BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig1343
         (1460 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY086976_1572014 Arabidopsis thaliana clone 30065 mRNA, compl...   404   e-111   
pir|F96810|F96810 hypothetical protein T11I11.8 [imported] - Ara...   335   2e-90   Arabidopsis thaliana [mouse-ear cress]
gb:AP003568_1830983 Oryza sativa (japonica cultivar-group) genom...   320   6e-86   
gb:AP004658_1842820 Oryza sativa (japonica cultivar-group) genom...   219   1e-55   
pir|T02115|T02115 hypothetical protein At2g41040 [imported] - Ar...   206   1e-51   Arabidopsis thaliana [mouse-ear cress]
gb:AE011153_269626 Methanosarcina acetivorans str. C2A, section ...    75   4e-12   
gb:AY596298_634895 Haloarcula marismortui ATCC 43049 chromosome ...    62   3e-08   
gb:AY142866_592049 Heliobacillus mobilis 2-heptaprenyl-1,4-napht...    61   7e-08   
gb:BX571856_780922 Staphylococcus aureus subsp. aureus strain MR...    60   9e-08   
pir|T44579|T44579 C5-O-methyltransferase [imported] - Streptomyc...    60   9e-08   Streptomyces avermitilis
sp|Q99U19|UBIE_STAAM|UBIE_STAAM Menaquinone biosynthesis methyltransferase ...    60   9e-08   Staphylococcus aureus
gb:BA000021_687201 Wigglesworthia glossinidia endosymbiont of Gl...    60   1e-07   
gb:BA000016_673215 Clostridium perfringens str. 13 DNA, complete...    60   1e-07   
pir|A90193|A90193 conserved hypothetical protein [imported] - Su...    60   1e-07   Saccharolobus solfataricus
pir|E72392|E72392 ubiquinone/menaquinone biosynthesis-related pr...    60   1e-07   Thermotoga maritima
pir|G96969|G96969 probable methyltransferase [imported] - Clostr...    60   1e-07   Clostridium acetobutylicum
gb:AE016781_331416 Pseudomonas putida KT2440 section 8 of 21 of ...    59   2e-07   
pir|JC6531|JC6531 avermectin B 5-O-methyltransferase (EC 2.1.1.-...    59   2e-07   Streptomyces avermitilis
gb:CP000001_853228 Bacillus cereus ZK, complete genome.                59   3e-07   
gb:AE017355_463944 Bacillus thuringiensis serovar konkukian str....    59   3e-07   
gb:AE017033_382958 Bacillus anthracis str. Ames section 10 of 18...    59   3e-07   
pir|B97320|B97320 S-adenosylmethionine-dependent methyltransfera...    59   3e-07   Clostridium acetobutylicum
gb:AE017007_377796 Bacillus cereus ATCC 14579 section 10 of 18 o...    59   3e-07   
gb:AE016857_349953 Pseudomonas syringae pv. tomato str. DC3000 s...    59   3e-07   
pir|B48653|B48653 hypothetical protein 2 (pip 3' region) - Lacto...    59   3e-07   Lactococcus lactis subsp. lactis
sp|P49016|UBIE_LACLA|UBIE_LACLA Menaquinone biosynthesis methyltransferase ...    59   3e-07   Lactococcus lactis subsp. lactis
pir|E95996|E95996 probable methyltransferase, S-Adenosyl-L-methi...    58   4e-07   Sinorhizobium meliloti
pir|B82239|B82239 biotin synthesis protein BioC VC1114 [imported...    58   6e-07   Vibrio cholerae
sp|Q8CSH9|UBIE_STAEP|UBIE_STAEP Menaquinone biosynthesis methyltransferase ...    58   6e-07   Staphylococcus epidermidis
gb:CR555306_108838 Azoarcus sp. EbN1 complete genome.                  57   7e-07   
sp|Q89AK7|BIOC_BUCBP|BIOC_BUCBP Biotin synthesis protein bioC.>gb:AE014017_...    57   1e-06   
gb:OSJN00169_1696105 Oryza sativa genomic DNA, chromosome 4, BAC...    57   1e-06   
gb:BX950851_841560 Erwinia carotovora subsp. atroseptica SCRI104...    56   2e-06   
gb:AY426747_617092 Geobacillus stearothermophilus uroporphyrin-I...    56   2e-06   
gb:CR628336_112396 Legionella pneumophila str. Paris complete ge...    56   2e-06   
gb:AP006878_577393 Thermococcus kodakaraensis strain KOD1 DNA, c...    56   2e-06   
gb:AF487998_515319 Saccharopolyspora erythraea NRRL 2338 eryCI f...    56   2e-06   
gb:AE017354_460679 Legionella pneumophila subsp. pneumophila str...    56   2e-06   
gb:TACID2_196399 Thermoplasma acidophilum complete genome; segme...    56   2e-06   
sp|Q92A77|UBIE_LISMO|UBIE_LISMO Menaquinone biosynthesis methyltransferase ...    56   2e-06   
gb:D89131_1675249 Schizosaccharomyces pombe mRNA, partial cds, c...    55   4e-06   
gb:CR628337_115455 Legionella pneumophila str. Lens complete gen...    55   4e-06   
pir|T42375|T42375 probable sterol 24-C-methyltransferase (EC 2.1...    55   4e-06   Schizosaccharomyces pombe
sp|O14321|ERG6_SCHPO|ERG6_SCHPO Probable sterol 24-C-methyltransferase (EC ...    55   4e-06   Schizosaccharomyces pombe
gb:AP003943_1835567 Oryza sativa (japonica cultivar-group) genom...    55   5e-06   
gb:AF042332_1763634 Oryza sativa subsp. japonica cycloartenol-C2...    55   5e-06   
gb:AE017246_415311 Treponema denticola ATCC 35405, section 1 of ...    55   5e-06   
gb:BX571864_786344 Photorhabdus luminescens subsp. laumondii TTO...    54   6e-06   
gb:AY596297_633713 Haloarcula marismortui ATCC 43049 chromosome ...    54   6e-06   
gb:AE010689_265692 Methanosarcina acetivorans str. C2A, section ...    54   6e-06   
gb:SCO939108_174837 Streptomyces coelicolor A3(2) complete genom...    54   6e-06   
pir|AG2274|AG2274 methyltransferase [imported] - Nostoc sp. (str...    54   6e-06   Nostoc sp. PCC 7120
pir|E70669|E70669 probable glycosyltransferase - Mycobacterium t...    53   6e-06   Mycobacterium tuberculosis
gb:AY596297_632024 Haloarcula marismortui ATCC 43049 chromosome ...    54   8e-06   
gb:RLE571701_164330 Rhizobium leguminosarum bv. viciae 3841 lipo...    54   8e-06   
gb:BX572597_800922 Rhodopseudomonas palustris CGA009 complete ge...    54   1e-05   
gb:CR522870_100177 Desulfotalea psychrophila LSv54 chromosome.         54   1e-05   
gb:AF042333_1763635 Oryza sativa 24-methylene lophenol C24(1)met...    53   1e-05   
gb:BA000030_699471 Streptomyces avermitilis MA-4680 genomic DNA,...    53   1e-05   
gb:BA000012_668806 Mesorhizobium loti MAFF303099 DNA, complete g...    53   1e-05   
gb:AE017273_424139 Bacillus cereus ATCC 10987, section 10 of 18 ...    53   1e-05   
gb:AE017178_397997 Porphyromonas gingivalis W83 section 7 of 8 o...    53   1e-05   
gb:AE016822_339474 Leifsonia xyli subsp. xyli str. CTCB07, compl...    53   1e-05   
gb:AE010739_266145 Methanosarcina acetivorans str. C2A, section ...    53   1e-05   
gb:BA000030_698550 Streptomyces avermitilis MA-4680 genomic DNA,...    53   2e-05   
pir|AI2182|AI2182 hypothetical protein all3016 [imported] - Nost...    53   2e-05   Nostoc sp. PCC 7120
gb:BA000012_668987 Mesorhizobium loti MAFF303099 DNA, complete g...    52   2e-05   
gb:AY596297_634322 Haloarcula marismortui ATCC 43049 chromosome ...    52   2e-05   
gb:AE013432_292279 Methanosarcina mazei strain Goe1, section 214...    52   2e-05   
gb:AE012450_282555 Xanthomonas campestris pv. campestris str. AT...    52   2e-05   
gb:AE010801_266672 Methanosarcina acetivorans str. C2A, section ...    52   2e-05   
gb:CP000010_865109 Burkholderia mallei ATCC 23344 chromosome 1, ...    52   3e-05   
gb:BX571965_790796 Burkholderia pseudomallei strain K96243, chro...    52   3e-05   
gb:BA000040_734894 Bradyrhizobium japonicum USDA 110 DNA, comple...    52   3e-05   
pir|F85505|F85505 unknown [imported] - Escherichia coli (strain ...    52   3e-05   Escherichia coli O157:H7
pir|T10173|T10173 sterol 24-C-methyltransferase (EC 2.1.1.41) - ...    52   3e-05   Ricinus communis
sp|P20187|YT37_STRFR|YT37_STRFR Hypothetical 37.1 kDa protein in transposon...    52   3e-05   Streptomyces fradiae
sp|O66128|UBIE_MICLU|UBIE_MICLU Menaquinone biosynthesis methyltransferase ...    52   3e-05   Micrococcus luteus
gb:NTU81312_1691910 Nicotiana tabacum S-adenosyl-methionine-ster...    52   4e-05   
gb:AX283161_1465223 Sequence 13 from Patent WO0179513.                 52   4e-05   
gb:BX957222_844432 Methanococcus maripaludis S2 complete genome;...    52   4e-05   
gb:CP000026_77268 Salmonella enterica subsp. enterica serovar Pa...    52   4e-05   
pir|S76411|S76411 hypothetical protein - Synechocystis sp. (stra...    52   4e-05   Synechocystis sp. PCC 6803
sp|P36571|BIOC_SERMA|BIOC_SERMA Biotin synthesis protein bioC.>gb:SMABIO_18...    52   4e-05   Serratia marcescens
gb:BA000031_706575 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    51   5e-05   
gb:AF250768_492671 Uncultured bacterium pCosFS1 BioA-like protei...    51   5e-05   
gb:AE005674_70309 Shigella flexneri 2a str. 301, complete genome...    51   5e-05   
gb:AE000516_21614 Mycobacterium tuberculosis CDC1551, complete g...    51   5e-05   
pir|C70723|C70723 probable methyltransferase - Mycobacterium tub...    51   5e-05   Mycobacterium tuberculosis
pir|T01572|T01572 sterol 24-C-methyltransferase (EC 2.1.1.41) - ...    51   5e-05   Zea mays [maize]
gb:BX842656_826371 Bdellovibrio bacteriovorus complete genome, s...    51   7e-05   
gb:BA000039_727155 Thermosynechococcus elongatus BP-1 DNA, compl...    51   7e-05   
gb:BA000023_692721 Sulfolobus tokodaii str. 7 DNA, complete genome.    51   7e-05   
gb:AY744399_645050 Uncultured alpha proteobacterium EBAC2C11, co...    51   7e-05   
gb:AE017239_414164 Mycobacterium avium subsp. paratuberculosis s...    51   7e-05   
gb:AE017229_411376 Mycobacterium avium subsp. paratuberculosis s...    51   7e-05   
gb:AE017002_376380 Bacillus cereus ATCC 14579 section 5 of 18 of...    51   7e-05   
gb:AE010901_267485 Methanosarcina acetivorans str. C2A, section ...    51   7e-05   
gb:AE008706_241988 Salmonella typhimurium LT2, section 14 of 220...    51   7e-05   
gb:AB078612_10181 Leptothrix cholodnii orf1, lthA, lthB, lthC, o...    51   7e-05   
pir|T04138|T04138 sterol 24-C-methyltransferase (EC 2.1.1.41) ES...    51   7e-05   Zea mays [maize]
sp|Q8EXJ3|UBIE_LEPIN|UBIE_LEPIN Menaquinone biosynthesis methyltransferase ...    51   7e-05   
gb:AF053766_1764474 Nicotiana tabacum S-adenosyl-methionine cycl...    50   9e-05   
gb:AY113031_1578191 Arabidopsis thaliana At1g76090/T23E18_40 mRN...    50   9e-05   
gb:BA000040_736280 Bradyrhizobium japonicum USDA 110 DNA, comple...    50   9e-05   
gb:AY396042_616302 Streptomyces griseochromogenes C5-O-methyltra...    50   9e-05   
gb:AE017273_424041 Bacillus cereus ATCC 10987, section 10 of 18 ...    50   9e-05   
gb:AE017269_422795 Bacillus cereus ATCC 10987, section 6 of 18 o...    50   9e-05   
gb:AE014291_307578 Brucella suis 1330 chromosome I, complete seq...    50   9e-05   
gb:AE011114_269301 Methanosarcina acetivorans str. C2A, section ...    50   9e-05   
pir|AF2054|AF2054 hypothetical protein all1988 [imported] - Nost...    50   9e-05   Nostoc sp. PCC 7120
pir|T35233|T35233 hypothetical protein SC5C7.26 SC5C7.26 - Strep...    50   9e-05   Streptomyces coelicolor
pir|T38024|T38024 hypothetical protein SPAC1B3.06c - fission yea...    50   9e-05   Schizosaccharomyces pombe
pir|S62195|S62195 hypothetical protein 3 - Methanosarcina barker...    50   9e-05   Methanosarcina barkeri
pir|AD3481|AD3481 ubiquinone/menaquinone biosynthesis methyltran...    50   9e-05   Brucella melitensis
pir|G90735|G90735 probable enzyme BioC [imported] - Escherichia ...    50   9e-05   Escherichia coli O157:H7
gb:NTU71107_1691894 Nicotiana tabacum S-adenosyl-methionine-ster...    50   1e-04   
gb:BX950851_842206 Erwinia carotovora subsp. atroseptica SCRI104...    50   1e-04   
gb:BX936398_835829 Yersinia pseudotuberculosis IP32953 genome, c...    50   1e-04   
gb:BA000030_704118 Streptomyces avermitilis MA-4680 genomic DNA,...    50   1e-04   
gb:BA000028_695883 Oceanobacillus iheyensis HTE831 DNA, complete...    50   1e-04   
gb:AY593479_630644 Collimonas fungivorans fosmid CFUFOS19, compl...    50   1e-04   
gb:AP006618_561530 Nocardia farcinica IFM 10152 DNA, complete ge...    50   1e-04   
gb:AE016757_324899 Escherichia coli CFT073 section 3 of 18 of th...    50   1e-04   
gb:CP000027_80548 Dehalococcoides ethenogenes 195, complete genome.    50   1e-04   
pir|T03845|T03845 probable sterol 24-C-methyltransferase (EC 2.1...    50   1e-04   Nicotiana tabacum [American tobacco]
pir|AG0141|AG0141 biotin synthesis protein BioC [imported] - Yer...    50   1e-04   Yersinia pestis
sp|Q88SI6|UBIE_LACPL|UBIE_LACPL Menaquinone biosynthesis methyltransferase ...    50   1e-04   Lactobacillus plantarum
gb:TAU60755_1724749 Triticum aestivum delta-24-sterol methyltran...    50   2e-04   
gb:BA000040_735494 Bradyrhizobium japonicum USDA 110 DNA, comple...    50   2e-04   
gb:AP006627_566319 Bacillus clausii KSM-K16 DNA, complete genome.      50   2e-04   
gb:AE017200_403424 Lactobacillus johnsonii NCC 533, section 1 of...    50   2e-04   
gb:AE016775_329810 Pseudomonas putida KT2440 section 2 of 21 of ...    50   2e-04   
gb:AE011136_269529 Methanosarcina acetivorans str. C2A, section ...    50   2e-04   
pir|AI0533|AI0533 probable methyltransferase yafE [imported] - S...    50   2e-04   Salmonella enterica subsp. enterica serovar Typhi
pir|T06795|T06795 probable sterol 24-C-methyltransferase (EC 2.1...    50   2e-04   Triticum aestivum [Canadian hard winter wheat]
sp|Q8YLP4|UBIE_ANASP|UBIE_ANASP Menaquinone biosynthesis methyltransferase ...    50   2e-04   Anabaena sp.
gb:ATU71400_1557202 Arabidopsis thaliana S-adenosyl-methionine-s...    49   2e-04   
gb:AB006704_1509989 Arabidopsis thaliana genomic DNA, chromosome...    49   2e-04   
gb:AX064605_1459216 Sequence 887 from Patent WO0100843.                49   2e-04   
gb:BX927152_832936 Corynebacterium glutamicum ATCC 13032, IS fin...    49   2e-04   
gb:BA000045_741558 Gloeobacter violaceus PCC 7421 DNA, complete ...    49   2e-04   
gb:BA000036_719085 Corynebacterium glutamicum ATCC 13032 DNA, co...    49   2e-04   
gb:AE017028_381645 Bacillus anthracis str. Ames section 5 of 18 ...    49   2e-04   
gb:AE017007_377712 Bacillus cereus ATCC 14579 section 10 of 18 o...    49   2e-04   
gb:AE000516_23559 Mycobacterium tuberculosis CDC1551, complete g...    49   2e-04   
pir|T06780|T06780 probable sterol 24-C-methyltransferase (EC 2.1...    49   2e-04   Glycine max [soybeans]
pir|T03848|T03848 probable sterol 24-C-methyltransferase (EC 2.1...    49   2e-04   Nicotiana tabacum [American tobacco]
pir|T35744|T35744 hypothetical protein SC7H2.13 - Streptomyces c...    49   2e-04   Streptomyces coelicolor
sp|O53392|YX42_MYCTU|YX42_MYCTU Putative methyltransferase Rv3342/MT3445/Mb...    49   2e-04   Mycobacterium tuberculosis
sp|Q10886|Y089_MYCTU|Y089_MYCTU Putative methyltransferase Rv0089/MT0098/Mb...    49   2e-04   Mycobacterium tuberculosis
gb:BX572598_801228 Rhodopseudomonas palustris CGA009 complete ge...    49   3e-04   
gb:AE015943_321240 Clostridium tetani E88, section 8 of 10 of th...    49   3e-04   
gb:AE013315_291222 Methanosarcina mazei strain Goe1, section 97 ...    49   3e-04   
gb:AE013298_291060 Methanosarcina mazei strain Goe1, section 80 ...    49   3e-04   
gb:AE008732_242505 Salmonella typhimurium LT2, section 40 of 220...    49   3e-04   
gb:CP000031_84677 Silicibacter pomeroyi DSS-3, complete genome.        49   3e-04   
gb:CP000026_76749 Salmonella enterica subsp. enterica serovar Pa...    49   3e-04   
pir|C71246|C71246 hypothetical protein PH0226 - Pyrococcus horik...    49   3e-04   Pyrococcus horikoshii
pir|B86925|B86925 conserved hypothetical protein ML0130 [importe...    49   3e-04   Mycobacterium leprae
pir|AB0597|AB0597 biotin synthesis protein BioC [imported] - Sal...    49   3e-04   Salmonella enterica subsp. enterica serovar Typhi
gb:CR382132_1665304 Yarrowia lipolytica chromosome F of strain C...    49   3e-04   
gb:BT000750_1635022 Arabidopsis thaliana clone RAFL09-74-F07 (R1...    49   3e-04   
gb:AY128389_1580688 Arabidopsis thaliana 24-sterol C-methyltrans...    49   3e-04   
gb:ATSTERMET_1554177 A.thaliana mRNA for sterol-C-methyltransfer...    49   3e-04   
gb:BA000045_742117 Gloeobacter violaceus PCC 7421 DNA, complete ...    49   3e-04   
gb:AE016755_324306 Escherichia coli CFT073 section 1 of 18 of th...    49   3e-04   
gb:AE011102_269191 Methanosarcina acetivorans str. C2A, section ...    49   3e-04   
gb:AE010901_267486 Methanosarcina acetivorans str. C2A, section ...    49   3e-04   
gb:CR555306_109223 Azoarcus sp. EbN1 complete genome.                  49   3e-04   
gb:AB091437_12253 Burkholderia multivorans genes for putative me...    49   3e-04   
pir|G75440|G75440 conserved hypothetical protein - Deinococcus r...    49   3e-04   Deinococcus radiodurans
pir|D89009|D89009 protein R08E5.3 [imported] - Caenorhabditis el...    49   3e-04   Caenorhabditis elegans [roundworm]
pir|C83941|C83941 hypothetical protein BH2331 [imported] - Bacil...    49   3e-04   Bacillus halodurans
pir|C75569|C75569 probable methyltransferase - Deinococcus radio...    49   3e-04   Deinococcus radiodurans
pir|H70323|H70323 hypothetical protein aq_262 - Aquifex aeolicus...    49   3e-04   Aquifex aeolicus
pir|S63686|S63686 sterol 24-C-methyltransferase (EC 2.1.1.41) - ...    49   3e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AP006618_557180 Nocardia farcinica IFM 10152 DNA, complete ge...    48   4e-04   
gb:AE017355_462636 Bacillus thuringiensis serovar konkukian str....    48   4e-04   
gb:AE011062_268832 Methanosarcina acetivorans str. C2A, section ...    48   4e-04   
gb:CR543861_102759 Acinetobacter sp. ADP1 complete genome.             48   4e-04   
gb:AB088119_11472 Streptomyces sp. TP-A0274 staurosporine biosyn...    48   4e-04   
pir|G84010|G84010 hypothetical protein BH2887 [imported] - Bacil...    48   4e-04   Bacillus halodurans
pir|AB1903|AB1903 hypothetical protein all0772 [imported] - Nost...    48   4e-04   Nostoc sp. PCC 7120
sp|O06898|BIOC_ERWHE|BIOC_ERWHE Biotin synthesis protein bioC.>gb:EHU51207_...    48   4e-04   Pantoea agglomerans
gb:CP000001_853136 Bacillus cereus ZK, complete genome.                48   6e-04   
gb:BA000030_703620 Streptomyces avermitilis MA-4680 genomic DNA,...    48   6e-04   
gb:AP006627_565746 Bacillus clausii KSM-K16 DNA, complete genome.      48   6e-04   
gb:AE017234_412780 Mycobacterium avium subsp. paratuberculosis s...    48   6e-04   
gb:AE017222_405235 Thermus thermophilus HB27 plasmid pTT27, comp...    48   6e-04   
gb:CR555306_106340 Azoarcus sp. EbN1 complete genome.                  48   6e-04   
pir|E75511|E75511 conserved hypothetical protein - Deinococcus r...    48   6e-04   Deinococcus radiodurans
sp|P71673|YE05_MYCTU|YE05_MYCTU Hypothetical protein Rv1405c/MT1449/Mb1440c...    48   6e-04   Mycobacterium tuberculosis
sp|O86169|UBIE_BACST|UBIE_BACST Menaquinone biosynthesis methyltransferase ...    48   6e-04   Geobacillus stearothermophilus
gb:AF494289_1805328 Arabidopsis thaliana cephalopod (CPH) mRNA, ...    47   8e-04   
gb:CP000001_852525 Bacillus cereus ZK, complete genome.                47   8e-04   
gb:BX950851_840891 Erwinia carotovora subsp. atroseptica SCRI104...    47   8e-04   
gb:AP008227_579520 Thermus thermophilus HB8 plasmid pTT27 DNA, c...    47   8e-04   
gb:AP006618_556510 Nocardia farcinica IFM 10152 DNA, complete ge...    47   8e-04   
gb:AE017355_463242 Bacillus thuringiensis serovar konkukian str....    47   8e-04   
gb:AE017283_431693 Propionibacterium acnes KPA171202, complete g...    47   8e-04   
gb:AE017225_407348 Bacillus anthracis str. Sterne, complete genome.    47   8e-04   
gb:AE017030_382233 Bacillus anthracis str. Ames section 7 of 18 ...    47   8e-04   
gb:AE017004_377025 Bacillus cereus ATCC 14579 section 7 of 18 of...    47   8e-04   
gb:AE012134_279658 Xanthomonas campestris pv. campestris str. AT...    47   8e-04   
sp|Q8A005|UBIE_BACTN|UBIE_BACTN Menaquinone biosynthesis methyltransferase ...    47   8e-04   Bacteroides thetaiotaomicron
gb:CR382121_1654337 Kluyveromyces lactis strain NRRL Y-1140 chro...    47   0.001   
gb:BA000035_716239 Corynebacterium efficiens YS-314 DNA, complet...    47   0.001   
gb:AY596297_632177 Haloarcula marismortui ATCC 43049 chromosome ...    47   0.001   
gb:AP006627_564205 Bacillus clausii KSM-K16 DNA, complete genome.      47   0.001   
gb:AE017271_423406 Bacillus cereus ATCC 10987, section 8 of 18 o...    47   0.001   
gb:AE017162_394885 Prochlorococcus marinus subsp. marinus str. C...    47   0.001   
gb:AE015941_320745 Clostridium tetani E88, section 6 of 10 of th...    47   0.001   
gb:SCU24241_181685 Sorangium cellulosum acyl-CoA dehydrogenase (...    47   0.001   
gb:SAU421825_172282 Stigmatella aurantiaca ORF8, ORF7, ORF6, ORF...    47   0.001   
gb:ECOBIO_128203 E.coli 7,8-diamino-pelargonic acid (bioA), biot...    47   0.001   
sp|Q92BP0|PRMA_LISIN|PRMA_LISIN Ribosomal protein L11 methyltransferase (EC...    47   0.001   
sp|P12999|BIOC_ECOLI|BIOC_ECOLI Biotin synthesis protein bioC.>pir|A64814|B...    47   0.001   Escherichia coli [E. coli]
gb:CR380954_1651256 Candida glabrata strain CBS138 chromosome H ...    47   0.001   
gb:BA000045_740202 Gloeobacter violaceus PCC 7421 DNA, complete ...    47   0.001   
gb:AY138899_591665 Mycobacterium smegmatis glycopeptidolipid loc...    47   0.001   
gb:AP006618_558973 Nocardia farcinica IFM 10152 DNA, complete ge...    47   0.001   
gb:AE017333_448124 Bacillus licheniformis DSM 13, complete genom...    47   0.001   
gb:AE017282_427895 Methylococcus capsulatus str. Bath, complete ...    47   0.001   
gb:AE016824_341444 Leptospira interrogans serovar Copenhageni st...    47   0.001   
gb:AE013598_293934 Xanthomonas oryzae pv. oryzae KACC10331, comp...    47   0.001   
gb:AE011788_276501 Xanthomonas axonopodis pv. citri str. 306, se...    47   0.001   
gb:AE011599_274701 Leptospira interrogans serovar lai str. 56601...    47   0.001   
gb:AE005674_69778 Shigella flexneri 2a str. 301, complete genome...    47   0.001   
sp|Q55423|Y829_SYNY3|Y829_SYNY3 Putative methyltransferase sll0829 (EC 2.1....    47   0.001   Synechocystis sp.
sp|Q8CWG0|UBIE_OCEIH|UBIE_OCEIH Menaquinone biosynthesis methyltransferase ...    47   0.001   Oceanobacillus iheyensis
gb:AC091494_1734775 Oryza sativa chromosome 3 BAC OSJNBa0070N04 ...    46   0.002   
gb:CR382136_1669417 Debaryomyces hansenii chromosome D of strain...    46   0.002   
gb:BA000040_735254 Bradyrhizobium japonicum USDA 110 DNA, comple...    46   0.002   
gb:AP006840_569704 Symbiobacterium thermophilum DNA, complete ge...    46   0.002   
gb:AP006840_569558 Symbiobacterium thermophilum DNA, complete ge...    46   0.002   
gb:AE017333_448252 Bacillus licheniformis DSM 13, complete genom...    46   0.002   
gb:AE013598_295776 Xanthomonas oryzae pv. oryzae KACC10331, comp...    46   0.002   
gb:AE012929_287222 Chlorobium tepidum TLS section 150 of 194 of ...    46   0.002   
gb:AE012252_280765 Xanthomonas campestris pv. campestris str. AT...    46   0.002   
gb:CZA382_119901 Amycolatopsis orientalis cosmid pCZA382.              46   0.002   
gb:CP000031_84215 Silicibacter pomeroyi DSS-3, complete genome.        46   0.002   
gb:AE017342_1754966 Cryptococcus neoformans var. neoformans JEC2...    46   0.002   
gb:BA000043_738788 Geobacillus kaustophilus HTA426 DNA, complete...    46   0.002   
gb:BA000028_695424 Oceanobacillus iheyensis HTE831 DNA, complete...    46   0.002   
gb:AL646078_548725 Ralstonia solanacearum GMI1000 megaplasmid, c...    46   0.002   
gb:AF127374_481430 Streptomyces lavendulae LinA homolog, cytochr...    46   0.002   
gb:AE017269_422868 Bacillus cereus ATCC 10987, section 6 of 18 o...    46   0.002   
gb:AE016925_359337 Chromobacterium violaceum ATCC 12472 section ...    46   0.002   
pir|T25826|T25826 hypothetical protein K12D9.1 - Caenorhabditis ...    46   0.002   Caenorhabditis elegans [roundworm]
pir|AI1512|AI1512 weakly methyltransferase homolog lin0641 [impo...    46   0.002   Listeria innocua
gb:AC135958_1742970 Oryza sativa chromosome 3 BAC OSJNBa0059E14 ...    45   0.003   
gb:AY086699_1571743 Arabidopsis thaliana clone 2688 mRNA, comple...    45   0.003   
gb:CP000020_871270 Vibrio fischeri ES114 chromosome I, complete ...    45   0.003   
gb:CP000001_851944 Bacillus cereus ZK, complete genome.                45   0.003   
gb:BX640422_808221 Bordetella pertussis strain Tohama I, complet...    45   0.003   
gb:BA000045_741371 Gloeobacter violaceus PCC 7421 DNA, complete ...    45   0.003   
gb:BA000012_670414 Mesorhizobium loti MAFF303099 DNA, complete g...    45   0.003   
gb:AY281354_605941 Uncultured Acidobacteria bacterium clone 38c7...    45   0.003   
gb:AP006841_571445 Bacteroides fragilis YCH46 DNA, complete genome.    45   0.003   
gb:AE017355_462464 Bacillus thuringiensis serovar konkukian str....    45   0.003   
pir|T30229|T30229 methyltransferase homolog - Streptomyces hygro...    45   0.003   Streptomyces hygroscopicus
pir|C95849|C95849 conserved hypothetical protein [imported] - Si...    45   0.003   Sinorhizobium meliloti
pir|T50969|T50969 probable DELTA(24)-STEROL C-METHYLTRANSFERASE ...    45   0.003   Neurospora crassa
gb:AY179503_1587411 Clavispora lusitaniae S-adenosylmethionine:D...    45   0.004   
gb:AY070037_1566680 Arabidopsis thaliana unknown protein (At2g31...    45   0.004   
gb:CP000010_866345 Burkholderia mallei ATCC 23344 chromosome 1, ...    45   0.004   
gb:BX572594_800171 Rhodopseudomonas palustris CGA009 complete ge...    45   0.004   
gb:BX571965_792436 Burkholderia pseudomallei strain K96243, chro...    45   0.004   
gb:BX571965_790418 Burkholderia pseudomallei strain K96243, chro...    45   0.004   
gb:BA000045_743553 Gloeobacter violaceus PCC 7421 DNA, complete ...    45   0.004   
gb:AE017238_413767 Mycobacterium avium subsp. paratuberculosis s...    45   0.004   
gb:AE016924_358913 Chromobacterium violaceum ATCC 12472 section ...    45   0.004   
gb:AE011802_276636 Xanthomonas axonopodis pv. citri str. 306, se...    45   0.004   
gb:SAU421825_172267 Stigmatella aurantiaca ORF8, ORF7, ORF6, ORF...    45   0.004   
pir|F97014|F97014 SAM-dependent methyltransferase [imported] - C...    45   0.004   Clostridium acetobutylicum
gb:AY658754_2147764 Synthetic construct Peudomonas aeruginosa cl...    45   0.005   
gb:AY032981_1559421 Pneumocystis carinii S-adenosyl methionine:s...    45   0.005   
gb:CP000001_851766 Bacillus cereus ZK, complete genome.                45   0.005   
gb:BX640411_804608 Bordetella pertussis strain Tohama I, complet...    45   0.005   
gb:BA000043_738159 Geobacillus kaustophilus HTA426 DNA, complete...    45   0.005   
gb:BA000039_727388 Thermosynechococcus elongatus BP-1 DNA, compl...    45   0.005   
gb:BA000035_715266 Corynebacterium efficiens YS-314 DNA, complet...    45   0.005   
gb:BA000030_701994 Streptomyces avermitilis MA-4680 genomic DNA,...    45   0.005   
gb:AY744396_644968 Uncultured proteobacterium RedeBAC7D11 contig...    45   0.005   
gb:AY596296_631305 Haloarcula marismortui ATCC 43049 plasmid pNG...    45   0.005   
gb:AE017275_424804 Bacillus cereus ATCC 10987, section 12 of 18 ...    45   0.005   
gb:AE012556_284194 Xylella fastidiosa Temecula1, section 4 of 9 ...    45   0.005   
gb:AE011511_273781 Leptospira interrogans serovar lai str. 56601...    45   0.005   
gb:AE011090_269070 Methanosarcina acetivorans str. C2A, section ...    45   0.005   
gb:AE010866_267189 Methanosarcina acetivorans str. C2A, section ...    45   0.005   
gb:CP000032_88173 Silicibacter pomeroyi DSS-3 plasmid megaplasmi...    45   0.005   
gb:CP000027_80389 Dehalococcoides ethenogenes 195, complete genome.    45   0.005   
pir|H75436|H75436 conserved hypothetical protein - Deinococcus r...    45   0.005   
pir|A83583|A83583 probable biotin synthesis protein BioC PA0503 ...    45   0.005   
sp|Q8FSB3|UBIE_COREF|UBIE_COREF Menaquinone biosynthesis methyltransferase ...    45   0.005   
sp|Q81SW0|UBIE_BACAN|UBIE_BACAN Menaquinone biosynthesis methyltransferase ...    45   0.005   
gb:AE016817_1747580 Ashbya gossypii (= Eremothecium gossypii) AT...    44   0.006   
gb:AY714864_1190254 Uncultured archaeon GZfos35B7 clone GZfos35B...    44   0.006   
gb:AP006840_569735 Symbiobacterium thermophilum DNA, complete ge...    44   0.006   
gb:AE017233_412395 Mycobacterium avium subsp. paratuberculosis s...    44   0.006   
gb:AE012557_284562 Xylella fastidiosa Temecula1, section 5 of 9 ...    44   0.006   
gb:AE012269_280926 Xanthomonas campestris pv. campestris str. AT...    44   0.006   
gb:AE011103_269202 Methanosarcina acetivorans str. C2A, section ...    44   0.006   
pir|H87413|H87413 hypothetical protein CC1327 [imported] - Caulo...    44   0.006   
pir|H90214|H90214 hypothetical protein SSO0673 [imported] - Sulf...    44   0.006   
pir|A82658|A82658 hypothetical protein XF1617 [imported] - Xylel...    44   0.006   
pir|T36753|T36753 hypothetical protein SCI11.20c - Streptomyces ...    44   0.006   
pir|B75137|B75137 ubiquinone/menaquinone biosynthesis methyl tra...    44   0.006   
pir|C84241|C84241 hypothetical protein Vng0845c [imported] - Hal...    44   0.006   
pir|AC2071|AC2071 hypothetical protein all2121 [imported] - Nost...    44   0.006   
pir|H84364|H84364 membrane protein [imported] - Halobacterium sp...    44   0.006   
pir|D69903|D69903 hypothetical protein yodH - Bacillus subtilis>...    44   0.006   
pir|E84138|E84138 biotin synthesis BioC proein BH3909 [imported]...    44   0.006   
sp|Q9XAP8|UBIE_STRCO|UBIE_STRCO Menaquinone biosynthesis methyltransferase ...    44   0.006   
sp|Q8NT39|UBIE_CORGL|UBIE_CORGL Menaquinone biosynthesis methyltransferase ...    44   0.006   
sp|O74198|ERG6_CANAL|ERG6_CANAL Sterol 24-C-methyltransferase (EC 2.1.1.41)...    44   0.006   
gb:AP006627_566400 Bacillus clausii KSM-K16 DNA, complete genome.      44   0.008   
gb:AP006618_558291 Nocardia farcinica IFM 10152 DNA, complete ge...    44   0.008   
gb:AE017324_443099 Listeria monocytogenes str. 4b F2365, section...    44   0.008   
gb:AE016827_342096 Mannheimia succiniciproducens MBEL55E, comple...    44   0.008   
gb:AE011664_275346 Xanthomonas axonopodis pv. citri str. 306, se...    44   0.008   
gb:SCO939114_176488 Streptomyces coelicolor A3(2) complete genom...    44   0.008   
gb:AB090952_12177 Lechevalieria aerocolonigenes rebeccamycin bio...    44   0.008   
gb:AB071405_9543 Lechevalieria aerocolonigenes rebeccamycin bios...    44   0.008   
pir|F72262|F72262 ubiquinone/menaquinone biosynthesis methyltran...    44   0.008   
pir|H69313|H69313 bioC protein homolog - Archaeoglobus fulgidus>...    44   0.008   
sp|Q820B5|UBIG_COXBU|UBIG_COXBU 3-demethylubiquinone-9 3-methyltransferase ...    44   0.008   
gb:OSJN00271_1697737 Oryza sativa genomic DNA, chromosome 4, BAC...    44   0.011   
gb:AY714847_1189605 Uncultured archaeon GZfos27E7 clone GZfos27E...    44   0.011   
gb:CP000021_872865 Vibrio fischeri ES114 chromosome II, complete...    44   0.011   
gb:BX248355_761722 Corynebacterium diphtheriae gravis NCTC13129,...    44   0.011   
gb:AY142776_591959 Heliobacillus mobilis magnesium-protoporphyri...    44   0.011   
gb:AE017275_424886 Bacillus cereus ATCC 10987, section 12 of 18 ...    44   0.011   
gb:AE017197_402640 Rickettsia typhi str. Wilmington complete gen...    44   0.011   
gb:AE016919_357710 Chromobacterium violaceum ATCC 12472 section ...    44   0.011   
gb:AE011801_276634 Xanthomonas axonopodis pv. citri str. 306, se...    44   0.011   
gb:AE011174_269811 Methanosarcina acetivorans str. C2A, section ...    44   0.011   
gb:AE010793_266606 Methanosarcina acetivorans str. C2A, section ...    44   0.011   
gb:AE010688_265686 Methanosarcina acetivorans str. C2A, section ...    44   0.011   
gb:AE010463_263370 Fusobacterium nucleatum subsp. nucleatum ATCC...    44   0.011   
gb:SME591789_186218 Sinorhizobium meliloti 1021 complete chromos...    44   0.011   
gb:CP000031_87485 Silicibacter pomeroyi DSS-3, complete genome.        44   0.011   
pir|S75267|S75267 hypothetical protein slr1039 - Synechocystis s...    44   0.011   
pir|T31455|T31455 magnesium-protoporphyrin IX methyltransferase ...    44   0.011   
pir|AE1154|AE1154 methyltransferase homolog lmo0637 [imported] -...    44   0.011   
pir|A87478|A87478 methyltransferase, probable [imported] - Caulo...    44   0.011   
sp|P31113|UBIE_BACSU|UBIE_BACSU Menaquinone biosynthesis methyltransferase ...    44   0.011   
sp|Q81FQ6|UBIE_BACCR|UBIE_BACCR Menaquinone biosynthesis methyltransferase ...    44   0.011   
gb:AP004329_1840262 Oryza sativa (japonica cultivar-group) genom...    43   0.014   
gb:AP003734_1832589 Oryza sativa (japonica cultivar-group) genom...    43   0.014   
gb:AB039927_1519381 Arabidopsis thaliana mRNA for ERD3 protein, ...    43   0.014   
gb:BX248586_764211 Blochmannia floridanus complete genome; segme...    43   0.014   
gb:BA000023_692282 Sulfolobus tokodaii str. 7 DNA, complete genome.    43   0.014   
gb:AL646058_545288 Ralstonia solanacearum GMI1000 chromosome, co...    43   0.014   
gb:AF348454_503456 Rhizobium etli putative O-acetyltransferases ...    43   0.014   
gb:AF040570_472274 Amycolatopsis mediterranei rifamycin biosynth...    43   0.014   
gb:AE017327_443916 Listeria monocytogenes str. 4b F2365, section...    43   0.014   
gb:AE013474_292638 Methanosarcina mazei strain Goe1, section 256...    43   0.014   
gb:AE012280_281035 Xanthomonas campestris pv. campestris str. AT...    43   0.014   
gb:CP000027_79404 Dehalococcoides ethenogenes 195, complete genome.    43   0.014   
pir|T36289|T36289 hypothetical protein SCE7.07c - Streptomyces c...    43   0.014   
pir|A85216|A85216 hypothetical protein AT4g19120 [imported] - Ar...    43   0.014   
pir|T04433|T04433 hypothetical protein T18B16.90 - Arabidopsis t...    43   0.014   
pir|AB2424|AB2424 hypothetical protein all4946 [imported] - Nost...    43   0.014   
pir|E87193|E87193 hypothetical protein ML2273 [imported] - Mycob...    43   0.014   
pir|B70527|B70527 hypothetical protein Rv0329c - Mycobacterium t...    43   0.014   
sp|Q9CBA8|UBIE_MYCLE|UBIE_MYCLE Menaquinone biosynthesis methyltransferase ...    43   0.014   
sp|Q83A90|UBIE_COXBU|UBIE_COXBU Ubiquinone/menaquinone biosynthesis methylt...    43   0.014   
sp|Q9KCC4|UBIE_BACHD|UBIE_BACHD Menaquinone biosynthesis methyltransferase ...    43   0.014   
gb:AL161659_1922116 Human DNA sequence from clone RP11-526K24 on...    43   0.019   
gb:AF308162_1784797 Pneumocystis carinii f. sp. carinii sterol m...    43   0.019   
gb:SCPDR4_1709074 Yeast PDR4 gene for pdr4 protein.                    43   0.019   
gb:S72460_1704474 LIS1/ERG6=putative S-adenosylmethionine-depend...    43   0.019   
gb:AE013599_1131771 Drosophila melanogaster chromosome 2R, compl...    43   0.019   
gb:BX571965_790227 Burkholderia pseudomallei strain K96243, chro...    43   0.019   
gb:BX294133_765203 Pirellula sp. strain 1 complete genome; segme...    43   0.019   
gb:BA000012_670546 Mesorhizobium loti MAFF303099 DNA, complete g...    43   0.019   
gb:AP008231_581148 Synechococcus elongatus PCC 6301 DNA, complet...    43   0.019   
gb:AE016910_355131 Chromobacterium violaceum ATCC 12472 section ...    43   0.019   
gb:AE013598_296690 Xanthomonas oryzae pv. oryzae KACC10331, comp...    43   0.019   
gb:CR628336_113087 Legionella pneumophila str. Paris complete ge...    43   0.019   
pir|AI2460|AI2460 hypothetical protein all5241 [imported] - Nost...    43   0.019   
pir|A90354|A90354 conserved hypothetical protein [imported] - Su...    43   0.019   
pir|D81599|D81599 ubiquinone/menaquinone biosynthesis methyltran...    43   0.019   
pir|S42003|S42003 sterol 24-C-methyltransferase (EC 2.1.1.41) - ...    43   0.019   
sp|Q58648|YC52_METJA|YC52_METJA Hypothetical protein MJ1252.>pir|B64456|B64...    43   0.019   
sp|P30866|YAFE_ECOLI|YAFE_ECOLI Hypothetical protein yafE.>pir|JS0718|JS071...    43   0.019   
sp|Q9K075|UBIE_NEIMB|UBIE_NEIMB Ubiquinone/menaquinone biosynthesis methylt...    43   0.019   
sp|Q9JV83|UBIE_NEIMA|UBIE_NEIMA Ubiquinone/menaquinone biosynthesis methylt...    43   0.019   
sp|Q9K2B6|UBIE_CHLPN|UBIE_CHLPN Menaquinone biosynthesis methyltransferase ...    43   0.019   
sp|P25087|ERG6_YEAST|ERG6_YEAST Sterol 24-C-methyltransferase (EC 2.1.1.41)...    43   0.019   
gb:AE017233_412370 Mycobacterium avium subsp. paratuberculosis s...    42   0.025   
gb:AE013358_291607 Methanosarcina mazei strain Goe1, section 140...    42   0.025   
gb:AE013182_289961 Thermoanaerobacter tengcongensis MB4, section...    42   0.025   
gb:AE010192_260305 Pyrococcus furiosus DSM 3638, section 67 of 1...    42   0.025   
gb:CR628337_116025 Legionella pneumophila str. Lens complete gen...    42   0.025   
gb:AE004969_60097 Neisseria gonorrhoeae FA 1090, complete genome.      42   0.025   
pir|C71674|C71674 ubiquinone/menaquinone biosynthesis methlytran...    42   0.025   
sp|Q8DGE4|UBIE_SYNEL|UBIE_SYNEL Menaquinone biosynthesis methyltransferase ...    42   0.025   
sp|Q9ZCP3|UBIE_RICPR|UBIE_RICPR Ubiquinone/menaquinone biosynthesis methylt...    42   0.025   
gb:AY714841_1189332 Uncultured archaeon GZfos26E7 clone GZfos26E...    42   0.032   
gb:CR858563_1182734 Pongo pygmaeus mRNA; cDNA DKFZp468A017 (from...    42   0.032   
gb:BX321864_774626 Nitrosomonas europaea ATCC 19718, complete ge...    42   0.032   
gb:BA000040_733199 Bradyrhizobium japonicum USDA 110 DNA, comple...    42   0.032   
gb:BA000030_702607 Streptomyces avermitilis MA-4680 genomic DNA,...    42   0.032   
gb:AP008231_580145 Synechococcus elongatus PCC 6301 DNA, complet...    42   0.032   
gb:AP008231_579842 Synechococcus elongatus PCC 6301 DNA, complet...    42   0.032   
gb:AF048749_473026 Bacteroides fragilis capsular polysaccharide ...    42   0.032   
gb:AE017282_429482 Methylococcus capsulatus str. Bath, complete ...    42   0.032   
gb:AE017282_428032 Methylococcus capsulatus str. Bath, complete ...    42   0.032   
gb:AE017282_427772 Methylococcus capsulatus str. Bath, complete ...    42   0.032   
gb:AE017241_414760 Mycobacterium avium subsp. paratuberculosis s...    42   0.032   
gb:AE017024_380554 Bacillus anthracis str. Ames section 1 of 18 ...    42   0.032   
gb:AE016913_355950 Chromobacterium violaceum ATCC 12472 section ...    42   0.032   
pir|A83577|A83577 probable transcription regulator PA0547 [impor...    42   0.032   
pir|G86977|G86977 probable methyltransferase [imported] - Mycoba...    42   0.032   
pir|F86367|F86367 protein F26F24.24 [imported] - Arabidopsis tha...    42   0.032   
pir|D69267|D69267 ubiquinone/menaquinone biosynthesis methyltran...    42   0.032   
sp|Q81ZX2|UBIE_STRAW|UBIE_STRAW Menaquinone biosynthesis methyltransferase ...    42   0.032   
sp|Q88D17|UBIE_PSEPK|UBIE_PSEPK Ubiquinone/menaquinone biosynthesis methylt...    42   0.032   
sp|Q9HUC0|UBIE_PSEAE|UBIE_PSEAE Ubiquinone/menaquinone biosynthesis methylt...    42   0.032   
sp|Q9S5A2|PRMA_LISMO|PRMA_LISMO Ribosomal protein L11 methyltransferase (EC...    42   0.032   
gb:AY293576_1595720 Chlamydomonas reinhardtii MPBQ/MSBQ transfer...    42   0.042   
gb:AY085864_1570928 Arabidopsis thaliana clone 19143 mRNA, compl...    42   0.042   
gb:AB054257_1521314 Arabidopsis thaliana mRNA for APG1, complete...    42   0.042   
gb:AY714826_1188787 Uncultured archaeon GZfos18C8 clone GZfos18C...    42   0.042   
gb:CP000001_853961 Bacillus cereus ZK, complete genome.                42   0.042   
gb:BA000030_698536 Streptomyces avermitilis MA-4680 genomic DNA,...    42   0.042   
gb:BA000012_669708 Mesorhizobium loti MAFF303099 DNA, complete g...    42   0.042   
gb:AE017354_461235 Legionella pneumophila subsp. pneumophila str...    42   0.042   
gb:AE015641_316378 Shewanella oneidensis MR-1 section 190 of 457...    42   0.042   
gb:AE013598_296403 Xanthomonas oryzae pv. oryzae KACC10331, comp...    42   0.042   
gb:CR522870_101936 Desulfotalea psychrophila LSv54 chromosome.         42   0.042   
pir|S74449|S74449 hypothetical protein sll1407 - Synechocystis s...    42   0.042   
pir|G70812|G70812 hypothetical protein Rv0839 - Mycobacterium tu...    42   0.042   
pir|T49182|T49182 probable chloroplast inner envelope protein - ...    42   0.042   
sp|P44167|YECP_HAEIN|YECP_HAEIN Protein HI1351.>pir|E64026|E64026 probable ...    42   0.042   
gb:AF125448_1243082 Caenorhabditis elegans fosmid H14E04, comple...    41   0.055   
gb:BX248335_757692 Mycobacterium bovis subsp. bovis AF2122/97 co...    41   0.055   
gb:BA000039_727737 Thermosynechococcus elongatus BP-1 DNA, compl...    41   0.055   
gb:AY061859_587425 Pseudomonas fluorescens safracin biosynthesis...    41   0.055   
gb:AP006840_569093 Symbiobacterium thermophilum DNA, complete ge...    41   0.055   
gb:AE017268_422603 Bacillus cereus ATCC 10987, section 5 of 18 o...    41   0.055   
gb:AE011813_276740 Xanthomonas axonopodis pv. citri str. 306, se...    41   0.055   
gb:AE010977_268095 Methanosarcina acetivorans str. C2A, section ...    41   0.055   
gb:AE000516_20577 Mycobacterium tuberculosis CDC1551, complete g...    41   0.055   
pir|G90369|G90369 conserved hypothetical protein [imported] - Su...    41   0.055   
pir|T45395|T45395 hypothetical protein MLCB637.02c [imported] - ...    41   0.055   
pir|T33885|T33885 hypothetical protein H14E04.1 - Caenorhabditis...    41   0.055   
sp|Q9PAM5|UBIG_XYLFA|UBIG_XYLFA 3-demethylubiquinone-9 3-methyltransferase ...    41   0.055   
sp|Q9Z439|UBIE_PSEPU|UBIE_PSEPU Ubiquinone/menaquinone biosynthesis methylt...    41   0.055   
sp|Q9Z5E9|UBIE_PSEOL|UBIE_PSEOL Ubiquinone/menaquinone biosynthesis methylt...    41   0.055   
sp|O06424|UBIE_MYCTU|UBIE_MYCTU Menaquinone biosynthesis methyltransferase ...    41   0.055   
sp|Q8YDE4|UBIE_BRUME|UBIE_BRUME Ubiquinone/menaquinone biosynthesis methylt...    41   0.055   
gb:BX908798_830616 Parachlamydia-related symbiont UWE25, complet...    41   0.071   
gb:BX572096_797954 Prochlorococcus marinus MIT9313 complete geno...    41   0.071   
gb:BA000030_703743 Streptomyces avermitilis MA-4680 genomic DNA,...    41   0.071   
gb:AY596297_633797 Haloarcula marismortui ATCC 43049 chromosome ...    41   0.071   
gb:AY596297_633165 Haloarcula marismortui ATCC 43049 chromosome ...    41   0.071   
gb:AY005136_584407 Chlorobium tepidum FruB (fruB) gene, partial ...    41   0.071   
gb:AP006840_568553 Symbiobacterium thermophilum DNA, complete ge...    41   0.071   
gb:AL646066_546732 Ralstonia solanacearum GMI1000 chromosome, co...    41   0.071   
gb:AE017311_438860 Desulfovibrio vulgaris subsp. vulgaris str. H...    41   0.071   
gb:AE016998_375311 Bacillus cereus ATCC 14579 section 1 of 18 of...    41   0.071   
gb:AE015763_317603 Shewanella oneidensis MR-1 section 312 of 457...    41   0.071   
gb:SAG766847_170333 Streptococcus agalactiae NEM316 complete gen...    41   0.071   
pir|E84390|E84390 24-sterol C-methyltransferase [imported] - Hal...    41   0.071   
pir|T08338|T08338 conserved hypothetical protein H1434 - Halobac...    41   0.071   
pir|D86772|D86772 hypothetical protein yljG [imported] - Lactoco...    41   0.071   
pir|H82600|H82600 biotin synthesis protein XF2099 [imported] - X...    41   0.071   
sp|Q8D382|UBIE_WIGBR|UBIE_WIGBR Ubiquinone/menaquinone biosynthesis methylt...    41   0.071   
sp|P59911|UBIE_HAEDU|UBIE_HAEDU Ubiquinone/menaquinone biosynthesis methylt...    41   0.071   
sp|Q8FUZ3|UBIE_BRUSU|UBIE_BRUSU Ubiquinone/menaquinone biosynthesis methylt...    41   0.071   
gb:AP004333_1840365 Oryza sativa (japonica cultivar-group) genom...    40   0.093   
gb:BX640412_805038 Bordetella pertussis strain Tohama I, complet...    40   0.093   
gb:BA000045_741593 Gloeobacter violaceus PCC 7421 DNA, complete ...    40   0.093   
gb:BA000043_737169 Geobacillus kaustophilus HTA426 DNA, complete...    40   0.093   
gb:AP006618_560686 Nocardia farcinica IFM 10152 DNA, complete ge...    40   0.093   
gb:AE017355_464705 Bacillus thuringiensis serovar konkukian str....    40   0.093   
gb:AE017301_435749 Thermus thermophilus HB27 section 1 of 7 of t...    40   0.093   
gb:AE017225_408827 Bacillus anthracis str. Sterne, complete genome.    40   0.093   
gb:AE017180_401083 Geobacter sulfurreducens PCA, complete genome.      40   0.093   
gb:AE017035_383705 Bacillus anthracis str. Ames section 12 of 18...    40   0.093   
gb:AE015712_317105 Shewanella oneidensis MR-1 section 261 of 457...    40   0.093   
gb:AE012946_287419 Chlorobium tepidum TLS section 167 of 194 of ...    40   0.093   
gb:AE011052_268757 Methanosarcina acetivorans str. C2A, section ...    40   0.093   
gb:CR555306_105970 Azoarcus sp. EbN1 complete genome.                  40   0.093   
pir|AC2543|AC2543 hypothetical protein all7630 [imported] - Nost...    40   0.093   
sp|P46326|YXBB_BACSU|YXBB_BACSU Hypothetical protein yxbB.>pir|F70072|F7007...    40   0.093   
gb:AP003800_1833532 Oryza sativa (japonica cultivar-group) genom...    40   0.12    
gb:AF467900_1802447 Prunus persica clone pPn31C7 hypothetical pr...    40   0.12    
gb:BX842655_826243 Bdellovibrio bacteriovorus complete genome, s...    40   0.12    
gb:BX640423_808541 Bordetella parapertussis strain 12822, comple...    40   0.12    
gb:BX571965_790258 Burkholderia pseudomallei strain K96243, chro...    40   0.12    
gb:BA000045_744446 Gloeobacter violaceus PCC 7421 DNA, complete ...    40   0.12    
gb:AE017282_428746 Methylococcus capsulatus str. Bath, complete ...    40   0.12    
gb:AE017234_412712 Mycobacterium avium subsp. paratuberculosis s...    40   0.12    
gb:AE013598_296688 Xanthomonas oryzae pv. oryzae KACC10331, comp...    40   0.12    
gb:AE012269_280928 Xanthomonas campestris pv. campestris str. AT...    40   0.12    


