BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig1311
         (615 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF533771_1809470 Medicago truncatula lecithine cholesterol ac...   222   4e-57   
gb:AE005172_891626 Arabidopsis thaliana chromosome 1, top arm co...   198   7e-50   
gb:AC120983_1739969 Oryza sativa chromosome 3 BAC OSJNBb0011H13 ...   192   3e-48   
gb:CQ891268_1454976 Sequence 34 from Patent WO2004087902.             137   2e-31   
gb:AC103891_1737310 Oryza sativa (japonica cultivar-group) chrom...   113   2e-24   
gb:AP005640_1855256 Oryza sativa (japonica cultivar-group) genom...   110   1e-23   
gb:AP005643_1855334 Oryza sativa (japonica cultivar-group) genom...   105   6e-22   
gb:AE014134_1129893 Drosophila melanogaster chromosome 2L, compl...    92   9e-18   
gb:AE014134_1129891 Drosophila melanogaster chromosome 2L, compl...    92   9e-18   
gb:AY072914_1424595 Bos taurus lysosomal phospholipase A2 (LPLA2...    91   2e-17   
gb:AY490816_2085589 Rattus norvegicus lysosomal phospholipase A2...    87   3e-16   
sp|Q8VEB4|LYA3_MOUSE|LYA3_MOUSE 1-O-acylceramide synthase precursor (EC 2.3...    86   4e-16   Mus musculus [mouse]
gb:AY217754_1427290 Canis familiaris lysosomal phospholipase A2 ...    86   5e-16   
gb:CQ782776_1452142 Sequence 2916 from Patent EP1396543.>gb:AK07...    86   6e-16   
gb:CR859035_1183175 Pongo pygmaeus mRNA; cDNA DKFZp468N192 (from...    86   6e-16   
sp|Q8NCC3|LYA3_HUMAN|LYA3_HUMAN 1-O-acylceramide synthase precursor (EC 2.3...    86   6e-16   Homo sapiens [man]
pir|T23726|T23726 hypothetical protein M05B5.4 - Caenorhabditis ...    85   8e-16   Caenorhabditis elegans [roundworm]
gb:BC066589_2554464 Danio rerio cDNA clone IMAGE:6959873, partia...    84   1e-15   
gb:AP004073_1837337 Oryza sativa (japonica cultivar-group) genom...    80   3e-14   
gb:RNU62803_2137559 Rattus norvegicus lecithin:cholesterol acylt...    76   4e-13   
gb:AF272861_1417415 Tupaia glis lecithin cholesterol acyltransfe...    76   4e-13   
pir|S11214|XXRTN phosphatidylcholine-sterol O-acyltransferase (E...    76   4e-13   
sp|P18424|LCAT_RAT|LCAT_RAT Phosphatidylcholine-sterol acyltransferase pr...    76   4e-13   Rattus norvegicus [brown rat]
gb:BC028861_2096355 Mus musculus lecithin cholesterol acyltransf...    75   7e-13   
gb:AK004914_1152689 Mus musculus adult male liver cDNA, RIKEN fu...    75   7e-13   
sp|P16301|LCAT_MOUSE|LCAT_MOUSE Phosphatidylcholine-sterol acyltransferase ...    75   7e-13   Mus musculus [mouse]
gb:BT009747_2151240 Synthetic construct Homo sapiens lecithin-ch...    75   9e-13   
gb:HUMLCATGA_2034023 Human lecithin-cholesterol acyltransferase ...    75   9e-13   
gb:HSLCAT1_2016956 Human mRNA for lecithin:cholesterol acyltrans...    75   9e-13   
sp|Q08758|LCAT_PAPAN|LCAT_PAPAN Phosphatidylcholine-sterol acyltransferase ...    75   9e-13   Papio anubis [baboon]
sp|P04180|LCAT_HUMAN|LCAT_HUMAN Phosphatidylcholine-sterol acyltransferase ...    75   9e-13   Homo sapiens [man]
gb:AF324887_2487737 Anas platyrhynchos lecithin cholesterol acyl...    75   1e-12   
gb:AY092004_1936305 Macaca sp. lecithin cholesterol acyltransfer...    74   2e-12   
gb:AY092002_1936303 Gorilla gorilla lecithin cholesterol acyltra...    74   2e-12   
