S67038 ribosomal protein L13,
           mitochondrial - yeast (Saccharomyces
           cerevisiae)>gb:AY558133_1614360 Saccharomyces cerevisiae
           clone FLH110924.01X YOR150W gene, complete
           cds.>gb:SCU55020_1710481 Saccharomyces cerevisiae cosmid
           pEOA477 from chromosome 15R.>gb:SCYOR150W_1714382
           S.cerevisiae chromosome XV reading frame ORF YOR150w.
          Length = 163

 Score = 40.4 bits (93), Expect = 0.042
 Identities = 33/110 (30%), Positives = 52/110 (47%), Gaps = 13/110 (11%)
 Frame = +2

Query: 125 LGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKY-HRFLRKRM 265
           LGRLAS +A  L+             G  VVV  C++I ++G    QK  + H     ++
Sbjct: 28  LGRLASAIAITLIGRHKPVYHPSQDCGDYVVVTNCQKIRVTGKKFEQKTYWSHSGRPGQL 87

Query: 266 NTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
             +  +  +  +   +IL + + GM+P K K     L RLKV++G   PY
Sbjct: 88  KLQTMNKVVADKGFGEILKKAVSGMLP-KNKLRKQRLDRLKVFDGSENPY 136



>sp|Q9Z8T7|RL13_CHLPN 50S ribosomal protein L13.>pir|G86521|G86521
           ribosomal protein L13 [similarity] - Chlamydophila
           pneumoniae (strain J138)>pir|C72101|C72101 ribosomal
           protein L13 [similarity] - Chlamydophila pneumoniae
           (strains CWL029 and AR39)>gb:AE001610_37112 Chlamydia
           pneumoniae section 26 of 103 of the complete
           genome.>gb:AE002211_43994 Chlamydophila pneumoniae AR39,
           section 40 of 94 of the complete
           genome.>gb:AE017157_393599 Chlamydophila pneumoniae
           TW-183, section 1 of 4 of the complete
           genome.>gb:BA000008_663620 Chlamydophila pneumoniae J138
           genomic DNA, complete sequence.>gb:AE002161_886119
           Chlamydophila pneumoniae AR39, complete
           genome.>gb:AE001363_941669 Chlamydia pneumoniae,
           complete genome.>gb:AE009440_1027861 Chlamydophila
           pneumoniae TW-183, complete genome.
          Length = 149

 Score = 40.4 bits (93), Expect = 0.042
 Identities = 35/113 (30%), Positives = 55/113 (48%), Gaps = 13/113 (11%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKM-KY 241
           VVDA    LGRL+S +AK L              G  V+V+  E++ L+G    QK+ +Y
Sbjct: 23  VVDAAGKTLGRLSSEVAKILRGKHKVTYTPHVAMGDGVIVINAEKVRLTGAKKGQKIYRY 82

Query: 242 HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
           +      M   P    +  R P+ I+   I+GM+P +T+ G   L  L++ +G
Sbjct: 83  YTGYISGMREIPFEN-MMARKPNYIIEHAIKGMMP-RTRLGKKQLKSLRIVKG 133



>sp|O46915|RK13_GUITH Chloroplast 50S ribosomal protein
           L13.>gb:AF041468_1763594 Guillardia theta complete
           plastid genome.
          Length = 143

 Score = 40.4 bits (93), Expect = 0.042
 Identities = 31/118 (26%), Positives = 52/118 (44%), Gaps = 12/118 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           ++DA    LGRLAS  AK L+                +V++  ++I ++G     K  Y 
Sbjct: 18  IIDATDKNLGRLASETAKTLVGKYDPLYAPNVNPKNIIVIINADKIRVTGNKKFDKFYYR 77

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYD 418
              +    T  +   +  R P +IL + ++G++P K   G      LKVY G   P++
Sbjct: 78  HSGQVGGLTIETFNELQSRLPGRILEKAVKGILP-KGPLGRELFNNLKVYAGSSHPHE 134



>gb:AL646059_545418 Ralstonia solanacearum GMI1000 chromosome,
           complete sequence; segment 3/19.
          Length = 142

 Score = 40.0 bits (92), Expect = 0.055
 Identities = 31/125 (24%), Positives = 56/125 (44%), Gaps = 12/125 (9%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           V+DA   +LGR+AS +A  L              G  ++V+   ++ ++G     K  Y 
Sbjct: 17  VIDATDKVLGRVASEVALRLRGKHKPEFTPHVDTGDFIIVINAAKLRVTGAKTTDKKYYR 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV 424
                    + + G +  R P + L + ++GM+P K   G A + +LKVY     P++  
Sbjct: 77  HSGYPGGIYETTFGKMQQRFPGRALEKAVKGMLP-KGPLGYAMIKKLKVYAEGSHPHEAQ 135