>gb:AY086976_1572014 Arabidopsis thaliana clone 30065 mRNA, complete
            sequence.>gb:BT004126_1637226 Arabidopsis thaliana clone
            RAFL15-15-H02 (R20689) unknown protein (At1g78140) mRNA,
            complete cds.>gb:BT004985_1637931 Arabidopsis thaliana
            clone U20689 unknown protein (At1g78140) mRNA, complete
            cds.
          Length = 355

 Score =  404 bits (1039), Expect = e-111
 Identities = 198/302 (65%), Positives = 240/302 (79%), Gaps = 2/302 (0%)
 Frame = +3

Query: 225  FVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDP-GLSLSSMAQSNLECSTCRKKYS 401
            FV +K  +   EKK+      LACPICY++  W   P GL  S+ +   ++C+TC++ YS
Sbjct: 61   FVIEKKDKNRGEKKI------LACPICYNSLAWISQPNGLIESAASGIQVQCNTCKRSYS 114

Query: 402  GNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFEL 581
            GNETH+DL +A G K Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+
Sbjct: 115  GNETHLDLAVASGSKRYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEM 173

Query: 582  MQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFP 761
             + YLKPV+GGNIIDASCGSG+FSRLF +S LFSLV+ALD+SE ML+QCYE + +EENFP
Sbjct: 174  AKAYLKPVLGGNIIDASCGSGMFSRLFTRSDLFSLVIALDYSENMLRQCYELLNKEENFP 233

Query: 762  N-ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI 938
            N E ++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I
Sbjct: 234  NKEKLVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFI 293

Query: 939  VDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK 1118
             DG +SF PF++ LR+   + SGSHIFL+E+ELED+C  CGLV F  +RN  FIML+A K
Sbjct: 294  YDGPFSFIPFLKNLRQEIMRYSGSHIFLNERELEDICKACGLVNFTRVRNGPFIMLSATK 353

Query: 1119 PS 1124
            PS
Sbjct: 354  PS 355



>pir|F96810|F96810 hypothetical protein T11I11.8 [imported] -
            Arabidopsis thaliana>gb:AE005173_895337 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC012680_1537803 Arabidopsis thaliana
            chromosome 1 BAC T11I11 genomic sequence, complete
            sequence.
          Length = 317

 Score =  335 bits (858), Expect = 2e-90
 Identities = 172/301 (57%), Positives = 208/301 (69%), Gaps = 1/301 (0%)
 Frame = +3

Query: 225  FVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDP-GLSLSSMAQSNLECSTCRKKYS 401
            FV +K  +   EKK+      LACPICY++  W   P GL  S+ +   ++C+TC++ YS
Sbjct: 61   FVIEKKDKNRGEKKI------LACPICYNSLAWISQPNGLIESAASGIQVQCNTCKRSYS 114

Query: 402  GNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFEL 581
            GNETH+DL +A G K Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+
Sbjct: 115  GNETHLDLAVASGSKRYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEM 173

Query: 582  MQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFP 761
             + YLKPV+GGNIIDASCGSG+FSR                                   
Sbjct: 174  AKAYLKPVLGGNIIDASCGSGMFSR----------------------------------- 198

Query: 762  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV 941
               ++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I 
Sbjct: 199  --KLVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIY 256

Query: 942  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP 1121
            DG +SF PF++ LR+   + SGSHIFL+E+ELED+C  CGLV F  +RN  FIML+A KP
Sbjct: 257  DGPFSFIPFLKNLRQEIMRYSGSHIFLNERELEDICKACGLVNFTRVRNGPFIMLSATKP 316

Query: 1122 S 1124
            S
Sbjct: 317  S 317



>gb:AP003568_1830983 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC
            clone:P0017B12.>gb:AP004008_1836263 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 6, BAC
            clone:OJ1226_A12.
          Length = 345

 Score =  320 bits (819), Expect = 6e-86
 Identities = 164/306 (53%), Positives = 209/306 (68%), Gaps = 8/306 (2%)
 Frame = +3

Query: 228  VEDKPVRLIDEKKVEIRTN----LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKK 395
            VE   + +  E KV    N    + ACP+CY+     G  G++L S+ +S  +CS C K 
Sbjct: 43   VEAAAIAVEPENKVPQSNNSEAEVFACPVCYEPLIRKGPSGINLPSIYRSGFKCSKCNKS 102

Query: 396  YSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEF 575
            ++  +  +DLT+  G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF
Sbjct: 103  FTSKDIFLDLTVTSGTKEYSELKPARTELFRSPLVSFLYERGWRQNFNR-SGFPGLDEEF 161

Query: 576  ELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEEN 755
            ++ QDY + V GG ++D SCGSGLF+R FAKSG +S V+ALDFSE ML QCYEFI+Q++ 
Sbjct: 162  QMAQDYFQSVAGGVLLDVSCGSGLFTRKFAKSGSYSAVIALDFSENMLCQCYEFIQQDDT 221

Query: 756  FPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTY 935
              N N+ LVRADISRLPFASSS+DA+HAGAA+HCWPSPS AVAEISRVLRPGGVFVATT+
Sbjct: 222  LVNTNLALVRADISRLPFASSSIDAIHAGAAIHCWPSPSNAVAEISRVLRPGGVFVATTF 281

Query: 936  IVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIM 1103
            +        PF    +RPLR+    ++ S+ +  E ELEDLC +CGLV +     R FIM
Sbjct: 282  LSSP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGELEDLCKSCGLVNYSSKVQRSFIM 339

Query: 1104 LTAMKP 1121
             +  KP
Sbjct: 340  FSGQKP 345



>gb:AP004658_1842820 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0042B03.
          Length = 323

 Score =  219 bits (557), Expect = 1e-55
 Identities = 124/274 (45%), Positives = 164/274 (59%), Gaps = 19/274 (6%)
 Frame = +3

Query: 210 ALSTTFVEDKPVRLIDEKKVEI------RTNLLACPICYDAFTWNGDPGLSLSSMAQSNL 371
           +++  FV   P   ++E  VE       +   LACPICY     + D    +S+ + S+L
Sbjct: 50  SVTPEFVTAAPDEAVEESSVEREPAAENKLRKLACPICYYPLISSSDQSAPVSAASSSSL 109

Query: 372 ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG 551
           ECSTC+K Y     + D+T+A G   Y E+   +TE+FR PLVSFLYERGWRQ+F +W G
Sbjct: 110 ECSTCKKFYPNRGDYWDMTVAVGSTEYSESTTVTTEVFRTPLVSFLYERGWRQNF-IWSG 168

Query: 552 FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVAL---DFSETMLQ 722
           FPG E+E +++  Y           A   +  FS   A+  LF+  + L   DFSE ML+
Sbjct: 169 FPGLERERDMINIY-----------AQMFTQPFSLRQARKVLFASKLGLAQSDFSENMLK 217

Query: 723 QCYEFIKQEE-------NFPNEN---IILVRADISRLPFASSSVDAVHAGAALHCWPSPS 872
           QC E++KQE         FPN     + L RADISRLPF S S+DAVHA AA+HCWPSP+
Sbjct: 218 QCNEYVKQENISDKYGPQFPNHQHLTLALARADISRLPFVSGSIDAVHAAAAIHCWPSPA 277

Query: 873 AAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVR 974
            AVAEISRVLRPGGVFVA+T++ D +    P +R
Sbjct: 278 CAVAEISRVLRPGGVFVASTFVADILPPAVPVLR 311



>pir|T02115|T02115 hypothetical protein At2g41040 [imported] -
           Arabidopsis thaliana>gb:AC004261_1531634 Arabidopsis
           thaliana chromosome 2 clone T3K9 map CIC11C08, complete
           sequence.
          Length = 262

 Score =  206 bits (523), Expect = 1e-51
 Identities = 104/209 (49%), Positives = 136/209 (65%), Gaps = 2/209 (0%)
 Frame = +3

Query: 264 KVEIR-TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG 440
           K+EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct: 68  KIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD 127

Query: 441 GKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNI 620
              Y E    +TELFR PLVSFLYERGWRQ+F    GFPGP++EF + ++Y K   GG +
Sbjct: 128 LDDYNEVKPITTELFRSPLVSFLYERGWRQAFKR-SGFPGPDEEFRMAEEYFKEAEGGLL 186

Query: 621 IDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNE-NIILVRADIS 797
           +D              SG +S V+ALD+SE ML+QC EFIK +  F N  NI +VRAD+S
Sbjct: 187 VD--------------SGKYSGVIALDYSENMLRQCKEFIKNDNTFDNSTNIAVVRADVS 232

Query: 798 RLPFASSSVDAVHAGAALHCWPSPSAAVA 884
           RLPF S SVDAVHAGAALHCWPSP+ AV+
Sbjct: 233 RLPFPSGSVDAVHAGAALHCWPSPTNAVS 261



>gb:AE011153_269626 Methanosarcina acetivorans str. C2A, section 498
           of 534 of the complete genome.>gb:AE010299_910185
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 179

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 41/116 (35%), Positives = 62/116 (53%), Gaps = 1/116 (0%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKS-GLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVR 785
           G ++++  CGSG F+   A++ G+   V ALD    ML Q  E + + EN    NI L++
Sbjct: 28  GMHVLEVGCGSGAFTTFVARTVGIKGEVYALDIQPGMLMQLKEKLSRPENRDIRNIKLIK 87

Query: 786 ADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY 953
            D   LPF  +S D V+A   +   P  +  + EI RVL+PGG+   T ++ D  Y
Sbjct: 88  GDAHNLPFDDNSFDLVYAITVIQEIPDKNKVLKEIKRVLKPGGILAVTEFLPDPDY 143



>gb:AY596298_634895 Haloarcula marismortui ATCC 43049 chromosome II,
           complete sequence.
          Length = 240

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 44/128 (34%), Positives = 62/128 (48%), Gaps = 4/128 (3%)
 Frame = +3

Query: 612 GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRAD 791
           G ++DA  G+G+ +R+F ++   +  +ALD S  ML +             E+   ++AD
Sbjct: 46  GTVLDAGAGTGVSTRVFTETA--AETIALDISREMLSEI------------ESTARLQAD 91

Query: 792 ISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATT----YIVDGIYSF 959
              LP    SVD V   A+L   P P+AAV E +RVLR GGV  A      +  DG   F
Sbjct: 92  FDHLPLCDQSVDGVAFTASLFLVPEPAAAVREAARVLRSGGVVGAVAPLGWFRPDGTDVF 151

Query: 960 TPFVRPLR 983
             F R  R
Sbjct: 152 EQFERESR 159



>gb:AY142866_592049 Heliobacillus mobilis
            2-heptaprenyl-1,4-naphthoquinone methyltransferase gene,
            partial cds.
          Length = 254

 Score = 60.8 bits (146), Expect = 7e-08
 Identities = 49/174 (28%), Positives = 79/174 (45%), Gaps = 17/174 (9%)
 Frame = +3

Query: 606  MGGNIIDASCGSGLFSRLFAKS-GLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILV 782
            +GG  +D  CG+G  ++  A+  G    VVALDF+  ML+   E  KQ +      I  +
Sbjct: 53   IGGTALDVCCGTGELAQALAERVGRRGHVVALDFNHDMLEVARE--KQRQRLLEPQIEFI 110

Query: 783  RADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVAT---------TY 935
            + +   LPF  +  DA   G  L   P    A+ E++RV+RPGG  V             
Sbjct: 111  QGNAMELPFEDNRFDAATVGFGLRNVPDYRQALREMTRVIRPGGTVVCLETSKPVSTGLR 170

Query: 936  IVDGIY--SFTPFVRPLREN----FAQISGS-HIFLDEKELEDLCTTCGLVGFK 1076
            ++ G+Y   F P +  +       +A ++ S   FL ++EL  +    GL+  +
Sbjct: 171  LLHGLYVDHFIPMLDKMAAGRQGPYAWLARSTQAFLSQEELAQVFRDIGLINVR 224



>gb:BX571856_780922 Staphylococcus aureus subsp. aureus strain
           MRSA252, complete genome.
          Length = 241

 Score = 60.5 bits (145), Expect = 9e-08
 Identities = 38/106 (35%), Positives = 56/106 (52%), Gaps = 1/106 (0%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKS-GLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVR 785
           G   +D  CG+G ++   +K+ G    V  +DFSE ML+     + +E+    EN+ LV 
Sbjct: 50  GMKALDVCCGTGDWTIALSKAVGSTGEVTGIDFSENMLE-----VGKEKTASMENVKLVH 104

Query: 786 ADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
            D   LPF  +S D V  G  L   P    A+ E++RVL+PGG+ V
Sbjct: 105 GDAMELPFEDNSFDYVTIGFGLRNVPDYLVALKEMNRVLKPGGMVV 150



>pir|T44579|T44579 C5-O-methyltransferase [imported] - Streptomyces
           avermitilis>gb:AB032524_5143 Streptomyces avermitilis
           avermectin biosynthetic gene cluster (aveR, aveF, aveD),
           complete cds.>gb:BA000030_698823 Streptomyces
           avermitilis MA-4680 genomic DNA, complete genome.
          Length = 283

 Score = 60.5 bits (145), Expect = 9e-08
 Identities = 43/130 (33%), Positives = 60/130 (46%), Gaps = 2/130 (1%)
 Frame = +3

Query: 546 GGFPGP--EKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETML 719
           G  PG   ++  +L+   L+ + G  ++D  CGSG  +   A S     VV +  SE  +
Sbjct: 45  GSSPGKAADRLTDLLIGKLRGITGRRVLDVGCGSGKPAVRLALSAPVD-VVGVTVSEVQV 103

Query: 720 QQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRV 899
                  KQ      + ++  RAD   LPF   S DA  A   L   PSP+  + EI+RV
Sbjct: 104 GLATALAKQSH--VADRVVFTRADAMELPFPDGSFDAAWALECLLHMPSPAQVIREIARV 161

Query: 900 LRPGGVFVAT 929
           LRPGG    T
Sbjct: 162 LRPGGRLAVT 171



>sp|Q99U19|UBIE_STAAM Menaquinone biosynthesis methyltransferase
           ubiE (EC 2.1.1.-).>pir|G89925|G89925 menaquinone
           biosynthesis methyltransferase [imported] -
           Staphylococcus aureus (strain N315)>gb:CP000046_91634
           Staphylococcus aureus subsp. aureus COL, complete
           genome.>gb:BA000017_677160 Staphylococcus aureus subsp.
           aureus Mu50 DNA, complete genome.>gb:BA000018_679746
           Staphylococcus aureus subsp. aureus N315 genomic DNA,
           complete genome.>gb:BA000033_711652 Staphylococcus
           aureus subsp. aureus MW2 DNA, complete genome,
           strain:MW2.>gb:BX571857_783633 Staphylococcus aureus
           strain MSSA476, complete genome.
          Length = 241

 Score = 60.5 bits (145), Expect = 9e-08
 Identities = 38/106 (35%), Positives = 56/106 (52%), Gaps = 1/106 (0%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKS-GLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVR 785
           G   +D  CG+G ++   +K+ G    V  +DFSE ML+     + +E+    EN+ LV 
Sbjct: 50  GTKALDVCCGTGDWTIALSKAVGPTGEVTGIDFSENMLE-----VGKEKTASMENVKLVH 104

Query: 786 ADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
            D   LPF  +S D V  G  L   P    A+ E++RVL+PGG+ V
Sbjct: 105 GDAMELPFEDNSFDYVTIGFGLRNVPDYLVALKEMNRVLKPGGMVV 150



>gb:BA000021_687201 Wigglesworthia glossinidia endosymbiont of
           Glossina brevipalpis DNA, complete genome.
          Length = 253

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 38/112 (33%), Positives = 58/112 (51%)
 Frame = +3

Query: 603 VMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILV 782
           ++   ++DA CG+GLFSR +      + V+ALD S  ML+Q      +  N  N   I +
Sbjct: 42  IIQSKLLDAGCGTGLFSRYWKSFN--NQVIALDISYGMLEQA-----KRRNSAN---IYI 91

Query: 783 RADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI 938
             DI   P    +VD + +  A+      S A++E+ R+LRPGG  V +T I
Sbjct: 92  LGDIENSPLIDKTVDIIFSNLAIQWCNDFSRALSELYRILRPGGFLVLSTLI 143



>gb:BA000016_673215 Clostridium perfringens str. 13 DNA, complete
           genome.
          Length = 191

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 40/120 (33%), Positives = 61/120 (50%), Gaps = 2/120 (1%)
 Frame = +3

Query: 576 ELMQDYLKPVMGGN--IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQE 749
           EL +  +K V   N  I D   G+G  S   AK    ++V +LD S+ ML++ Y   K+ 
Sbjct: 9   ELREMAIKSVDISNKVIADLGAGTGFISLGIAKKA--NIVFSLDSSKNMLKELYSSAKEN 66

Query: 750 ENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVAT 929
           E     NI  ++ ++  LP    S+D +    ALH   +P  A+ E++RVL+P G  V T
Sbjct: 67  EI---NNIYPIKGELENLPLFDDSIDLIFMNMALHHVANPDKAIKEMNRVLKPNGKVVIT 123



>pir|A90193|A90193 conserved hypothetical protein [imported] -
           Sulfolobus solfataricus>gb:AE006679_221398 Sulfolobus
           solfataricus P2 section 38 of 272 of the complete
           genome.>gb:AE006641_1107246 Sulfolobus solfataricus P2,
           complete genome.
          Length = 182

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 44/117 (37%), Positives = 59/117 (50%)
 Frame = +3

Query: 591 YLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNEN 770
           Y+K + G  IID  CGSG     F       LV+ LD S   L Q  +  K  +N     
Sbjct: 9   YVKLINGDKIIDVGCGSGQNCDQFKGR----LVICLDLSLNQLNQARK--KGCQN----- 57

Query: 771 IILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV 941
             LV+AD+  LPF  SSVD++   A+LH    PS A+ E  RVL+  G  + T ++V
Sbjct: 58  --LVQADMEYLPFRDSSVDSLAYIASLHHLRDPSQALGEAQRVLKDKGEILVTVWLV 112



>pir|E72392|E72392 ubiquinone/menaquinone biosynthesis-related
           protein - Thermotoga maritima (strain
           MSB8)>gb:AE001713_38234 Thermotoga maritima MSB8 section
           25 of 136 of the complete genome.>gb:AE000512_1112707
           Thermotoga maritima MSB8, complete genome.
          Length = 207

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 39/119 (32%), Positives = 59/119 (49%), Gaps = 2/119 (1%)
 Frame = +3

Query: 564 EKEF--ELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEF 737
           EK+F     ++  K V G  I++   G+G     ++       VV +D SE ML+ C E 
Sbjct: 22  EKKFFSRFREELFKRVEGKKILEVGIGTGKNVPYYSDD---MDVVGVDISEGMLRVCQER 78

Query: 738 IKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
           +K+   FP + + L+RAD+  LPF+    D V +       P P   + E+ RVLRP G
Sbjct: 79  LKK---FPEKKVKLLRADVQNLPFSDGEYDCVVSTFVFCTVPDPVKGLKEVHRVLRPSG 134



>pir|G96969|G96969 probable methyltransferase [imported] - Clostridium
            acetobutylicum>gb:AE007572_227907 Clostridium
            acetobutylicum ATCC 824 section 60 of 356 of the complete
            genome.>gb:AE001437_1090862 Clostridium acetobutylicum
            ATCC 824, complete genome.
          Length = 209

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 46/169 (27%), Positives = 76/169 (44%), Gaps = 3/169 (1%)
 Frame = +3

Query: 564  EKEFELMQ---DYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYE 734
            E+ +EL     D +K      ++D  CG G      +K+     V  +D+S   ++   E
Sbjct: 28   ERHYELTGWGLDKIKIDKAYKMLDIGCGGGRTVNRLSKAAEEGEVYGIDYSSDCVRWASE 87

Query: 735  FIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
            + K  E      + +  A + +LPF  +  D V A   ++ WP+    + E++RVL+ GG
Sbjct: 88   YNK--ELIKEGRVHISEASVEKLPFEDNKFDVVTAVETIYFWPNVEENIKEVNRVLKKGG 145

Query: 915  VFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCG 1061
             F+    I++ IY    F R     FA+ S   I+  EK L+ L    G
Sbjct: 146  KFI----IINEIYDDDKF-RERNNEFAKNSNMKIYSPEK-LKSLLKNAG 188



>gb:AE016781_331416 Pseudomonas putida KT2440 section 8 of 21 of the
           complete genome.>gb:AE015451_946493 Pseudomonas putida
           KT2440 complete genome.
          Length = 254