sp|P53761|LCAT_RABIT|LCAT_RABIT Phosphatidylcholine-sterol acyltransferase ...    74   2e-12   Oryctolagus cuniculus [domestic rabbit]
gb:AY092003_1936304 Pongo pygmaeus lecithin cholesterol acyltran...    72   6e-12   
pir|I50662|I50662 lecithin-cholesterol acyltransferase - chicken...    72   7e-12   Gallus gallus [bantam]
sp|P53760|LCAT_CHICK|LCAT_CHICK Phosphatidylcholine-sterol acyltransferase ...    72   7e-12   Gallus gallus [bantam]
gb:BC081072_2561980 Xenopus laevis MGC82035 protein, mRNA (cDNA ...    72   9e-12   
gb:BC075304_2558409 Xenopus tropicalis lecithin-cholesterol acyl...    69   8e-11   
gb:AF183897_1415624 Didelphis marsupialis lecithin: cholesterol ...    64   2e-09   
gb:AE016959_1021069 Oryza sativa (japonica cultivar-group) chrom...    64   3e-09   
gb:MGLCAT02_2113645 Myoxus glis lecithin:cholesterol acyl transf...    61   1e-08   
gb:AP005640_1855253 Oryza sativa (japonica cultivar-group) genom...    61   1e-08   
gb:AF183898_1415625 Erinaceus europaeus lecithin: cholesterol ac...    61   1e-08   
gb:NLLCAT02_2130909 Nannospalax leucodon lecithin:cholesterol ac...    61   2e-08   
gb:SGLCAT02_2139953 Sciurus griseus lecithin:cholesterol acyl tr...    60   2e-08   
gb:GLO536381_2112916 Graphiurus lorraineus partial lcat gene for...    60   2e-08   
gb:GHLCAT02_2112913 Gerbillus henleyi lecithin:cholesterol acyl ...    60   2e-08   
gb:EME536373_2112818 Eliomys melanurus partial lcat gene for lec...    60   2e-08   
gb:DLA536374_2112751 Dryomys laniger partial lcat gene for lecit...    60   2e-08   
sp|O35573|LCAT_ELIQU|LCAT_ELIQU Phosphatidylcholine-sterol acyltransferase ...    60   2e-08   Eliomys quercinus
gb:OLLCAT01_2130970 Octodon lunatus lecithin:cholesterol acyl tr...    60   3e-08   
gb:MSP275583_2124774 Myospalax sp. partial lcat gene for lecithi...    60   4e-08   
gb:MMARLCAT2_2114203 Marmota marmota lecithin:cholesterol acyl t...    60   4e-08   
sp|O35840|LCAT_TATKG|LCAT_TATKG Phosphatidylcholine-sterol acyltransferase ...    60   4e-08   Gerbilliscus gambianus
gb:NELCAT02_2130897 Nannospalax ehrenbergi lecithin:cholesterol ...    59   6e-08   
gb:CMY275538_2111824 Calomyscus mystax partial lcat gene for lec...    59   6e-08   
sp|O35724|LCAT_MICMN|LCAT_MICMN Phosphatidylcholine-sterol acyltransferase ...    59   8e-08   Micromys minutus [Eurasian harvest mouse]
gb:MCLCAT02_2113455 Myocastor coypus lecithin:cholesterol acyl t...    58   1e-07   
gb:LSI275593_2113263 Lophuromys sikapusi partial lcat gene for l...    58   1e-07   
gb:CMLCAT02_2111815 Cricetulus migratorius lecithin:cholesterol ...    58   1e-07   
gb:PRO275573_2131210 Phodopus roborowski partial lcat gene for l...    58   1e-07   
gb:NFU275613_2130902 Neotoma fuscipes partial lcat gene for leci...    58   1e-07   
gb:MAL275558_2113311 Mystromys albicaudatus partial lcat gene fo...    57   2e-07   
gb:JJA275533_2113217 Jaculus jaculus partial lcat gene for lecit...    57   2e-07   
gb:DSA275528_2112771 Dipus sagitta partial lcat gene for lecithi...    57   2e-07   
gb:ACA275603_2049824 Acomys cahirinus partial lcat gene for leci...    57   2e-07   
gb:PMLCAT01_2131131 Peromyscus maniculatus lecithin:cholesterol ...    57   2e-07   