Query: 425 KRMVI 439
           +  V+
Sbjct: 136 QPQVL 140



>gb:SLMEN3_1715349 S.latifolia mRNA for Men-3 protein.
          Length = 104

 Score = 39.7 bits (91), Expect = 0.071
 Identities = 18/43 (41%), Positives = 24/43 (55%)
 Frame = -3

Query: 332 GWCARGS*TVRGSGWGRGRAWCSCACGGSGDTSFSDGQGRRRG 204
           GWC+ GS +  G GWG G      +C GSG   + +G+GR  G
Sbjct: 36  GWCSSGSGSGNGQGWGMGGGCQGRSCEGSG--GYGEGEGRAWG 76



>gb:BA000028_694538 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 145

 Score = 39.7 bits (91), Expect = 0.071
 Identities = 33/124 (26%), Positives = 55/124 (44%), Gaps = 12/124 (9%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICL 208
           M + + I  + +VVDA    LGRLAS +A  L              G  V+++  ++I L
Sbjct: 6   MANEANIERKWLVVDAEGQRLGRLASEVASILRGKHKATYTPHADTGDNVIIINADKIEL 65

Query: 209 SGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLK 388
           +G  +  KM Y          + +   +  + P ++L   ++GM+P K   G     +L 
Sbjct: 66  TGNKINDKMYYRHSNHPGGLKERNAYEMRTKYPEQMLEIAVKGMLP-KGPLGRKMGKKLH 124

Query: 389 VYEG 400
           VY G
Sbjct: 125 VYRG 128



>gb:CP000033_88630 Lactobacillus acidophilus NCFM, complete genome.
          Length = 147

 Score = 39.7 bits (91), Expect = 0.071
 Identities = 36/146 (24%), Positives = 62/146 (42%), Gaps = 12/146 (8%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICL 208
           +   S I  +  ++DA    LGRL++ +A  L              G  V+VV   +I L
Sbjct: 6   LAKSSEIERKWYIIDATDVSLGRLSAAVATILRGKNKPQYTPNVDCGDNVIVVNASKIKL 65

Query: 209 SGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLK 388
           +G     K  YH    +      S+G +    P K++  +++GM+P K   G     ++ 
Sbjct: 66  TGKKASDKFYYHHSSWRGGLKAVSYGELLANNPVKMVEISVKGMLP-KNTLGHQEFLKMH 124

Query: 389 VYEGVPPPYDKVKRMVIPDALKVLRL 466
           VY G    ++  K    P+ L + +L
Sbjct: 125 VYAGEDHKHEAQK----PEKLDINKL 146



>sp|P56038|RL13_HELPY 50S ribosomal protein L13.>pir|D64530|D64530
           ribosomal protein L13 - Helicobacter pylori (strain
           26695)>gb:AE000530_24263 Helicobacter pylori 26695
           section 8 of 134 of the complete
           genome.>gb:AE000511_879702 Helicobacter pylori 26695
           complete genome.
          Length = 141

 Score = 39.7 bits (91), Expect = 0.071
 Identities = 35/119 (29%), Positives = 54/119 (45%), Gaps = 13/119 (10%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQR------------VVVVRCEEICLSGGLVRQKMKY 241
           VV+DA+  + GRL + +A  L    R            VVV+   ++  SG  +  K  +
Sbjct: 15  VVLDAKDKVFGRLITEIAVLLRGKHRPFYTPNVDCGDFVVVINANKVKFSGMKLEDKEYF 74

Query: 242 -HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
            H        +K     +  +AP K+    +RGM+P KTK G A + +LKVY     P+
Sbjct: 75  THSGYFGSTKSKTLQEMLE-KAPEKLYHLAVRGMLP-KTKLGKAMIKKLKVYRDDKHPH 131



>gb:CR380958_1653254 Candida glabrata strain CBS138 chromosome L
           complete sequence.
          Length = 167

 Score = 39.3 bits (90), Expect = 0.093
 Identities = 32/116 (27%), Positives = 53/116 (45%), Gaps = 19/116 (16%)
 Frame = +2

Query: 125 LGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMN 268
           LGR+AS +A  L+             G  VVV  C+++ ++G    QK  +        +
Sbjct: 28  LGRVASSIAVTLIGKHKPVYHPSQDCGDYVVVTNCQKVRITGKKFEQKTYWSH------S 81

Query: 269 TKPSHGPI-------HFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
           TKP +  +         +   ++L + + GM+P K +     LARLKV++G   PY
Sbjct: 82  TKPGNLKLTTMKTMAENKGYGELLKKAVSGMLP-KNRLRKVRLARLKVFDGAEHPY 136