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 41/116 (35%), Positives = 56/116 (48%)
 Frame = +3

Query: 570 EFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQE 749
           EF L+Q  L       ++D  CG+G  S  F  + L + VVA D S++ML        + 
Sbjct: 32  EFALLQAELAGQAHARVLDLGCGAGHVS--FHVAPLVAEVVAYDLSQSMLDVVASAAAER 89

Query: 750 ENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGV 917
                 NI   R    RLPFA +S D V +  + H W     A+ E+ RVL+PGGV
Sbjct: 90  GL---ANITTERGAAERLPFADASFDFVFSRYSAHHWSDLGLALREVRRVLKPGGV 142



>pir|JC6531|JC6531 avermectin B 5-O-methyltransferase (EC 2.1.1.-) -
           Streptomyces "avermitilis"
          Length = 283

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 43/130 (33%), Positives = 60/130 (46%), Gaps = 2/130 (1%)
 Frame = +3

Query: 546 GGFPGP--EKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETML 719
           G  PG   ++  +L+   L+ + G  ++D  CGSG  +   A S     VV +  SE  +
Sbjct: 45  GSSPGKAADRLTDLLIGKLRGITGRRVLDVGCGSGKPAVRLALSAPVD-VVGVTVSEVQV 103

Query: 720 QQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRV 899
                  KQ      + ++  RAD   LPF   S DA  A   L   PSP+  + EI+RV
Sbjct: 104 GLATALAKQSH--VADRVVFTRADAHELPFPDGSFDAAWALECLLHNPSPAQVIREIARV 161

Query: 900 LRPGGVFVAT 929
           LRPGG    T
Sbjct: 162 LRPGGRLAVT 171



>gb:CP000001_853228 Bacillus cereus ZK, complete genome.
          Length = 261

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 36/122 (29%), Positives = 63/122 (51%)
 Frame = +3

Query: 558 GPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEF 737
           GP+ ++ + Q  ++      ++D + G G  + + A   LF  VVALD +E ML+   +F
Sbjct: 27  GPDLQYVVQQ--VESRHNNRLLDIATGGGHVANVLAP--LFKEVVALDLTEKMLENAKKF 82

Query: 738 IKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGV 917
           I    +   EN+  V  +   LPF+ SS D +    A H + +P+  + E++R L   G+
Sbjct: 83  IISNGH---ENVSFVAGNAESLPFSDSSFDTITCRIAAHHFTNPAQFIYEVNRTLEDNGL 139

Query: 918 FV 923
           F+
Sbjct: 140 FI 141



>gb:AE017355_463944 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 261

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 36/122 (29%), Positives = 63/122 (51%)
 Frame = +3

Query: 558 GPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEF 737
           GP+ ++ + Q  ++      ++D + G G  + + A   LF  VVALD +E ML+   +F
Sbjct: 27  GPDLQYVVQQ--VESRHNNRLLDIATGGGHVANVLAP--LFKEVVALDLTEKMLENAKKF 82

Query: 738 IKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGV 917
           I    +   EN+  V  +   LPF+ SS D +    A H + +P+  + E++R L   G+
Sbjct: 83  IISNGH---ENVSFVAGNAESLPFSDSSFDTITCRIAAHHFTNPAQFIYEVNRTLEDNGL 139

Query: 918 FV 923
           F+
Sbjct: 140 FI 141



>gb:AE017033_382958 Bacillus anthracis str. Ames section 10 of 18 of
           the complete genome.>gb:AE017225_408080 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_452805 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE016879_1012663 Bacillus
           anthracis str. Ames complete genome.
          Length = 258

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 36/122 (29%), Positives = 63/122 (51%)
 Frame = +3

Query: 558 GPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEF 737
           GP+ ++ + Q  ++      ++D + G G  + + A   LF  VVALD +E ML+   +F
Sbjct: 27  GPDLQYVVQQ--VESRHNNRLLDIATGGGHVANVLAP--LFKEVVALDLTEKMLENAKKF 82

Query: 738 IKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGV 917
           I    +   EN+  V  +   LPF+ SS D +    A H + +P+  + E++R L   G+
Sbjct: 83  IISNGH---ENVSFVAGNAESLPFSDSSFDTITCRIAAHHFTNPAQFIYEVNRTLEDNGL 139

Query: 918 FV 923
           F+
Sbjct: 140 FI 141



>pir|B97320|B97320 S-adenosylmethionine-dependent methyltransferase
            [imported] - Clostridium
            acetobutylicum>gb:AE007839_230710 Clostridium
            acetobutylicum ATCC 824 section 327 of 356 of the
            complete genome.>gb:AE001437_1093665 Clostridium
            acetobutylicum ATCC 824, complete genome.
          Length = 207

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 43/173 (24%), Positives = 77/173 (44%), Gaps = 5/173 (2%)
 Frame = +3

Query: 579  LMQDYLKPVMGGN---IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQE 749
            +  + +K ++  N   ++D  CG+G   ++ AK    SL   LD SE M++   + +K  
Sbjct: 35   MYDEIIKRILRANPKTVLDVGCGTGNVLKILAKDENLSLY-GLDLSEKMIEIAKKNLKGR 93

Query: 750  ENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVAT 929
                     L   D   +P+ S+S D +   A+ H +P+P   + E+ R+L+  G  +  
Sbjct: 94   AE-------LKLGDSENMPWKSNSFDVIVCNASFHHYPNPKKVLIEMKRILKKDGTLIIG 146

Query: 930  TYIVDGIYSFTPFVRPLRENFAQIS--GSHIFLDEKELEDLCTTCGLVGFKCI 1082
                  IY      R +   + +IS  G +    +KE+E++   CG   F  I
Sbjct: 147  DPTAPVIY------RQILNLYCKISNKGDYKLYSKKEIENIMKECGFEPFNFI 193



>gb:AE017007_377796 Bacillus cereus ATCC 14579 section 10 of 18 of
           the complete genome.>gb:AE016877_1018046 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 261

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 33/102 (32%), Positives = 55/102 (53%)
 Frame = +3

Query: 618 IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
           ++D + G G  + + A   +F  VVALD +E ML++   FIKQ  +   EN+  V  +  
Sbjct: 45  LLDVATGGGHVANMLAP--MFEEVVALDLTEQMLEKAKVFIKQNGH---ENVSFVAGNAE 99

Query: 798 RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
            LPFA    D +    A H + +P+  + E++R L+  G+F+
Sbjct: 100 DLPFADHFFDTITCRIAAHHFTNPAQFIYEVNRTLKDNGLFI 141



>gb:AE016857_349953 Pseudomonas syringae pv. tomato str. DC3000
            section 2 of 21 of the complete
            genome.>gb:AE016853_1035128 Pseudomonas syringae pv.
            tomato str. DC3000 complete genome.
          Length = 269

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 43/151 (28%), Positives = 66/151 (43%), Gaps = 3/151 (1%)
 Frame = +3

Query: 621  IDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISR 800
            +D  CG+G FSR  A++   S  +ALD +E ML+        +          V  D  R
Sbjct: 58   LDLGCGTGYFSRALARTFSQSEGIALDIAEGMLRHAQPLGGAQH--------FVAGDAER 109

Query: 801  LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL 980
            LP      + + +  A+      +A ++E  RVL PGGVF   +  V  +Y        L
Sbjct: 110  LPLRDERCELIFSSLAVQWCADFAAVLSEAHRVLSPGGVFAFASLCVGTLYE-------L 162

Query: 981  RENFAQISGS-HI--FLDEKELEDLCTTCGL 1064
            R+++  + G  H+  F  E +   LC   GL
Sbjct: 163  RDSWRAVDGQVHVNRFRHEDDYRQLCAASGL 193



>pir|B48653|B48653 hypothetical protein 2 (pip 3' region) -
            Lactococcus lactis subsp. lactis (strain C2)
          Length = 252

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 53/170 (31%), Positives = 79/170 (46%), Gaps = 17/170 (10%)
 Frame = +3

Query: 609  GGNIIDASCGSGLFSRLFAKS-GLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVR 785
            G +I+D  CG+G ++   ++S G    V+ LDFSE ML+     +K+E     +NI  ++
Sbjct: 54   GLSILDLCCGTGDWTFDLSESVGPSGKVIGLDFSENMLEIAKAKLKEEAK---KNIEFLQ 110

Query: 786  ADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG--VFVATTYIVDGIY-- 953
             +   LPF   S D V  G  L   P     + EI RVL+PGG  V + T++    IY  
Sbjct: 111  GNAMALPFEKGSFDVVTIGYGLRNTPDYLTVLKEIFRVLKPGGRVVCIETSHPTLPIYKQ 170

Query: 954  -------SFTPFV-----RPLRENFAQISGSHIFLDEKELEDLCTTCGLV 1067
                   +  PF+     + L+E       +  F D K LE+L    G V
Sbjct: 171  AFELYFKNVMPFLGKVFAKSLKEYQWLQKSAEDFPDAKTLEELFRKAGFV 220



>sp|P49016|UBIE_LACLA Menaquinone biosynthesis methyltransferase ubiE
            (EC 2.1.1.-) (gerC2 protein homolog).>gb:LACPIP_139969
            Lactococcus lactis pip and gerC2 genes, complete cds's,
            and rrg gene, 5' end of cds.
          Length = 252

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 53/170 (31%), Positives = 79/170 (46%), Gaps = 17/170 (10%)
 Frame = +3

Query: 609  GGNIIDASCGSGLFSRLFAKS-GLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVR 785
            G +I+D  CG+G ++   ++S G    V+ LDFSE ML+     +K+E     +NI  ++
Sbjct: 54   GLSILDLCCGTGDWTFDLSESVGPSGKVIGLDFSENMLEIAKAKLKEEAK---KNIEFLQ 110

Query: 786  ADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG--VFVATTYIVDGIY-- 953
             +   LPF   S D V  G  L   P     + EI RVL+PGG  V + T++    IY  
Sbjct: 111  GNAMALPFEKGSFDVVTIGYGLRNTPDYLTVLKEIFRVLKPGGRVVCIETSHPTLPIYKQ 170

Query: 954  -------SFTPFV-----RPLRENFAQISGSHIFLDEKELEDLCTTCGLV 1067
                   +  PF+     + L+E       +  F D K LE+L    G V
Sbjct: 171  AFELYFKNVMPFLGKVFAKSLKEYQWLQKSAEDFPDAKTLEELFRKAGFV 220



>pir|E95996|E95996 probable methyltransferase,
           S-Adenosyl-L-methionine  (SAM)-MTase protein (EC
           2.1.1.-) [imported] - Sinorhizobium meliloti (strain
           1021) magaplasmid pSymB>gb:RME591985_165885
           Sinorhizobium meliloti 1021 complete pSymB.
          Length = 289

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 38/139 (27%), Positives = 57/139 (41%)
 Frame = +3

Query: 519 GWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVAL 698
           G+ Q    W     P+       D+     G  ++D  CG+G  +   A +     + A+
Sbjct: 35  GYEQLMGRWSRKLAPK-----FIDFAGVADGEKVLDVGCGTGSLTFALADAARLKEIAAI 89

Query: 699 DFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAA 878
           D+S   +++            N  I +  AD   LPF   + D   A   LH  P    A
Sbjct: 90  DYSPVFVEEA------TRRNTNPRIKIREADACALPFEDRTFDRAFALLVLHFVPEAGKA 143

Query: 879 VAEISRVLRPGGVFVATTY 935
           VAE+ RV+RPGGV  A  +
Sbjct: 144 VAEMRRVVRPGGVVAAAVW 162



>pir|B82239|B82239 biotin synthesis protein BioC VC1114 [imported] -
           Vibrio cholerae (strain N16961 serogroup
           O1)>gb:AE004192_51503 Vibrio cholerae O1 biovar eltor
           str. N16961 chromosome I, section 100 of 251 of the
           complete chromosome.>gb:AE003852_1052277 Vibrio cholerae
           O1 biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 312

 Score = 57.8 bits (138), Expect = 6e-07
 Identities = 42/124 (33%), Positives = 64/124 (51%), Gaps = 1/124 (0%)
 Frame = +3

Query: 579 LMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENF 758
           L+Q     + G  ++D  CG+G FS L  + G  + VV  D S  ML+Q       ++  
Sbjct: 88  LLQKMPSCLKGLRVLDLGCGTGYFSALLRERG--AQVVCADISHAMLEQA------KQRC 139

Query: 759 PNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP-GGVFVATTY 935
            +E +    AD  +LPFAS+  D V +  AL      S  ++EI RVL+P G  F++T  
Sbjct: 140 GDEGMSYQLADAEQLPFASACFDMVFSSLALQWCEDLSLPLSEIRRVLKPHGQAFLST-- 197

Query: 936 IVDG 947
           ++DG
Sbjct: 198 LLDG 201



>sp|Q8CSH9|UBIE_STAEP Menaquinone biosynthesis methyltransferase
           ubiE (EC 2.1.1.-).>gb:CP000029_81644 Staphylococcus
           epidermidis RP62A, complete genome.>gb:AE016747_322808
           Staphylococcus epidermidis ATCC 12228, section 4 of 9 of
           the complete genome.>gb:AE015929_1147477 Staphylococcus
           epidermidis ATCC 12228, complete genome.
          Length = 241

 Score = 57.8 bits (138), Expect = 6e-07
 Identities = 44/132 (33%), Positives = 65/132 (49%), Gaps = 8/132 (6%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKS-GLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVR 785
           G   +D  CG+  ++   +++ G    V  LDFSE ML+     + +++    ENI LV 
Sbjct: 50  GSKALDVCCGTADWTIALSEAVGSKGQVTGLDFSENMLE-----VGKQKTASLENIQLVH 104

Query: 786 ADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA------TTYIVDG 947
            D   LPF  +S D V  G  L   P   +A+ E+ RVL+PGG+ V       T  +   
Sbjct: 105 GDAMNLPFDDNSFDYVTIGFGLRNVPDYLSALKEMHRVLKPGGMVVCLETSQPTLPLFKQ 164

Query: 948 IYS-FTPFVRPL 980
           IYS +  FV P+
Sbjct: 165 IYSLYFKFVMPI 176



>gb:CR555306_108838 Azoarcus sp. EbN1 complete genome.
          Length = 288

 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 39/105 (37%), Positives = 57/105 (54%), Gaps = 1/105 (0%)
 Frame = +3

Query: 618 IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
           IIDA CG+G    L A+    + ++ALDF+  ML +            +   + + AD+ 
Sbjct: 53  IIDAGCGTGYGLDLLARLCPQARLIALDFAPAMLARL-----ATAGPGHAQPVPLCADLE 107

Query: 798 RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG-VFVAT 929
            LP A  S+DAV +  AL  W  P+ A+ E +RVLRPGG  ++AT
Sbjct: 108 ALPLAGGSIDAVWSSLALQ-WCEPALALGEFARVLRPGGEAWIAT 151



>sp|Q89AK7|BIOC_BUCBP Biotin synthesis protein
           bioC.>gb:AE014017_302679 Buchnera aphidicola str. Bp
           (Baizongia pistaciae), section 2 of 2 of the complete
           genome.>gb:AE016826_981280 Buchnera aphidicola str. Bp
           (Baizongia pistaciae), complete genome.
          Length = 247

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 36/128 (28%), Positives = 62/128 (48%)
 Frame = +3

Query: 615 NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADI 794
           +I+DA CG+G FS+ + + G  + V ALDFS+ ML              N     + AD+
Sbjct: 43  SILDAGCGTGWFSKKWRQLG--NTVTALDFSKNMLLTAKN--------TNSADYYLHADM 92

Query: 795 SRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVR 974
            +LP   +  D   +  +L      + A++E+ RV +PGG+ V +T     +Y F    R
Sbjct: 93  EQLPICDNIFDLSWSNLSLQWCNKFNKAISELCRVTKPGGMVVFSTIAHGSLYEFNKAYR 152

Query: 975 PLRENFAQ 998
            +  ++ +
Sbjct: 153 TINSSYQE 160



>gb:OSJN00169_1696105 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0043L24, complete sequence.
          Length = 267

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 51/172 (29%), Positives = 73/172 (42%), Gaps = 16/172 (9%)
 Frame = +3

Query: 609  GGNIIDASCGSGLFSRLFA-KSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVR 785
            G  ++D  CGSG  + L + K GL   V+A+DFS   LQ       Q      +NI  + 
Sbjct: 80   GDRVLDLCCGSGDLAFLLSQKVGLDGQVMAVDFSSQQLQTAASRQDQRWKPCYKNIKWIE 139

Query: 786  ADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPG------------GVFVAT 929
             D   LPF     DAV  G  L        A+ EI RVL+PG             +F  +
Sbjct: 140  GDALDLPFTDCYFDAVTVGYGLRNVVDKPKAMREIFRVLKPGSRASILDFNKSSSLFTTS 199

Query: 930  --TYIVDGIYSFTPFVRPLRENFAQISGSHI-FLDEKELEDLCTTCGLVGFK 1076
              ++++D +         L E +  +  S + +L EKELE+L    G    K
Sbjct: 200  LQSWMIDNVVVPLASGYGLTEEYKYLKSSILHYLTEKELEELAKEAGFSAAK 251



>gb:BX950851_841560 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 253

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 40/116 (34%), Positives = 56/116 (48%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
           G  ++DA CG+G FSR + ++G    V ALD S  ML    E    +          +  
Sbjct: 45  GLQVLDAGCGTGHFSRYWRQAG--RNVTALDLSAEMLAYAREQHAADR--------YLEG 94

Query: 789 DISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYS 956
           DI  LP A S VD  ++  A+    S   A+ E+ R+ RPGGV +A   + DG  S
Sbjct: 95  DIENLPLADSCVDICYSNLAVQWCDSLPRALGELYRITRPGGV-IAFATLADGSLS 149



>gb:AY426747_617092 Geobacillus stearothermophilus uroporphyrin-III
           C-methyltransferase (cobA), ATP:corrinoid
           adenosyltransferase (btuR), and UbiE/COQ5
           methyltransferase (ubiE) genes, complete cds.
          Length = 199

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 37/106 (34%), Positives = 53/106 (50%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
           G NI+D  CG G  +   AK+G    V  +D S  M++      K +E   +E I  V+ 
Sbjct: 21  GSNILDLGCGDGYGAWKLAKAGY--EVTGVDLSAEMIE------KAKERGESERIRFVQG 72

Query: 789 DISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA 926
           D++RLPFA  +  A  A  +L     P  A+ E  RV++ GG F A
Sbjct: 73  DLTRLPFADETFAAAMAVNSLEWTERPLVALQEAKRVVKRGGYFCA 118



>gb:CR628336_112396 Legionella pneumophila str. Paris complete
           genome.
          Length = 284

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 39/120 (32%), Positives = 59/120 (49%)
 Frame = +3

Query: 573 FELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEE 752
           FE +Q YLK +    I+D  CG G FS+  A     + +V +D S  ML+Q  +      
Sbjct: 33  FERLQ-YLK-IAPRRILDLGCGPGFFSKELALLYPKAQIVGMDLSFAMLEQARKKQGWRR 90

Query: 753 NFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATT 932
            +P     LV AD+ ++PFA+ + D V A   +H   S      E++RV+   G  + TT
Sbjct: 91  KWP-----LVSADMQKMPFATGAFDLVFANQVIHWSSSLGTVFRELNRVMNVNGCLMFTT 145



>gb:AP006878_577393 Thermococcus kodakaraensis strain KOD1 DNA,
           complete genome.
          Length = 228

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 39/106 (36%), Positives = 55/106 (51%), Gaps = 2/106 (1%)
 Frame = +3

Query: 612 GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRAD 791
           G ++D +CG G FS L    G    VV LD S  ML++  EF K++E+     +  +  D
Sbjct: 40  GRVLDLACGVGGFSFLLEDLGFE--VVGLDNSRFMLEKAREFAKEKES----RVEFIEGD 93

Query: 792 ISRLPFASSSVDAV-HAGAALHCWPSPSAAV-AEISRVLRPGGVFV 923
              LPF + S D V    + +H  P   A V  E +RVL+PGG F+
Sbjct: 94  ARELPFENDSFDYVLFIDSLVHFEPQDLAKVFKETARVLKPGGKFI 139



>gb:AF487998_515319 Saccharopolyspora erythraea NRRL 2338 eryCI
            flanking region.
          Length = 271

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 41/143 (28%), Positives = 64/143 (44%)
 Frame = +3

Query: 621  IDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISR 800
            +D  CG+G+ S   A      L V +D SE  +      +      P     +V AD   
Sbjct: 43   VDVGCGTGVLSAAVAARCRPRLTVGIDRSEGFV------VSARTTAPVSTYFIV-ADAMS 95

Query: 801  LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL 980
            LP    + D   +G AL+  P+P+AAVAE++R +RPGG+  A  +   G      F+R  
Sbjct: 96   LPVRDDACDVAVSGLALNFLPAPTAAVAEMARAVRPGGLIAAYVWDYAG---GMEFIRRF 152

Query: 981  RENFAQISGSHIFLDEKELEDLC 1049
             +   ++  S   +DE     +C
Sbjct: 153  WDAAIEVDPSAAAMDEGRRFPVC 175



>gb:AE017354_460679 Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1, complete genome.
          Length = 334

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 39/120 (32%), Positives = 59/120 (49%)
 Frame = +3

Query: 573 FELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEE 752
           FE +Q YLK +    I+D  CG G FS+  A     + +V +D S  ML+Q  +      
Sbjct: 83  FERLQ-YLK-IAPRRILDLGCGPGFFSKELALLYPKAQIVGMDLSFAMLEQARKKQGWRR 140

Query: 753 NFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATT 932
            +P     LV AD+ ++PFA+ + D V A   +H   S      E++RV+   G  + TT
Sbjct: 141 KWP-----LVSADMQKMPFATGAFDLVFANQVIHWSSSLGMVFRELNRVMNVNGCLMFTT 195



>gb:TACID2_196399 Thermoplasma acidophilum complete genome; segment
            2/5.
          Length = 172

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 48/152 (31%), Positives = 69/152 (45%), Gaps = 1/152 (0%)
 Frame = +3

Query: 588  DYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNE 767
            D L    G +I+D  CG G F+   A S     V A+D S+ M++     I +E    + 
Sbjct: 14   DQLPISPGFDIVDLGCGPGFFTLPLA-SRTDGKVYAVDASDEMIE-----ILKERIDGHS 67

Query: 768  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG 947
            NII V+A    +P    +VD V    A H +    A + EI R+LR GG  V   +  D 
Sbjct: 68   NIIPVKARAENIPIPDGTVDLVFIANAFHDFDDRDAVLGEIYRILRDGGYLVDIDWKKDE 127

Query: 948  IYSFTPF-VRPLRENFAQISGSHIFLDEKELE 1040
                 P  +R  R++   +  SH F   KE+E
Sbjct: 128  TTHGPPVDIRIDRKDALLLISSHNFDIVKEIE 159



>sp|Q92A77|UBIE_LISMO Menaquinone biosynthesis methyltransferase
           ubiE (EC 2.1.1.-).>pir|AC1316|AC1316
           2-heptaprenyl-1,4-naphthoquinone methyltransferase
           homolog menH [imported] - Listeria monocytogenes (strain
           EGD-e)>pir|AC1688|AC1688
           2-heptaprenyl-1,4-naphthoquinone methyltransferase
           homolog menH [imported] - Listeria innocua (strain
           Clip11262)>gb:AE017328_444381 Listeria monocytogenes
           str. 4b F2365, section 7 of 10 of the complete
           genome.>gb:AL591981_536422 Listeria monocytogenes strain
           EGD, complete genome, segment 9/12.>gb:AL596170_539389
           Listeria innocua Clip11262 complete genome, segment
           8/12.>gb:AE017262_1076737 Listeria monocytogenes str. 4b
           F2365, complete genome.
          Length = 237

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 36/103 (34%), Positives = 53/103 (51%), Gaps = 1/103 (0%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKS-GLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVR 785
           G N++D  CG+  +S + A+  G    V  LDFSE ML+   E +K+ +     N+ L+ 
Sbjct: 48  GTNVLDVCCGTADWSIMMAEEIGPEGHVTGLDFSENMLKVGREKVKEADL---HNVELIH 104

Query: 786 ADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
            +   LPF  +S D V  G  L   P     + E+ RVL+PGG
Sbjct: 105 GNAMELPFPDNSFDYVTIGFGLRNVPDYMQVLREMYRVLKPGG 147



>gb:D89131_1675249 Schizosaccharomyces pombe mRNA, partial cds,
           clone: SY 0514.
          Length = 315

 Score = 55.1 bits (131), Expect = 4e-06
 Identities = 44/159 (27%), Positives = 72/159 (45%), Gaps = 6/159 (3%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSLWGGFPGPE--KEFELMQDYLKPVMG----GNIIDASCGSGLFSR 656
           L + LYE GW QSF     + G    +     + YL   MG      ++D  CG G  +R
Sbjct: 18  LATDLYEYGWSQSFHFSRFYKGEAFAQSIARHEHYLAYRMGIKPGSRVLDVGCGVGGPAR 77

Query: 657 LFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVH 836
              +    +LV  L+ ++  + +C  +  +     ++  + V+ D   +PF  ++ D V+
Sbjct: 78  EITEFTGCNLV-GLNNNDYQISRCNNYAVKRNL--DKKQVFVKGDFMHMPFEDNTFDYVY 134

Query: 837 AGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY 953
           A  A    PS      EI RVL+PGGVF    +++   Y
Sbjct: 135 AIEATVHAPSLEGVYGEIFRVLKPGGVFGVYEWVMSDDY 173



>gb:CR628337_115455 Legionella pneumophila str. Lens complete
           genome.
          Length = 284

 Score = 55.1 bits (131), Expect = 4e-06
 Identities = 39/120 (32%), Positives = 58/120 (48%)
 Frame = +3

Query: 573 FELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEE 752
           FE +Q YLK +    I+D  CG G FS+  A     + +V +D S  ML+Q  +      
Sbjct: 33  FERLQ-YLK-IAPRRILDLGCGPGFFSKELALLYPKAQIVGMDLSFAMLEQARKKQGWRR 90

Query: 753 NFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATT 932
            +P     LV AD+ ++PFA+   D V A   +H   S      E++RV+   G  + TT
Sbjct: 91  KWP-----LVSADMQKMPFATGVFDLVFANQVIHWSSSLGTVFRELNRVMNVNGCLMFTT 145



>pir|T42375|T42375 probable sterol 24-C-methyltransferase (EC
           2.1.1.41) - fission yeast (Schizosaccharomyces pombe)
           (fragment)
          Length = 324

 Score = 55.1 bits (131), Expect = 4e-06
 Identities = 44/159 (27%), Positives = 72/159 (45%), Gaps = 6/159 (3%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSLWGGFPGPE--KEFELMQDYLKPVMG----GNIIDASCGSGLFSR 656
           L + LYE GW QSF     + G    +     + YL   MG      ++D  CG G  +R
Sbjct: 27  LATDLYEYGWSQSFHFSRFYKGEAFAQSIARHEHYLAYRMGIKPGSRVLDVGCGVGGPAR 86

Query: 657 LFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVH 836
              +    +LV  L+ ++  + +C  +  +     ++  + V+ D   +PF  ++ D V+
Sbjct: 87  EITEFTGCNLV-GLNNNDYQISRCNNYAVKRNL--DKKQVFVKGDFMHMPFEDNTFDYVY 143

Query: 837 AGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY 953
           A  A    PS      EI RVL+PGGVF    +++   Y
Sbjct: 144 AIEATVHAPSLEGVYGEIFRVLKPGGVFGVYEWVMSDDY 182



>sp|O14321|ERG6_SCHPO Probable sterol 24-C-methyltransferase (EC
           2.1.1.41) (Delta(24)-sterol
           C-methyltransferase).>pir|T39579|T39579 sterol
           methyltransferase - fission yeast  (Schizosaccharomyces
           pombe)>gb:SPBC16E9_1719144 S.pombe chromosome II cosmid
           c16E9.
          Length = 378

 Score = 55.1 bits (131), Expect = 4e-06
 Identities = 44/159 (27%), Positives = 72/159 (45%), Gaps = 6/159 (3%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSLWGGFPGPE--KEFELMQDYLKPVMG----GNIIDASCGSGLFSR 656
           L + LYE GW QSF     + G    +     + YL   MG      ++D  CG G  +R
Sbjct: 81  LATDLYEYGWSQSFHFSRFYKGEAFAQSIARHEHYLAYRMGIKPGSRVLDVGCGVGGPAR 140

Query: 657 LFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVH 836
              +    +LV  L+ ++  + +C  +  +     ++  + V+ D   +PF  ++ D V+
Sbjct: 141 EITEFTGCNLV-GLNNNDYQISRCNNYAVKRNL--DKKQVFVKGDFMHMPFEDNTFDYVY 197

Query: 837 AGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY 953
           A  A    PS      EI RVL+PGGVF    +++   Y
Sbjct: 198 AIEATVHAPSLEGVYGEIFRVLKPGGVFGVYEWVMSDDY 236



>gb:AP003943_1835567 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1119_B04.
          Length = 344

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 49/161 (30%), Positives = 72/161 (44%), Gaps = 8/161 (4%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSL---WGGFPGPE-----KEFELMQDYLKPVMGGNIIDASCGSGLF 650
           L +  YE GW +SF     W G    E     + F  +Q  +KP  G  ++D  CG G  
Sbjct: 57  LATSFYEYGWGESFHFAHRWNGESLRESIKRHEHFLALQLGVKP--GMKVLDVGCGIGGP 114

Query: 651 SRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDA 830
            R  AK  L S V  L+ +E  + +  E  +      +     V+AD  ++PF+ ++ DA
Sbjct: 115 LREIAKFSLAS-VTGLNNNEYQITRGKELNRVAG--VSGTCDFVKADFMKMPFSDNTFDA 171

Query: 831 VHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY 953
           V+A  A    P P     EI RVL+PG  F    + +   Y
Sbjct: 172 VYAIEATCHAPDPVGCYKEIYRVLKPGQCFAVYEWCITDHY 212



>gb:AF042332_1763634 Oryza sativa subsp. japonica
           cycloartenol-C24-methyltransferase mRNA, complete cds.
          Length = 349

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 49/161 (30%), Positives = 72/161 (44%), Gaps = 8/161 (4%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSL---WGGFPGPE-----KEFELMQDYLKPVMGGNIIDASCGSGLF 650
           L +  YE GW +SF     W G    E     + F  +Q  +KP  G  ++D  CG G  
Sbjct: 57  LATSFYEYGWGESFHFAHRWNGESLRESIKRHEHFLALQLGVKP--GMKVLDVGCGIGGP 114

Query: 651 SRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDA 830
            R  AK  L S V  L+ +E  + +  E  +      +     V+AD  ++PF+ ++ DA
Sbjct: 115 LREIAKFSLAS-VTGLNNNEYQITRGKELNRVAG--VSGTCDFVKADFMKMPFSDNTFDA 171

Query: 831 VHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY 953
           V+A  A    P P     EI RVL+PG  F    + +   Y
Sbjct: 172 VYAIEATCHAPDPVGCYKEIYRVLKPGQCFAVYEWCITDHY 212



>gb:AE017246_415311 Treponema denticola ATCC 35405, section 1 of 10
           of the complete genome.>gb:AE017226_1068907 Treponema
           denticola ATCC 35405, complete genome.
          Length = 250

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 36/116 (31%), Positives = 58/116 (50%)
 Frame = +3

Query: 576 ELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEEN 755
           +L+Q+ LK   G  ++DA CG+G  + L A+ G    V A+D SE ML++  +    EE 
Sbjct: 34  KLLQENLKDCKGKKVLDAGCGTGFLAILLAQDGW--EVTAIDSSEAMLEEGKK--TAEEL 89

Query: 756 FPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
             ++ I  +  D     F     DAV +  A   + +P     E  R+L+PGG+ +
Sbjct: 90  GLSDKITFLLKDAHSTDFPEHLFDAVVSRHASWLFTAPETVYKEWKRILKPGGIML 145



>gb:BX571864_786344 Photorhabdus luminescens subsp. laumondii TTO1
            complete genome; segment 6/17.
          Length = 255

 Score = 54.3 bits (129), Expect = 6e-06
 Identities = 39/147 (26%), Positives = 69/147 (46%)
 Frame = +3

Query: 609  GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
            G  ++DA CG+G FS  + + G    V+ LD +  ML    + +  +          ++A
Sbjct: 47   GKLVLDAGCGTGFFSHRWRQQG--KQVIGLDLASGMLAHARKQLAAD--------YYLQA 96

Query: 789  DISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF 968
            DI  L  A +SVD   +   +      S+A+ E+ RV RPGG+ + +T     +Y     
Sbjct: 97   DIEHLGLADNSVDICFSNLVVQWCDDLSSALRELYRVTRPGGLILFSTLAKGSLYELKQ- 155

Query: 969  VRPLRENFAQISGSHIFLDEKELEDLC 1049
               + +N+  I+    FL ++ ++D C
Sbjct: 156  AWSVVDNYQHINQ---FLPQQTIKDAC 179



>gb:AY596297_633713 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 259

 Score = 54.3 bits (129), Expect = 6e-06
 Identities = 36/117 (30%), Positives = 54/117 (46%), Gaps = 1/117 (0%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
           G  ++D   GSG   R    +        LD S  ML+   E+        ++ I  +R 
Sbjct: 71  GDTVLDLGTGSGYALRALRDTNDAGPCYGLDGSPEMLRNAREYTD------DDGIGFLRG 124

Query: 789 DISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVF-VATTYIVDGIYS 956
           D   LPFA+ S+D V +  A +    P   + EI+RVLRPGG   +A  Y  + ++S
Sbjct: 125 DFDALPFATDSIDHVFSMEAFYYASDPPHTLEEIARVLRPGGTANIAVNYYEENVHS 181



>gb:AE010689_265692 Methanosarcina acetivorans str. C2A, section 34
           of 534 of the complete genome.>gb:AE010299_906251
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 256

 Score = 54.3 bits (129), Expect = 6e-06
 Identities = 41/118 (34%), Positives = 52/118 (44%)
 Frame = +3

Query: 600 PVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIIL 779
           P  G  I+D  CG+G  S LFA+ G    V  +D S  ML+      K +      N+  
Sbjct: 50  PGKGLRILDVGCGTGELSLLFAEMG--HRVTGIDISRKMLKTA----KTKAEACRANVTF 103

Query: 780 VRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY 953
              D    PF  SS D V +   L   P+P  AV    RVLR  G  V    IVDG++
Sbjct: 104 GEGDAENPPFEPSSFDIVFSRHLLWTLPNPKKAVENWGRVLRKNGKVV----IVDGVW 157



>gb:SCO939108_174837 Streptomyces coelicolor A3(2) complete genome;
           segment 5/29.
          Length = 199

 Score = 54.3 bits (129), Expect = 6e-06
 Identities = 34/104 (32%), Positives = 52/104 (50%), Gaps = 1/104 (0%)
 Frame = +3

Query: 609 GGNIIDASCGSG-LFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVR 785
           G  ++DA CG+G     L A  G   LVV  D +  ML+      +  +        L+ 
Sbjct: 42  GDRVLDAGCGTGRALPPLRAAVGPSGLVVGADLTPAMLEAAVRAGRDRDGR------LLL 95

Query: 786 ADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGV 917
            D++ LP  S ++DAV A   +   P P+  + E++RV+RPGGV
Sbjct: 96  TDVAALPLRSRTLDAVFAAGLVAHLPDPAGNLRELARVVRPGGV 139



>pir|AG2274|AG2274 methyltransferase [imported] - Nostoc sp. (strain
           PCC 7120)>gb:BA000019_684739 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 207

 Score = 54.3 bits (129), Expect = 6e-06
 Identities = 37/109 (33%), Positives = 51/109 (46%), Gaps = 2/109 (1%)
 Frame = +3

Query: 615 NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADI 794
           +++D  CGSG  ++L  KS     V  LD S   LQ+        +N P  N   V A  
Sbjct: 48  SVLDVCCGSGQATQLLVKSS--QNVTGLDASPLSLQRA------RQNVPEANY--VEAFA 97

Query: 795 SRLPFASSSVDAVHAGAALHCWPSPS--AAVAEISRVLRPGGVFVATTY 935
            ++PF  +  D VH  AALH          + E+ RVL+PGGVF    +
Sbjct: 98  EKMPFPDNQFDIVHTSAALHEMEPQQLREIIQEVYRVLKPGGVFTLVDF 146



>pir|E70669|E70669 probable glycosyltransferase - Mycobacterium
           tuberculosis  (strain H37RV)>gb:AE000516_23121
           Mycobacterium tuberculosis CDC1551, complete
           genome.>gb:MTU00024_151352 Mycobacterium tuberculosis
           cosmid tbc2.>gb:BX248344_760333 Mycobacterium bovis
           subsp. bovis AF2122/97 complete genome; segment
           11/14.>gb:BX842581_821045 Mycobacterium tuberculosis
           H37Rv complete genome; segment 10/13.
          Length = 270

 Score = 53.1 bits (126), Expect(2) = 6e-06
 Identities = 33/104 (31%), Positives = 49/104 (47%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
           G  +++ SCG G  +    ++   +    LD ++  ++ C    K+    P   +  VR 
Sbjct: 81  GKQVLEVSCGHGGGASYLTRTLHPASYTGLDLNQAGIKLC----KKRHRLPG--LDFVRG 134

Query: 789 DISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVF 920
           D   LPF   S D V    A HC+P     +AE+ RVLRPGG F
Sbjct: 135 DAENLPFDDESFDVVLNVEASHCYPHFRRFLAEVVRVLRPGGYF 178



 Score = 20.8 bits (42), Expect(2) = 6e-06
 Identities = 6/16 (37%), Positives = 10/16 (62%)
 Frame = +1

Query: 496 WCPFFTRGVGDKAFLY 543
           W P  TRG+G+   ++
Sbjct: 26  WYPLMTRGLGNDEIVF 41



>gb:AY596297_632024 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 229

 Score = 53.9 bits (128), Expect = 8e-06
 Identities = 35/103 (33%), Positives = 56/103 (54%), Gaps = 3/103 (2%)
 Frame = +3