gb:ARU536382_2073230 Aplodontia rufa partial lcat gene for lecit...    57   2e-07   
gb:AEL275518_2049956 Allactaga elater partial lcat gene for Leci...    57   2e-07   
gb:CGA277518_2111618 Cricetomys gambianus partial LCAT gene for ...    57   3e-07   
gb:MNLCAT01_2124671 Microtus nivalis lecithin:cholesterol acyl t...    56   5e-07   
gb:ATLCAT02_2073381 Akodon torques lecithin:cholesterol acyl tra...    56   5e-07   
gb:SCA277513_2139924 Saccostomus campestris partial LCAT gene fo...    55   7e-07   
gb:OAN275608_2130926 Otomys angoniensis partial lcat gene for le...    55   7e-07   
gb:DMY275553_2112761 Dendromus mystacalis partial lcat gene for ...    55   7e-07   
gb:SKA275513_2139963 Sicista kazbegica partial lcat gene for lec...    55   9e-07   
gb:DTO275588_2112787 Dicrostonyx torquatus partial lcat gene for...    54   2e-06   
sp|O35502|LCAT_CLEGL|LCAT_CLEGL Phosphatidylcholine-sterol acyltransferase ...    54   2e-06   
gb:AF183896_2058171 Cavia porcellus lecithin: cholesterol acyl-t...    54   3e-06   
gb:URU275598_2140354 Uranomys ruddi partial lcat gene for lecith...    52   6e-06   
gb:GOC536379_2112927 Graphiurus ocularis partial lcat gene for l...    52   8e-06   
gb:DFE275548_2112728 Deomys ferrugineus partial lcat gene for le...    52   8e-06   
gb:MIN275563_2113660 Macrotarsomys ingens partial lcat gene for ...    51   2e-05   
gb:SSP275543_2140002 Steatomys sp. partial lcat gene for lecithi...    50   2e-05   
gb:MAU275578_2113369 Mesocricetus auratus partial lcat gene for ...    50   2e-05   
gb:NIN275523_2130907 Napaeozapus insignis partial lcat gene for ...    50   3e-05   
gb:MRO536375_2124717 Myomimus roachi partial lcat gene for lecit...    50   3e-05   
gb:CR382401_1375114 Plasmodium falciparum chromosome 6, complete...    50   3e-05   
gb:RPLCAT02_2138089 Rhizomys pruinosus lecithin:cholesterol acyl...    49   7e-05   
gb:AY092001_1936302 Pan troglodytes lecithin cholesterol acyltra...    49   9e-05   
gb:NRU275568_2130917 Nesomys rufus partial lcat gene for lecithi...    48   1e-04   
gb:GPL536378_2113022 Graphiurus platyops partial lcat gene for l...    46   6e-04   
gb:AP005640_1855251 Oryza sativa (japonica cultivar-group) genom...    45   0.001   
gb:AP005640_1855248 Oryza sativa (japonica cultivar-group) genom...    42   0.006   
gb:AE016959_1021078 Oryza sativa (japonica cultivar-group) chrom...    42   0.008   
gb:AY223006_1176471 Schistosoma japonicum clone ZZD1085 mRNA seq...    40   0.023   
gb:AE016959_1021068 Oryza sativa (japonica cultivar-group) chrom...    40   0.031   
gb:AP005640_1855252 Oryza sativa (japonica cultivar-group) genom...    39   0.052   
gb:AY092005_1936306 Saguinus oedipus lecithin cholesterol acyltr...    37   0.20    
gb:BLU35855_749089 Bacillus licheniformis esterase (est) gene, c...    36   0.44    
gb:AY448010S4_1606585 Ipomoea trifida haplotype S1 self-incompat...    34   2.2     
gb:AP008227_579588 Thermus thermophilus HB8 plasmid pTT27 DNA, c...    32   6.4     
gb:AE017222_405303 Thermus thermophilus HB27 plasmid pTT27, comp...    32   6.4     
pir|T23939|T23939 hypothetical protein R05H5.3 - Caenorhabditis ...    32   8.3     Caenorhabditis elegans [roundworm]