>gb:AP008226_578922 Thermus thermophilus HB8 genomic DNA, complete
           genome.
          Length = 140

 Score = 39.3 bits (90), Expect = 0.093
 Identities = 42/145 (28%), Positives = 63/145 (43%), Gaps = 23/145 (15%)
 Frame = +2

Query: 92  RRVVVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKM 235
           R V++DA    LGRLA+ +A  L              G  VVVV  ++I ++G  + QK+
Sbjct: 12  RWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKKLEQKI 71

Query: 236 KYHRF-----------LRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALAR 382
            Y R+           L K + T           P ++L   ++GM+P K   G     R
Sbjct: 72  -YTRYSGYPGGLKKIPLEKMLATH----------PERVLEHAVKGMLP-KGPLGRRLFKR 119

Query: 383 LKVYEGVPPPYDKVKRMVIPDALKV 457
           LKVY G   P+   +    P+ L+V
Sbjct: 120 LKVYAGPDHPHQAQR----PEKLEV 140



>gb:AP006841_574532 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 153

 Score = 39.3 bits (90), Expect = 0.093
 Identities = 30/121 (24%), Positives = 54/121 (44%), Gaps = 14/121 (11%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQK--M 235
           V+VDA    LGRL + +AK L              G  V+++  +++ LSG     +  +
Sbjct: 21  VIVDATDQTLGRLGAKVAKLLRGKYKPNFTPHVDCGDNVIIINADKVKLSGNKWNDRVYL 80

Query: 236 KYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
            Y  +   +    P+          ++L + ++GM+P K + GA  L+ + VY G    +
Sbjct: 81  SYTGYPGGQREMTPARLIAKPNGEDRLLRKVVKGMLP-KNRLGAKLLSNMYVYAGSEHKH 139

Query: 416 D 418
           D
Sbjct: 140 D 140



>gb:AP006628_566573 Onion yellows phytoplasma OY-M DNA, complete
           genome.
          Length = 152

 Score = 39.3 bits (90), Expect = 0.093
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 12/110 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           +VDA+   LGRLA+ +A  L             NG  V+VV    I L+G   +QK  Y 
Sbjct: 27  LVDAKGKTLGRLATKVASILKGKHKTHYTPHVDNGDYVIVVNAAYIHLTGKKWQQKTYYK 86

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVY 394
                   TK     +  + P++++ + I GM+PH TK G+    +L VY
Sbjct: 87  HSGYPGGLTKVVASEMMRKFPTRMVEKAILGMVPH-TKLGSQIGKKLFVY 135



>gb:AE017304_436735 Thermus thermophilus HB27 section 4 of 7 of the
           complete genome.>gb:AE017221_1078713 Thermus
           thermophilus HB27 complete genome.
          Length = 163

 Score = 39.3 bits (90), Expect = 0.093
 Identities = 42/145 (28%), Positives = 63/145 (43%), Gaps = 23/145 (15%)
 Frame = +2

Query: 92  RRVVVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKM 235
           R V++DA    LGRLA+ +A  L              G  VVVV  ++I ++G  + QK+
Sbjct: 35  RWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKKLEQKI 94

Query: 236 KYHRF-----------LRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALAR 382
            Y R+           L K + T           P ++L   ++GM+P K   G     R
Sbjct: 95  -YTRYSGYPGGLKKIPLEKMLATH----------PERVLEHAVKGMLP-KGPLGRRLFKR 142

Query: 383 LKVYEGVPPPYDKVKRMVIPDALKV 457
           LKVY G   P+   +    P+ L+V
Sbjct: 143 LKVYAGPDHPHQAQR----PEKLEV 163



>gb:AE014291_308232 Brucella suis 1330 chromosome I, complete
           sequence.
          Length = 154

 Score = 39.3 bits (90), Expect = 0.093
 Identities = 34/141 (24%), Positives = 63/141 (44%), Gaps = 13/141 (9%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKY 241
           V++DA   ++GRLAS++A  L             +G  V+++  +++ L+G     K  Y
Sbjct: 16  VLIDAEGLVVGRLASLVANRLRGKHKATFTPHVDDGDNVIIINADKVVLTGKKYTDKKYY 75

Query: 242 -HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYD 418
            H      +  + +   +  R P ++L + I  MIP +   G   +  L+VY G    ++
Sbjct: 76  WHTGHPGGIKERTARQILEGRFPERVLEKAIERMIP-RGPLGRRQMKNLRVYAGPNHQHE 134