Query: 612 GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRAD 791
           G  +DA CG+G  + L A  G+   VV LD S  +L+   + +        +++ L++ D
Sbjct: 53  GTALDAGCGNGRHAELLA--GVADRVVGLDASRALLRAATDRV-------GDSVALLQGD 103

Query: 792 ISRLPFASSSVDAVHAGAALHCWPSPS---AAVAEISRVLRPG 911
            +RLP A+ +VD     A LH  PS +   A++ E++RVL PG
Sbjct: 104 ATRLPLAAGAVDLAVYVATLHHLPSQTARRASLDELARVLAPG 146



>gb:RLE571701_164330 Rhizobium leguminosarum bv. viciae 3841
           lipopolysaccharide O-chain biosynthesis gene region.
          Length = 280

 Score = 53.9 bits (128), Expect = 8e-06
 Identities = 38/119 (31%), Positives = 56/119 (47%)
 Frame = +3

Query: 570 EFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQE 749
           E+  ++++L P   G  +D   G G+ S   AK G     +  D S+ +       +  E
Sbjct: 47  EWGAIREFL-PQAPGTAVDIGAGRGIASYALAKEGFEVTALEPDASDLVGAGAIRALFNE 105

Query: 750 ENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA 926
            + P   I +      RLPF+ ++ D V A A LH     SAA  E  RVL+PGG F+A
Sbjct: 106 VHLP---ISIAEEFSERLPFSDNAFDVVFARAVLHHTSDLSAACREFFRVLKPGGRFIA 161



>gb:BX572597_800922 Rhodopseudomonas palustris CGA009 complete
           genome; segment 5/16.
          Length = 212

 Score = 53.5 bits (127), Expect = 1e-05
 Identities = 33/111 (29%), Positives = 59/111 (53%)
 Frame = +3

Query: 606 MGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVR 785
           +GG ++D   G+GL    ++K+   + +  +D SE ML++ +E ++   N  N +++ V 
Sbjct: 43  IGGRVLDVGVGTGLSLSDYSKT---TRLCGVDISEPMLRKAHERVRTL-NLSNVDVLAVM 98

Query: 786 ADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI 938
            D   L F ++  DAV A   +   P P A + +  RVL+PGG  +   +I
Sbjct: 99  -DAKNLAFPANYFDAVVAQYVITAVPDPEATLDDFIRVLKPGGELILVNHI 148



>gb:CR522870_100177 Desulfotalea psychrophila LSv54 chromosome.
          Length = 246

 Score = 53.5 bits (127), Expect = 1e-05
 Identities = 52/182 (28%), Positives = 78/182 (42%), Gaps = 26/182 (14%)
 Frame = +3

Query: 501 SFLYERGWRQSFSLWGGFPGPEKEFELMQ---DYLKPVM--------------------G 611
           S   E   R+ F L  G PG EK F+ +    D +  VM                     
Sbjct: 7   SLFLEMKCREEFVLSKG-PGVEKMFDAIAGRYDLMNKVMTMGQDQRWRRFVVAKAGDPGA 65

Query: 612 GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRAD 791
           G ++D + G+G  + L  +S   + V   DFS  ML++       ++ F  + I     D
Sbjct: 66  GQVLDLATGTGDIAALMHRSYPRAQVTGGDFSRNMLEEA------KKRFAGQGIDWQVCD 119

Query: 792 ISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV---ATTYIVDGIYSFT 962
            ++LPFA ++ +AV  G  L      S+ +AE+ RVL+PGG  V    T    + IY F 
Sbjct: 120 ANKLPFADNTFEAVTFGYLLRNVDDASSVLAEVYRVLKPGGRCVCLDTTPPAKNIIYPFV 179

Query: 963 PF 968
            F
Sbjct: 180 QF 181



>gb:AF042333_1763635 Oryza sativa 24-methylene lophenol
           C24(1)methyltransferase mRNA, complete cds.
          Length = 363

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 46/177 (25%), Positives = 78/177 (44%), Gaps = 7/177 (3%)
 Frame = +3

Query: 444 KAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEF------ELMQDYLKPV 605
           +A  E + A  + F   LV+ +YE GW QSF      PG           E + D L+  
Sbjct: 69  EASAEKVPAFVDTF-YNLVTDIYEWGWGQSFHFSPSLPGRSHREATRVHEERVADLLQAK 127

Query: 606 MGGNIIDASCG-SGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILV 782
            G  ++D  CG  G    + A SG  S VV +  +E  + +     ++     +    +V
Sbjct: 128 PGHRLLDVGCGVGGPMRAIAAHSG--SNVVGITINEYQVNRARAHNRKAGL--DSRCEVV 183

Query: 783 RADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY 953
             +   +PF+ +S D  ++  A    P       E+ RVL+PGG++V+  ++   +Y
Sbjct: 184 CGNFLSMPFSDASFDGAYSIEATCHAPRLQEVYGEVFRVLKPGGLYVSYEWVTTSLY 240



>gb:BA000030_699471 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 202

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 33/103 (32%), Positives = 52/103 (50%), Gaps = 1/103 (0%)
 Frame = +3

Query: 609 GGNIIDASCGSG-LFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVR 785
           G  ++DA CG+G     L A  G   +VV +D +  ML       +  +        L+ 
Sbjct: 45  GDRVLDAGCGTGRALPSLRAAVGSSGVVVGVDLTPAMLAAAARAGRGRDGH------LLL 98

Query: 786 ADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
           AD++RLP  + S+DAV A   +   P P+  + E++RV+R GG
Sbjct: 99  ADVTRLPLGTESLDAVFAAGLIAHLPEPAENLRELARVVRAGG 141



>gb:BA000012_668806 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 264

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 40/138 (28%), Positives = 66/138 (47%), Gaps = 3/138 (2%)
 Frame = +3

Query: 537 SLWG-GF--PGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFS 707
           +LWG G+  PG  +E + + + L  + G  ++D  CGSG  +    +    +     D  
Sbjct: 19  ALWGDGYLSPGGPEEVDRVVEGLS-LEGKTVLDIGCGSGGITLHLVERHGAARATGFDVE 77

Query: 708 ETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAE 887
           + +++      +      ++    V+A    LPFA  S DAV +  AL   P      AE
Sbjct: 78  QPVIEAARR--RAAGRGLSDRASFVQAPPGALPFADRSFDAVFSKDALLHVPDKDGVFAE 135

Query: 888 ISRVLRPGGVFVATTYIV 941
           I RVL+PGGVF A+ +++
Sbjct: 136 IFRVLKPGGVFAASNWMI 153



>gb:AE017273_424139 Bacillus cereus ATCC 10987, section 10 of 18 of
           the complete genome.>gb:AE017194_1062558 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 261

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 35/122 (28%), Positives = 59/122 (48%)
 Frame = +3

Query: 558 GPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEF 737
           GP+ ++ + Q  ++      ++D + G G  + + A   LF  VVALD +E ML+    F
Sbjct: 27  GPDLQYVVQQ--VESRHNNRLLDIATGGGHVANVLAP--LFQEVVALDLTEKMLENAKNF 82

Query: 738 IKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGV 917
           I    +   EN+  V  +   LPF+  S D +    A H + +    V E++R L   G+
Sbjct: 83  IISNGH---ENVSFVAGNAESLPFSDRSFDVITCRIAAHHFTNXDQFVYEVNRTLEDNGL 139

Query: 918 FV 923
           F+
Sbjct: 140 FI 141



>gb:AE017178_397997 Porphyromonas gingivalis W83 section 7 of 8 of the
            complete genome.>gb:AE015924_1033608 Porphyromonas
            gingivalis W83 complete genome.
          Length = 219

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 46/170 (27%), Positives = 72/170 (42%), Gaps = 10/170 (5%)
 Frame = +3

Query: 612  GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRAD 791
            G I+D   G+ +F+    +    + +V LD+S+ ML         E+     N+ L + D
Sbjct: 54   GRILDVPVGTAIFTYDKYRRMPQAEIVGLDYSQEMLDIAAMRFSAEQI---TNVSLRQGD 110

Query: 792  ISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV 971
            +  LPF  ++ D V +    H +P    A AE  RVLR GG+F    Y+         FV
Sbjct: 111  VGSLPFPDAAFDLVLSMNGFHVFPDKDRAFAETFRVLRGGGLFCGCFYVKGERKPADWFV 170

Query: 972  RPLRENFAQISGSHIFLDEKELEDLCTTCG----------LVGFKCIRNR 1091
            R   +        H +  E+ +E L +  G          L+ FKC + R
Sbjct: 171  RKFLDKKGLFRPPH-YTREEAIEKLRSLYGDNVEIQDARSLLVFKCTKPR 219



>gb:AE016822_339474 Leifsonia xyli subsp. xyli str. CTCB07, complete
           genome.
          Length = 365

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 35/105 (33%), Positives = 52/105 (49%)
 Frame = +3

Query: 600 PVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIIL 779
           P+ G  I+D + G+G  S   A++G  + VVA DFS  M++     + +     N  +  
Sbjct: 50  PLAGETILDIAAGTGTSSASLARNG--ARVVAADFSPGMIE-----VGRRRQSGNPFVTF 102

Query: 780 VRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
            +AD + LPF   + DAV     L     P  A+AE  RV +PGG
Sbjct: 103 QQADATDLPFPDDTFDAVTIAFGLRNIVEPRRALAEFYRVTKPGG 147



>gb:AE010739_266145 Methanosarcina acetivorans str. C2A, section 84
           of 534 of the complete genome.>gb:AE010299_906704
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 254

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 38/123 (30%), Positives = 56/123 (45%)
 Frame = +3

Query: 618 IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
           ++DA CG+G    LF + G    V  LD SE ML +  E   +++     +I     D  
Sbjct: 55  VLDAGCGTGEIGLLFTEMGHH--VTGLDLSEQMLAKAREKTSRKKY----DINFRAGDAE 108

Query: 798 RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRP 977
             PF + + D V     L   P P  AV    +VLR GGV +    ++DG+Y+     R 
Sbjct: 109 NPPFEAETFDVVVTRHLLWTLPHPDTAVRNWEKVLRKGGVLI----VIDGLYNGGSIERK 164

Query: 978 LRE 986
            R+
Sbjct: 165 TRQ 167



>gb:BA000030_698550 Streptomyces avermitilis MA-4680 genomic DNA,
            complete genome.
          Length = 258

 Score = 52.8 bits (125), Expect = 2e-05
 Identities = 45/135 (33%), Positives = 61/135 (45%), Gaps = 1/135 (0%)
 Frame = +3

Query: 603  VMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILV 782
            V G  I+DA CGSG  S      G  ++V  +D S  ML      +        +++ L 
Sbjct: 55   VAGRRILDAGCGSGPLSAALRDRG--AVVTGIDASAGMLALARRRL-------GDDVALH 105

Query: 783  RADIS-RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSF 959
              D+S RLPF   + D V A   LH        +AE+ RVLRPGG  +A+   VD  +  
Sbjct: 106  VVDLSDRLPFDDGAFDDVVASLVLHYLEDWGPTLAELRRVLRPGGRLIAS---VDHPFVA 162

Query: 960  TPFVRPLRENFAQIS 1004
              F  P  + FA  S
Sbjct: 163  YTFQDPRPDYFATTS 177



>pir|AI2182|AI2182 hypothetical protein all3016 [imported] - Nostoc
            sp. (strain PCC 7120)>gb:BA000019_684005 Nostoc sp. PCC
            7120 DNA, complete genome.
          Length = 220

 Score = 52.8 bits (125), Expect = 2e-05
 Identities = 43/160 (26%), Positives = 66/160 (41%), Gaps = 7/160 (4%)
 Frame = +3

Query: 612  GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRAD 791
            G ++DA  G+     L  +      +VA+D +E MLQ   + ++Q      E+I L   D
Sbjct: 44   GLVLDAGTGTARIPVLICQKRPQWQLVAIDMAENMLQIATQHVQQSGL--QEHIRLELVD 101

Query: 792  ISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP-GGVFVATTYIVDGIYSFTPF 968
              RLP+     D V + + +H  P P    AEI RV +P GG+F+      +   +    
Sbjct: 102  AKRLPYEDGIFDLVVSNSLVHHLPDPLPFFAEIKRVCKPQGGIFIRDLLRPEDEATMNAL 161

Query: 969  VRPLRENFAQI------SGSHIFLDEKELEDLCTTCGLVG 1070
            V  +   +            H  L   E+  L  T GL G
Sbjct: 162  VASIGNEYDDYQKKLFRDSLHAALTLDEVNQLIITAGLTG 201



>gb:BA000012_668987 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 242

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 38/121 (31%), Positives = 54/121 (44%)
 Frame = +3

Query: 570 EFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQE 749
           E+  ++  L  V G  I+D  CG G F R   + G  S V+ LD SE ML +        
Sbjct: 30  EWPALRAMLPEVGGLRIVDLGCGFGWFCRWAHEHGA-SYVLGLDLSEKMLARA------R 82

Query: 750 ENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVAT 929
              P+  I   RAD+ +L     S D  ++  ALH     +     + + L PGG FV +
Sbjct: 83  AAGPDTGITYERADLDKLHLPQDSFDLAYSSLALHYVEDVARLFRTVHQALSPGGHFVFS 142

Query: 930 T 932
           T
Sbjct: 143 T 143



>gb:AY596297_634322 Haloarcula marismortui ATCC 43049 chromosome I,
            complete sequence.
          Length = 206

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 45/156 (28%), Positives = 68/156 (43%), Gaps = 3/156 (1%)
 Frame = +3

Query: 618  IIDASCGSGLFSRLFAKSGLFS---LVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
            ++D  CG+G     FA  GL      V  LD S   L + +E   +   F +    L   
Sbjct: 49   VLDVGCGTG-----FATEGLLEHVDTVYGLDQSPHQLSKAFEKFGK---FGDVRYHL--G 98

Query: 789  DISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF 968
            D  RLPF   S DAV +  ++  WP+P  A+AE  R+ +PGG       IV   Y  +  
Sbjct: 99   DAERLPFKDDSFDAVWSSGSIEYWPNPVDALAECRRLTKPGG----KVLIVGPDYPNSTV 154

Query: 969  VRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFK 1076
             + + +         +F DE+E + + T  G   F+
Sbjct: 155  FQKMADAIM------LFYDEEEADRMFTKAGYEEFE 184



>gb:AE013432_292279 Methanosarcina mazei strain Goe1, section 214 of
           379 of the complete genome.>gb:AE008384_966388
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 266

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 32/113 (28%), Positives = 57/113 (50%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
           G  +++A CG G  + + AK+   + + ++D S   L++  E     E    +N+  ++A
Sbjct: 36  GAKVLEAGCGIGAQTVILAKNNPDAEITSIDISPESLEKARE---NTEKNGIKNVKFLQA 92

Query: 789 DISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG 947
           +I  LPF  SS D +     L    SP  A+  + +VL+PGG    T  +++G
Sbjct: 93  NIFSLPFEDSSFDHIFVCFVLEHLQSPEEALKSLKKVLKPGG----TITVIEG 141



>gb:AE012450_282555 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 358 of 460 of the complete
           genome.>gb:AE008922_915837 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 249

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 38/127 (29%), Positives = 55/127 (43%)
 Frame = +3

Query: 570 EFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQE 749
           EF  ++  L     G ++D  CG+G  S  F  + L   VVA D S  ML+         
Sbjct: 27  EFAELRAGLAGHRNGRLLDLGCGAGHVS--FQLAPLMDEVVAYDLSADMLEVVAATAADR 84

Query: 750 ENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVAT 929
                  +   +    RLPF S S+D V +  + H W     A+ E+ RVLRPGG+    
Sbjct: 85  GLTQMRTL---QGVAERLPFESGSMDVVVSRYSAHHWSDLGQALREVRRVLRPGGIAALI 141

Query: 930 TYIVDGI 950
             +  G+
Sbjct: 142 DVVAPGL 148



>gb:AE010801_266672 Methanosarcina acetivorans str. C2A, section 146
           of 534 of the complete genome.>gb:AE010299_907231
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 199

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 44/159 (27%), Positives = 72/159 (45%)
 Frame = +3

Query: 462 LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGS 641
           +AA  +L  LP+  FLY R WR+               E + D     + G +++   G+
Sbjct: 10  IAAIYDLMELPMEFFLYGR-WRE---------------ETLSD-----LQGRVLEVGVGT 48

Query: 642 GLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSS 821
           G   + ++     S V  +D SE ML++     K+ E   N N++L+  D   L F+  +
Sbjct: 49  GRNLKYYSSG---SSVTGIDVSEGMLEKAR---KKAEGMKNVNLLLM--DAEHLEFSDKT 100

Query: 822 VDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI 938
            D V     L   P P  A+ E+ RVL+P G  +A  ++
Sbjct: 101 FDYVITTFVLCSIPDPVKALKEMRRVLKPSGELIAIEHM 139



>gb:CP000010_865109 Burkholderia mallei ATCC 23344 chromosome 1,
           complete sequence.
          Length = 251

 Score = 52.0 bits (123), Expect = 3e-05
 Identities = 36/102 (35%), Positives = 50/102 (49%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
           G  ++D  CG+G  S   A+ G    V+A D +  ML    E   +E    N  I    A
Sbjct: 42  GARVLDLGCGAGHASFAAARGGAHE-VIAYDLAPQMLATV-EAAARERGLSNVRIEQGAA 99

Query: 789 DISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
           +  RLPFA +S D + +  + H W     A+AE  RVL+PGG
Sbjct: 100 E--RLPFADASFDWIVSRMSAHHWHGVPRALAEARRVLKPGG 139



>gb:BX571965_790796 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.
          Length = 257

 Score = 52.0 bits (123), Expect = 3e-05
 Identities = 36/102 (35%), Positives = 50/102 (49%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
           G  ++D  CG+G  S   A+ G    V+A D +  ML    E   +E    N  I    A
Sbjct: 48  GARVLDLGCGAGHASFAAARGGAHE-VIAYDLAPQMLATV-EAAARERGLSNVRIEQGAA 105

Query: 789 DISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
           +  RLPFA +S D + +  + H W     A+AE  RVL+PGG
Sbjct: 106 E--RLPFADASFDWIVSRMSAHHWHDVPRALAEARRVLKPGG 145



>gb:BA000040_734894 Bradyrhizobium japonicum USDA 110 DNA, complete
            genome.
          Length = 229

 Score = 52.0 bits (123), Expect = 3e-05
 Identities = 40/142 (28%), Positives = 68/142 (47%), Gaps = 7/142 (4%)
 Frame = +3

Query: 606  MGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVR 785
            +GG +++   G+G+   L+A +     +   D SE ML +  + + + +    E + ++ 
Sbjct: 53   IGGRVLEVGVGTGISLPLYAPN---LRIFGTDISEAMLDKARQRVAEGKLKNVEGLAVM- 108

Query: 786  ADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV--DGIYSF 959
             D  +L F  +S D V A   +   P+P  A+ E +RVLRPGG  +  T +    G+  F
Sbjct: 109  -DAEKLEFPDNSFDVVMAQYVVTAVPNPEKALDEFARVLRPGGELIILTRVSADAGMRRF 167

Query: 960  -----TPFVRPLRENFAQISGS 1010
                  P VRPL    A+ + S
Sbjct: 168  IEQKLQPVVRPLGFRTAEFAWS 189



>pir|F85505|F85505 unknown [imported] - Escherichia coli (strain
           O157:H7, substrain EDL933)>pir|F90654|F90654 probable
           biotin synthesis protein [imported] - Escherichia coli
           (strain O157:H7, substrain RIMD
           0509952)>gb:AE005174_64439 Escherichia coli O157:H7
           EDL933, complete genome.>gb:BA000007_658218 Escherichia
           coli O157:H7 DNA, complete genome.
          Length = 256

 Score = 52.0 bits (123), Expect = 3e-05
 Identities = 35/127 (27%), Positives = 62/127 (48%)
 Frame = +3

Query: 567 KEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQ 746
           ++ +L+   L      +++D  CG+G  S + A++   S VVA D S  ML    +  + 
Sbjct: 31  RDLQLLAVCLADYPDASVLDMGCGAGHASFVAAQN--VSTVVAYDLSAQMLDVVAQAAEV 88

Query: 747 EENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA 926
            +    +NI   +     LPFA ++ D V +  + H W    AA+ E++R+L+PGG  + 
Sbjct: 89  RQL---KNITTRQGYAESLPFADNAFDIVISRYSAHHWHDVGAALREVNRILKPGGRLIV 145

Query: 927 TTYIVDG 947
              +  G
Sbjct: 146 MDVMSPG 152



>pir|T10173|T10173 sterol 24-C-methyltransferase (EC 2.1.1.41) -
           castor bean>gb:RCU81313_1703411 Ricinus communis
           sterol-C-methyltransferase mRNA, complete cds.
          Length = 346

 Score = 52.0 bits (123), Expect = 3e-05
 Identities = 45/152 (29%), Positives = 65/152 (42%), Gaps = 8/152 (5%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSLWGGFPGPE--------KEFELMQDYLKPVMGGNIIDASCGSGLF 650
           LV+  YE GW +SF     F G          + F  +Q  LKP     ++D  CG G  
Sbjct: 57  LVTSFYEFGWGESFHFAHRFKGESLRESIKRHEHFLALQLGLKPEQ--KVLDVGCGIGGP 114

Query: 651 SRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDA 830
            R  ++   FSL      +    Q     +       ++    V+AD  ++PF ++S DA
Sbjct: 115 LREISR---FSLTSVTGLNNNEYQITRGKVLNRIAGVDKTCDFVKADFMKMPFPANSFDA 171

Query: 831 VHAGAALHCWPSPSAAVAEISRVLRPGGVFVA 926
           V+A  A    P      +EI RVL+PG  F A
Sbjct: 172 VYAIEATCHAPDAYGCYSEIYRVLKPGQFFAA 203



>sp|P20187|YT37_STRFR Hypothetical 37.1 kDa protein in transposon
           TN4556.>pir|JQ0429|JQ0429 hypothetical 37.1K protein -
           Streptomyces fradiae transposon
           Tn4556>gb:STMTN4556_193107 S.fradiae class II
           transposable element Tn4556 encoding pot. transposase
           (tnpA), pot. resolvase (tnpR) and pot. mercury
           resistance, complete cds.
          Length = 345

 Score = 52.0 bits (123), Expect = 3e-05
 Identities = 39/116 (33%), Positives = 54/116 (46%), Gaps = 1/116 (0%)
 Frame = +3

Query: 579 LMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFS-LVVALDFSETMLQQCYEFIKQEEN 755
           +M D L    G + +D  CG G      AK+   S  V+ +D S+ M++Q     ++ EN
Sbjct: 117 VMLDALDARPGESALDLGCGPGTDLGTLAKAVSPSGRVIGIDSSQEMVEQAR---RRTEN 173

Query: 756 FPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
            P   + L   DI  LP    S+D       L     P+ A+AE  RVLRPGG  V
Sbjct: 174 LPAVEVEL--GDIHTLPLEDGSIDCARTDRVLQHVADPAQALAEARRVLRPGGRLV 227



>sp|O66128|UBIE_MICLU Menaquinone biosynthesis methyltransferase
           ubiE (EC 2.1.1.-).>gb:AB003188_613 Micrococcus luteus
           hexs-a, menG, hexs-b gene, complete cds.
          Length = 246

 Score = 52.0 bits (123), Expect = 3e-05
 Identities = 44/153 (28%), Positives = 69/153 (45%), Gaps = 2/153 (1%)
 Frame = +3

Query: 471 STELFRL-PLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGL 647
           ST+  RL  ++SF   + WR+              + + Q  +K   G   +D  CG+G 
Sbjct: 28  STKYDRLNDIISFNQHKSWRK--------------YTMKQMNVKK--GSKALDVCCGTGD 71

Query: 648 FSRLFAKS-GLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSV 824
           ++   A++ G    V+ LDFSE ML      + Q +    +NI L+  +   LPF  +  
Sbjct: 72  WTIQMAQAVGKNGHVIGLDFSENMLS-----VAQGKTNHIQNIELIHGNAMELPFEDNIF 126

Query: 825 DAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
           D    G  L   P     + E+ RVL+PGG+ V
Sbjct: 127 DYTTIGFGLRNLPDYKKGLEEMYRVLKPGGMIV 159



>gb:NTU81312_1691910 Nicotiana tabacum
           S-adenosyl-methionine-sterol-C-methyltransferase mRNA,
           complete cds.
          Length = 346

 Score = 51.6 bits (122), Expect = 4e-05
 Identities = 47/162 (29%), Positives = 71/162 (43%), Gaps = 8/162 (4%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSL---WGGFPGPE-----KEFELMQDYLKPVMGGNIIDASCGSGLF 650
           L +  YE GW +SF     W G    E     + F  +Q  LKP  G  ++D  CG G  
Sbjct: 57  LCTSFYEYGWGESFHFAPRWKGESLQESIKRHEHFLALQLGLKP--GQKVLDVGCGIGGP 114

Query: 651 SRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDA 830
            R  A+    S V  L+ +E  + +    +   +   ++    V+ D  ++PF  +S DA
Sbjct: 115 LREIARFSSTS-VTGLNNNEYQISRGQ--VLNRKVGLDQTCNFVKGDFMKMPFPDNSFDA 171

Query: 831 VHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYS 956
           V+A  A    P P     EI RVL+PG  F    + +   Y+
Sbjct: 172 VYAIEATCHAPDPLGCYKEIYRVLKPGQCFAVYEWCMTDSYN 213



>gb:AX283161_1465223 Sequence 13 from Patent WO0179513.
          Length = 346

 Score = 51.6 bits (122), Expect = 4e-05
 Identities = 47/162 (29%), Positives = 71/162 (43%), Gaps = 8/162 (4%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSL---WGGFPGPE-----KEFELMQDYLKPVMGGNIIDASCGSGLF 650
           L +  YE GW +SF     W G    E     + F  +Q  LKP  G  ++D  CG G  
Sbjct: 57  LCTSFYEYGWGESFHFAPRWKGESLQESIKRHEHFLALQLGLKP--GQKVLDVGCGIGGP 114

Query: 651 SRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDA 830
            R  A+    S V  L+ +E  + +    +   +   ++    V+ D  ++PF  +S DA
Sbjct: 115 LREIARFSSTS-VTGLNNNEYQISRGQ--VLNRKVGLDQTCNFVKGDFMKMPFPDNSFDA 171

Query: 831 VHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYS 956
           V+A  A    P P     EI RVL+PG  F    + +   Y+
Sbjct: 172 VYAIEATCHAPDPVGCYKEIYRVLKPGQCFAVYEWCMTDSYN 213



>gb:BX957222_844432 Methanococcus maripaludis S2 complete genome;
           segment 4/5.
          Length = 218

 Score = 51.6 bits (122), Expect = 4e-05
 Identities = 36/115 (31%), Positives = 55/115 (47%)
 Frame = +3

Query: 603 VMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILV 782
           +  GN ID   G G  S   AK   FS + ALDFS+ M +   + I   +   N+ I +V
Sbjct: 41  ITAGNCIDIGSGPGALSIALAKQSDFS-IRALDFSKHMNEIALKNIADAD--LNDRIQIV 97

Query: 783 RADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG 947
           + D+  +P   +  D + +  ++  W   + A  EI R+L+ GG     TYI  G
Sbjct: 98  QGDVHNIPIEDNYADLIVSRGSVFFWEDVTTAFREIYRILKSGG----KTYIGGG 148



>gb:CP000026_77268 Salmonella enterica subsp. enterica serovar
           Paratypi A str. ATCC 9150.
          Length = 256

 Score = 51.6 bits (122), Expect = 4e-05
 Identities = 33/103 (32%), Positives = 53/103 (51%)
 Frame = +3

Query: 615 NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADI 794
           N++D  CG+G  S + A+    + VVA D S +ML+      ++       NI L +   
Sbjct: 47  NVLDMGCGAGHASFVAAQHA--NSVVAYDLSASMLEVVAGAAEERHL---SNITLRQGYA 101

Query: 795 SRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
            +LPF  +S + V +  + H W     A+ E+ RVL+PGGV +
Sbjct: 102 EKLPFEDASFEVVISRYSAHHWHDVGQALREVYRVLKPGGVLI 144



>pir|S76411|S76411 hypothetical protein - Synechocystis sp. (strain
           PCC 6803)>gb:BA000022_689321 Synechocystis sp. PCC 6803
           DNA, complete genome.
          Length = 270

 Score = 51.6 bits (122), Expect = 4e-05
 Identities = 41/122 (33%), Positives = 58/122 (47%), Gaps = 1/122 (0%)
 Frame = +3

Query: 564 EKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKS-GLFSLVVALDFSETMLQQCYEFI 740
           +K FE MQ  LKP  G ++++  CG+G  + L A   G    V A+D S+ ML Q  E  
Sbjct: 38  QKTFEKMQ--LKP--GDSVLEVGCGTGNDALLLANYVGETGKVTAVDRSQFMLDQARERA 93

Query: 741 KQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVF 920
           K            V AD  +LPF  ++  A      L     P  A+AE++RV++  G  
Sbjct: 94  KNSTT----KFEFVLADAEQLPFPGANFTAARVDRTLQHIAQPQKAIAEMARVVQSNGWV 149

Query: 921 VA 926
           VA
Sbjct: 150 VA 151



>sp|P36571|BIOC_SERMA Biotin synthesis protein
           bioC.>gb:SMABIO_183882 S. marcescens biotin operon,
           complete sequence.
          Length = 255

 Score = 51.6 bits (122), Expect = 4e-05
 Identities = 32/108 (29%), Positives = 56/108 (51%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
           G  ++DA CG+G FSR++ + G    V ALD +  ML      + ++    +  ++    
Sbjct: 47  GEQLLDAGCGTGYFSRMWRERG--KRVTALDLAPGMLD-----VARQRQAAHHYLL---G 96

Query: 789 DISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATT 932
           DI ++P   +++D   +   +       AA+AE+ RV RPGGV + +T
Sbjct: 97  DIEQVPLPDAAMDICFSSLVVQWCSDLPAALAELYRVTRPGGVILFST 144



>gb:BA000031_706575 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 268

 Score = 51.2 bits (121), Expect = 5e-05
 Identities = 38/110 (34%), Positives = 53/110 (48%)
 Frame = +3

Query: 618 IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
           ++D  CG+G FS+L  + G  + VV  D S+ ML       K  E   + N+  V AD  
Sbjct: 57  VLDLGCGTGYFSQLLLERG--ASVVCADLSQGMLD------KARERCGDHNVRYVVADAE 108

Query: 798 RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG 947
            LPF  +S D V +  AL      S  + EI R+L   G    +T +VDG
Sbjct: 109 SLPFEDASFDYVFSSLALQWCVDLSYPLREIRRILAANGKGCFST-LVDG 157



>gb:AF250768_492671 Uncultured bacterium pCosFS1 BioA-like protein
            (bioA) gene, partial cds; BioB-like protein (bioB) and
            KAPA-synthetase (bioF) genes, complete cds; and biotin
            biosynthesis protein BioC (bioC) gene, partial cds.
          Length = 187

 Score = 51.2 bits (121), Expect = 5e-05
 Identities = 42/150 (28%), Positives = 70/150 (46%), Gaps = 3/150 (2%)
 Frame = +3

Query: 609  GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
            G  ++DA CG+G FSR + + G    V ALD +  ML     F +Q++   +     +  
Sbjct: 47   GEQLLDAGCGTGYFSRRWRELG--KQVTALDLAPGML----AFARQQQAADH----YLLG 96

Query: 789  DISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF 968
            DI  +P   ++VD   +   +        A+AE+ RV RPGGV + +T     ++     
Sbjct: 97   DIENVPLGDAAVDISFSSLVVQWCSDLPRALAELYRVTRPGGVILFSTLAEGSLHE---- 152

Query: 969  VRPLRENFAQISGS-HI--FLDEKELEDLC 1049
               L + + Q+ G  H+  FL   ++E  C
Sbjct: 153  ---LGDAWQQVDGERHVNDFLPLAQIEAAC 179



>gb:AE005674_70309 Shigella flexneri 2a str. 301, complete
            genome.>gb:AE016980_370686 Shigella flexneri 2a str.
            2457T section 3 of 16 of the complete
            genome.>gb:AE014073_995436 Shigella flexneri 2a str.
            2457T complete genome.
          Length = 251

 Score = 51.2 bits (121), Expect = 5e-05
 Identities = 40/143 (27%), Positives = 66/143 (46%)
 Frame = +3

Query: 615  NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADI 794
            +++DA CG G  SR + +    + V ALD S  ML Q       +          +  DI
Sbjct: 45   HVLDAGCGPGWMSRHWRER--HAQVTALDLSPPMLAQARHKDAADH--------YLAGDI 94

Query: 795  SRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVR 974
              LP A+++ D   +  A+    + S A+ E+ RV+RPGGV   TT +   +    P + 
Sbjct: 95   ESLPLATATFDLAWSNLAVQWCGNLSTALRELYRVVRPGGVVAFTTLVQGSL----PELH 150

Query: 975  PLRENFAQISGSHIFLDEKELED 1043
              R+   +   ++ FL   E+E+
Sbjct: 151  QARQAVDERPHANRFLPPDEIEE 173



>gb:AE000516_21614 Mycobacterium tuberculosis CDC1551, complete
           genome.
          Length = 317

 Score = 51.2 bits (121), Expect = 5e-05
 Identities = 33/107 (30%), Positives = 52/107 (48%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
           G  +++ SCG+G  +   A++   +    LD +   +  C    + +   P   +  V+ 
Sbjct: 131 GKEVLEVSCGAGGGASYIARNLGPASYTGLDLNPASIDLC----RAKHRLPG--LQFVQG 184

Query: 789 DISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVAT 929
           D   LPF   S DAV    A H +P     +AE++RVLRPGG F+ T
Sbjct: 185 DAQNLPFPDESFDAVVNVEASHQYPDFRGFLAEVARVLRPGGHFLYT 231



>pir|C70723|C70723 probable methyltransferase - Mycobacterium
           tuberculosis  (strain H37RV)>gb:BX248339_758906
           Mycobacterium bovis subsp. bovis AF2122/97 complete
           genome; segment 6/14.>gb:BX842576_819592 Mycobacterium
           tuberculosis H37Rv complete genome; segment 5/13.
          Length = 347

 Score = 51.2 bits (121), Expect = 5e-05
 Identities = 33/107 (30%), Positives = 52/107 (48%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
           G  +++ SCG+G  +   A++   +    LD +   +  C    + +   P   +  V+ 
Sbjct: 161 GKEVLEVSCGAGGGASYIARNLGPASYTGLDLNPASIDLC----RAKHRLPG--LQFVQG 214

Query: 789 DISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVAT 929
           D   LPF   S DAV    A H +P     +AE++RVLRPGG F+ T
Sbjct: 215 DAQNLPFPDESFDAVVNVEASHQYPDFRGFLAEVARVLRPGGHFLYT 261



>pir|T01572|T01572 sterol 24-C-methyltransferase (EC 2.1.1.41) -
           maize>gb:AF045570_1763829 Zea mays
           (S)-adenosyl-L-methionine:delta 24-sterol
           methyltransferase mRNA, complete cds.
          Length = 344

 Score = 51.2 bits (121), Expect = 5e-05
 Identities = 49/161 (30%), Positives = 70/161 (43%), Gaps = 8/161 (4%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSL---WGGFPGPE-----KEFELMQDYLKPVMGGNIIDASCGSGLF 650
           L +  YE GW +SF     W G    E     + F  +Q  LKP  G  ++D  CG G  
Sbjct: 57  LATSFYEYGWGESFHFAHRWNGESLRESIKRHEHFLALQLGLKP--GMKVLDVGCGIGGP 114

Query: 651 SRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDA 830
            R  A+    S V  L+ +E  + +  E  +      +     V+AD  ++PF  ++ DA
Sbjct: 115 LREIARFSSTS-VTGLNNNEYQITRGKELNRLAGI--SGTCDFVKADFMKMPFDDNTFDA 171

Query: 831 VHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY 953
           V+A  A    P P     EI RVL+PG  F    + V   Y
Sbjct: 172 VYAIEATCHAPDPVGCYKEIYRVLKPGQCFAVYEWCVTDHY 212



>gb:BX842656_826371 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 11/11.
          Length = 284

 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 33/106 (31%), Positives = 50/106 (47%)
 Frame = +3

Query: 618 IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
           I+D  CG+G  +   A +G    V  +D S + L+        E      ++   + D+ 
Sbjct: 88  ILDMGCGAGFLANDLAAAG--HKVTGIDLSTSSLKVA------ESRDLTHSVHYRQGDVY 139

Query: 798 RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTY 935
           ++PF + S D V A   L     P   +AE SRVLRPGG+F   T+
Sbjct: 140 QVPFPNESFDVVAAMDLLEHVSDPQRVIAEASRVLRPGGLFFFNTF 185



>gb:BA000039_727155 Thermosynechococcus elongatus BP-1 DNA, complete
            genome.
          Length = 360

 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 37/131 (28%), Positives = 63/131 (48%), Gaps = 3/131 (2%)
 Frame = +3

Query: 618  IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
            I+D +CG+G   +    +   +++  LD S   L++    +  +     +   L++ +  
Sbjct: 194  ILDVACGTGRTLKQLRYAFPGAVLFGLDLSPAYLRKANALLATQTGALPQ---LIQGNAE 250

Query: 798  RLPFASSSVDAVHAGAALHCWPSP--SAAVAEISRVLRPGGVFVATTYIVDGIYSF-TPF 968
             LP+  S   A+      H  P+P     + E +RVL+PGG+FV    I D I S  +P 
Sbjct: 251  SLPYVDSYFSAITCVFLFHELPAPVRQNVIHECARVLQPGGIFV----ICDSIQSLDSPE 306

Query: 969  VRPLRENFAQI 1001
             RP+ ENFA +
Sbjct: 307  QRPMMENFANL 317



>gb:BA000023_692721 Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 230

 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 28/67 (41%), Positives = 41/67 (61%)
 Frame = +3

Query: 729 YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP 908
           Y+F+K  ++    N++ VR +  +LPFA  S+D + A   LH +PS   AV EI+RVL+ 
Sbjct: 112 YKFLKILKD-KRPNVVAVRGNALKLPFADESIDGISAMFVLHMFPSVLVAVREINRVLKH 170

Query: 909 GGVFVAT 929
           G   VAT
Sbjct: 171 GKKCVAT 177



>gb:AY744399_645050 Uncultured alpha proteobacterium EBAC2C11,
           complete sequence.
          Length = 258

 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 39/113 (34%), Positives = 53/113 (46%), Gaps = 1/113 (0%)
 Frame = +3

Query: 609 GGNIIDASCGSG-LFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVR 785
           G  I+D  CG+G L   L    G+   V  LD S + + Q     K    F N   I   
Sbjct: 38  GDTIVDVGCGAGHLLPHLAKAVGINGTVYGLDPSNSQIDQAQ---KSGSEFVNIRYIKKN 94

Query: 786 ADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVD 944
           AD S+L   ++S   V +  AL   P    A+ EI+R+LRPGG FV  + + D
Sbjct: 95  ADESQLK--TNSCHFVTSTQALEYVPDLEPALDEITRILRPGGAFVNVSILWD 145



>gb:AE017239_414164 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 13 of 16 of the complete
           genome.>gb:AE016958_1057568 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 243

 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 36/109 (33%), Positives = 52/109 (47%)
 Frame = +3

Query: 588 DYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNE 767
           D+L PV    ++D   G+G  +    + GL   VVA+D    ML+          + P  
Sbjct: 32  DWLLPVGARQVLDLGAGTGKLTTRLVERGLD--VVAVDPIPDMLEVL------RSSLPET 83

Query: 768 NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
             +L  A+   +P   +SVD V    A H W  P  A+ E++RVLRPGG
Sbjct: 84  RALLGTAE--EIPLEDNSVDVVLVAQAWH-WVDPERAIPEVARVLRPGG 129



>gb:AE017229_411376 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 3 of 16 of the complete
           genome.>gb:AE016958_1054780 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 324

 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 33/103 (32%), Positives = 47/103 (45%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
           G +++D  CG G  +   A       V A+D +  +L       +Q       N+    A
Sbjct: 40  GLSVLDVGCGPGTITADLAARVAPGQVTAVDQAADVLDVARAEAEQRNL---SNVSFGTA 96

Query: 789 DISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGV 917
           D+ RL FA  + D VHA   L     P AA+ E+ RV RPGG+
Sbjct: 97  DVHRLDFADDTFDVVHAHQVLQHLSDPVAALREMRRVCRPGGI 139



>gb:AE017002_376380 Bacillus cereus ATCC 14579 section 5 of 18 of
           the complete genome.>gb:AE016877_1016630 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 258

 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 33/108 (30%), Positives = 52/108 (48%), Gaps = 1/108 (0%)
 Frame = +3

Query: 603 VMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPN-ENIIL 779
           +    IID  CG G++++  A  G  + VV LDFS+ +LQ        +EN  N  NI  
Sbjct: 33  IQNKQIIDIGCGGGIYTKELALMGAKN-VVGLDFSKLILQAA------KENCNNFSNISF 85

Query: 780 VRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
           +  D   +P+ + + D V + A +H        + E SR+L   GV +
Sbjct: 86  IHGDAHNIPYPNETFDIVISRAVIHHLQDIPTFLREASRILNKNGVLI 133



>gb:AE010901_267485 Methanosarcina acetivorans str. C2A, section 246
           of 534 of the complete genome.>gb:AE010299_908044
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 261

 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 40/133 (30%), Positives = 62/133 (46%), Gaps = 3/133 (2%)
 Frame = +3

Query: 558 GPEKEFELMQDYLKPVMGG---NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC 728
           G  +E ++ +  L   +G    NI+D   G+G+ +   A+ G    V A+DFSE M+   
Sbjct: 36  GGNEESQIWKKLLSSSIGPDLKNILDVGSGTGIIAMYLAELGYG--VTAVDFSEGMM--- 90

Query: 729 YEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP 908
            +  +++       I  +  DI  L F   + D V A   L   P P  A+ E  RV++P
Sbjct: 91  -DIARKKALEKGAKIRFMEGDIENLSFEDETFDCVTARYVLWTLPHPEKALKEWVRVVKP 149

Query: 909 GGVFVATTYIVDG 947
           GG  V    I+DG
Sbjct: 150 GGRIV----IIDG 158



>gb:AE008706_241988 Salmonella typhimurium LT2, section 14 of 220 of
           the complete genome.>gb:AE006468_999070 Salmonella
           typhimurium LT2, complete genome.
          Length = 256

 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 32/103 (31%), Positives = 54/103 (52%)
 Frame = +3

Query: 615 NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADI 794
           +++D  CG+G  S + A+    + VVA D S +ML+      ++       NI L +   
Sbjct: 47  SVLDMGCGAGHASFVAAQHA--NSVVAYDLSASMLEVVAGAAEERHL---SNITLRQGYA 101

Query: 795 SRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
            +LPF  +S + V +  + H W     A+ E++RVL+PGGV +
Sbjct: 102 EKLPFEDASFEVVISRYSAHHWHDVGQALREVNRVLKPGGVLI 144



>gb:AB078612_10181 Leptothrix cholodnii orf1, lthA, lthB, lthC,
           orf5, orf6 genes, complete cds.
          Length = 243

 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 38/129 (29%), Positives = 58/129 (44%), Gaps = 1/129 (0%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFA-KSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVR 785
           G  ++D + G+G  +R FA K G    VV  D +E+ML+   + +  E       +  V 
Sbjct: 59  GHQVLDIAAGTGDLTRQFARKVGASGTVVHTDINESMLRTGRDRLLDE----GLQLPTVL 114

Query: 786 ADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP 965
            D  RLPF S+  D V     L        A+ E++RVL+PGG  +        +  F+ 
Sbjct: 115 CDAERLPFPSARFDIVSVAFGLRNMTHKDVALGEMARVLKPGGKLL--------VLEFSR 166

Query: 966 FVRPLRENF 992
              PLR  +
Sbjct: 167 VAEPLRRAY 175



>pir|T04138|T04138 sterol 24-C-methyltransferase (EC 2.1.1.41)
           ESMT1, endosperm - maize>gb:ZMU79669_1732229 Zea mays
           endosperm C-24 sterol methyltransferase (ESMT1) mRNA,
           complete cds.
          Length = 344

 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 48/161 (29%), Positives = 70/161 (43%), Gaps = 8/161 (4%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSL---WGGFPGPE-----KEFELMQDYLKPVMGGNIIDASCGSGLF 650
           L +  YE GW +SF     W G    E     + F  +Q  LKP  G  ++D  CG G  
Sbjct: 57  LATSFYEYGWGESFHFAHRWNGESLRESIKRHEHFLALQLGLKP--GMKVLDVGCGIGGP 114

Query: 651 SRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDA 830
            R  A+    S V  L+ +E  + +  E  +      +     V+AD  ++PF  ++ DA
Sbjct: 115 LREIARFSSTS-VTGLNNNEYQITRGKELNRLAGI--SGTCDFVKADFMKMPFDDNTFDA 171

Query: 831 VHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY 953
           V+A  A    P P     EI RVL+PG  F    + +   Y
Sbjct: 172 VYAIEATCHAPDPVGCYKEIYRVLKPGQCFAVYEWCITDHY 212



>sp|Q8EXJ3|UBIE_LEPIN Menaquinone biosynthesis methyltransferase
           ubiE (EC 2.1.1.-).>gb:AE011609_274811 Leptospira
           interrogans serovar lai str. 56601 chromosome II,
           section 21 of 34 of the complete
           sequence.>gb:AE016824_341532 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome II,
           complete sequence.>gb:AE010301_1003485 Leptospira
           interrogans serovar lai str. 56601 chromosome II,
           complete sequence.
          Length = 249

 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 34/104 (32%), Positives = 52/104 (50%), Gaps = 1/104 (0%)
 Frame = +3

Query: 615 NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADI 794
           +++D  CG+G  S     S     V  +DFSE ML+     +K++      +  L   D 
Sbjct: 59  HVLDLCCGTGDISLRLENSSFVDHVTCVDFSENMLEIAKTRLKKQAQKGRVHFEL--GDA 116

Query: 795 SRL-PFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
           ++L  F +S  D V  G  L    + S A+ EI RVL+PGG+F+
Sbjct: 117 TKLIQFQNSQFDVVSIGFGLRNVDNLSKAIGEIFRVLKPGGMFL 160



>gb:AF053766_1764474 Nicotiana tabacum S-adenosyl-methionine
           cycloartenol-C24-methyltransferase mRNA, complete cds.
          Length = 349

 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 45/161 (27%), Positives = 68/161 (42%), Gaps = 8/161 (4%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSLWGGFPGPE--------KEFELMQDYLKPVMGGNIIDASCGSGLF 650
           L +  YE GW +SF     + G          + F  +Q  LKP  G  ++D  CG G  
Sbjct: 58  LSTSFYEYGWGESFHFAPRWKGESLLESIKRNEHFLALQLGLKP--GQKVLDVGCGIGGP 115

Query: 651 SRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDA 830
            R  A+    S +  L+ +E  + +  E   +     N+    V+ D  ++ F  +S DA
Sbjct: 116 LREIARFSSTS-ITGLNNNEYQITRGQELNNKIGLTLNQTCNFVKGDFMKMSFPDNSFDA 174

Query: 831 VHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY 953
           V+A AA    P       EI RVL+PG  F    + +   Y
Sbjct: 175 VYAIAATCHAPDVVGCYKEIYRVLKPGQCFAVYEWCMTDSY 215



>gb:AY113031_1578191 Arabidopsis thaliana At1g76090/T23E18_40 mRNA,
           complete cds.>gb:AF375397_1792902 Arabidopsis thaliana
           At1g76090/T23E18_40 mRNA, complete cds.
          Length = 359

 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 42/159 (26%), Positives = 70/159 (44%), Gaps = 6/159 (3%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSLWGGFPGPEKEF------ELMQDYLKPVMGGNIIDASCGSGLFSR 656
           LV+ +YE GW QSF      PG   +       E+  D +K   G  I+DA CG G   R
Sbjct: 80  LVTDIYEWGWGQSFHFSPHVPGKSDKDATRIHEEMAVDLIKVKPGQKILDAGCGVGGPMR 139

Query: 657 LFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVH 836
             A     + V  +  +E  +Q+     K+       N++    +  ++PF  ++ D  +
Sbjct: 140 AIAAHSK-AQVTGITINEYQVQRAKLHNKKAGLDSLCNVVC--GNFLKMPFDENTFDGAY 196

Query: 837 AGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY 953
           +  A    P      +EI RV++PG +FV+  ++    Y
Sbjct: 197 SIEATCHAPKLEEVYSEIFRVMKPGSLFVSYEWVTTEKY 235



>gb:BA000040_736280 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 299

 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 31/116 (26%), Positives = 52/116 (44%)
 Frame = +3

Query: 588 DYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNE 767
           D + P  G  ++D +CG+G+ +R  A+ G    +V +D +  ML              + 
Sbjct: 62  DRIDPAKGECVLDVACGTGVVARRLAERGHVGRLVGIDLNGAMLAVA--------RAKSS 113

Query: 768 NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTY 935
           ++         LPFA+ S D V     L  +P    A+ E++RVL+P G    + Y
Sbjct: 114 DVEWTEGSALDLPFATRSFDVVLCQLGLQFFPDRPQALREMARVLKPSGRLGLSVY 169



>gb:AY396042_616302 Streptomyces griseochromogenes
           C5-O-methyltransferase (milD) gene, complete cds.
          Length = 281

 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 36/107 (33%), Positives = 52/107 (48%)
 Frame = +3

Query: 594 LKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENI 773
           L  + G  ++D  CGSG  +   A S     VV +  S   +++     ++E     + +
Sbjct: 61  LGDIAGRRVLDVGCGSGKPAVRLALSAPTE-VVGVTVSPVQVERATALAEREG--VADRV 117

Query: 774 ILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
             V AD   LPF  +S DAV A   +   PSP+  + EISRVL PGG
Sbjct: 118 RFVCADAMTLPFPDASFDAVWALECMFHMPSPAQVLGEISRVLCPGG 164



>gb:AE017273_424041 Bacillus cereus ATCC 10987, section 10 of 18 of
           the complete genome.>gb:AE017194_1062460 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 238

 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 35/138 (25%), Positives = 66/138 (47%)
 Frame = +3

Query: 579 LMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENF 758
           +M+   K + G +++DA C +G ++  F +SG  + V A+D S  M++   E +  +  F
Sbjct: 38  MMEMIPKRLEGKSVLDAGCAAGWYTSQFVESG--ANVTAIDVSSEMVKAAKESMGDKATF 95

Query: 759 PNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI 938
              ++  +      LPF   + D + +   LH   + +    E  RVL+PGG F+ + + 
Sbjct: 96  LCHDLQEI------LPFEDHTFDVIVSSLTLHYLENWNQVFQEFRRVLKPGGEFIYSIH- 148

Query: 939 VDGIYSFTPFVRPLRENF 992
               + F  F +   EN+
Sbjct: 149 ----HPFMDFTKFTCENY 162



>gb:AE017269_422795 Bacillus cereus ATCC 10987, section 6 of 18 of
           the complete genome.>gb:AE017194_1061214 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 258

 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 32/102 (31%), Positives = 51/102 (50%)
 Frame = +3

Query: 618 IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
           IID  CG G++++  A  G  S VV LDFS+ +LQ       +E      NI  ++ D  
Sbjct: 38  IIDIGCGGGIYTKELALMGAES-VVGLDFSKEILQAA-----KENCSGFSNISFIQGDAH 91

Query: 798 RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
            +P+ + + D V + A +H        + E SR+L+  GV +
Sbjct: 92  SVPYPNDTFDIVISRAVIHHLQDVPTFLREASRILKKNGVLI 133



>gb:AE014291_307578 Brucella suis 1330 chromosome I, complete
           sequence.
          Length = 262

 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 34/120 (28%), Positives = 55/120 (45%)
 Frame = +3

Query: 570 EFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQE 749
           E+ +++  L  + G +I D  CG G F R   + G  S V   D S+ ML++        
Sbjct: 30  EWPVVRSLLPDLTGRDIADLGCGFGWFCRFAREQGAAS-VTGYDLSQNMLERA------R 82

Query: 750 ENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVAT 929
            +  ++ +  ++AD+ RL    +S D V++  A H        +  I   LRP G FV T
Sbjct: 83  RDTQDDAVCYIQADMERLELPEASFDLVYSSLAFHYIRDFPRILKTIHAALRPDGRFVFT 142



>gb:AE011114_269301 Methanosarcina acetivorans str. C2A, section 459
           of 534 of the complete genome.>gb:AE010299_909860
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 250

 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 37/110 (33%), Positives = 50/110 (45%)
 Frame = +3

Query: 618 IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
           ++D   G+G  + LFA+ G    V  +D SE ML++     K   +     I L   D  
Sbjct: 49  VLDVGTGTGFLALLFAEMG--HEVTGIDLSEGMLEKA----KHNADNMGIEIDLFHGDAE 102

Query: 798 RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG 947
            LPF   S D V     L     PS AV E  RVL+PGG+     + +DG
Sbjct: 103 NLPFEDCSFDLVVNKYLLWALEEPSRAVCEWKRVLKPGGMI----FSIDG 148



>pir|AF2054|AF2054 hypothetical protein all1988 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_682977 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 260

 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 35/111 (31%), Positives = 57/111 (51%)
 Frame = +3

Query: 594 LKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENI 773
           L P  G  I+D  CG+G  +   A++G  + V+  D + TM++      K  +N+P+ + 
Sbjct: 34  LNPQPGEYILDLGCGTGQLTEKIAQAG--AEVLGTDNAATMIE------KARQNYPHLHF 85

Query: 774 ILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA 926
            +  A   R+      ++AV + A LH    P AA+A I + L+ GG FVA
Sbjct: 86  DVADARNFRV---DKPLEAVFSNAMLHWVKEPEAAIASIHQALKSGGRFVA 133



>pir|T35233|T35233 hypothetical protein SC5C7.26 SC5C7.26 -
           Streptomyces coelicolor>gb:SCO939128_180208 Streptomyces
           coelicolor A3(2) complete genome; segment 25/29.
          Length = 248

 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 40/117 (34%), Positives = 56/117 (47%), Gaps = 5/117 (4%)
 Frame = +3

Query: 594 LKPVMGGNIIDASCGSGLFSR--LFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNE 767
           L P     ++D +CG+G+ +R  +  + GL   VV +D +  M ++           P  
Sbjct: 31  LVPRQARRLLDVACGTGIVTRRIVVGRDGL--RVVGVDLAPAMARRA------AARLPGA 82

Query: 768 NIILVRADISRLPFASSSVDAVHAGAALHCWPSPS---AAVAEISRVLRPGGVFVAT 929
              +V AD  RLPFA    DAV +   LH         A VAE +RVLRPGG +V T
Sbjct: 83  ---VVLADSRRLPFADGEFDAVASVWLLHLAGGAENVRAIVAECARVLRPGGTYVTT 136



>pir|T38024|T38024 hypothetical protein SPAC1B3.06c - fission yeast 
           (Schizosaccharomyces pombe)>gb:SPAC1B3_1716969 S.pombe
           chromosome I cosmid c1B3.
          Length = 278

 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 36/121 (29%), Positives = 55/121 (45%), Gaps = 3/121 (2%)
 Frame = +3

Query: 561 PEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFI 740
           PE     M  Y+K      I+D  CG G  +  F K      V+ ++ S+ +L +  E +
Sbjct: 27  PETCSTYMLKYVKKT--DRILDVGCGPGTITVGFPKYVPEGEVIGVEPSQELLDKAEEAL 84

Query: 741 KQEENFPNE---NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPG 911
           ++EE    E   N       I +LPF  ++ D V+    L     P AA+ E+ RV +PG
Sbjct: 85  RKEETLKKEKINNCSFRLGSIYKLPFPDNTFDIVNTHQVLVHLQDPVAALVELKRVTKPG 144

Query: 912 G 914
           G
Sbjct: 145 G 145



>pir|S62195|S62195 hypothetical protein 3 - Methanosarcina
           barkeri>gb:MBFMDSUBS_142719 M.barkeri fmdE, fmdF, fmdA,
           fmdC, fmdD, fmdB, orf4, orf3, orf2, and orf1 genes.
          Length = 262

 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 38/112 (33%), Positives = 52/112 (46%)
 Frame = +3

Query: 618 IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
           I+D  CG+G  S LFA+ G    V  +D S  ML+      K +      +I     D  
Sbjct: 62  ILDVGCGTGELSLLFAEMG--HEVAGIDISGQMLK----IAKAKAEALGADITFREGDAE 115

Query: 798 RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY 953
             PF +SS D V +   L   P+P  AV   +R+LR  G  V    IVDG++
Sbjct: 116 NPPFDTSSYDIVFSRHLLWTLPNPKVAVENWNRILRKNGKVV----IVDGVW 163



>pir|AD3481|AD3481 ubiquinone/menaquinone biosynthesis
           methyltransferase ubie  (EC 2.1.1.-) [imported] -
           Brucella melitensis (strain 16M)>gb:AE009616_253752
           Brucella melitensis 16M chromosome I, section 173 of 195
           of the complete sequence.>gb:AE008917_979664 Brucella
           melitensis 16M chromosome I, complete sequence.
          Length = 262

 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 34/120 (28%), Positives = 55/120 (45%)
 Frame = +3

Query: 570 EFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQE 749
           E+ +++  L  + G +I D  CG G F R   + G  S V   D S+ ML++        
Sbjct: 30  EWPVVRSLLPDLTGRDIADLGCGFGWFCRFAREQGAAS-VTGYDLSQNMLERA------R 82

Query: 750 ENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVAT 929
            +  ++ +  ++AD+ RL    +S D V++  A H        +  I   LRP G FV T
Sbjct: 83  RDTQDDAVCYIQADMERLELPEASFDLVYSSLAFHYIRDFPRILKTIHAALRPDGRFVFT 142



>pir|G90735|G90735 probable enzyme BioC [imported] - Escherichia
           coli (strain O157:H7, substrain RIMD
           0509952)>pir|H85585|H85585 hypothetical protein bioC
           [imported] - Escherichia coli  (strain O157:H7,
           substrain EDL933)>gb:AE005174_65081 Escherichia coli
           O157:H7 EDL933, complete genome.>gb:BA000007_658867
           Escherichia coli O157:H7 DNA, complete genome.
          Length = 251

 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 35/108 (32%), Positives = 56/108 (51%)
 Frame = +3

Query: 615 NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADI 794
           +++DA CG G  SR + +    + V ALD S  ML Q     +Q++   +     +  DI
Sbjct: 45  HVLDAGCGPGWMSRHWRER--HAQVTALDLSPPMLAQA----RQKDAADH----YLAGDI 94

Query: 795 SRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI 938
             LP A+++ D   +  A+    + S A+ E+ RV+RPGGV   TT +
Sbjct: 95  ESLPLATATFDLAWSNLAVQWCGNLSTALRELYRVVRPGGVVAFTTLV 142



>gb:NTU71107_1691894 Nicotiana tabacum
           S-adenosyl-methionine-sterol-C-methyltransferase homolog
           mRNA, partial cds.
          Length = 352

 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 42/161 (26%), Positives = 72/161 (44%), Gaps = 7/161 (4%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSLWGGFPGP------EKEFELMQDYLKPVMGGNIIDASCG-SGLFS 653
           LV+ +YE GW QSF       G           E+  D L    G  ++DA CG  G   
Sbjct: 75  LVTDIYEWGWGQSFHFSPAITGKFHREATRLHEEMAVDLLGIKPGARVLDAGCGVGGPMR 134

Query: 654 RLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAV 833
            + A SG  + +V +  +E  + +     K+     +    +V  +  ++PF  +S D V
Sbjct: 135 AIAAHSG--ANIVGITINEYQVNRARAHNKKAGL--DSQCEVVCGNFLQMPFDDNSFDGV 190

Query: 834 HAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYS 956
           ++  A    P      +EI RVL+PG ++V+  ++   +Y+
Sbjct: 191 YSIEATCHAPKLEEVYSEIYRVLKPGSMYVSYEWVTTELYN 231



>gb:BX950851_842206 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 256

 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 37/128 (28%), Positives = 57/128 (44%), Gaps = 1/128 (0%)
 Frame = +3

Query: 567 KEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQ 746
           K+   +   L P     +ID  CG+G  S  F  +   + VVA D S  ML    + + Q
Sbjct: 32  KDLTRLATLLAPFPQARVIDVGCGAGHAS--FVAAQAVAEVVAYDLSSQML----DVVSQ 85

Query: 747 EENFPNENIILVRADISR-LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
                  N I V+  ++  LPF + S D + +  + H W     A+ E+ RVL+PGG  +
Sbjct: 86  AAAQKGLNNIRVQQGVAESLPFDNGSADIIISRYSAHHWHDVGQALREMRRVLKPGGRVI 145

Query: 924 ATTYIVDG 947
               +  G
Sbjct: 146 MMDVVSPG 153



>gb:BX936398_835829 Yersinia pseudotuberculosis IP32953 genome,
            complete sequence.
          Length = 267

 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 40/147 (27%), Positives = 70/147 (47%)
 Frame = +3

Query: 618  IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
            ++DA CG+G FS+ +   G    V+ALD +  ML    ++ +Q++   +     +  DI 
Sbjct: 62   VLDAGCGTGHFSQHWRLLG--KRVIALDLAAGML----DYARQQQVADD----YLLGDIE 111

Query: 798  RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRP 977
             +P    SVD   +  A+       AA++E  RV RPGG+ + +T + +G       +  
Sbjct: 112  HIPLPDQSVDICFSNLAVQWCSDLGAALSEFYRVTRPGGIILFST-LAEG------SLGE 164

Query: 978  LRENFAQISGSHIFLDEKELEDLCTTC 1058
            L + + Q+ G     D   L+ + T C
Sbjct: 165  LGQAWQQVDGQRHVNDFLPLQHIQTAC 191



>gb:BA000030_704118 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 289

 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 43/125 (34%), Positives = 57/125 (45%), Gaps = 4/125 (3%)
 Frame = +3

Query: 561 PEKEFELMQDYLKP---VMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCY 731
           PE   E+  + L P   + G ++++   G+   SR  A  G  +  VALD S   LQ   
Sbjct: 73  PEGLDEVEAELLGPAEDLKGKDVLEIGAGAAQCSRWLAGQG--ARPVALDLSHRQLQHAL 130

Query: 732 EFIKQEENFPNENIILVRADISRLPFASSSVD-AVHAGAALHCWPSPSAAVAEISRVLRP 908
                       ++ LV AD   LPFA +S D A  A  AL     P   + E+ RVLRP
Sbjct: 131 RI--------GGDVPLVEADAGALPFADASFDLACSAYGALPFVADPVRVLREVHRVLRP 182

Query: 909 GGVFV 923
           GG FV
Sbjct: 183 GGRFV 187



>gb:BA000028_695883 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 257

 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 40/130 (30%), Positives = 58/130 (44%)
 Frame = +3

Query: 567 KEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQ 746
           KE E M  +  P     ++D + G G  ++ +A       V+A D +  MLQ     ++ 
Sbjct: 28  KELEKMITWTVPNKRMLMLDIATGGGHVAKKYAP--YVENVIAADLTPEMLQVARTHLRD 85

Query: 747 EENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA 926
             N     I  V AD   LPF   S D V    A H +P+P+  + E +RVL+  G F+ 
Sbjct: 86  YTN-----IQYVVADAENLPFLDESFDLVSCRIAAHHFPNPTKFIEEATRVLKSKGTFI- 139

Query: 927 TTYIVDGIYS 956
               VD I S
Sbjct: 140 ---FVDNISS 146



>gb:AY593479_630644 Collimonas fungivorans fosmid CFUFOS19, complete
            sequence.
          Length = 327

 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 46/173 (26%), Positives = 72/173 (41%), Gaps = 25/173 (14%)
 Frame = +3

Query: 618  IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYE------------------FIK 743
            ++DA CG+G       +    + ++ LD S  ML    E                  F  
Sbjct: 72   VLDAGCGAGPDIYTLQQRFSEAAIIGLDASAAMLSMAKEQRQTAQLSVNRLLKKWLPFTG 131

Query: 744  QEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
            + +   ++   L+  D ++LP A ++VD V +  ALH  P P    AE  R+LR      
Sbjct: 132  KSDELASD---LLCGDFAQLPLAPNTVDLVWSNLALHWHPQPDRVFAEWRRILR------ 182

Query: 924  ATTYIVDGIYSFTPF----VRPLRENFAQI-SGSHI--FLDEKELEDLCTTCG 1061
                 VDG+  F+ F     + LR  FA I  G+H+  F+D  +  D+    G
Sbjct: 183  -----VDGLLMFSCFGPDTFKELRNAFAGIDDGAHVLPFVDMHDFGDMLVNAG 230



>gb:AP006618_561530 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 237

 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 37/109 (33%), Positives = 52/109 (47%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
           G  ++D + G+G+ +  FAKSG +   VA DFS+ ML           +F    + +V  
Sbjct: 60  GERVLDLAAGTGVSTVEFAKSGAWC--VAADFSKGMLAA--------GSF--REVPMVAG 107

Query: 789 DISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTY 935
           D   LPFA  S DAV     L     P  A+ E+ RV +PGG  V   +
Sbjct: 108 DAMALPFADESFDAVAISYGLRNVADPDLAMREMLRVTKPGGRLVIAEF 156



>gb:AE016757_324899 Escherichia coli CFT073 section 3 of 18 of the
           complete genome.>gb:AE014075_955483 Escherichia coli
           CFT073 complete genome.
          Length = 264

 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 35/108 (32%), Positives = 56/108 (51%)
 Frame = +3

Query: 615 NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADI 794
           +++DA CG G  SR + +    + V ALD S  ML Q     +Q++   +     +  DI
Sbjct: 58  HVLDAGCGPGWMSRRWRER--HAQVTALDLSPPMLVQA----RQKDAADH----YLAGDI 107

Query: 795 SRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI 938
             LP A+++ D   +  A+    + S A+ E+ RV+RPGGV   TT +
Sbjct: 108 ESLPLATATFDLAWSNLAVQWCGNLSMALRELYRVVRPGGVVAFTTLV 155



>gb:CP000027_80548 Dehalococcoides ethenogenes 195, complete genome.
          Length = 221

 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 34/109 (31%), Positives = 48/109 (44%), Gaps = 2/109 (1%)
 Frame = +3

Query: 615 NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADI 794
           NIID  CG+G  +RL A       V  +D S  M+       + +E       +  +A  
Sbjct: 56  NIIDMCCGTGATTRLVAGKLKDGQVTGVDLSPDMM------ARAKEKVTGLPAVFQQASG 109

Query: 795 SRLPFASSSVDAVHAGAALHCWPSP--SAAVAEISRVLRPGGVFVATTY 935
             LPF   + D       LH  P+P    A+ +I +VL+PGGVF    Y
Sbjct: 110 DNLPFPEGTFDKAFVSYGLHEMPTPIRHEAIKQIYKVLKPGGVFNVLDY 158



>pir|T03845|T03845 probable sterol 24-C-methyltransferase (EC
           2.1.1.41) - common tobacco (fragment)
          Length = 352

 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 42/161 (26%), Positives = 72/161 (44%), Gaps = 7/161 (4%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSLWGGFPGP------EKEFELMQDYLKPVMGGNIIDASCG-SGLFS 653
           LV+ +YE GW QSF       G           E+  D L    G  ++DA CG  G   
Sbjct: 75  LVTDIYEWGWGQSFHFSPAITGKFHREATRLHEEMAVDLLGIKPGARVLDAGCGVGGPMR 134

Query: 654 RLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAV 833
            + A SG  + +V +  +E  + +     K+     +    +V  +  ++PF  +S D V
Sbjct: 135 AIAAHSG--ANIVGITINEYQVNRARAHNKKAGL--DSQCEVVCGNFLQMPFDDNSFDGV 190

Query: 834 HAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYS 956
           ++  A    P      +EI RVL+PG ++V+  ++   +Y+
Sbjct: 191 YSIEATCHAPKLEEVYSEIYRVLKPGSMYVSYEWVTTELYN 231



>pir|AG0141|AG0141 biotin synthesis protein BioC [imported] - Yersinia
            pestis  (strain CO92)>gb:AE013904_301322 Yersinia pestis
            KIM section 304 of 415 of the complete
            genome.>gb:AE017130_386835 Yersinia pestis biovar
            Medievalis str. 91001 section 4 of 16 of the complete
            genome.>gb:AJ414146_522987 Yersinia pestis strain CO92
            complete genome; segment 6/20.>gb:AE009952_931505
            Yersinia pestis KIM complete genome.>gb:AE017042_1143401
            Yersinia pestis biovar Medievalis str. 91001 complete
            genome.
          Length = 267

 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 40/147 (27%), Positives = 70/147 (47%)
 Frame = +3

Query: 618  IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
            ++DA CG+G FS+ +   G    V+ALD +  ML    ++ +Q++   +     +  DI 
Sbjct: 62   VLDAGCGTGHFSQHWRLLG--KRVIALDLAAGML----DYARQQQVADD----YLLGDIE 111

Query: 798  RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRP 977
             +P    SVD   +  A+       AA++E  RV RPGG+ + +T + +G       +  
Sbjct: 112  HIPLPDQSVDICFSNLAVQWCSDLGAALSEFYRVTRPGGIILFST-LAEG------SLDE 164

Query: 978  LRENFAQISGSHIFLDEKELEDLCTTC 1058
            L + + Q+ G     D   L+ + T C
Sbjct: 165  LGQAWQQVDGQRHVNDFLPLQHIQTAC 191



>sp|Q88SI6|UBIE_LACPL Menaquinone biosynthesis methyltransferase
           ubiE (EC 2.1.1.-).>gb:AL935262_552876 Lactobacillus
           plantarum strain WCFS1 complete genome; segment 11/11.
          Length = 237

 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 33/104 (31%), Positives = 53/104 (50%), Gaps = 1/104 (0%)
 Frame = +3

Query: 615 NIIDASCGSGLFSRLFAKS-GLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRAD 791
           +++D  CG+G ++   AK       V+ LDFS  ML+   + + Q++    + + L R +
Sbjct: 50  HVLDLCCGTGDWTIALAKELQAPGEVIGLDFSAPMLKLAQQKVTQQQ--VADRVWLRRGN 107

Query: 792 ISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
              LPF  ++ D V  G  L   P  + A+ EI RVL+PG   V
Sbjct: 108 AMHLPFKDNTFDLVTIGFGLRNLPDKAQALTEIYRVLKPGARLV 151



>gb:TAU60755_1724749 Triticum aestivum delta-24-sterol
           methyltransferase (TA-MT) gene, complete cds.
          Length = 363

 Score = 49.7 bits (117), Expect = 2e-04
 Identities = 46/161 (28%), Positives = 64/161 (39%), Gaps = 8/161 (4%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSL---WGGFPGPE-----KEFELMQDYLKPVMGGNIIDASCGSGLF 650
           L +  YE GW +SF     W G    E     + F  +Q  LKP  G  ++D  CG G  
Sbjct: 76  LATSFYEYGWGESFHFAHRWNGESLRESIKRHEHFLALQLELKP--GMKVLDVGCGIGGP 133

Query: 651 SRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDA 830
            R  A+   FS       +    Q                   V+AD  ++PF+ ++ DA
Sbjct: 134 LREIAR---FSSTSVTGLNNNDYQITRGKALNRSVGLGATCDFVKADFMKMPFSDNTFDA 190

Query: 831 VHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY 953
           V+A  A    P P     EI RVL+PG  F    + +   Y
Sbjct: 191 VYAIEATCHAPDPVGCYKEIYRVLKPGQCFAVYEWCITDHY 231



>gb:BA000040_735494 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 306

 Score = 49.7 bits (117), Expect = 2e-04
 Identities = 29/109 (26%), Positives = 52/109 (47%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
           G  ++D  CG+G+ +   A+ G  + V  LD S  ++++     ++     N ++  V  
Sbjct: 82  GQRLLDVGCGTGVVAITAARRG--AKVRGLDLSPVLIERA----REHAQLVNLDVDFVDG 135

Query: 789 DISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTY 935
           D   LP+  +  D V +       P P  A+ E+ RVL+PGG    +T+
Sbjct: 136 DAESLPYGDNEFDVVLSQFGHMFAPRPDVAIGEMLRVLKPGGTIAFSTW 184



>gb:AP006627_566319 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 260

 Score = 49.7 bits (117), Expect = 2e-04
 Identities = 34/104 (32%), Positives = 48/104 (46%), Gaps = 4/104 (3%)
 Frame = +3

Query: 624 DASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ----CYEFIKQEENFPNENIILVRAD 791
           D  CG G+++R  A  G+   V+ +D S  ML      C +F         + I L + D
Sbjct: 39  DIGCGGGIYTRALAMIGI-PHVIGIDSSAQMLADAKAACRDF---------QQIALKKGD 88

Query: 792 ISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
              LP AS S+D + A A +H  PS      E  R L  GG+F+
Sbjct: 89  CEDLPLASGSIDLLLARALIHHLPSVQPFFQEAWRTLADGGLFI 132



>gb:AE017200_403424 Lactobacillus johnsonii NCC 533, section 1 of 7 of
            the complete genome.>gb:AE017198_1121911 Lactobacillus
            johnsonii NCC 533, complete genome.
          Length = 244

 Score = 49.7 bits (117), Expect = 2e-04
 Identities = 50/182 (27%), Positives = 75/182 (41%), Gaps = 8/182 (4%)
 Frame = +3

Query: 495  LVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKS- 671
            L+S   + GWR+ F                   LK   G   +D  CG+G  +   AK  
Sbjct: 33   LISLGTQNGWRKKFF----------------KKLKVKAGDFALDLCCGTGDLTIALAKQV 76

Query: 672  GLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAAL 851
            G    V+ LDF++ ML    + I+ + N   E I L + D   LP+   S D V  G  L
Sbjct: 77   GPSGNVIGLDFNQKMLDLADKKIRGQ-NLQKE-IQLKQGDAMHLPYTDQSFDIVTIGFGL 134

Query: 852  HCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVR-------PLRENFAQISGS 1010
               P     + EI RVL+P G       I++      P ++        L  NFA++ G+
Sbjct: 135  RNVPDADQVLKEIYRVLKPDG----KVGILETSQPTNPIIKLGWESYFKLFPNFAKLLGA 190

Query: 1011 HI 1016
            ++
Sbjct: 191  NV 192



>gb:AE016775_329810 Pseudomonas putida KT2440 section 2 of 21 of the
            complete genome.>gb:AE015451_944887 Pseudomonas putida
            KT2440 complete genome.
          Length = 272

 Score = 49.7 bits (117), Expect = 2e-04
 Identities = 44/158 (27%), Positives = 68/158 (43%)
 Frame = +3

Query: 621  IDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISR 800
            +D   G+G FSR+ A+    +  VA+D +E ML      +K    +       V  D  R
Sbjct: 58   LDLGSGTGHFSRMLAERFAQAGGVAVDIAEGMLLHA-RHVKGGAQYH------VVGDAER 110

Query: 801  LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPL 980
            LP   +SVD V +  A+      ++ +AE  RVLRPGGV   ++  V  +         L
Sbjct: 111  LPLRDASVDLVFSSLAVQWCDQFASVLAEAQRVLRPGGVLAFSSLCVGTL-------DEL 163

Query: 981  RENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRR 1094
            R ++  + G       +  ED    C   GF+ +   R
Sbjct: 164  RASWQAVDGLVHVNRFRRFEDYQRLCAASGFEQLELER 201



>gb:AE011136_269529 Methanosarcina acetivorans str. C2A, section 481
           of 534 of the complete genome.>gb:AE010299_910088
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 252

 Score = 49.7 bits (117), Expect = 2e-04
 Identities = 39/135 (28%), Positives = 58/135 (42%), Gaps = 2/135 (1%)
 Frame = +3