Query: 419 KVKRMVIPDALKVLRLQAGHK 481
             +    P+ L V  L   +K
Sbjct: 135 AQQ----PEVLDVAALNRKNK 151



>gb:AE016799_335368 Vibrio vulnificus CMCP6 chromosome I section 3
           of 11 of the complete sequence.>gb:BA000037_721420
           Vibrio vulnificus YJ016 DNA, chromosome I, complete
           sequence.>gb:AE016795_1045092 Vibrio vulnificus CMCP6
           chromosome I complete sequence.
          Length = 142

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 30/112 (26%), Positives = 47/112 (41%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLAS +A  L              G  ++V+  E++ ++G     K  Y 
Sbjct: 17  VVDAEGKTLGRLASEIASRLRGKHKAEYTPHVDTGDYIIVINAEKVTVTGNKAAAKTYYR 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
                      +   +  R P  ++   ++GM+P +   G A   +LKVY G
Sbjct: 77  HTEFPGGIKSITFDKLIVRKPEMVIELAVKGMLP-RGPLGRAMYRKLKVYAG 127



>gb:CP000031_85728 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 152

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 23/119 (19%), Positives = 55/119 (46%), Gaps = 12/119 (10%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKY 241
           +++DA   +LGRLASI+A  L              G  V+V+  +++ ++G    +   +
Sbjct: 16  ILIDAEGVVLGRLASIVAMRLRGKHKASFTPHMDMGDNVIVINADKVQITGKKREEHFYW 75

Query: 242 HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYD 418
           H      + ++     +    P +++++ ++ M+P   +     +  L++Y G   P++
Sbjct: 76  HTGHPGGIKSRTKQQILEGAHPERVVYQAVKRMLP-GNRLSRQQMTNLRIYAGTEHPHE 133



>gb:BX248355_761854 Corynebacterium diphtheriae gravis NCTC13129,
           complete genome; segment 2/8.
          Length = 147

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 31/118 (26%), Positives = 55/118 (46%), Gaps = 13/118 (11%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKY- 241
           V+DA   +LGRLA+  A  L              G  V+V+  +++ +S     ++M+Y 
Sbjct: 17  VIDATDVVLGRLATHAADLLRGKGKPQFAPNVDCGDHVIVINADKVHVSSNKREREMRYR 76

Query: 242 HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
           H      + T      +    P +++  +IRGM+PH  +   A++ +L V+ G   PY
Sbjct: 77  HSGYPGGLKTMTLGRSLEVH-PERVVEESIRGMMPH-NRLSRASVKKLHVFAGSEHPY 132



>gb:BA000035_715371 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 147

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 29/117 (24%), Positives = 54/117 (46%), Gaps = 12/117 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLAS------------ILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH 244
           V+DA   +LGRLA+            + A  +  G  V+++  +++ ++     ++M+Y 
Sbjct: 17  VIDATDVVLGRLATHAADLLRGKGKPLFAPNVDCGDHVIIINADKVAITSNKRDREMRYR 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
                      + G      P ++L  +I GM+PH  K  AA++ +L V+ G   PY
Sbjct: 77  HSGYPGGLKSMTLGRSLELHPERVLEESITGMMPH-NKLTAASVKKLHVFAGSEHPY 132



>gb:AE017263_421047 Mesoplasma florum L1 complete genome.
          Length = 150

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 34/137 (24%), Positives = 58/137 (42%), Gaps = 12/137 (8%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICL 208
           +++   I     +VDA    +GRL++ +A+ L             NG  V+++  E++  
Sbjct: 6   LIAAKDIKKNWYIVDAAGQNVGRLSTEVARILRGKHKVDFTPHMNNGDHVIIINAEKVLF 65

Query: 209 SGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLK 388
           +G     K  YH  +      + +         +KIL R+IR M+P K  +G      L 
Sbjct: 66  TGKKESDKTYYHHSMHPGGLRRRTVAVQRELDATKILERSIRLMLP-KNVQGRNQFRALH 124

Query: 389 VYEGVPPPYDKVKRMVI 439
           V+ G   PY   K  V+
Sbjct: 125 VFVGENHPYAAQKPEVL 141



>pir|T39596|T39596 50s ribosomal protein - fission yeast
           (Schizosaccharomyces pombe)>gb:SPBC16G5_1719161 S.pombe
           chromosome II cosmid c16G5.
          Length = 157

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 36/123 (29%), Positives = 55/123 (44%), Gaps = 19/123 (15%)
 Frame = +2

Query: 104 VDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYHR 247
           V A++  LGRLAS +A  L+             G  VVV  C EI +SG    +K++ H+
Sbjct: 19  VSAKNVPLGRLASQIATTLMGKHKPIYHPAADCGDVVVVTDCSEIGISG----RKLENHK 74

Query: 248 FLRKRMNTKPSH-------GPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVP 406
           +     + +P H            R    +L R + GM+P + K     + RL +Y+G  
Sbjct: 75  YYSH--SGQPGHLKEWTMEEMAAKRGHKDLLRRAVGGMLP-RNKLWDRRMKRLYIYDGAE 131

Query: 407 PPY 415
            PY
Sbjct: 132 HPY 134



>pir|E90018|E90018 50S ribosomal protein L13 [imported] -
           Staphylococcus aureus (strain N315)>gb:CP000046_92296
           Staphylococcus aureus subsp. aureus COL, complete
           genome.>gb:BA000017_677903 Staphylococcus aureus subsp.
           aureus Mu50 DNA, complete genome.>gb:BA000018_680492
           Staphylococcus aureus subsp. aureus N315 genomic DNA,
           complete genome.>gb:BA000033_712429 Staphylococcus
           aureus subsp. aureus MW2 DNA, complete genome,
           strain:MW2.>gb:BX571856_781726 Staphylococcus aureus
           subsp. aureus strain MRSA252, complete
           genome.>gb:BX571857_784340 Staphylococcus aureus strain
           MSSA476, complete genome.
          Length = 145

 Score = 38.1 bits (87), Expect = 0.21
 Identities = 33/129 (25%), Positives = 54/129 (41%), Gaps = 12/129 (9%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICL 208
           M + S I  +  V+DA    LGRL+S +A  L              G  V+V+   +I  
Sbjct: 6   MANESNIERKWYVIDAEGQTLGRLSSEVASILRGKNKVTYTPHVDTGDYVIVINASKIEF 65

Query: 209 SGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLK 388
           +G     K+ Y            + G +    P +++  +I+GM+P  T+ G     +L 
Sbjct: 66  TGNKETDKVYYRHSNHPGGIKSITAGELRRTNPERLIENSIKGMLP-STRLGEKQGKKLF 124

Query: 389 VYEGVPPPY 415
           VY G   P+
Sbjct: 125 VYGGAEHPH 133



>sp|Q9ZMY6|RL13_HELPJ 50S ribosomal protein L13.>pir|H71975|H71975
           ribosomal protein L13 - Helicobacter pylori (strain
           J99)>gb:AE001447_35072 Helicobacter pylori, strain J99
           section 8 of 132 of the complete
           genome.>gb:AE001439_883842 Helicobacter pylori, strain
           J99 complete genome.
          Length = 141

 Score = 38.1 bits (87), Expect = 0.21
 Identities = 34/119 (28%), Positives = 53/119 (44%), Gaps = 13/119 (10%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLNGQR------------VVVVRCEEICLSGGLVRQKMKY 241
           VV+DA+  + GRL + +A  L    R            VVV+   ++  SG  +  K  +
Sbjct: 15  VVLDAKDKVFGRLITEIAVLLRGKHRPFYTPNVDCGDFVVVINANKVKFSGMKLEDKEYF 74

Query: 242 -HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
            H        +K     +  + P K+    +RGM+P KTK G A + +LKVY     P+
Sbjct: 75  THSGYFGSTKSKTLQEMLE-KTPEKLYHLAVRGMLP-KTKLGKAMIKKLKVYRDDKHPH 131



>sp|P31781|RL13_HAESO 50S ribosomal protein L13.>gb:S75161_169034
           rplM=ribosomal protein L13 homolog...stringent
           starvation protein (Ssp) homolog [Haemophilus somnus,
           HS25, Genomic, 3 genes, 1842 nt].
          Length = 142

 Score = 38.1 bits (87), Expect = 0.21
 Identities = 31/112 (27%), Positives = 48/112 (42%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRL   LA+ L              G  +VV+  E++ ++G     K+ Y 
Sbjct: 17  VVDATGKTLGRLGHELARRLRGKHKAEYTPHVDTGDYIVVINAEKVAVTGNKETDKLYYW 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
                    + +   +  R P  ++   ++GM+P K   G A   +LKVY G
Sbjct: 77  HTGYVGGIKQATFKEMIARRPEAVIEIAVKGMLP-KGPLGRAMFRKLKVYAG 127



>sp|P44387|RL13_HAEIN 50S ribosomal protein L13.>pir|G64123|G64123
           ribosomal protein L13 - Haemophilus influenzae (strain
           Rd KW20)>gb:U32823_205104 Haemophilus influenzae Rd KW20
           section 138 of 163 of the complete
           genome.>gb:L42023_1097653 Haemophilus influenzae Rd KW20
           complete genome.
          Length = 142