Query: 549 GFPGPEKEF--ELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQ 722
           GF   E+     +++++L P     ++D   G G  + LFA+ G    V A+D S  ML+
Sbjct: 24  GFDAEERIIWRRMLENFLPPGQRLKVLDVGTGPGFLALLFAEMG--HEVTAVDISMGMLE 81

Query: 723 QCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVL 902
           +     +         + L   D  +LPF     D V     L   P P  AV E  RVL
Sbjct: 82  KA----RNNAKTLGVKVDLFHGDAEKLPFEDCYFDLVVNKYLLWTLPQPEIAVQEWMRVL 137

Query: 903 RPGGVFVATTYIVDG 947
           +PGG      + +DG
Sbjct: 138 KPGG----RVFAIDG 148



>pir|AI0533|AI0533 probable methyltransferase yafE [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)>gb:AE016842_346638 Salmonella enterica
           subsp. enterica serovar Typhi Ty2, section 9 of 16 of
           the complete genome.>gb:AL627266_540584 Salmonella
           enterica serovar Typhi (Salmonella typhi) strain CT18,
           complete chromosome; segment 2/20.>gb:AE014613_983970
           Salmonella enterica subsp. enterica serovar Typhi Ty2,
           complete genome.
          Length = 256

 Score = 49.7 bits (117), Expect = 2e-04
 Identities = 32/103 (31%), Positives = 52/103 (50%)
 Frame = +3

Query: 615 NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADI 794
           +++D  CG+G  S  F  +   + VVA D S +ML+      ++       NI L +   
Sbjct: 47  SVLDMGCGAGHAS--FVAAQHVNSVVAYDLSASMLEVVAGAAEERHL---SNITLRQGYA 101

Query: 795 SRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
            +LPF  +S + V +  + H W     A+ E+ RVL+PGGV +
Sbjct: 102 EKLPFEDASFEVVISRYSAHHWHDVGQALREVYRVLKPGGVLI 144



>pir|T06795|T06795 probable sterol 24-C-methyltransferase (EC
           2.1.1.41) - wheat>gb:TAU60754_1724748 Triticum aestivum
           delta-24-sterol methyltransferase (TA-MT) mRNA, complete
           cds.
          Length = 363

 Score = 49.7 bits (117), Expect = 2e-04
 Identities = 46/161 (28%), Positives = 64/161 (39%), Gaps = 8/161 (4%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSL---WGGFPGPE-----KEFELMQDYLKPVMGGNIIDASCGSGLF 650
           L +  YE GW +SF     W G    E     + F  +Q  LKP  G  ++D  CG G  
Sbjct: 76  LATSFYEYGWGESFHFAHRWNGESLRESIKRHEHFLALQLELKP--GMKVLDVGCGIGGP 133

Query: 651 SRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDA 830
            R  A+   FS       +    Q                   V+AD  ++PF+ ++ DA
Sbjct: 134 LREIAR---FSSTSVTGLNNNDYQITRGKALNRSVGLGATCDFVKADFMKMPFSDNTFDA 190

Query: 831 VHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY 953
           V+A  A    P P     EI RVL+PG  F    + +   Y
Sbjct: 191 VYAIEATCHAPDPVGCYKEIYRVLKPGQCFAVYEWCITDHY 231



>sp|Q8YLP4|UBIE_ANASP Menaquinone biosynthesis methyltransferase
           ubiE (EC 2.1.1.-).>pir|AD2462|AD2462 hypothetical
           protein alr5252 [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_686241 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 229

 Score = 49.7 bits (117), Expect = 2e-04
 Identities = 36/115 (31%), Positives = 53/115 (46%), Gaps = 1/115 (0%)
 Frame = +3

Query: 567 KEFELMQDYLKPVMGGNIIDASCGSG-LFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK 743
           KE  +     KP  G   +D  CGSG L  RL  + G    V  +DFS  +L+   +  +
Sbjct: 32  KEMAIKWTGAKP--GDTCLDLCCGSGDLALRLARRVGSTGQVSGVDFSANLLETAKQ--R 87

Query: 744 QEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRP 908
            +  +P  NI  V A++  LPF  +  DA   G  L        ++ E+ RVL+P
Sbjct: 88  AQSQYPQPNISWVEANVLDLPFKDNQFDAATMGYGLRNVTDIPRSLQELHRVLKP 142



>gb:ATU71400_1557202 Arabidopsis thaliana
           S-adenosyl-methionine-sterol-C-methyltransferase mRNA,
           complete cds.
          Length = 359

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 42/159 (26%), Positives = 69/159 (43%), Gaps = 6/159 (3%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSLWGGFPGPEKEF------ELMQDYLKPVMGGNIIDASCGSGLFSR 656
           LV+  YE GW QSF      PG   +       E+  D +K   G  I+DA CG G   R
Sbjct: 80  LVTDTYEWGWGQSFHFSPHVPGKSDKDATRIHEEMAVDLIKVKPGQKILDAGCGVGGPMR 139

Query: 657 LFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVH 836
             A     + V  +  +E  +Q+     K+       N++    +  ++PF  ++ D  +
Sbjct: 140 AIAAHSK-AQVTGITINEYQVQRAKLHNKKAGLDSLCNVVC--GNFLKMPFDENTFDGAY 196

Query: 837 AGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY 953
           +  A    P      +EI RV++PG +FV+  ++    Y
Sbjct: 197 SIEATCHAPKLEEVYSEIFRVMKPGSLFVSYEWVTTEKY 235



>gb:AB006704_1509989 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MSH12.>gb:AY120716_1579598 Arabidopsis thaliana
           24-sterol C-methyltransferase (At5g13710) mRNA, complete
           cds.>gb:BT000058_1634336 Arabidopsis thaliana 24-sterol
           C-methyltransferase (At5g13710) mRNA, complete
           cds.>gb:AF090372_1767360 Arabidopsis thaliana
           SAM:cycloartenol-C24-methyltransferase (SMT1) mRNA,
           complete cds.>gb:AF195648_1775887 Arabidopsis thaliana
           sterol methyltransferase SMT1 (SMT1) mRNA, complete cds.
          Length = 336

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 46/152 (30%), Positives = 69/152 (45%), Gaps = 8/152 (5%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSL---WGGFPGPE-----KEFELMQDYLKPVMGGNIIDASCGSGLF 650
           L +  YE GW +SF     W G    E     + F  +Q  ++P  G  ++D  CG G  
Sbjct: 51  LATSFYEYGWGESFHFAQRWKGESLRESIKRHEHFLALQLGIQP--GQKVLDVGCGIGGP 108

Query: 651 SRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDA 830
            R  A+    S+V  L+ +E  + +  E  +      ++    V+AD  ++PF  +S DA
Sbjct: 109 LREIARFSN-SVVTGLNNNEYQITRGKELNRLAG--VDKTCNFVKADFMKMPFPENSFDA 165

Query: 831 VHAGAALHCWPSPSAAVAEISRVLRPGGVFVA 926
           V+A  A    P       EI RVL+PG  F A
Sbjct: 166 VYAIEATCHAPDAYGCYKEIYRVLKPGQCFAA 197



>gb:AX064605_1459216 Sequence 887 from Patent WO0100843.
          Length = 246

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 35/103 (33%), Positives = 50/103 (48%), Gaps = 1/103 (0%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
           G  I++  CGS   +R  A     + V A D S  ML+             + N+ LV+A
Sbjct: 46  GKKILEIGCGSAPCARWLANDVPNAFVTAFDISSQMLKYAGH---------DHNVHLVQA 96

Query: 789 DISRLPFASSSVDAVHA-GAALHCWPSPSAAVAEISRVLRPGG 914
           D   LP+A SS D V +   A+      +A + EI+RVL+PGG
Sbjct: 97  DAMSLPYADSSFDVVFSVFGAIPFVEDSAALMKEIARVLKPGG 139



>gb:BX927152_832936 Corynebacterium glutamicum ATCC 13032, IS
           fingerprint type 4-5, complete genome; segment 5/10.
          Length = 259

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 35/103 (33%), Positives = 50/103 (48%), Gaps = 1/103 (0%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
           G  I++  CGS   +R  A     + V A D S  ML+             + N+ LV+A
Sbjct: 59  GKKILEIGCGSAPCARWLANDVPNAFVTAFDISSQMLKYAGH---------DHNVHLVQA 109

Query: 789 DISRLPFASSSVDAVHA-GAALHCWPSPSAAVAEISRVLRPGG 914
           D   LP+A SS D V +   A+      +A + EI+RVL+PGG
Sbjct: 110 DAMSLPYADSSFDVVFSVFGAIPFVEDSAALMKEIARVLKPGG 152



>gb:BA000045_741558 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 217

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 35/109 (32%), Positives = 50/109 (45%), Gaps = 2/109 (1%)
 Frame = +3

Query: 615 NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADI 794
           +++D  CG G  +R  A +G  + V  LD SE  L+            P  + +  RA+ 
Sbjct: 57  SVLDLCCGPGGATRYLAATG--ARVTGLDRSEGSLRHA------RARVPGAHFVQGRAEA 108

Query: 795 SRLPFASSSVDAVHAGAALHCWPSPS--AAVAEISRVLRPGGVFVATTY 935
             +PFA +S D VH   ALH          + E+ RVL+PGG F    Y
Sbjct: 109 --MPFAGASFDLVHTSVALHEMEPTQRRTIIREVLRVLKPGGTFALIDY 155



>gb:BA000036_719085 Corynebacterium glutamicum ATCC 13032 DNA,
           complete genome.
          Length = 218

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 35/103 (33%), Positives = 50/103 (48%), Gaps = 1/103 (0%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
           G  I++  CGS   +R  A     + V A D S  ML+             + N+ LV+A
Sbjct: 18  GKKILEIGCGSAPCARWLANDVPNAFVTAFDISSQMLKYAGH---------DHNVHLVQA 68

Query: 789 DISRLPFASSSVDAVHA-GAALHCWPSPSAAVAEISRVLRPGG 914
           D   LP+A SS D V +   A+      +A + EI+RVL+PGG
Sbjct: 69  DAMSLPYADSSFDVVFSVFGAIPFVEDSAALMKEIARVLKPGG 111



>gb:AE017028_381645 Bacillus anthracis str. Ames section 5 of 18 of
           the complete genome.>gb:AE017225_406748 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_451493 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE016879_1011350 Bacillus
           anthracis str. Ames complete genome.
          Length = 258

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 32/107 (29%), Positives = 50/107 (46%)
 Frame = +3

Query: 603 VMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILV 782
           +    IID  CG G++++  A  G  S VV LDFS+ +LQ       +E      NI  +
Sbjct: 33  IQNKQIIDIGCGGGIYTKELALMGAKS-VVGLDFSKEILQAA-----KENCSGFSNISFI 86

Query: 783 RADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
             D    P+ + + D V + A +H        + E SR+L+  GV +
Sbjct: 87  HGDAHSTPYPNDTFDIVISRAVIHHLQDIPTFLREASRILKKNGVLI 133



>gb:AE017007_377712 Bacillus cereus ATCC 14579 section 10 of 18 of
           the complete genome.>gb:AE016877_1017962 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 235

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 37/138 (26%), Positives = 64/138 (46%)
 Frame = +3

Query: 579 LMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENF 758
           +M+   K + G  I+DA C +G ++  F K G  + V A+D S  M++   E I +E  F
Sbjct: 35  MMELIPKELEGKKILDAGCAAGWYTSQFIKRG--ANVTAIDVSPEMVKAAKENIGEEATF 92

Query: 759 PNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI 938
              ++         LPF  ++ D + +   LH   + +    E  RVL+PGG  + + + 
Sbjct: 93  LCHDLQ------ETLPFKDNTYDVIVSSLTLHYIENWNQVFQEFRRVLKPGGELIYSIH- 145

Query: 939 VDGIYSFTPFVRPLRENF 992
               + F  F +   EN+
Sbjct: 146 ----HPFMDFTKFPCENY 159



>gb:AE000516_23559 Mycobacterium tuberculosis CDC1551, complete
           genome.
          Length = 236

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 34/109 (31%), Positives = 50/109 (45%)
 Frame = +3

Query: 588 DYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNE 767
           D+L P     ++D   G+G  +    + GL   VVA+D    ML      + Q       
Sbjct: 25  DWLLPAAARRVLDLGAGTGKLTTRLVERGLD--VVAVDPIPEMLDVLRAALPQT------ 76

Query: 768 NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
             + +      +P   +SVDAV    A H W  P+ A+ E++RVLRPGG
Sbjct: 77  --VALLGTAEEIPLDDNSVDAVLVAQAWH-WVDPARAIPEVARVLRPGG 122



>pir|T06780|T06780 probable sterol 24-C-methyltransferase (EC
           2.1.1.41) - soybean>gb:GMU43683_1680669 Glycine max
           S-adenosyl-L-methionine:delta24-sterol-C-
           methyltransferase mRNA, complete cds.
          Length = 367

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 47/152 (30%), Positives = 69/152 (45%), Gaps = 8/152 (5%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSL---WGGFPGPE-----KEFELMQDYLKPVMGGNIIDASCGSGLF 650
           LV+  YE GW +SF     W G    E     + F  +Q  LKP  G  ++D  CG G  
Sbjct: 78  LVTSFYEFGWGESFHFAPRWKGESLRESIKRHEHFLPLQLGLKP--GQKVLDVGCGIGGP 135

Query: 651 SRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDA 830
            R  ++    S +  L+ +E  + +  E  +      ++    V+AD  ++PF  +S DA
Sbjct: 136 LREISRFSSTS-ITGLNNNEYQITRGKELNRIAG--VDKTCNFVKADFMKMPFPDNSFDA 192

Query: 831 VHAGAALHCWPSPSAAVAEISRVLRPGGVFVA 926
           V+A  A    P       EI RVL+PG  F A
Sbjct: 193 VYAIEATCHAPDAYGCYKEIFRVLKPGQYFAA 224



>pir|T03848|T03848 probable sterol 24-C-methyltransferase (EC
           2.1.1.41) - common tobacco>gb:NTU71108_1691895 Nicotiana
           tabacum S-adenosyl-methionine-sterol-C-methyltransferase
           mRNA, complete cds.
          Length = 357

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 41/159 (25%), Positives = 69/159 (43%), Gaps = 6/159 (3%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSLWGGFPGPEKEF------ELMQDYLKPVMGGNIIDASCGSGLFSR 656
           LV+ +YE GW QSF      PG           E+  D +    G  I+DA CG G   R
Sbjct: 81  LVTDIYEWGWGQSFHFSPSIPGKSHREATRIHEEMAVDLIGVKPGARILDAGCGVGGPMR 140

Query: 657 LFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVH 836
             A     + VV +  +E  +++     K+     +    +V  +  ++PF  +S D  +
Sbjct: 141 AIAAHSRAN-VVGITINEYQVKRARMHNKKAGL--DSLCEVVCGNFLQMPFPDNSFDGAY 197

Query: 837 AGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY 953
           +  A    P       EI RV++PG ++V+  ++   +Y
Sbjct: 198 SIEATCHAPKLEEVYKEIYRVMKPGSLYVSYEWVTTELY 236



>pir|T35744|T35744 hypothetical protein SC7H2.13 - Streptomyces
           coelicolor>gb:SCO939111_175674 Streptomyces coelicolor
           A3(2) complete genome; segment 8/29.
          Length = 220

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 45/125 (36%), Positives = 59/125 (47%), Gaps = 4/125 (3%)
 Frame = +3

Query: 561 PEKEFELMQDYLKP---VMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCY 731
           PE   E+  + L P   + G ++++   G+   SR     G  +  VALD S   LQ   
Sbjct: 4   PEGLDEVEAELLGPPEDLKGRDVLELGAGAAQCSRWLTAQG--ARPVALDLSHRQLQHA- 60

Query: 732 EFIKQEENFPNENIILVRADISRLPFASSSVD-AVHAGAALHCWPSPSAAVAEISRVLRP 908
             ++   +FP     LV AD S LPFA  S D A  A  AL     P   + E+ RVLRP
Sbjct: 61  --LRIGVSFP-----LVCADASVLPFADGSFDLACSAYGALPFVADPRLVLREVRRVLRP 113

Query: 909 GGVFV 923
           GG FV
Sbjct: 114 GGRFV 118



>sp|O53392|YX42_MYCTU Putative methyltransferase
           Rv3342/MT3445/Mb3374 (EC 2.1.1.-).>pir|E70846|E70846
           hypothetical protein Rv3342 - Mycobacterium tuberculosis
            (strain H37RV)>gb:BX248345_760731 Mycobacterium bovis
           subsp. bovis AF2122/97 complete genome; segment
           12/14.>gb:BX842582_821448 Mycobacterium tuberculosis
           H37Rv complete genome; segment 11/13.
          Length = 243

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 34/109 (31%), Positives = 50/109 (45%)
 Frame = +3

Query: 588 DYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNE 767
           D+L P     ++D   G+G  +    + GL   VVA+D    ML      + Q       
Sbjct: 32  DWLLPAAARRVLDLGAGTGKLTTRLVERGLD--VVAVDPIPEMLDVLRAALPQT------ 83

Query: 768 NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
             + +      +P   +SVDAV    A H W  P+ A+ E++RVLRPGG
Sbjct: 84  --VALLGTAEEIPLDDNSVDAVLVAQAWH-WVDPARAIPEVARVLRPGG 129



>sp|Q10886|Y089_MYCTU Putative methyltransferase
           Rv0089/MT0098/Mb0092 (EC 2.1.1.-).>pir|A70750|A70750
           hypothetical protein Rv0089 - Mycobacterium tuberculosis
            (strain H37RV)>gb:AE000516_20089 Mycobacterium
           tuberculosis CDC1551, complete
           genome.>gb:BX248334_757449 Mycobacterium bovis subsp.
           bovis AF2122/97 complete genome; segment
           1/14.>gb:BX842572_818128 Mycobacterium tuberculosis
           H37Rv complete genome; segment 1/13.
          Length = 197

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 33/137 (24%), Positives = 62/137 (45%), Gaps = 4/137 (2%)
 Frame = +3

Query: 573 FELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEE 752
           ++ + D + P+    ++D  CG GL +   A+      V A+D    +L++       + 
Sbjct: 11  YDALLDAMVPLGTQCVLDVGCGDGLLAARLARR--IPYVTAVDIDAPVLRRA------QT 62

Query: 753 NFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATT 932
            F N  I  + ADI      ++  DAV + AALH       A++ +  ++ PGG     T
Sbjct: 63  RFANAPIRWLHADIMTAELPNAGFDAVVSNAALHHIEDTRTALSRLGGLVTPGGTLAVVT 122

Query: 933 YIV----DGIYSFTPFV 971
           ++     +G++  T +V
Sbjct: 123 FVTPSLRNGLWHLTSWV 139



>gb:BX572598_801228 Rhodopseudomonas palustris CGA009 complete genome;
            segment 6/16.
          Length = 264

 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 43/150 (28%), Positives = 66/150 (44%)
 Frame = +3

Query: 594  LKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENI 773
            L PV G   +D  CG G  +R  A+ G  + +  LD + T L+      +  E      I
Sbjct: 41   LPPVAGLKGLDLGCGEGTNTRTVARLG--ASMTGLDIAPTFLRHA----RDAERRDPLGI 94

Query: 774  ILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY 953
              V  D   LPFA  S D V A  ++      +A + E++RVL+PGG F+  + +     
Sbjct: 95   DYVLGDGLTLPFADRSFDFVTAFMSMMDMVDQAAVLREVARVLKPGG-FLQFSIL----- 148

Query: 954  SFTPFVRPLRENFAQISGSHIFLDEKELED 1043
                FV P R N     G+ + ++  +  D
Sbjct: 149  -HPCFVPPTRRNIRDAEGAPVAVEVADYFD 177



>gb:AE015943_321240 Clostridium tetani E88, section 8 of 10 of the
           complete genome.>gb:AE015927_964029 Clostridium tetani
           E88, complete genome.
          Length = 207

 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 35/116 (30%), Positives = 51/116 (43%), Gaps = 2/116 (1%)
 Frame = +3

Query: 594 LKPVMGGNIIDASCGSG--LFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNE 767
           LK +    I+D  CG+G  LF  L+ K  + +    LD SE ML    E +K       +
Sbjct: 43  LKNLNFNTILDVGCGTGSILFLLLYEKENIKAY--GLDISEEMLNVAKEKLK-------D 93

Query: 768 NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTY 935
             IL   D   +P+     D V    + H +P+P   + EI R L+  GV +   Y
Sbjct: 94  KAILTLGDSENMPYKDEFFDVVICTDSFHHYPNPLNVLKEIHRTLKERGVLIICDY 149



>gb:AE013315_291222 Methanosarcina mazei strain Goe1, section 97 of
           379 of the complete genome.>gb:AE008384_965331
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 274

 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 37/105 (35%), Positives = 48/105 (45%), Gaps = 2/105 (1%)
 Frame = +3

Query: 618 IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNEN--IILVRAD 791
           ++D   G+G  + LFA+ G    V  +D SE ML+      K   N  N    I L   D
Sbjct: 73  VLDVGTGTGFLALLFAEMG--HEVSGIDLSEGMLE------KARHNADNMGLEISLFHGD 124

Query: 792 ISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA 926
              LPF   S D V     L     P++AV E  RVL+PGG+  A
Sbjct: 125 AENLPFEDCSFDLVVNKYLLWTLQEPASAVREWKRVLKPGGMIFA 169



>gb:AE013298_291060 Methanosarcina mazei strain Goe1, section 80 of
           379 of the complete genome.>gb:AE008384_965169
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 243

 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 49/175 (28%), Positives = 69/175 (39%), Gaps = 5/175 (2%)
 Frame = +3

Query: 417 VDLTIAGGGKAYGEALAA---STELFRLPLVSFLYERGWRQSF--SLWGGFPGPEKEFEL 581
           V+L  A    AY   L A   S     LP +S   E+  +  F      G  G     ++
Sbjct: 30  VELVTADASSAYVRGLMAVNGSKVYSILPFISIDAEKAKKAKFPEDRMSGVRG-----KV 84

Query: 582 MQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFP 761
           +   L  + G  I+D  CG G  +   AK+   S V  +D  +++  Q  E   +    P
Sbjct: 85  IPSVLPEIKGETILDIGCGFGTLTMELAKNNPESQVYGIDLHDSLTGQA-EMNAEVLGLP 143

Query: 762 NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA 926
           N  +         LPF   S+DAV     LH       A+ EI RVL+ GG   A
Sbjct: 144 N--VEFRTGSAYALPFEKDSIDAVTCFLMLHHLEDIKFALFEIKRVLKKGGSLTA 196



>gb:AE008732_242505 Salmonella typhimurium LT2, section 40 of 220 of
           the complete genome.>gb:AE006468_999587 Salmonella
           typhimurium LT2, complete genome.
          Length = 251

 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 36/106 (33%), Positives = 53/106 (50%)
 Frame = +3

Query: 615 NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADI 794
           +++DA CG G  SR + + G  S V ALD S  MLQQ  +  +Q  +        + ADI
Sbjct: 45  SVLDAGCGPGRMSRYWRERG--SEVTALDLSLPMLQQARD--RQAAHH------YLLADI 94

Query: 795 SRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATT 932
             +P  +   D   +  A+        A++E+ RV+RPGGV   TT
Sbjct: 95  EAIPHDAEVFDLAWSNLAVQWCGDLRDALSELYRVVRPGGVVAFTT 140



>gb:CP000031_84677 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 208

 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 38/123 (30%), Positives = 58/123 (47%), Gaps = 2/123 (1%)
 Frame = +3

Query: 561 PEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLV--VALDFSETMLQQCYE 734
           PE +  L   +L    G ++ID  CG G    LF    +  L   V +DFSE ML++   
Sbjct: 32  PENDRAL--SFLDLADGDSLIDIGCGHG--ETLFQADRIVRLSGSVGVDFSEVMLKRARA 87

Query: 735 FIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
             +  +   +  +    AD + LPF         +   ++ WP+P+A +AE  RVLR GG
Sbjct: 88  --RNRDAVWDTRMAFHCADTAALPFPDKRFGKALSVHTIYFWPNPAAHLAEAFRVLRRGG 145

Query: 915 VFV 923
            F+
Sbjct: 146 RFL 148



>gb:CP000026_76749 Salmonella enterica subsp. enterica serovar
           Paratypi A str. ATCC 9150.
          Length = 251

 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 36/106 (33%), Positives = 53/106 (50%)
 Frame = +3

Query: 615 NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADI 794
           +++DA CG G  SR + + G  S V ALD S  MLQQ  +  +Q  +        + ADI
Sbjct: 45  SVLDAGCGPGRMSRYWRERG--SEVTALDLSLPMLQQARD--RQAAHH------YLLADI 94

Query: 795 SRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATT 932
             +P  +   D   +  A+        A++E+ RV+RPGGV   TT
Sbjct: 95  EAIPHDAEVFDLAWSNLAVQWCGDLRDALSELYRVVRPGGVVAFTT 140



>pir|C71246|C71246 hypothetical protein PH0226 - Pyrococcus
           horikoshii>gb:BA000001_648860 Pyrococcus horikoshii OT3
           DNA, complete genome.
          Length = 227

 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 36/117 (30%), Positives = 57/117 (48%), Gaps = 2/117 (1%)
 Frame = +3

Query: 579 LMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENF 758
           L+  Y+K    G ++D +CG G FS L    G    VV +D SE M+++  E+ K  E+ 
Sbjct: 31  LLMKYMKK--RGKVLDLACGVGGFSFLLEDYGFE--VVGVDISEDMIRKAREYAKSRES- 85

Query: 759 PNENIILVRADISRLPFASSSVD-AVHAGAALHCWPSPSAAV-AEISRVLRPGGVFV 923
              N+  +  D  +L F   + D  +   + +H  P     V  E+ RVL+P G F+
Sbjct: 86  ---NVEFIVGDARKLSFEDKTFDYVIFIDSIVHFEPLELNQVFKEVRRVLKPSGKFI 139



>pir|B86925|B86925 conserved hypothetical protein ML0130 [imported]
           - Mycobacterium leprae>gb:MLEPRTN1_145732 Mycobacterium
           leprae strain TN complete genome; segment 1/10.
          Length = 270

 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 32/102 (31%), Positives = 48/102 (47%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
           G  I++ SCG G  +    ++   +    LD +   ++ C    ++    P   +  VR 
Sbjct: 81  GKRILEVSCGHGGGASYLTRALHPASYTGLDLNPAGIKLC----QKRHQLPG--LEFVRG 134

Query: 789 DISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
           D   LPF + S D V    A HC+P     +AE+ RVLRPGG
Sbjct: 135 DAENLPFDNESFDVVINIEASHCYPHFPRFLAEVVRVLRPGG 176



>pir|AB0597|AB0597 biotin synthesis protein BioC [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)>gb:AE016841_346164 Salmonella enterica
           subsp. enterica serovar Typhi Ty2, section 8 of 16 of
           the complete genome.>gb:AL627268_541089 Salmonella
           enterica serovar Typhi (Salmonella typhi) strain CT18,
           complete chromosome; segment 4/20.>gb:AE014613_983496
           Salmonella enterica subsp. enterica serovar Typhi Ty2,
           complete genome.
          Length = 251

 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 36/106 (33%), Positives = 53/106 (50%)
 Frame = +3

Query: 615 NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADI 794
           +++DA CG G  SR + + G  S V ALD S  MLQQ  +  +Q  +        + ADI
Sbjct: 45  SVLDAGCGPGRMSRYWRERG--SEVTALDLSLPMLQQARD--RQAAHH------YLLADI 94

Query: 795 SRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATT 932
             +P  +   D   +  A+        A++E+ RV+RPGGV   TT
Sbjct: 95  EAIPHDAEVFDLAWSNLAVQWCGDLRDALSELYRVVRPGGVVAFTT 140



>gb:CR382132_1665304 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 381

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 43/159 (27%), Positives = 74/159 (46%), Gaps = 6/159 (3%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSLWGGFPGP--EKEFELMQDYLKPVMG----GNIIDASCGSGLFSR 656
           LV+  YE GW  SF     + G    +     + YL   MG      ++D  CG G  +R
Sbjct: 85  LVTDFYEYGWGSSFHFSRYYKGEAFRQATARHEHYLAYKMGIQPGMKVLDVGCGVGGPAR 144

Query: 657 LFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVH 836
             A+    + +V L+ ++  +++   +  + + F  + +  V+ D  ++ F  +S DAV+
Sbjct: 145 EIARF-TGANIVGLNNNDYQVERGTHY-SEVQGF-GDQVTYVKGDFMQMDFPDNSFDAVY 201

Query: 837 AGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY 953
           A  A    P      +EI RVL+PGGVF    +++   Y
Sbjct: 202 AIEATVHAPVLEGVYSEIFRVLKPGGVFGVYEWVMTDEY 240



>gb:BT000750_1635022 Arabidopsis thaliana clone RAFL09-74-F07
           (R19368) putative sterol-C-methyltransferase (At1g20330)
           mRNA, complete cds.
          Length = 361

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 40/154 (25%), Positives = 69/154 (44%), Gaps = 6/154 (3%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSLWGGFPGPEKEF------ELMQDYLKPVMGGNIIDASCGSGLFSR 656
           LV+ +YE GW QSF      PG   +       E+  D ++   G  I+D  CG G   R
Sbjct: 80  LVTDIYEWGWGQSFHFSPSIPGKSHKDATRLHEEMAVDLIQVKPGQKILDVGCGVGGPMR 139

Query: 657 LFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVH 836
             A     + VV +  +E  + +    +  ++   +    +V  +  ++PF  +S D  +
Sbjct: 140 AIASHSRAN-VVGITINEYQVNRAR--LHNKKAGLDALCEVVCGNFLQMPFDDNSFDGAY 196

Query: 837 AGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI 938
           +  A    P      AEI RVL+PG ++V+  ++
Sbjct: 197 SIEATCHAPKLEEVYAEIYRVLKPGSMYVSYEWV 230



>gb:AY128389_1580688 Arabidopsis thaliana 24-sterol
           C-methyltransferase (At1g20330) mRNA, complete
           cds.>gb:BT002093_1635696 Arabidopsis thaliana 24-sterol
           C-methyltransferase (At1g20330) mRNA, complete cds.
          Length = 361

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 40/154 (25%), Positives = 69/154 (44%), Gaps = 6/154 (3%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSLWGGFPGPEKEF------ELMQDYLKPVMGGNIIDASCGSGLFSR 656
           LV+ +YE GW QSF      PG   +       E+  D ++   G  I+D  CG G   R
Sbjct: 80  LVTDIYEWGWGQSFHFSPSIPGKSHKDATRLHEEMAVDLIQVKPGQKILDVGCGVGGPMR 139

Query: 657 LFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVH 836
             A     + VV +  +E  + +    +  ++   +    +V  +  ++PF  +S D  +
Sbjct: 140 AIASHSRAN-VVGITINEYQVNRAR--LHNKKAGLDALCEVVCGNFLQMPFDDNSFDGAY 196

Query: 837 AGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI 938
           +  A    P      AEI RVL+PG ++V+  ++
Sbjct: 197 SIEATCHAPKLEEVYAEIYRVLKPGSMYVSYEWV 230



>gb:ATSTERMET_1554177 A.thaliana mRNA for
           sterol-C-methyltransferase.
          Length = 361

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 40/154 (25%), Positives = 69/154 (44%), Gaps = 6/154 (3%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSLWGGFPGPEKEF------ELMQDYLKPVMGGNIIDASCGSGLFSR 656
           LV+ +YE GW QSF      PG   +       E+  D ++   G  I+D  CG G   R
Sbjct: 80  LVTDIYEWGWGQSFHFSPSIPGKSHKDATRLHEEMAVDLIQVKPGQKILDVGCGVGGPMR 139

Query: 657 LFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVH 836
             A     + VV +  +E  + +    +  ++   +    +V  +  ++PF  +S D  +
Sbjct: 140 AIASHSRAN-VVGITINEYQVNRAR--LHNKKAGLDALCEVVCGNFLQMPFDDNSFDGAY 196

Query: 837 AGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI 938
           +  A    P      AEI RVL+PG ++V+  ++
Sbjct: 197 SIEATCHAPKLEEVYAEIYRVLKPGSMYVSYEWV 230



>gb:BA000045_742117 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 274

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 39/114 (34%), Positives = 50/114 (43%), Gaps = 1/114 (0%)
 Frame = +3

Query: 588 DYLKPVMGGNIIDASCGSGLFSRLFA-KSGLFSLVVALDFSETMLQQCYEFIKQEENFPN 764
           D L+   G  +++  CG G  +   A + G    VVALD S+ ML        Q     N
Sbjct: 42  DLLQLGEGDRVLEVGCGGGEDAIALADRVGATGRVVALDSSQEMLA----LANQHAAGLN 97

Query: 765 ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA 926
             +  V AD   LPFA  S  A      L     P  AVAE++RV+  GG  VA
Sbjct: 98  LPVQFVLADAQNLPFADESFQAARVDRTLQHIREPRRAVAEMARVVAAGGRVVA 151



>gb:AE016755_324306 Escherichia coli CFT073 section 1 of 18 of the
           complete genome.>gb:AE014075_954890 Escherichia coli
           CFT073 complete genome.
          Length = 256

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 32/111 (28%), Positives = 56/111 (50%)
 Frame = +3

Query: 615 NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADI 794
           +++D  CG+G  S + A++   S VVA D S  ML    +  +  +    +NI   +  +
Sbjct: 47  SVLDMGCGAGHASFVAAQN--VSTVVAYDLSAHMLDVVAQAAEARQL---KNITTRQGYV 101

Query: 795 SRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG 947
             LPFA ++ D V +  + H W    AA+ E++R+L+ GG  +    +  G
Sbjct: 102 ESLPFADNAFDIVISRYSAHHWHDVGAALREVNRILKLGGKLIVMDVMSPG 152



>gb:AE011102_269191 Methanosarcina acetivorans str. C2A, section 447
           of 534 of the complete genome.>gb:AE010299_909750
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 251

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 39/125 (31%), Positives = 58/125 (46%), Gaps = 2/125 (1%)
 Frame = +3

Query: 546 GGFPGPEKEFELMQDYLKPVMGG--NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETML 719
           G +   ++E E  +  L+  +     I+D   G+G  S + A  G    VV +D SE M+
Sbjct: 24  GHYTASKEEEEAWKGLLRSKLDDAEKILDIGSGTGFLSLMLADMGYE--VVGIDLSEEMI 81

Query: 720 QQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRV 899
            +     K+       +I   + D  +L F ++S DA+   A L   P P  AV E  RV
Sbjct: 82  ARASAKAKER----GLSIDFHQDDAEQLGFENNSFDAIVNRAVLWTLPHPDIAVREWMRV 137

Query: 900 LRPGG 914
           LRPGG
Sbjct: 138 LRPGG 142



>gb:AE010901_267486 Methanosarcina acetivorans str. C2A, section 246
            of 534 of the complete genome.>gb:AE010299_908045
            Methanosarcina acetivorans str. C2A, complete genome.
          Length = 250

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 37/129 (28%), Positives = 55/129 (42%)
 Frame = +3

Query: 615  NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADI 794
            N++D  CG+G  SR+ A+ G    V  +D SE ML          ++  + +I   R D 
Sbjct: 54   NVLDVGCGTGEMSRILAEMG--HKVTGIDLSEKMLTVA-------KSKASGSIEFRRGDA 104

Query: 795  SRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVR 974
               PF     DAV     L   P+P  A+     VL+ GG  V    ++DGI+    F  
Sbjct: 105  ENPPFDEGKFDAVVTRHVLWTLPNPEKALKSWRNVLKSGGRVV----VLDGIWDNGSFET 160

Query: 975  PLRENFAQI 1001
             +R     +
Sbjct: 161  RMRRKIGNL 169



>gb:CR555306_109223 Azoarcus sp. EbN1 complete genome.
          Length = 205

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 30/109 (27%), Positives = 52/109 (47%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
           G  +++   G+GL  R + +   ++ V  +D S  ML +    +++ +     N+ L+  
Sbjct: 41  GEEVLEVGVGTGLSLRHYPR---YARVTGIDLSPHMLARASLQVQRHDL---RNVALMAM 94

Query: 789 DISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTY 935
           D+ RL F  +S D V A       P P+  + E+ RV RPGG  V   +
Sbjct: 95  DVQRLSFPDASFDKVSALYVASVVPDPAVMMQELERVCRPGGEVVVVNH 143



>gb:AB091437_12253 Burkholderia multivorans genes for putative
           methyltransferase, putative DNA-binding protein,
           argininosuccinate lyase, hypothetical protein, partial
           and complete cds.
          Length = 207

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 33/115 (28%), Positives = 55/115 (47%)
 Frame = +3

Query: 570 EFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQE 749
           + + + D ++      ++D  CG+G  S  FA +     VVA D +  ML       ++ 
Sbjct: 29  DLQTLADTVRATPDAAVLDLGCGAGHAS--FAVAPHVREVVAYDLAAPMLATVDAAARER 86

Query: 750 ENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
                 N+   +    RLPF +++ D V +  + H W    AA+AE+ RVL+PGG
Sbjct: 87  RL---ANVRTQQGPAERLPFDAATFDWVVSRMSAHHWHDVRAALAEVRRVLKPGG 138



>pir|G75440|G75440 conserved hypothetical protein - Deinococcus
           radiodurans  (strain R1)>gb:AE001958_41356 Deinococcus
           radiodurans R1 section 95 of 229 of the complete
           chromosome 1.>gb:AE000513_882251 Deinococcus radiodurans
           R1 complete chromosome 1.
          Length = 251

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 34/104 (32%), Positives = 52/104 (50%)
 Frame = +3

Query: 603 VMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILV 782
           ++ G + D   G+GLF+RL  + G  + V+A++ +  M +Q    +  E       +   
Sbjct: 35  LLRGQVADLGAGTGLFTRLLLQRG--AQVIAVEPNPEMREQLLRALAAEVTRGQLRVQSG 92

Query: 783 RADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
            A+ + LP   SSVD + A  A H W  P+    E  RVLRPGG
Sbjct: 93  TAEATGLP--GSSVDLLTAAQAAH-WFDPAPTRREFQRVLRPGG 133



>pir|D89009|D89009 protein R08E5.3 [imported] - Caenorhabditis
           elegans>gb:U97004_1407017 Caenorhabditis elegans cosmid
           R08E5, complete sequence.
          Length = 365

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 33/105 (31%), Positives = 47/105 (44%), Gaps = 1/105 (0%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
           G  ++D  CG G  S L A+    S  V LD  E  ++Q  +  K +      N+  +  
Sbjct: 176 GVRVLDVGCGGGFHSSLLAEQYPKSHFVGLDIGEDAIRQAKQR-KTKSGAAFNNLEFIEC 234

Query: 789 DISRLP-FASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVF 920
           D  ++P   + S D V    A H    P   V EI RVL+P G+F
Sbjct: 235 DAGKMPEIWTDSFDLVLIFDACHDQRRPDLCVQEIHRVLKPSGMF 279



>pir|C83941|C83941 hypothetical protein BH2331 [imported] - Bacillus
           halodurans (strain C-125)>gb:BA000004_656277 Bacillus
           halodurans C-125 DNA, complete genome.
          Length = 265

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 31/99 (31%), Positives = 49/99 (49%)
 Frame = +3

Query: 618 IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
           ++D + G G  +  FA       VVA D +E +L+    FI   E   ++ +  V+ D  
Sbjct: 46  VLDVATGGGHVANAFAP--FVKKVVAFDLTEDILKVARAFI---EGNGHQQVEYVQGDAE 100

Query: 798 RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
           +LPF       V    A H +P+P++ V+E  RVL+ GG
Sbjct: 101 QLPFTDERFHIVTCRIAAHHFPNPASFVSEAYRVLKKGG 139



>pir|C75569|C75569 probable methyltransferase - Deinococcus
           radiodurans (strain R1)>gb:AE001866_40316 Deinococcus
           radiodurans R1 section 3 of 229 of the complete
           chromosome 1.>gb:AE000513_881211 Deinococcus radiodurans
           R1 complete chromosome 1.
          Length = 269

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 33/108 (30%), Positives = 51/108 (47%)
 Frame = +3

Query: 612 GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRAD 791
           G ++D + G+G  +   A     + V+  D +  M++Q      ++      N+  V A+
Sbjct: 45  GRVLDVATGTGTVALTLAPK--VAEVMGTDIAPAMIEQA-----RQRAAGRSNVQFVLAE 97

Query: 792 ISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTY 935
            + L FA  S D V  GA L   P   AA+ E  RVLRPGG  V + +
Sbjct: 98  ATALTFADQSFDVVVCGAGLFFVPDMVAALREWRRVLRPGGEVVFSAF 145



>pir|H70323|H70323 hypothetical protein aq_262 - Aquifex
            aeolicus>gb:AE000681_25971 Aquifex aeolicus VF5 section
            13 of 109 of the complete genome.>gb:AE000657_976502
            Aquifex aeolicus VF5 complete genome.
          Length = 189

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 45/165 (27%), Positives = 69/165 (41%), Gaps = 4/165 (2%)
 Frame = +3

Query: 543  WGGFPGPEK-EFELMQDYLKPVMGGNI---IDASCGSGLFSRLFAKSGLFSLVVALDFSE 710
            W     PE+ E++ ++ +LK V        +D  CG G F+   AK      V A+D  E
Sbjct: 10   WEVLLNPERSEWQSVEVFLKAVNPSENEVWVDLGCGPGYFTLPLAKR--VKKVYAVDLEE 67

Query: 711  TMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEI 890
             ML+ C E   +EE    ENI  V+ +  R+P      D V     +H    P   ++E+
Sbjct: 68   KMLEVC-EMRAREEGI--ENIEFVKCEEDRIPLPDEIADGVLMANLIHELIKPKEFLSEV 124

Query: 891  SRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLD 1025
             R+ +P    V    ++D     +P   PL E   +     I  D
Sbjct: 125  KRISKPAAKIV----VIDWHPLPSPAGPPLEERIPKEKAIEIMED 165



>pir|S63686|S63686 sterol 24-C-methyltransferase (EC 2.1.1.41) -
           Arabidopsis thaliana>gb:AE005172_890989 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AY046042_1561532 Arabidopsis thaliana
           putative sterol-C-methyltransferase (At1g20330) mRNA,
           complete cds.>gb:AY113961_1578372 Arabidopsis thaliana
           putative sterol-C-methyltransferase (At1g20330) mRNA,
           complete cds.>gb:F14O10_1677481 Sequence of BAC F14O10
           from Arabidopsis thaliana chromosome 1, complete
           sequence.>gb:AF332417_1787229 Arabidopsis thaliana
           putative sterol-C-methyltransferase (At1g20330) mRNA,
           complete cds.
          Length = 361

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 40/154 (25%), Positives = 69/154 (44%), Gaps = 6/154 (3%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSLWGGFPGPEKEF------ELMQDYLKPVMGGNIIDASCGSGLFSR 656
           LV+ +YE GW QSF      PG   +       E+  D ++   G  I+D  CG G   R
Sbjct: 80  LVTDIYEWGWGQSFHFSPSIPGKSHKDATRLHEEMAVDLIQVKPGQKILDVGCGVGGPMR 139

Query: 657 LFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVH 836
             A     + VV +  +E  + +    +  ++   +    +V  +  ++PF  +S D  +
Sbjct: 140 AIASHSRAN-VVGITINEYQVNRAR--LHNKKAGLDALCEVVCGNFLQMPFDDNSFDGAY 196

Query: 837 AGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI 938
           +  A    P      AEI RVL+PG ++V+  ++
Sbjct: 197 SIEATCHAPKLEEVYAEIYRVLKPGSMYVSYEWV 230



>gb:AP006618_557180 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 177

 Score = 48.1 bits (113), Expect = 4e-04
 Identities = 31/105 (29%), Positives = 48/105 (45%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
           G  ++D   G G      A+     ++   D S  M++            P   + +  A
Sbjct: 37  GARLLDVGTGPGRLLARIARRRPDLVLAGADLSPHMIELA------TRRAPGARLAV--A 88

Query: 789 DISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
           D++ LPF   S+D V +  ++H WP   AA AE++RVL PGG  V
Sbjct: 89  DVADLPFPDGSLDYVVSTLSMHEWPDLPAAAAELARVLAPGGRLV 133



>gb:AE017355_462636 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 258

 Score = 48.1 bits (113), Expect = 4e-04
 Identities = 30/107 (28%), Positives = 50/107 (46%)
 Frame = +3

Query: 603 VMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILV 782
           +    I+D  CG G++++  A  G  S VV +DFS+ +LQ       +E      NI  +
Sbjct: 33  IQNKRIVDIGCGGGIYTKELALMGAKS-VVGIDFSKEILQAA-----KENCSGFSNISFI 86

Query: 783 RADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
             D    P+ + + D V + A +H        + E SR+L+  GV +
Sbjct: 87  HGDAHSTPYPNDTFDIVISRAVIHHLQDIPTFLREASRILKKNGVLI 133



>gb:AE011062_268832 Methanosarcina acetivorans str. C2A, section 407
           of 534 of the complete genome.>gb:AE010299_909391
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 241

 Score = 48.1 bits (113), Expect = 4e-04
 Identities = 35/115 (30%), Positives = 62/115 (53%), Gaps = 1/115 (0%)
 Frame = +3

Query: 582 MQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFP 761
           +++ L  V G +++DA CG G FS   A+ G  ++V ++D S+ ML      I + ++F 
Sbjct: 35  VKELLGDVAGKHVLDAGCGDGFFSFELAQKG--AIVTSVDNSDVMLN-----IAKRKHF- 86

Query: 762 NENIILVRADISR-LPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
           + N+   + D++R L F +   D V A   L   P   + + E++RVL+  G F+
Sbjct: 87  HSNLQYHKMDLTRKLTFENELFDIVVANMLLMDIPEIDSFIHEVARVLKKPGNFI 141



>gb:CR543861_102759 Acinetobacter sp. ADP1 complete genome.
          Length = 254

 Score = 48.1 bits (113), Expect = 4e-04
 Identities = 34/115 (29%), Positives = 54/115 (46%)
 Frame = +3

Query: 570 EFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQE 749
           EFE MQ +++     +++D  CG G  S   A       V A D +  M+Q   E  KQ+
Sbjct: 30  EFEKMQGFIQKHQLKHVLDLGCGGGHVSYQIAPFA--EQVTAYDLTAEMVQLVVEQAKQK 87

Query: 750 ENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
           +     NI+  +    +L F     D V +  + H W +   A++EI RV++P G
Sbjct: 88  KL---NNIVGQQGAAEQLEFEDDHFDGVISRYSAHHWQNIRQAMSEIFRVVKPSG 139



>gb:AB088119_11472 Streptomyces sp. TP-A0274 staurosporine
           biosynthetic gene cluster (staR, staB, staA, staN, staG,
           staO, staD, staP, staMA, staJ, staK, staI, staE, staMB),
           complete cds.
          Length = 280

 Score = 48.1 bits (113), Expect = 4e-04
 Identities = 40/134 (29%), Positives = 57/134 (42%), Gaps = 9/134 (6%)
 Frame = +3

Query: 555 PGPEKEFELMQDYLKPVM--------GGNIIDASCG-SGLFSRLFAKSGLFSLVVALDFS 707
           PG E   E   D L  V           +++D  CG  G   R+ A++G  + V  +  S
Sbjct: 43  PGSEATIEEAMDRLTDVFIERLNAYATSHVLDLGCGVGGPGLRVVARTG--ARVTGISIS 100

Query: 708 ETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAE 887
           E  ++         E    +  +    D  +LPFA +S DAV A  ++   P       E
Sbjct: 101 EEQIRTANRLAA--EAGVADRAVFQHGDAMKLPFADASFDAVMALESICHMPDRQQVFTE 158

Query: 888 ISRVLRPGGVFVAT 929
           +SRVLRPGG  V T
Sbjct: 159 VSRVLRPGGRIVLT 172



>pir|G84010|G84010 hypothetical protein BH2887 [imported] - Bacillus
           halodurans (strain C-125)>gb:BA000004_656833 Bacillus
           halodurans C-125 DNA, complete genome.
          Length = 261

 Score = 48.1 bits (113), Expect = 4e-04
 Identities = 36/112 (32%), Positives = 57/112 (50%)
 Frame = +3

Query: 591 YLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNEN 770
           +L P  G  ++D  CG+G  +    + G  S V+ +D SE+M++Q       +  FP+ +
Sbjct: 35  WLAPKEGECVLDLGCGTGDLTEQIHQLG--SRVIGVDVSESMIEQA------KGKFPHLD 86

Query: 771 IILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA 926
             +  A+ + L F S   DA+ + A LH       A+  I R L+PGG FVA
Sbjct: 87  FQV--AEATDLSF-SEKFDAIFSNAVLHWIKDAEEALTVIYRSLKPGGRFVA 135



>pir|AB1903|AB1903 hypothetical protein all0772 [imported] - Nostoc
            sp. (strain PCC 7120)>gb:BA000019_681763 Nostoc sp. PCC
            7120 DNA, complete genome.
          Length = 205

 Score = 48.1 bits (113), Expect = 4e-04
 Identities = 44/151 (29%), Positives = 60/151 (39%)
 Frame = +3

Query: 615  NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADI 794
            NI+D  CG+G      A          LD S  ML+Q      +  N  +  +I +    
Sbjct: 48   NILDLGCGTGRLLERLANKFPELRGTGLDLSSNMLRQA-----RLSNRHHPRLIFLEGKA 102

Query: 795  SRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVR 974
              LPF     DAV    +   +  P   + E+SRVL PGG F    Y+VD    FT    
Sbjct: 103  ESLPFGDGQFDAVFNTISFLHYREPEKVLQEVSRVLSPGGRF----YLVD----FTTTRE 154

Query: 975  PLRENFAQISGSHIFLDEKELEDLCTTCGLV 1067
             L E     S    F    + E L ++ GL+
Sbjct: 155  KLPEILPISSQGIRFYSPHQREVLGSSTGLL 185



>sp|O06898|BIOC_ERWHE Biotin synthesis protein
           bioC.>gb:EHU51207_135537 Erwinia herbicola bioC gene,
           complete cds.
          Length = 251

 Score = 48.1 bits (113), Expect = 4e-04
 Identities = 34/106 (32%), Positives = 48/106 (45%)
 Frame = +3

Query: 615 NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADI 794
           +++DA CG G  SR +  +G  + V ALD S  ML+Q       +          V ADI
Sbjct: 45  SVLDAGCGPGSMSRYWRDAG--AEVTALDLSLPMLRQAQSQQAAQH--------YVAADI 94

Query: 795 SRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATT 932
             LP A +  D   +  A+        A+  + RV+RPGG    TT
Sbjct: 95  EALPLADARFDLAWSNLAVQWCNDLGQALKSLHRVVRPGGAVAFTT 140



>gb:CP000001_853136 Bacillus cereus ZK, complete genome.
          Length = 238

 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 35/138 (25%), Positives = 65/138 (47%)
 Frame = +3

Query: 579 LMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENF 758
           +M+   K + G +I+DA C +G ++  F + G  + V A+D S  M++   E    +  F
Sbjct: 38  MMEIIPKNLDGKSILDAGCAAGWYTSQFIERG--ANVTAIDVSSEMVKAAKERTGDKATF 95

Query: 759 PNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI 938
              ++  +      LPF  ++ D + +   LH   + +    E  RVL+PGG F+ + + 
Sbjct: 96  LCHDLQEI------LPFEDNTFDVIVSSLTLHYLENWNQVFQEFRRVLKPGGEFIYSIH- 148

Query: 939 VDGIYSFTPFVRPLRENF 992
               + F  F +   EN+
Sbjct: 149 ----HPFMDFTKFTCENY 162



>gb:BA000030_703620 Streptomyces avermitilis MA-4680 genomic DNA,
            complete genome.
          Length = 244

 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 39/156 (25%), Positives = 71/156 (45%), Gaps = 4/156 (2%)
 Frame = +3

Query: 549  GFPGPEKEFELMQDYLKPVMGG--NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQ 722
            G P   ++  ++   L P   G   ++D  CG G  +   A       +V +D+S+  L+
Sbjct: 25   GTPRSLRQARMLAAALGPATAGAKTVLDIGCGDGTAAATAAPFLAGHRLVGVDWSQDALR 84

Query: 723  QCYEFIKQEENFPNENIILVRADISR--LPFASSSVDAVHAGAALHCWPSPSAAVAEISR 896
            + +  +             VR +++   LPFAS++ DAV     +     P  A+ EI R
Sbjct: 85   RAHTRLPYA----------VRGELTDGGLPFASATADAVLFSEVIEHLVDPDGALDEIRR 134

Query: 897  VLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQIS 1004
            VLRPGG  + +T  +   Y+    +  ++  F+++S
Sbjct: 135  VLRPGGHLMLSTPNLAAWYNRALLLAGVQPVFSEVS 170



>gb:AP006627_565746 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 261

 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 37/113 (32%), Positives = 56/113 (49%)
 Frame = +3

Query: 588 DYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNE 767
           + L+P     I+D   G+G  +   AK G  ++V  +D S  M+       K    +P+ 
Sbjct: 32  ELLQPTKKEAILDLGSGTGDLANELAKLG--AVVTGVDQSSNMVA------KARSKYPH- 82

Query: 768 NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA 926
            ++   AD + LPF + + DAV + A LH      AA+  I R L+PGG FVA
Sbjct: 83  -LLFDMADATNLPF-TETFDAVLSNAVLHWVLDAEAALKSIWRALKPGGRFVA 133



>gb:AE017234_412780 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 8 of 16 of the complete
           genome.>gb:AE016958_1056184 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 212

 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 30/100 (30%), Positives = 49/100 (49%)
 Frame = +3

Query: 618 IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
           I D +CG+G+ S    +      +  +D S+ ML Q            ++ +  +RA   
Sbjct: 53  IADIACGTGILSERIQRELNPDEIYGVDMSDGMLNQA--------RAKSDRVQWLRAPAE 104

Query: 798 RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGV 917
           +LPF   ++DA+   +A H +  P AA+ E  RVL PGG+
Sbjct: 105 QLPFDDGALDAIVTTSAFHFFDQP-AALREFHRVLAPGGL 143



>gb:AE017222_405235 Thermus thermophilus HB27 plasmid pTT27,
           complete sequence.
          Length = 250

 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 58/214 (27%), Positives = 85/214 (39%), Gaps = 4/214 (1%)
 Frame = +3

Query: 285 LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA- 461
           LLACP C       G PG               C + +      +DL      +A+ E  
Sbjct: 26  LLACPFCRGPLLGEGCPG---------------CGRVFPRKGGFLDL------RAFRERP 64

Query: 462 -LAASTELFRLPLVSFLYERGWRQSFS--LWGGFPGPEKEFELMQDYLKPVMGGNIIDAS 632
            LA +    RLP V+ LY+  WR   +  L GG      E  L++++L P  GG  +D  
Sbjct: 65  HLALAN---RLPPVAALYDL-WRTRSTGLLSGGRLDLAGELALLREWLLPT-GGPFLDVG 119

Query: 633 CGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFA 812
            G+G++     +      +V +D S   L+        +   P   ++   A   RLPF 
Sbjct: 120 TGTGVYREALGEG-----MVGVDPSPAFLEVA------QRRRPGAYLL---AHGERLPFR 165

Query: 813 SSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
             +   V  G   + +  P  A  E  RVLRPGG
Sbjct: 166 EGAFSGVAIGPTWNEFLDPEGAAREARRVLRPGG 199



>gb:CR555306_106340 Azoarcus sp. EbN1 complete genome.
          Length = 302

 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 40/137 (29%), Positives = 61/137 (44%), Gaps = 6/137 (4%)
 Frame = +3

Query: 609  GGNIIDASCGSGLFSRLFAKSGL-FSLVVALDFSETMLQQCYEFIKQEENFP-----NEN 770
            G  ++D + G GL +R  A+       V+A D +E ML +       E            
Sbjct: 49   GQQVLDLASGPGLLARAAARQVQPGGWVLASDIAEEMLAEGARRTLGETAAAALPAGTPA 108

Query: 771  IILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGI 950
            +    AD  +L    +S D V AG AL  +P P  A+ E+ RVLRPGG    +T+   G 
Sbjct: 109  LSFAAADAEQLCLPDASFDCVLAGLALFMFPHPDRALIEMHRVLRPGGRVALSTW---GA 165

Query: 951  YSFTPFVRPLRENFAQI 1001
                P +R  ++  A++
Sbjct: 166  RDDVPLIRCAQDCIARL 182



>pir|E75511|E75511 conserved hypothetical protein - Deinococcus
           radiodurans  (strain R1)>gb:AE001909_40781 Deinococcus
           radiodurans R1 section 46 of 229 of the complete
           chromosome 1.>gb:AE000513_881676 Deinococcus radiodurans
           R1 complete chromosome 1.
          Length = 254

 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 39/117 (33%), Positives = 57/117 (48%), Gaps = 1/117 (0%)
 Frame = +3

Query: 576 ELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEEN 755
           +L  ++L+P  G  I+D  CGSG  +   A+SG  + VV +D S  M+         + +
Sbjct: 24  DLAAEWLRPQPGERILDLGCGSGELTARIAQSG--AQVVGVDASPAMIAAA------QSS 75

Query: 756 FPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAV-AEISRVLRPGGVFV 923
           FP   +     D   L F  S  +AV + AALH W  P   V   ++  L+PGG FV
Sbjct: 76  FP--AVPFEVQDAHALTF-GSEFEAVFSNAALH-WMKPLPPVFGRVAAALKPGGRFV 128



>sp|P71673|YE05_MYCTU Hypothetical protein Rv1405c/MT1449/Mb1440c
           precursor.>pir|B70901|B70901 hypothetical protein
           Rv1405c - Mycobacterium tuberculosis  (strain
           H37RV)>gb:AE000516_21487 Mycobacterium tuberculosis
           CDC1551, complete genome.>gb:BX248338_758796
           Mycobacterium bovis subsp. bovis AF2122/97 complete
           genome; segment 5/14.>gb:BX842576_819469 Mycobacterium
           tuberculosis H37Rv complete genome; segment 5/13.
          Length = 274

 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 35/126 (27%), Positives = 56/126 (44%), Gaps = 1/126 (0%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
           G  ++D + GSG  S   AK+G  + V++ D +  +LQ+      Q+       +    A
Sbjct: 50  GVRVLDVAAGSGNISLPAAKTG--ATVISTDLTPELLQRSQARAAQQ----GLTLQYQEA 103

Query: 789 DISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYS-FTP 965
           +   LPFA    D V +   +   P   AA  E+ RV RPGG     ++  +G +     
Sbjct: 104 NAQALPFADDEFDTVISAIGVMFAPDHQAAADELVRVCRPGGTIGVISWTCEGFFGRMLA 163

Query: 966 FVRPLR 983
            +RP R
Sbjct: 164 TIRPYR 169



>sp|O86169|UBIE_BACST Menaquinone biosynthesis methyltransferase
           ubiE (EC 2.1.1.-).>pir|T48892|T48892
           2-heptaprenyl-1,4-naphthoquinone methyltransferase
           [validated] - Bacillus
           stearothermophilus>gb:D87054_120943 Bacillus
           stearothermophilus gene for
           2-heptaprenyl-1,4-naphthoquinone methyltransferase,
           complete cds.
          Length = 234

 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 33/106 (31%), Positives = 51/106 (48%), Gaps = 1/106 (0%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKS-GLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVR 785
           G   +D  CG+  ++   A++ G    V  LDFSE ML+   + +K        N+ L+ 
Sbjct: 48  GKKALDVCCGTADWTIALAEAVGPEGKVYGLDFSENMLKVGEQKVKARGL---HNVKLIH 104

Query: 786 ADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
            +  +LPF  +S D V  G  L   P     + E+ RV +PGG+ V
Sbjct: 105 GNAMQLPFPDNSFDYVTIGFGLRNVPDYMTVLKEMHRVTKPGGITV 150



>gb:AF494289_1805328 Arabidopsis thaliana cephalopod (CPH) mRNA,
           complete cds.
          Length = 336

 Score = 47.4 bits (111), Expect = 8e-04
 Identities = 45/152 (29%), Positives = 68/152 (44%), Gaps = 8/152 (5%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSL---WGGFPGPE-----KEFELMQDYLKPVMGGNIIDASCGSGLF 650
           L +  YE GW +SF     W G    E     + F  +Q  ++P  G  ++D  CG G  
Sbjct: 51  LATSFYEYGWGESFHFAQRWKGESLRESIKRHEHFLALQLGIQP--GQKVLDVGCGIGGP 108

Query: 651 SRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDA 830
            R  A+    S V  L+ +E  + +  E  +      ++    V+AD  ++PF  ++ DA
Sbjct: 109 LREIARFSN-SAVTGLNNNEYQITRGKELNRLAG--VDKTCNFVKADFMKMPFPENNFDA 165

Query: 831 VHAGAALHCWPSPSAAVAEISRVLRPGGVFVA 926
           V+A  A    P       EI RVL+PG  F A
Sbjct: 166 VYAIEATCHAPDAYGCYKEIYRVLKPGQCFAA 197



>gb:CP000001_852525 Bacillus cereus ZK, complete genome.
          Length = 236

 Score = 47.4 bits (111), Expect = 8e-04
 Identities = 29/99 (29%), Positives = 50/99 (50%)
 Frame = +3

Query: 618 IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
           ++D  CG G  +   +++G  +  V +D SE M+Q      K +E     ++  ++ D+S
Sbjct: 51  VLDVGCGDGYGTYKLSRTGYKA--VGVDISEVMIQ------KGKERGEGPDLSFIKGDLS 102

Query: 798 RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
            LPF +   +A+ A  +L     P  A+ EI RVL+  G
Sbjct: 103 SLPFENEQFEAIMAINSLEWTEEPLRALNEIKRVLKSDG 141



>gb:BX950851_840891 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 264

 Score = 47.4 bits (111), Expect = 8e-04
 Identities = 43/142 (30%), Positives = 65/142 (45%), Gaps = 7/142 (4%)
 Frame = +3

Query: 522 WRQSFSLW-----GGFPGPEKEFEL--MQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLF 680
           W Q+ + W      G+      F L     +L  +   N+ID  CG G  +R FA+ G  
Sbjct: 13  WNQNANQWTSDVRNGYDVYRDFFTLPAFLQFLPTMADLNVIDFGCGEGSNTRHFAQMG-- 70

Query: 681 SLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCW 860
           + VV +D S  +++   +  + +       I+   +D     F +SS DAV +  AL   
Sbjct: 71  AKVVGIDISNGLIEHARQAERVDPVGITYKIVSYSSDTG---FPASSFDAVVSTMALMDG 127

Query: 861 PSPSAAVAEISRVLRPGGVFVA 926
           P    A+ E  R+LRPGG FVA
Sbjct: 128 PDLQGAMHEAYRLLRPGG-FVA 148



>gb:AP008227_579520 Thermus thermophilus HB8 plasmid pTT27 DNA,
           complete sequence.
          Length = 250

 Score = 47.4 bits (111), Expect = 8e-04
 Identities = 58/214 (27%), Positives = 85/214 (39%), Gaps = 4/214 (1%)
 Frame = +3

Query: 285 LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA- 461
           LLACP C       G PG               C + +      +DL      +A+ E  
Sbjct: 26  LLACPFCRGPLLGEGCPG---------------CGRVFPRKGGFLDL------RAFRERP 64

Query: 462 -LAASTELFRLPLVSFLYERGWRQSFS--LWGGFPGPEKEFELMQDYLKPVMGGNIIDAS 632
            LA +    RLP V+ LY+  WR   +  L GG      E  L++++L P  GG  +D  
Sbjct: 65  HLALAN---RLPPVAALYDL-WRAHSTGLLSGGRLDLAGELALLREWLLPT-GGPFLDVG 119

Query: 633 CGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFA 812
            G+G++     +      +V +D S   L+        +   P   ++   A   RLPF 
Sbjct: 120 TGTGVYREALGEG-----MVGVDPSPAFLKVA------QRRRPGAYLL---AHGERLPFR 165

Query: 813 SSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
             +   V  G   + +  P  A  E  RVLRPGG
Sbjct: 166 EGAFSGVAIGPTWNEFLDPEGAAREARRVLRPGG 199



>gb:AP006618_556510 Nocardia farcinica IFM 10152 DNA, complete genome.
          Length = 272

 Score = 47.4 bits (111), Expect = 8e-04
 Identities = 38/148 (25%), Positives = 63/148 (42%), Gaps = 11/148 (7%)
 Frame = +3

Query: 618  IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
            ++D + G G  S   A+    + V A+DFSE M++      + E     +NI     D  
Sbjct: 46   VLDVAAGPGTLSLPAARQ--VAEVAAIDFSEEMVRLLTARARAEGI---DNIRATVGDGQ 100

Query: 798  RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTY-----------IVD 944
            RLPF     DA  +   L  +P       E+ RVLRPGGV V +++           +  
Sbjct: 101  RLPFTDDRFDAAFSMFGLMFFPDRRKGFGEMFRVLRPGGVAVVSSWAPVLESTLMRMVFA 160

Query: 945  GIYSFTPFVRPLRENFAQISGSHIFLDE 1028
             + +  P ++  + N+  +    +F  E
Sbjct: 161  ALRAADPSIQEPQPNYLNLENPEVFATE 188



>gb:AE017355_463242 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 236

 Score = 47.4 bits (111), Expect = 8e-04
 Identities = 29/99 (29%), Positives = 50/99 (50%)
 Frame = +3

Query: 618 IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
           ++D  CG G  +   +++G  +  V +D SE M+Q      K +E     ++  ++ D+S
Sbjct: 51  VLDVGCGDGYGTYKLSRAGYKA--VGVDISEVMIQ------KGKERGEGPDLSFIKGDLS 102

Query: 798 RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
            LPF +   +A+ A  +L     P  A+ EI RVL+  G
Sbjct: 103 SLPFENEQFEAIMAINSLEWTEEPLRALNEIKRVLKSDG 141



>gb:AE017283_431693 Propionibacterium acnes KPA171202, complete
            genome.
          Length = 340

 Score = 47.4 bits (111), Expect = 8e-04
 Identities = 48/178 (26%), Positives = 76/178 (42%), Gaps = 16/178 (8%)
 Frame = +3

Query: 576  ELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEEN 755
            +L+ D ++P  G  I+D + G+G  S  FA  G  + V   D S  ML       KQ + 
Sbjct: 131  DLVVDAVEPEPGQTILDLAAGTGTSSATFAARG--AQVYPTDISTGMLAVG----KQRQ- 183

Query: 756  FPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA--- 926
                ++  V  D + LP+A +S DAV     L     P  A+ E+ RV +PGG  V    
Sbjct: 184  ---PHLHFVAGDATCLPYADNSFDAVTISYGLRNVEDPHQALREMLRVAKPGGRVVICEF 240

Query: 927  ------------TTYIVDGIYSFTPFVRPLRENFAQISGSHI-FLDEKELEDLCTTCG 1061
                        T Y++  I +        R+ +  ++ S + + D+  L D+ T  G
Sbjct: 241  SYPTWAPFRHVYTKYLLAAIPAMARLASSNRQAYDYLAESILTWPDQPHLADMMTETG 298



>gb:AE017225_407348 Bacillus anthracis str. Sterne, complete genome.
          Length = 236

 Score = 47.4 bits (111), Expect = 8e-04
 Identities = 29/99 (29%), Positives = 50/99 (50%)
 Frame = +3

Query: 618 IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
           ++D  CG G  +   +++G  +  V +D SE M+Q      K +E     ++  ++ D+S
Sbjct: 51  VLDVGCGDGYGTYKLSRTGYKA--VGVDLSEVMIQ------KGKERGEGPDLSFIKGDLS 102

Query: 798 RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
            LPF +   +A+ A  +L     P  A+ EI RVL+  G
Sbjct: 103 SLPFENEQFEAIMAINSLEWTEEPLRALNEIKRVLKSDG 141



>gb:AE017030_382233 Bacillus anthracis str. Ames section 7 of 18 of
           the complete genome.>gb:AE017334_452081 Bacillus
           anthracis str. 'Ames Ancestor', complete
           genome.>gb:AE016879_1011938 Bacillus anthracis str. Ames
           complete genome.
          Length = 209

 Score = 47.4 bits (111), Expect = 8e-04
 Identities = 29/99 (29%), Positives = 50/99 (50%)
 Frame = +3

Query: 618 IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
           ++D  CG G  +   +++G  +  V +D SE M+Q      K +E     ++  ++ D+S
Sbjct: 24  VLDVGCGDGYGTYKLSRTGYKA--VGVDLSEVMIQ------KGKERGEGPDLSFIKGDLS 75

Query: 798 RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
            LPF +   +A+ A  +L     P  A+ EI RVL+  G
Sbjct: 76  SLPFENEQFEAIMAINSLEWTEEPLRALNEIKRVLKSDG 114



>gb:AE017004_377025 Bacillus cereus ATCC 14579 section 7 of 18 of
           the complete genome.>gb:AE016877_1017275 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 226

 Score = 47.4 bits (111), Expect = 8e-04
 Identities = 29/99 (29%), Positives = 49/99 (49%)
 Frame = +3

Query: 618 IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
           ++D  CG G  +   + +G  +  V +D SE M+Q      K +E     N+  ++ D+S
Sbjct: 51  VLDVGCGDGYGTYKLSSAGYKA--VGVDLSEVMIQ------KGKERGEGPNLSFIKGDLS 102

Query: 798 RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
            LPF +   +++ A  +L     P  A+ EI RVL+  G
Sbjct: 103 ALPFENEQFESIMAINSLEWTEEPLRALNEIKRVLKKDG 141



>gb:AE012134_279658 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 42 of 460 of the complete
           genome.>gb:AE008922_912940 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 294

 Score = 47.4 bits (111), Expect = 8e-04
 Identities = 44/147 (29%), Positives = 62/147 (42%), Gaps = 2/147 (1%)
 Frame = +3

Query: 564 EKEFELMQ--DYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEF 737
           E E  L++  DYL       ++D   G G  S    K    + V+ALD +  ML+Q  + 
Sbjct: 30  EVETRLLESLDYLGDTAPKVVLDVGAGPGHASATIKKRWPKAQVIALDQALPMLRQARKT 89

Query: 738 IKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGV 917
               + F       V AD   LP A  SVD + +   L       A  A   R LRPGG+
Sbjct: 90  AGWWKPFAQ-----VCADARALPVADGSVDVIFSNLCLQWVEDLPAVFAGFRRALRPGGL 144

Query: 918 FVATTYIVDGIYSFTPFVRPLRENFAQ 998
            + +T+  + +         LRE FAQ
Sbjct: 145 LLCSTFGPETLIE-------LREAFAQ 164



>sp|Q8A005|UBIE_BACTN Menaquinone biosynthesis methyltransferase
           ubiE (EC 2.1.1.-).>gb:AE016944_363582 Bacteroides
           thetaiotaomicron VPI-5482, section 19 of 21 of the
           complete genome.>gb:AE015928_990070 Bacteroides
           thetaiotaomicron VPI-5482, complete genome.
          Length = 245

 Score = 47.4 bits (111), Expect = 8e-04
 Identities = 35/137 (25%), Positives = 60/137 (43%)
 Frame = +3

Query: 513 ERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVV 692
           +R WR+    W                L+P    +I+D + G+G F+ L  +      ++
Sbjct: 44  DRSWRRKAIAW----------------LRPFRPQHIMDVATGTGDFAILACRELNPDELI 87

Query: 693 ALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPS 872
             D SE M+    E +K+E    ++ I   R D + L FA +  DA+     +  +    
Sbjct: 88  GTDISEGMMNVGREKVKKEGL--SDKISFAREDCTSLSFADNRFDAITVAFGIRNFEDLD 145

Query: 873 AAVAEISRVLRPGGVFV 923
             ++E+ RVL+PGG  V
Sbjct: 146 KGLSEMCRVLKPGGHLV 162



>gb:CR382121_1654337 Kluyveromyces lactis strain NRRL Y-1140
           chromosome A of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 371

 Score = 47.0 bits (110), Expect = 0.001
 Identities = 39/162 (24%), Positives = 73/162 (45%), Gaps = 6/162 (3%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSLWGGFPGPEKEFELM--QDYLKPVMGGN----IIDASCGSGLFSR 656
           +V+  YE GW  SF     F G      +   + YL    G      I+D  CG G  +R
Sbjct: 76  VVTDFYEYGWGSSFHFSRFFKGESFSASVARHEHYLAYKAGIKENDLILDVGCGVGGPAR 135

Query: 657 LFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVH 836
             ++    + ++ L+ ++  +Q+   + K++    +  +  V+ D  ++ F  ++ D+V+
Sbjct: 136 TISRFTGCN-IIGLNNNDYQIQKANYYAKRDHL--DSKLSFVKGDFMKMEFDENTFDSVY 192

Query: 837 AGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFT 962
           A  A    P+      EI +VL+PGG F    +++   Y  T
Sbjct: 193 AIEATCHAPTFEGVYGEIYKVLKPGGTFAVYEWVMTDKYDET 234



>gb:BA000035_716239 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 267

 Score = 47.0 bits (110), Expect = 0.001
 Identities = 37/107 (34%), Positives = 51/107 (47%), Gaps = 2/107 (1%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENII-LVR 785
           G NI++  CGS   +R  A     + V   D S  ML+              +N+  LV+
Sbjct: 69  GKNILEIGCGSAPCARWLAHDVPDAFVTGFDISMGMLRHA----------GTDNVAHLVQ 118

Query: 786 ADISRLPFASSSVDAVHAGAALHCWPSPSA-AVAEISRVLRPGGVFV 923
           AD + LPFA  S D V +      +   SA  + EI+RV+RPGG FV
Sbjct: 119 ADATALPFADDSFDVVFSVFGAIPFVEDSAHLMREIARVIRPGGRFV 165



>gb:AY596297_632177 Haloarcula marismortui ATCC 43049 chromosome I,
            complete sequence.
          Length = 264

 Score = 47.0 bits (110), Expect = 0.001
 Identities = 40/150 (26%), Positives = 65/150 (43%), Gaps = 1/150 (0%)
 Frame = +3

Query: 555  PGPEKEFELMQDYLKPVMGGNIIDASCGSGLF-SRLFAKSGLFSLVVALDFSETMLQQCY 731
            P      E ++  L P  G  ++   CG G   + +    G    V  +D S+ ML+   
Sbjct: 22   PAAAARRERVRGLLAPEPGDTVLSIGCGPGFEPAEIGWAVGNEGHVHGIDRSQAMLE--- 78

Query: 732  EFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPG 911
              + +E       + + + D   LP A  SVDA  A        + S+AVAE++RVLRPG
Sbjct: 79   --LARERCASLPQVTVSQGDAGDLPVADESVDAAVAVQVFEYLETVSSAVAELARVLRPG 136

Query: 912  GVFVATTYIVDGIYSFTPFVRPLRENFAQI 1001
            G    +  + D  ++   +  P  E  A++
Sbjct: 137  G----SAVVCDADFASLVWRSPNPERMARV 162



>gb:AP006627_564205 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 235

 Score = 47.0 bits (110), Expect = 0.001
 Identities = 33/106 (31%), Positives = 51/106 (48%), Gaps = 1/106 (0%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKS-GLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVR 785
           G + +D  CG+G ++   +++ G    V+ LDFSE ML    E +   +     NI LV 
Sbjct: 48  GTSALDVCCGTGDWTLALSEAVGEQGSVIGLDFSENMLAVGREKVAAAKR---TNISLVH 104

Query: 786 ADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
            +   LP+  ++ D V  G  L   P     + E+ RV +PGG  V
Sbjct: 105 GNAMALPYDDNTFDYVTIGFGLRNVPDYMQVLQEMCRVAKPGGKIV 150



>gb:AE017271_423406 Bacillus cereus ATCC 10987, section 8 of 18 of
           the complete genome.>gb:AE017194_1061825 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 199

 Score = 47.0 bits (110), Expect = 0.001
 Identities = 29/99 (29%), Positives = 50/99 (50%)
 Frame = +3