 Score = 38.1 bits (87), Expect = 0.21
 Identities = 30/112 (26%), Positives = 50/112 (44%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLA+ LA+ L              G  ++V+  +++ ++G     K+ Y 
Sbjct: 17  VVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVINADKVAVTGRKETDKLYYW 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
                    + +   +  R P  ++   ++GM+P K   G A   +LKVY G
Sbjct: 77  HTGYVGGIKQATFKEMIARRPEAVIEIAVKGMLP-KGPLGRAMFRKLKVYAG 127



>gb:AE006087_215408 Pasteurella multocida subsp. multocida str. Pm70
           section 54 of 204 of the complete
           genome.>gb:AE004439_1118138 Pasteurella multocida subsp.
           multocida str. Pm70, complete genome.
          Length = 142

 Score = 37.7 bits (86), Expect = 0.27
 Identities = 30/112 (26%), Positives = 50/112 (44%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLA+ LA+ L              G  ++V+  E++ ++G     K+ + 
Sbjct: 17  VVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVINAEKVAVTGNKESDKLYHW 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
                    + +   +  R P  ++   ++GM+P K   G A   +LKVY G
Sbjct: 77  HTGYVGGIKQATFKEMIARRPEAVIEIAVKGMLP-KGPLGRAMYRKLKVYAG 127



>pir|A43310|A43310 ribosomal protein L13 homolog - Haemophilus
           somnus
          Length = 142

 Score = 37.7 bits (86), Expect = 0.27
 Identities = 31/112 (27%), Positives = 48/112 (42%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRL   LA+ L              G  +VV+  E++ ++G     K+ Y 
Sbjct: 17  VVDATCKTLGRLGHELARRLRGKHKAEYTPHVDTGDYIVVINAEKVAVTGNKETDKLYYW 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
                    + +   +  R P  ++   ++GM+P K   G A   +LKVY G
Sbjct: 77  HTGYVGGIKQATFKEMIARRPEAVIEIAVKGMLP-KGPLGRAMFRKLKVYAG 127



>gb:AF147722_1772306 Kluyveromyces lactis ribosomal protein L23
           (MRP-L23) gene, complete cds; mitochondrial gene for
           mitochondrial product.
          Length = 155

 Score = 37.4 bits (85), Expect = 0.35
 Identities = 30/109 (27%), Positives = 48/109 (44%), Gaps = 13/109 (11%)
 Frame = +2

Query: 128 GRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYHRFLRK-RMN 268
           GR+AS +A  L+             G  VVV  C+ + ++G  + QK  +    R   + 
Sbjct: 29  GRVASQVATALMGKHKPVYHPSADCGDYVVVTNCQALRVTGNKMTQKTYWSHTSRPGSLK 88

Query: 269 TKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
                  I  +  S++L + + GM P K K      ARLK+++G   PY
Sbjct: 89  LTTMEDMISNKGYSEVLKKAVSGMTP-KNKTRKIRTARLKIFDGSEHPY 136



>sp|O83988|RL13_TREPA 50S ribosomal protein L13.>pir|D71251|D71251
           probable ribosomal protein L13 (rplM) - syphilis
           spirochete>gb:AE001270_33846 Treponema pallidum subsp.
           pallidum str. Nichols section 86 of 87 of the complete
           genome.>gb:AE000520_1050074 Treponema pallidum subsp.
           pallidum str. Nichols complete genome.
          Length = 142

 Score = 37.4 bits (85), Expect = 0.35
 Identities = 32/118 (27%), Positives = 51/118 (43%), Gaps = 12/118 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYH 244
           ++DA    LGR+A+ +A  L              G  VVV+  E++ LSG   + KM Y 
Sbjct: 17  LIDAAGRPLGRVAARVACLLRGKHKASYTPNQEMGDYVVVINAEKVFLSGTKPKDKMYYR 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYD 418
                      S   +  R P + L   ++GM+P K   G   +  +K+Y G   P++
Sbjct: 77  HSGYPGGLKSVSFSALVKRRPVEPLRHAVKGMLP-KGPLGRKLIKNVKIYAGSVHPHE 133



>gb:AE016819_1749238 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 156

 Score = 37.0 bits (84), Expect = 0.46
 Identities = 36/136 (26%), Positives = 59/136 (43%), Gaps = 17/136 (12%)
 Frame = +2

Query: 59  AKMVSGSGICARR----VVVDARHHMLGRLASILAKELLN------------GQRVVVVR 190
           ++ +  SG+   R    V V      LGRLAS +A  L+             G  VVV  
Sbjct: 2   SQKIGQSGLAFARLWHHVDVAREQRTLGRLASSIAITLMGKHKPVYHPSMDCGDYVVVTN 61

Query: 191 CEEICLSGGLVRQKMKY-HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGA 367
            +++ ++G    QK  + H      +  +        +  S++L + + GM+P K +   
Sbjct: 62  AQDLQVTGKKWEQKTYWSHSGRPGHLKLRTMETIATNKGHSELLRKAVSGMLP-KNRLRK 120

Query: 368 AALARLKVYEGVPPPY 415
             LARLKV++G   PY
Sbjct: 121 VRLARLKVFDGSEHPY 136



>gb:AP006627_562510 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 145

 Score = 37.0 bits (84), Expect = 0.46
 Identities = 32/112 (28%), Positives = 47/112 (41%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLAS +A  L              G  V+V+   +I L+G  ++ K+ Y 
Sbjct: 18  VVDAEGQTLGRLASEVASILRGKHKPTFTPHVDTGDHVIVLNASKIQLTGNKLQDKIYYR 77

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
                    +     +    P ++L   I+GM+P K   G     +L VY G
Sbjct: 78  HTNHPGGLKQTKAQDMRANKPERMLELAIKGMLP-KNTLGRKQGMKLHVYAG 128



>gb:AE016827_342912 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 147

 Score = 37.0 bits (84), Expect = 0.46
 Identities = 30/112 (26%), Positives = 49/112 (43%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGRLA+ LA  L              G  ++V+  +++ ++G     K+ Y 
Sbjct: 22  VVDATGKTLGRLATELASRLRGKHKAEYTPHVDTGDYIIVINADKVAVTGRKETDKVYYW 81

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
                    + +   +  R P  ++   ++GM+P K   G A   +LKVY G
Sbjct: 82  HTGYVGGIKQATFKEMIARRPEAVIEIAVKGMLP-KGPLGRAMFRKLKVYAG 132



>sp|Q89AE6|RL13_BUCBP 50S ribosomal protein L13.>gb:AE014017_302757
           Buchnera aphidicola str. Bp (Baizongia pistaciae),
           section 2 of 2 of the complete
           genome.>gb:AE016826_981358 Buchnera aphidicola str. Bp
           (Baizongia pistaciae), complete genome.
          Length = 144

 Score = 37.0 bits (84), Expect = 0.46
 Identities = 30/109 (27%), Positives = 48/109 (44%), Gaps = 12/109 (11%)
 Frame = +2

Query: 104 VDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKYHR 247
           +DA   +LGRLA+ +A  L              G  ++V+  + I ++G     K  YH 
Sbjct: 20  IDATGKILGRLATNIASRLRGKHKVEYTPHVDIGDYLIVINAKNIKVTGKKCTDKFYYHH 79

Query: 248 FLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVY 394
                   K +   +  R P +I+   +RGM+P K   G +   +LKVY
Sbjct: 80  TGYVGGLKKIAFKDMLHRYPERIIEIAVRGMLP-KGPLGRSMFKKLKVY 127



>gb:CP000020_872398 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 142

 Score = 36.6 bits (83), Expect = 0.60
 Identities = 29/112 (25%), Positives = 48/112 (42%), Gaps = 12/112 (10%)
 Frame = +2

Query: 101 VVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICLSGGLVRQKMKYH 244
           VVDA    LGR+A+ +A  L              G  ++V+  E++ ++G     K+ Y 
Sbjct: 17  VVDAEGKTLGRIATEIASRLRGKHKAEYTPHVDTGDYIIVINAEKVRVTGKKASDKIYYR 76

Query: 245 RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG 400
                      S   +  R P  ++   ++GM+P +   G A   +LKVY G
Sbjct: 77  HSEFPGGLKSISFEKLIDRKPEMVIELAVKGMLP-RGPLGRAMYRKLKVYAG 127



>pir|A87420|A87420 ribosomal protein L13 [imported] - Caulobacter
           crescentus>gb:AE005812_212520 Caulobacter crescentus
           CB15 section 138 of 359 of the complete
           genome.>gb:AE005673_922419 Caulobacter crescentus CB15
           complete genome.
          Length = 157

 Score = 36.6 bits (83), Expect = 0.60
 Identities = 28/119 (23%), Positives = 51/119 (42%), Gaps = 13/119 (10%)
 Frame = +2

Query: 98  VVVDARHHMLGRLASILAKELLN------------GQRVVVVRCEEICLSGGLVRQKMKY 241
           +VVDA + ++GRLAS +A  L              G  VVV+  +++  +G  +  K+ Y
Sbjct: 18  IVVDAENAVVGRLASFIAMRLRGKHRPDYTPHVDCGDFVVVINADKVKFTGKKLDDKVYY 77

Query: 242 -HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY 415
            H      +        +  R P ++L + +  M+P ++      L  L +Y     P+
Sbjct: 78  RHTGHPGGIKETTPRKVLGGRFPERVLEKAVERMLPKESPLARKQLTHLLIYNNGEHPH 136