Query: 618 IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
           ++D  CG G  +   +++G  +  V +D SE M+Q      K +E     ++  ++ D+S
Sbjct: 24  VLDVGCGDGYGTYQLSRAGYKA--VGVDLSEVMIQ------KGKERGEGPDLSFIKGDLS 75

Query: 798 RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
            LPF +   +A+ A  +L     P  A+ EI RVL+  G
Sbjct: 76  SLPFENEQFEAIMAINSLEWTEEPLRALNEIKRVLKRDG 114



>gb:AE017162_394885 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 2 of 6 of the complete
           genome.>gb:AE017126_1030554 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 233

 Score = 47.0 bits (110), Expect = 0.001
 Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = +3

Query: 591 YLKPVMGGNIIDASCGSGLFSRLFAK-SGLFSLVVALDFSETMLQQCYEFIKQEENFPNE 767
           +LKP  G   ID  CG+G  S   A+    F  V+ +DFS   +   ++   +E   P  
Sbjct: 42  WLKPASGEKWIDLCCGTGDLSLPLARLVRPFGSVIGVDFSRAQINCAHKRSLKEPWLP-- 99

Query: 768 NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPG 911
            I  +  D+ +    SS+ D V     L    SP A + EI R+L+PG
Sbjct: 100 -ISWLNEDVLKAGLPSSTFDGVVMAYGLRNLSSPEAGLKEIHRLLKPG 146



>gb:AE015941_320745 Clostridium tetani E88, section 6 of 10 of the
            complete genome.>gb:AE015927_963534 Clostridium tetani
            E88, complete genome.
          Length = 405

 Score = 47.0 bits (110), Expect = 0.001
 Identities = 35/135 (25%), Positives = 65/135 (48%), Gaps = 2/135 (1%)
 Frame = +3

Query: 618  IIDASCGSGLFSRLFAKSGLFSLVVAL-DFSETMLQQCYE-FIKQEENFPNENIILVRAD 791
            +++  CG G   R+       S  + L DFS+ ML+   +  +KQ+E F  + +     D
Sbjct: 185  VLELGCGDGSLWRINYNYIPKSWDIYLTDFSKGMLEDAKKNLVKQKERFKFQIV-----D 239

Query: 792  ISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV 971
            + ++P+   S D V A   L+   +   A++EI RVL+  GVF A+T   + +      +
Sbjct: 240  VEKIPYEDESFDLVIANHMLYHVENIDRAMSEIKRVLKKDGVFYASTVGKEHMKEMREII 299

Query: 972  RPLRENFAQISGSHI 1016
              + +N  Q+   ++
Sbjct: 300  SKVDKNILQVESFNL 314



>gb:SCU24241_181685 Sorangium cellulosum acyl-CoA dehydrogenase
           (sorE), beta-hydroxybutyryl-CoA dehydrogenase (sorD),
           putative methoxymalonyl-CoA synthase (sorC), reductase
           (sorR), soraphen polyketide synthase A (sorA), soraphen
           polyketide synthase B (sorB), O-methyltransferase
           (sorM), beta-mannanase, and xylanse-arabinofuranosidase
           bifunctional enzyme genes, complete cds; and unknown
           genes.
          Length = 346

 Score = 47.0 bits (110), Expect = 0.001
 Identities = 33/113 (29%), Positives = 49/113 (43%)
 Frame = +3

Query: 618 IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
           I++  C +G      ++    S  V LD S    QQ  +      + P  ++  V+ D  
Sbjct: 129 ILEVGCNTGKGLNFLSRIEGRSTFVGLDLS----QQAVDIANARFSRPG-SLTYVQGDAE 183

Query: 798 RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYS 956
            LPFA    D V    + H +P+   +  E++RVLRPGG F       D  YS
Sbjct: 184 NLPFADGEFDVVINVESSHNYPNLRKSFLEVARVLRPGGFFSHVDVFSDNRYS 236



>gb:SAU421825_172282 Stigmatella aurantiaca ORF8, ORF7, ORF6, ORF5,
           ORF4, ORF3, ORF2, ORF1, stiA gene, stiB gene, stiC gene,
           stiD gene, stiE gene, stiF gene, stiG gene, stiH gene,
           stiJ gene, stiK gene, stiL gene and ORF9.
          Length = 256

 Score = 47.0 bits (110), Expect = 0.001
 Identities = 34/105 (32%), Positives = 49/105 (46%)
 Frame = +3

Query: 618 IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
           ++D  CG GL +  F+K G    V  +D S   +    E  K        NI    +   
Sbjct: 52  VLDVGCGGGLLAEEFSKKGW--KVTGVDQSAPSI----ELAKAHSAKVGLNIDYHVSKAQ 105

Query: 798 RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATT 932
           +LPF   + D V+    L   P+  AAVAE +RVL+ GGV++  T
Sbjct: 106 KLPFEDETFDIVYCCDVLEHIPTYPAAVAESARVLKKGGVYLYET 150



>gb:ECOBIO_128203 E.coli 7,8-diamino-pelargonic acid (bioA), biotin
           synthetase (bioB), 7-keto-8-amino-pelargonic acid
           synthetase (bioF), bioC protein, and dethiobiotin
           synthetase (bioD), complete cds.
          Length = 251

 Score = 47.0 bits (110), Expect = 0.001
 Identities = 34/108 (31%), Positives = 55/108 (50%)
 Frame = +3

Query: 615 NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADI 794
           +++DA CG G  SR + +    + V ALD S  ML Q     +Q++   +     +  DI
Sbjct: 45  HVLDAGCGPGWMSRHWRER--HAQVTALDLSPPMLVQA----RQKDAADH----YLAGDI 94

Query: 795 SRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI 938
             LP A+++ D   +  A+    + S A+ E+ RV+RP GV   TT +
Sbjct: 95  ESLPLATATFDLAWSNLAVQWCGNLSTALRELYRVVRPKGVVAFTTLV 142



>sp|Q92BP0|PRMA_LISIN Ribosomal protein L11 methyltransferase (EC
           2.1.1.-) (L11 Mtase).>pir|AC1621|AC1621 ribosomal
           protein L11 methyltransferase homolog lin1508 [imported]
           - Listeria innocua (strain Clip11262)>gb:AL596168_538853
           Listeria innocua Clip11262 complete genome, segment
           6/12.
          Length = 314

 Score = 47.0 bits (110), Expect = 0.001
 Identities = 41/136 (30%), Positives = 62/136 (45%), Gaps = 3/136 (2%)
 Frame = +3

Query: 546 GGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ 725
           G  P  +     + DYL+P  G  +ID   GSG+ S   AK G  S ++A D  E   + 
Sbjct: 156 GTHPTTQLCIRALSDYLQP--GDELIDVGTGSGVLSIASAKLGAKS-ILATDLDEIATRA 212

Query: 726 CYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGA---ALHCWPSPSAAVAEISR 896
             E I+  +    ENII V+ +        S VD V A      +  +P       ++ +
Sbjct: 213 AEENIRLNKT---ENIITVKQNNLLQDINKSDVDIVVANILAEVILLFPE------DVYK 263

Query: 897 VLRPGGVFVATTYIVD 944
            L+PGG+F+A+  I D
Sbjct: 264 ALKPGGIFIASGIIED 279



>sp|P12999|BIOC_ECOLI Biotin synthesis protein
           bioC.>pir|A64814|BVECBC biotin biosynthesis protein bioC
           - Escherichia coli (strain K-12)>gb:U00096_199853
           Escherichia coli K-12 MG1655 complete
           genome.>gb:A11534_1447347 BioC gene of E.coli with
           primers.>gb:A38246_1448692 Sequence 1 from Patent
           WO9408023.>gb:A93674_1451305 Sequence 1 from Patent
           EP0798384.
          Length = 251

 Score = 47.0 bits (110), Expect = 0.001
 Identities = 34/108 (31%), Positives = 55/108 (50%)
 Frame = +3

Query: 615 NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADI 794
           +++DA CG G  SR + +    + V ALD S  ML Q     +Q++   +     +  DI
Sbjct: 45  HVLDAGCGPGWMSRHWRER--HAQVTALDLSPPMLVQA----RQKDAADH----YLAGDI 94

Query: 795 SRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI 938
             LP A+++ D   +  A+    + S A+ E+ RV+RP GV   TT +
Sbjct: 95  ESLPLATATFDLAWSNLAVQWCGNLSTALRELYRVVRPKGVVAFTTLV 142



>gb:CR380954_1651256 Candida glabrata strain CBS138 chromosome H
           complete sequence.
          Length = 372

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 37/159 (23%), Positives = 72/159 (45%), Gaps = 6/159 (3%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSLWGGFPGPEKEFELMQD-----YLKPVMGGNII-DASCGSGLFSR 656
           +V+  YE GW  SF     + G   +  + +      Y+  +  G+++ D  CG G  +R
Sbjct: 76  VVTDFYEYGWGSSFHFSRFYKGENFQAAMARHEQYLAYMAGIKKGDLVLDVGCGVGGPAR 135

Query: 657 LFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVH 836
             A+    + ++ L+ ++  +Q+   + K+      +++  V+ D   + F  +S D V+
Sbjct: 136 TIARFTGCN-IIGLNNNDYQIQKAKYYAKKYNL--QDHMDFVKGDFMNMEFEPNSFDKVY 192

Query: 837 AGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY 953
           A  A    P       EI +VL+PGG F    +++   Y
Sbjct: 193 AIEATCHAPKLEGVYGEIYKVLKPGGTFAVYEWVMTENY 231



>gb:BA000045_740202 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 226

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 33/103 (32%), Positives = 48/103 (46%), Gaps = 1/103 (0%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKS-GLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVR 785
           G  ++D  CG+G  + L A+  G+   V  +DF+   L Q     ++        +  + 
Sbjct: 46  GDTVLDLCCGTGDLAFLLARRVGVAGTVWGVDFAAAQLAQARRRDREGR------VRWLE 99

Query: 786 ADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
           AD   LPFA  S DAV  G  L       A  A++ RVL+PGG
Sbjct: 100 ADALDLPFADDSFDAVTQGFGLRNVVDIPACFAQLRRVLKPGG 142



>gb:AY138899_591665 Mycobacterium smegmatis glycopeptidolipid locus,
           complete sequence.
          Length = 274

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 30/109 (27%), Positives = 50/109 (45%)
 Frame = +3

Query: 603 VMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILV 782
           V G  +++  CG G  +   A++   +    LD +   +  C    ++  N     +  V
Sbjct: 83  VEGKRVLEVGCGHGGGASYLARTFRPATYTGLDLNSDGINFC----RRRHNIAG--LEFV 136

Query: 783 RADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVAT 929
           + D   LPF   + DAV    + H +P     + E++RVLRPGG F+ T
Sbjct: 137 QGDAQDLPFPDKNFDAVLNVESSHLYPRFDVFLTEVARVLRPGGYFLYT 185



>gb:AP006618_558973 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 242

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 36/111 (32%), Positives = 50/111 (45%), Gaps = 4/111 (3%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETML---QQCYEFIKQEENFP-NENII 776
           G  +ID  CG+G  S    + G  + ++A D +   L   Q  +E +      P   N  
Sbjct: 14  GTRVIDVGCGAGRHSFEAYRRG--ADIIAFDQNADDLAGVQTMFEAMAAAGEAPAGANAR 71

Query: 777 LVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVAT 929
            VR D   LP+  +  D V A   L   P+   A+AE+ RVL PGG  V T
Sbjct: 72  TVRGDALALPYPDNHFDVVIASEILEHIPADDQAIAELVRVLEPGGQLVVT 122



>gb:AE017333_448124 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_857932 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 236

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 33/103 (32%), Positives = 54/103 (52%)
 Frame = +3

Query: 618 IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
           I+DA CG+G  +    +  L   V ALD    M+ +  +  K+E+     +I  VR+ + 
Sbjct: 39  ILDAGCGTGQTAAYLGQ--LLFPVTALDADPVMIDKARQRFKKEQL----SIPAVRSPLE 92

Query: 798 RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVA 926
            +PF S S   V   + L  + +  +A+ EI R+L+PGG+ VA
Sbjct: 93  EMPFQSESFACVLTESVLS-FTNIRSALQEIRRILKPGGMLVA 134



>gb:AE017282_427895 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 275

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 33/106 (31%), Positives = 51/106 (48%)
 Frame = +3

Query: 618 IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
           ++D   G+G FS L   +   +  +ALD +E ML+    F++       + + LV  D  
Sbjct: 60  MLDLGAGTGHFSGLLVAAFPTAECLALDIAEGMLR----FLRSHRPGA-DGMGLVVGDAE 114

Query: 798 RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTY 935
            LP A  SVD + +  A         A++E  RVLRPGG    +T+
Sbjct: 115 ALPLADESVDLIFSNMAFQWCERLDRAISECCRVLRPGGRLAFSTF 160



>gb:AE016824_341444 Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130, chromosome II, complete sequence.
          Length = 338

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 33/103 (32%), Positives = 52/103 (50%), Gaps = 2/103 (1%)
 Frame = +3

Query: 618 IIDASCG-SGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADI 794
           I D  CG  GL   L  KS     V+ +D S  M+++      Q     N ++ L+ + +
Sbjct: 180 IYDLGCGPGGLIPYLLTKS---DQVIGVDSSPKMVEEA-----QVAFAGNSHVSLIHSQL 231

Query: 795 SRLPFASS-SVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVF 920
             +  +++ S DAV A   LH   +P A + EI ++L+PGGVF
Sbjct: 232 ENVASSATWSADAVVASMVLHHLSNPPAVIREIYKILKPGGVF 274



>gb:AE013598_293934 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 294

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 42/147 (28%), Positives = 64/147 (43%), Gaps = 2/147 (1%)
 Frame = +3

Query: 564 EKEFELMQ--DYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEF 737
           E E  L++  DYL   +   ++D   G G  S    K    + V+ALD +  ML+Q  + 
Sbjct: 30  EAEARLLESLDYLGAQVPKVVLDVGAGPGHASGAIKKRWPKAQVIALDQAMPMLRQARKA 89

Query: 738 IKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGV 917
               + F       V AD   LP A  SVD + +   +       A  A + R LRPGG+
Sbjct: 90  AGWWKPFAQ-----VCADARALPVADGSVDVIFSNLCMQWVEDLPAVFAGLRRALRPGGL 144

Query: 918 FVATTYIVDGIYSFTPFVRPLRENFAQ 998
            + +T+  + +         LR+ FAQ
Sbjct: 145 LLCSTFGPETLIE-------LRDAFAQ 164



>gb:AE011788_276501 Xanthomonas axonopodis pv. citri str. 306,
           section 166 of 469 of the complete
           genome.>gb:AE008923_918276 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 331

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 34/119 (28%), Positives = 59/119 (49%), Gaps = 1/119 (0%)
 Frame = +3

Query: 561 PEKEFELMQDYLKPVMG-GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEF 737
           P + +E +     P++  G+++D + G G+ + L A     +  + +D S  ++    E 
Sbjct: 131 PGRTWEALARTALPLLETGDVLDIAAGDGVLAELVAPHA--TRYICIDTSARVVAAASER 188

Query: 738 IKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
           +++  N     + +   D+  LPF  +S D V    AL     P+ AVAE +RVLRPGG
Sbjct: 189 LRKLRN-----VEVREGDMHALPFPDASFDLVVLMHALTYAAKPAQAVAESARVLRPGG 242



>gb:AE011599_274701 Leptospira interrogans serovar lai str. 56601
           chromosome II, section 11 of 34 of the complete
           sequence.>gb:AE010301_1003375 Leptospira interrogans
           serovar lai str. 56601 chromosome II, complete sequence.
          Length = 338

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 33/103 (32%), Positives = 52/103 (50%), Gaps = 2/103 (1%)
 Frame = +3

Query: 618 IIDASCG-SGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADI 794
           I D  CG  GL   L  KS     V+ +D S  M+++      Q     N ++ L+ + +
Sbjct: 180 IYDLGCGPGGLIPYLLTKS---DQVIGVDSSPKMVEEA-----QVAFAGNSHVSLIHSQL 231

Query: 795 SRLPFASS-SVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVF 920
             +  +++ S DAV A   LH   +P A + EI ++L+PGGVF
Sbjct: 232 ENVASSATWSADAVVASMVLHHLSNPPAVIREIYKILKPGGVF 274



>gb:AE005674_69778 Shigella flexneri 2a str. 301, complete
           genome.>gb:AE016978_370186 Shigella flexneri 2a str.
           2457T section 1 of 16 of the complete
           genome.>gb:AE014073_994936 Shigella flexneri 2a str.
           2457T complete genome.
          Length = 206

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 32/105 (30%), Positives = 52/105 (49%)
 Frame = +3

Query: 633 CGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFA 812
           CG+G  S + A++   S VVA D S  ML    +  +  +    +NI   +     LPFA
Sbjct: 3   CGAGHASFVAAQN--VSAVVAYDLSAQMLDVVAQAAEARQL---KNITTRQGYAESLPFA 57

Query: 813 SSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDG 947
            ++ D V +  + H W    AA+ E++R+L+PGG  +    +  G
Sbjct: 58  DNAFDIVISRYSAHHWHDVGAALREVNRILKPGGRMIVMDVMSPG 102



>sp|Q55423|Y829_SYNY3 Putative methyltransferase sll0829 (EC
           2.1.1.-).>pir|S75787|S75787 methyltransferase -
           Synechocystis sp. (strain PCC 6803)>gb:BA000022_689911
           Synechocystis sp. PCC 6803 DNA, complete genome.
          Length = 212

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 38/123 (30%), Positives = 57/123 (46%), Gaps = 2/123 (1%)
 Frame = +3

Query: 558 GPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEF 737
           G E+  +L  + L    G  ++D  CG G  +   A+SG  + VV LD S   L +    
Sbjct: 29  GEERFHQLPLENLAISPGQKVLDLCCGGGQATVYLAQSG--ATVVGLDASPKALGRA--- 83

Query: 738 IKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALH-CWPSP-SAAVAEISRVLRPG 911
              + N P    +   A+   LPF     D VH   ALH   P+   + ++ + RVL+PG
Sbjct: 84  ---KINVPQATYVQGLAE--DLPFGEGEFDLVHTSVALHEMTPAQLQSIISGVHRVLKPG 138

Query: 912 GVF 920
           G+F
Sbjct: 139 GIF 141



>sp|Q8CWG0|UBIE_OCEIH Menaquinone biosynthesis methyltransferase
           ubiE (EC 2.1.1.-).>gb:BA000028_696176 Oceanobacillus
           iheyensis HTE831 DNA, complete genome.
          Length = 238

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 31/106 (29%), Positives = 52/106 (49%), Gaps = 1/106 (0%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKS-GLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVR 785
           G   +D  CG+G +S   +++ G    V+ LDFS+ ML    +   ++++     + LV 
Sbjct: 50  GETALDVCCGTGDWSISLSEAVGQTGKVIGLDFSKNMLSIAKQ---KKQDLQLNQLELVH 106

Query: 786 ADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
            +   LP+  +S D V  G  L   P     + E+ RV++PGG  V
Sbjct: 107 GNAMELPYEENSFDYVTIGFGLRNVPDYMTVLEEMYRVVKPGGKVV 152



>gb:AC091494_1734775 Oryza sativa chromosome 3 BAC OSJNBa0070N04
           genomic sequence, complete sequence.
          Length = 729

 Score = 46.2 bits (108), Expect = 0.002
 Identities = 42/159 (26%), Positives = 65/159 (40%), Gaps = 13/159 (8%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSLWGGFPGPEKEF--------ELMQDYLKPVMGGN----IIDASCG 638
           L S++   GW      +  FP  E EF        E + +    +  G     ++D  C 
Sbjct: 298 LSSYVKGHGWLNRTGDYLMFPPDEWEFKGGSRHYVEAIDEMAPDIDWGKNIRVVLDIGCK 357

Query: 639 SGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASS 818
           S  F     +  + +L + L   +T L Q    +  E   P     +      RLPF S 
Sbjct: 358 SAGFGVALLEKDVITLSLGLTNDQTDLAQ----VALERGIP---ATVGSLGSKRLPFPSG 410

Query: 819 SVDAVHAGAALHCWPSPSAAVA-EISRVLRPGGVFVATT 932
           + DA+H G     W S    +  EI+R+LRPGG F+ ++
Sbjct: 411 AFDAIHCGDCNIPWHSNGGKLLLEINRILRPGGYFIISS 449



>gb:CR382136_1669417 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 377

 Score = 46.2 bits (108), Expect = 0.002
 Identities = 40/159 (25%), Positives = 74/159 (46%), Gaps = 6/159 (3%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSLWGGFPGP--EKEFELMQDYLKPVMGGN----IIDASCGSGLFSR 656
           LV+  YE GW  SF     + G    +     + +L   M  N    ++D  CG G  +R
Sbjct: 80  LVTDFYEYGWGSSFHFSRYYTGEAFRQATARHEHFLAHKMQINENMKVLDVGCGVGGPAR 139

Query: 657 LFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVH 836
              +    S +V L+ ++  +++   + ++ +   ++ +  V+ D  ++ F + S DAV+
Sbjct: 140 EICRFTDCS-IVGLNNNDYQIERANHYARKYKL--DDKLSFVKGDFMQMDFEAESFDAVY 196

Query: 837 AGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY 953
           A  A    P      +EI +VL+PGGVF    +++   Y
Sbjct: 197 AIEATVHAPVLEGVYSEIYKVLKPGGVFGVYEWVMTDKY 235



>gb:BA000040_735254 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 212

 Score = 46.2 bits (108), Expect = 0.002
 Identities = 31/111 (27%), Positives = 53/111 (47%)
 Frame = +3

Query: 606 MGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVR 785
           +GG I+D   G+GL    ++++   + +  +D SE ML++    ++      N  ++ V 
Sbjct: 43  IGGRILDVGVGTGLSLSDYSRT---TKICGVDISEPMLRKAQARVRALR-LSNVEVLSVM 98

Query: 786 ADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI 938
            D   L F  +  DAV A   +   P P   + E  RVL+PGG  +   +I
Sbjct: 99  -DAKNLAFPENFFDAVVAQYVITAVPDPEGTLDEFVRVLKPGGELILVNHI 148



>gb:AP006840_569704 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 251

 Score = 46.2 bits (108), Expect = 0.002
 Identities = 40/138 (28%), Positives = 71/138 (51%), Gaps = 2/138 (1%)
 Frame = +3

Query: 567 KEFELMQDYLKPVMGGNIIDASCGSGLFSRL-FAKSGLFSLVVALDFSETMLQQCYEFIK 743
           +EF + Q + +P  G +I+D +CG+G  + L  A+      V+ +D SE ML+     + 
Sbjct: 45  REF-VAQTHFRP--GDHILDVACGTGDLTLLDAAQVAPDGKVIGVDISEGMLEVGRRRVA 101

Query: 744 QEENFPNENIILVR-ADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVF 920
                P +++I ++  +   LPF  ++ D V  G A+    S    ++EI RVL+PGG F
Sbjct: 102 AS---PYKDLITLQLGNAMDLPFPDNTFDGVTMGWAMRNVASIPRTLSEIYRVLKPGGRF 158

Query: 921 VATTYIVDGIYSFTPFVR 974
           +     ++    F+ F+R
Sbjct: 159 IC----LEASKPFSRFIR 172



>gb:AP006840_569558 Symbiobacterium thermophilum DNA, complete genome.
          Length = 278

 Score = 46.2 bits (108), Expect = 0.002
 Identities = 41/139 (29%), Positives = 60/139 (43%), Gaps = 1/139 (0%)
 Frame = +3

Query: 594  LKPVMGGNIIDASCGSGLFSRLFAKS-GLFSLVVALDFSETMLQQCYEFIKQEENFPNEN 770
            LKP  G  ++D   G+G    L A+  G    V+ +D +  ML +  E  ++   F N  
Sbjct: 91   LKP--GETVLDLGSGAGFDCFLAARQVGESGRVIGVDMTPEMLARARENARKG-GFANVE 147

Query: 771  IILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGI 950
              L   +I  LP A  SVD + +   ++  P       E  RVLRPGG        V  +
Sbjct: 148  FRL--GEIEHLPVADESVDVIISNCVINLSPEKEQVFREAFRVLRPGG-----RIAVADM 200

Query: 951  YSFTPFVRPLRENFAQISG 1007
             S  P    +RE+ A  +G
Sbjct: 201  VSLAPLPPEVREDLALYAG 219



>gb:AE017333_448252 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_858062 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 232

 Score = 46.2 bits (108), Expect = 0.002
 Identities = 38/144 (26%), Positives = 62/144 (43%), Gaps = 1/144 (0%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKS- 671
           ++SF   + WR            +K  +LM        G   +D  CG+G ++   A + 
Sbjct: 26  VISFKQHKKWR------------DKTMQLMN----VPKGATALDVCCGTGDWTIALADAA 69

Query: 672 GLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAAL 851
           G    +  LDFS+ ML      I +++      I L+  +   LPF  ++ D V  G  L
Sbjct: 70  GETGEIKGLDFSKNMLS-----IAEQKTESYSQIELIHGNAMELPFPDNTFDYVTIGFGL 124

Query: 852 HCWPSPSAAVAEISRVLRPGGVFV 923
              P     + E++RV++PGG  V
Sbjct: 125 RNVPDYLTVLKEMARVVKPGGQVV 148



>gb:AE013598_295776 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 331

 Score = 46.2 bits (108), Expect = 0.002
 Identities = 34/119 (28%), Positives = 59/119 (49%), Gaps = 1/119 (0%)
 Frame = +3

Query: 561 PEKEFELMQDYLKPVMG-GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEF 737
           P + +E +     P++  G+++D + G G+ + L A     +  + +D S  ++    E 
Sbjct: 131 PGRTWEALARTALPLLETGDVLDIASGDGVLAELVAPHA--TRYICIDTSARVVAAASER 188

Query: 738 IKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
           +++  N     + +   D+  LPF  +S D V    AL     P+ AVAE +RVLRPGG
Sbjct: 189 LRKLRN-----VEVREGDMHALPFPDASFDLVVLMHALTYAAKPAQAVAESARVLRPGG 242



>gb:AE012929_287222 Chlorobium tepidum TLS section 150 of 194 of the
           complete genome.>gb:AE006470_934390 Chlorobium tepidum
           TLS complete genome.
          Length = 275

 Score = 46.2 bits (108), Expect = 0.002
 Identities = 29/106 (27%), Positives = 48/106 (45%), Gaps = 2/106 (1%)
 Frame = +3

Query: 603 VMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQE--ENFPNENII 776
           V  G  +D   G G+     AK    ++ V       ++ +C E  ++   E    E + 
Sbjct: 100 VRSGRCVDLGGGPGMLGVCLAKITSLTVTVV-----DLMPECVELARENSAEAGVAERVD 154

Query: 777 LVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
           +V+     LPF  +S+D V +  ++  W      +AE+ RVLRPGG
Sbjct: 155 VVQGVAEALPFDDASIDLVVSRGSIFFWEDQQKGLAEVYRVLRPGG 200



>gb:AE012252_280765 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 160 of 460 of the complete
           genome.>gb:AE008922_914047 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 350

 Score = 46.2 bits (108), Expect = 0.002
 Identities = 34/119 (28%), Positives = 59/119 (49%), Gaps = 1/119 (0%)
 Frame = +3

Query: 561 PEKEFELMQDYLKPVMG-GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEF 737
           P + +E +     P++  G+++D + G G+ + L A     +  + +D S  ++    E 
Sbjct: 150 PGRTWEALARTALPLLETGDVLDIASGDGVLAELVAPHA--TRYICIDTSARVVAAASER 207

Query: 738 IKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
           +++  N     + +   D+  LPF  +S D V    AL     P+ AVAE +RVLRPGG
Sbjct: 208 LRKLRN-----VEVREGDMHALPFPDASFDLVVLMHALTYAAKPAQAVAESARVLRPGG 261



>gb:CZA382_119901 Amycolatopsis orientalis cosmid pCZA382.
          Length = 259

 Score = 46.2 bits (108), Expect = 0.002
 Identities = 33/117 (28%), Positives = 52/117 (44%)
 Frame = +3

Query: 594 LKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENI 773
           L+   G  ++D   G+G  +      G  + V+A++    ML +    +      P    
Sbjct: 36  LEHAPGPRVLDLGAGTGKLTAALVALG--AEVIAVEPDPAMLTELRRAVPTVRALPG--- 90

Query: 774 ILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVD 944
                +   +P   +S+DAV AG ALH W   S A  EI+RVL PGG+      ++D
Sbjct: 91  -----NAEAIPLPDASIDAVLAGNALH-WFDMSVAGPEIARVLAPGGILAGLWNVMD 141



>gb:CP000031_84215 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 257

 Score = 46.2 bits (108), Expect = 0.002
 Identities = 33/113 (29%), Positives = 50/113 (44%)
 Frame = +3

Query: 576 ELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEEN 755
           + M D+L P  G  ++D + G+G  S  F K         LD +E ML +  +  + E  
Sbjct: 60  DAMMDWLAPRPGQRLLDVAGGTGDISFRFLKRAGHGHATVLDLTEPMLVEGRK--RAEAE 117

Query: 756 FPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGG 914
              +++  V  D   LPF  ++ D       +     P  A+ E  RVLRPGG
Sbjct: 118 RMADSLDWVVGDAMALPFEDNTFDVYTISFGIRNVTRPQEALNEAYRVLRPGG 170



>gb:AE017342_1754966 Cryptococcus neoformans var. neoformans JEC21
           chromosome 2, complete sequence.
          Length = 343

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 40/146 (27%), Positives = 64/146 (43%), Gaps = 8/146 (5%)
 Frame = +3

Query: 507 LYERGWRQSFSLWGGFPGPE--KEFELMQDYLKPVM----GGNIIDASCGSGLFSRLFAK 668
           LYE GW +SF     + G    +     + YL  +M    G  ++D  CG G  +R  A+
Sbjct: 51  LYEYGWAESFHFCRFYKGEAFLQALARHEHYLASMMQLKPGMRVLDVGCGVGGPAREIAR 110

Query: 669 SGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLP--FASSSVDAVHAG 842
              FS    +  +    Q      K ++   ++ +  V+ D  +L   F  +S DA++A 
Sbjct: 111 ---FSDATIVGVNNNDFQIGRATAKSKKAGLSDKVSFVKGDFMKLSEQFGENSFDAIYAI 167

Query: 843 AALHCWPSPSAAVAEISRVLRPGGVF 920
            A    P+      EI + L+PGGVF
Sbjct: 168 EATCHAPNFEGIYGEIFKCLKPGGVF 193



>gb:BA000043_738788 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 234

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 33/106 (31%), Positives = 51/106 (48%), Gaps = 1/106 (0%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKS-GLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVR 785
           G   +D  CG+  ++   A++ G    V  LDFSE ML+   + +K        N+ L+ 
Sbjct: 48  GKRALDVCCGTADWAIALAEAVGPEGEVYGLDFSENMLKVGEQKVKARGL---GNVKLIH 104

Query: 786 ADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
            +  +LPF  +S D V  G  L   P     + E+ RV +PGG+ V
Sbjct: 105 GNAMQLPFPDNSFDYVTIGFGLRNVPDYMTVLKEMHRVTKPGGMTV 150



>gb:BA000028_695424 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 261

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 32/117 (27%), Positives = 51/117 (43%), Gaps = 3/117 (2%)
 Frame = +3

Query: 576 ELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQC---YEFIKQ 746
           E +Q ++        +D  CG GL++++ A  G F  +  +DFS+ ML      Y  + Q
Sbjct: 24  EKLQTFIGNPQQKTAVDMGCGGGLYTKVLADLG-FKEIYGIDFSDAMLTSASNNYHHLHQ 82

Query: 747 EENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGV 917
            +         ++ +       S SVD     A LH    P AA  E +R+LR  G+
Sbjct: 83  AQ--------FLKGNAYNSGLESDSVDFYLQRAVLHHLTDPEAAFIEAARILRQEGI 131



>gb:AL646078_548725 Ralstonia solanacearum GMI1000 megaplasmid,
           complete sequence; segment 3/11.
          Length = 246

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 30/102 (29%), Positives = 43/102 (42%)
 Frame = +3

Query: 618 IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADIS 797
           I D  CG G+  RL   +     ++ +DF    L       KQ        + L+  D +
Sbjct: 58  IADVGCGQGISFRLLESAFAPQRMIGIDFHRPSLAAA----KQAAAALATPVDLLHGDCA 113

Query: 798 RLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV 923
            LP   +SVD V      H       A+AE  RVL+PGG+ +
Sbjct: 114 ALPLPDASVDMVFCHQTFHHLVEQDRALAEFHRVLKPGGLLL 155



>gb:AF127374_481430 Streptomyces lavendulae LinA homolog, cytochrome
           P450 hydroxylase ORF4, cytochrome P450 hydroxylase ORF3,
           MitT (mitT), MitS (mitS), MitR (mitR), MitQ (mitQ), MitP
           (mitP), MitO (mitO), MitN (mitN), MitM (mitM), MitL
           (mitL), MitK (mitK), MitJ (mitJ), MitI (mitI), MitH
           (mitH), MitG (mitG), MitF (mitF), MitE (mitE), MitD
           (mitD), MitC (mitC), MitB (mitB), MitA (mitA), MmcA
           (mmcA), MmcB (mmcB), MmcC (mmcC), MmcD (mmcD), MmcE
           (mmcE), MmcF (mmcF), MmcG (mmcG), MmcH (mmcH), MmcI
           (mmcI), MmcJ (mmcJ), MmcK (mmcK), MmcL (mmcL), MmcM
           (mmcM), MmcN (mmcN), MmcO (mmcO), Mrd (mrd), MmcP
           (mmcP), MmcQ (mmcQ), MmcR (mmcR), MmcS (mmcS), MmcT
           (mmcT), MmcU (mmcU), MmcV (mmcV), Mct (mct), MmcW
           (mmcW), MmcX (mmcX), and MmcY (mmcY) genes, complete
           cds; and unknown genes.
          Length = 283

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 34/121 (28%), Positives = 54/121 (44%), Gaps = 1/121 (0%)
 Frame = +3

Query: 576 ELMQDYLKPVMGGNIIDASCGSGLFS-RLFAKSGLFSLVVALDFSETMLQQCYEFIKQEE 752
           ++M + L+   G  ++D  CG G    R+   SG     +++   + +          EE
Sbjct: 61  DMMAERLRIGAGSRVLDLGCGVGTPGVRIARLSGAHVTGISVSHEQVVRANALA----EE 116

Query: 753 NFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATT 932
               +     RAD   LPF   S DAV A  ++   P  +  +A++ RVLRPGG  V T 
Sbjct: 117 AGLADRARFQRADAMDLPFEDESFDAVIALESIIHMPDRAQVLAQVGRVLRPGGRLVLTD 176

Query: 933 Y 935
           +
Sbjct: 177 F 177



>gb:AE017269_422868 Bacillus cereus ATCC 10987, section 6 of 18 of
           the complete genome.>gb:AE017194_1061287 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 237

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 40/141 (28%), Positives = 64/141 (45%), Gaps = 1/141 (0%)
 Frame = +3

Query: 495 LVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKS- 671
           ++SF   + WR             KE   + D +KP  G   +D  CG+  ++   A++ 
Sbjct: 26  VISFQRHKAWR-------------KETMRIMD-VKP--GSKALDVCCGTADWTIALAEAV 69

Query: 672 GLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAAL 851
           G    VV LDFSE ML    + +   E    + + L+  +   LPF  ++ D V  G  L
Sbjct: 70  GEQGKVVGLDFSENMLSVGKQKV---EALQLKQVELLHGNAMELPFEDNTFDYVTIGFGL 126

Query: 852 HCWPSPSAAVAEISRVLRPGG 914
              P     + E++RV++PGG
Sbjct: 127 RNVPDYMHVLKEMTRVVKPGG 147



>gb:AE016925_359337 Chromobacterium violaceum ATCC 12472 section 16 of
            16 of the complete genome.>gb:AE016825_1044491
            Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 302

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 44/166 (26%), Positives = 72/166 (43%), Gaps = 8/166 (4%)
 Frame = +3

Query: 588  DYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEEN---- 755
            DY+K      I+DA  G+G  +    +    + V+ LD +  ML    E  +  +     
Sbjct: 42   DYIKH-QPAVILDAGAGTGYGAAELRRRYPQARVIELDLAHAMLLASRERGRAGDGLLKK 100

Query: 756  -FPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATT 932
             F       + ADI +LP A +SVD + +   +     P    AE+ RVL+P G+ + +T
Sbjct: 101  LFKPSLPWQINADIEKLPLADASVDMIWSNLTIQWINVPDKMFAELRRVLKPDGMLMFST 160

Query: 933  YIVDGIYSFTPFVRPLRENFAQISG-SHI--FLDEKELEDLCTTCG 1061
               D +         LR  FA + G +H+  F+D  ++ D     G
Sbjct: 161  LGPDTL-------SELRAAFAGVDGATHVNQFIDMHDIGDALMRAG 199



>pir|T25826|T25826 hypothetical protein K12D9.1 - Caenorhabditis
           elegans>gb:U80030_1406166 Caenorhabditis elegans cosmid
           K12D9, complete sequence.
          Length = 391

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 32/108 (29%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = +3

Query: 609 GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIKQEENFPNENIILVRA 788
           G  ++D  CG G  S L A++   S  V LD  E  ++   +  K+ +    +N+  V  
Sbjct: 203 GFRVLDVGCGEGFHSCLLAENYSKSQFVGLDICEKAIKSA-KLNKKSDGSDFQNLEFVVG 261

Query: 789 DISRLPFA-SSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVAT 929
           D   +P   +   D V    +LH    P  ++ E+ RVL+PGG+ V T
Sbjct: 262 DAMIMPEDWTGCFDLVAFFGSLHDLLRPDLSLLEVHRVLKPGGMVVLT 309


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,568,491,367
Number of Sequences: 1806583
Number of extensions: 34053002
Number of successful extensions: 90245
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 85257
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 89955
length of database: 581,917,975
effective HSP length: 129
effective length of database: 348,868,768
effective search space used: 124546150176
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)