>sp|Q00990|RL13_STACA 50S ribosomal protein L13.>pir|S23063|S23063
           ribosomal protein L13 - Staphylococcus
           carnosus>gb:SCRPLM_181561 S.carnosus rplM gene for
           ribosomal protein L13.
          Length = 145

 Score = 36.6 bits (83), Expect = 0.60
 Identities = 32/129 (24%), Positives = 57/129 (44%), Gaps = 12/129 (9%)
 Frame = +2

Query: 65  MVSGSGICARRVVVDARHHMLGRLASILAKELL------------NGQRVVVVRCEEICL 208
           M + S I  +  V+DA    LGRL+S +A  L             +G  V+++   +I +
Sbjct: 6   MANESNIERKWYVIDAAGQTLGRLSSEVASILRGKHKATYTPHVDSGDYVIIINAGQIEM 65

Query: 209 SGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLK 388
           +G     K+ Y            + G +  + P ++L  +I+GM+P  ++ G     +L 
Sbjct: 66  TGKKASDKVYYRHSNYPGGIKSITAGELREKNPERLLEISIKGMLP-SSRLGEKQGKKLF 124

Query: 389 VYEGVPPPY 415
           VY G   P+
Sbjct: 125 VYGGAEHPH 133



>gb:SRGENSPMRN_1722396 Sorghum bicolor endosperm tissue mRNA,
           complete CDS.
          Length = 212

 Score = 36.2 bits (82), Expect = 0.79
 Identities = 23/61 (37%), Positives = 25/61 (40%), Gaps = 1/61 (1%)
 Frame = +1

Query: 199 NLPLRRPCPSENEVSPLPPQAHEHQAL-PRPHPLPRTV*DPLAHHPRNDSA*DEERSCGA 375
           +LP     P    V P PPQ H H  L P PHP P     P   HP +        SCG 
Sbjct: 45  HLPPPVHLPPPVHVPPPPPQCHPHPTLPPHPHPCPTYPPHPSPCHPGHPG------SCGV 98

Query: 376 G 378
           G
Sbjct: 99  G 99



>gb:AY566299_1615386 Sorghum bicolor clone MML-07 gamma kafirin
           protein gene, partial cds.
          Length = 186

 Score = 36.2 bits (82), Expect = 0.79
 Identities = 23/61 (37%), Positives = 25/61 (40%), Gaps = 1/61 (1%)
 Frame = +1

Query: 199 NLPLRRPCPSENEVSPLPPQAHEHQAL-PRPHPLPRTV*DPLAHHPRNDSA*DEERSCGA 375
           +LP     P    V P PPQ H H  L P PHP P     P   HP +        SCG 
Sbjct: 45  HLPPPVHLPPPVHVPPPPPQCHPHPTLPPHPHPCPTYPPHPSPCHPGHPG------SCGV 98

Query: 376 G 378
           G
Sbjct: 99  G 99



>gb:AY566298_1615385 Sorghum bicolor clone MML-06 gamma kafirin
           protein gene, partial cds.
          Length = 186

 Score = 36.2 bits (82), Expect = 0.79
 Identities = 23/61 (37%), Positives = 25/61 (40%), Gaps = 1/61 (1%)
 Frame = +1

Query: 199 NLPLRRPCPSENEVSPLPPQAHEHQAL-PRPHPLPRTV*DPLAHHPRNDSA*DEERSCGA 375
           +LP     P    V P PPQ H H  L P PHP P     P   HP +        SCG 
Sbjct: 45  HLPPPVHLPPPVHVPPPPPQCHPHPTLPPHPHPCPTYPPHPSPCHPGHPG------SCGV 98

Query: 376 G 378
           G
Sbjct: 99  G 99



>gb:ATH286347_1552276 Arabidopsis thaliana partial mRNA for 60S L13
           ribosomal protein (diDi 13A-1 gene).
          Length = 61

 Score = 36.2 bits (82), Expect = 0.79
 Identities = 18/58 (31%), Positives = 30/58 (51%)
 Frame = +2

Query: 509 EVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY 682
           EVGW +   ++ LE KRK +  A Y ++K   KL+ +A + A+ +      +L    Y
Sbjct: 3   EVGWQYQGIVEKLEEKRKVKGTAYYTKKKAEMKLKRQAIEKAKAKTAVYDKVLEQYGY 60


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 877,344,477
Number of Sequences: 1806583
Number of extensions: 19338145
Number of successful extensions: 75262
Number of sequences better than 10.0: 288
Number of HSP's better than 10.0 without gapping: 67265
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 74586
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 55754781230
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)