>gb:AF533771_1809470 Medicago truncatula lecithine cholesterol
           acyltransferase-like protein mRNA, complete cds.
          Length = 449

 Score =  222 bits (565), Expect = 4e-57
 Identities = 107/155 (69%), Positives = 122/155 (78%), Gaps = 1/155 (0%)
 Frame = +2

Query: 152 ATTNLHPLILIPGNGGNQLEARLTAKYKPTSLWCK-WYPVKKDGDGWFRLWFDSSVLLSP 328
           +  NL+P+ILIPGNGGNQLEA+LT KYKP++L C  WYP  K  +GWFRLWFDSSVLL+P
Sbjct: 33  SNNNLNPVILIPGNGGNQLEAKLTTKYKPSTLICDPWYPPFKKKNGWFRLWFDSSVLLAP 92

Query: 329 LTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESL 508
            TKCF+ RM            N PGVETRVP+FGST SLLYL+P LK ++ YMAPLVESL
Sbjct: 93  FTKCFASRMTLYYDQDLDDYFNVPGVETRVPSFGSTSSLLYLNPRLKLVTGYMAPLVESL 152

Query: 509 EQLXYEDGKNMFGAPYDFRYGLAAKGHPSQVGSKF 613
           EQL Y DG+N+FGAPYDFRYGLAA  HPSQVGSKF
Sbjct: 153 EQLGYIDGQNLFGAPYDFRYGLAAPSHPSQVGSKF 187



>gb:AE005172_891626 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC004557_1531861 Genomic sequence
           for Arabidopsis thaliana BAC F17L21 from chromosome I,
           complete sequence.>gb:AY087433_1572464 Arabidopsis
           thaliana clone 35408 mRNA, complete
           sequence.>gb:AY133614_1581437 Arabidopsis thaliana
           At1g27480/F17L21_28 mRNA, complete
           cds.>gb:AY443040_1606355 Arabidopsis thaliana lecithine
           cholesterol acyltransferase-like protein (At1g27480)
           mRNA, complete cds.>gb:AF301376S2_1784269 Arabidopsis
           thaliana lecithin cholesterol acyltransferase gene, exon
           2 and complete cds.>gb:AF367326_1791778 Arabidopsis
           thaliana At1g27480/F17L21_28 mRNA, complete cds.
          Length = 432

 Score =  198 bits (503), Expect = 7e-50
 Identities = 96/160 (60%), Positives = 122/160 (76%), Gaps = 4/160 (2%)
 Frame = +2

Query: 146 CQAT-TNLHPLILIPGNGGNQLEARLTAKYKPTSLWCK-W-YPVKKDGDGWFRLWFDSSV 316
           CQA  +N++PLIL+PGNGGNQLE RL  +YKP+S+WC  W YP+ K   GWFRLWFD++V
Sbjct: 24  CQAVGSNVYPLILVPGNGGNQLEVRLDREYKPSSVWCSSWLYPIHKKSGGWFRLWFDAAV 83

Query: 317 LLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPL 496
           LLSP T+CFS+RMM           NAPGV+TRVP+FGST+SLLYLDP L+  ++YM  L
Sbjct: 84  LLSPFTRCFSDRMMLYYDPDLDDYQNAPGVQTRVPHFGSTKSLLYLDPRLRDATSYMEHL 143

Query: 497 VESLE-QLXYEDGKNMFGAPYDFRYGLAAKGHPSQVGSKF 613
           V++LE +  Y + + + GAPYDFRYGLAA GHPS+V S+F
Sbjct: 144 VKALEKKCGYVNDQTILGAPYDFRYGLAASGHPSRVASQF 183



>gb:AC120983_1739969 Oryza sativa chromosome 3 BAC OSJNBb0011H13
           genomic sequence, complete sequence.
          Length = 579

 Score =  192 bits (489), Expect = 3e-48
 Identities = 90/150 (60%), Positives = 113/150 (75%)
 Frame = +2

Query: 164 LHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSPLTKCF 343
           LHP+ILIPG GGNQLEARLT +Y P+SL C+ +PV +   GWFRLWFD SV+++PLT+CF
Sbjct: 164 LHPVILIPGAGGNQLEARLTEEYAPSSLACRVWPVVRGRGGWFRLWFDPSVVVAPLTRCF 223

Query: 344 SERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQLXY 523
           ++RM            NAPGVETRV +FGST +L YLDPNLK ++ YM  L  +LE+  Y
Sbjct: 224 ADRMTLFYDSVADDYRNAPGVETRVSDFGSTSTLRYLDPNLKLLTGYMNVLASTLEKAGY 283

Query: 524 EDGKNMFGAPYDFRYGLAAKGHPSQVGSKF 613
           E+G ++FGAPYDFRYGLA  GHPS+VGS +
Sbjct: 284 EEGFDLFGAPYDFRYGLAGPGHPSRVGSAY 313



>gb:CQ891268_1454976 Sequence 34 from Patent WO2004087902.
          Length = 500

 Score =  137 bits (344), Expect = 2e-31
 Identities = 68/151 (45%), Positives = 95/151 (62%)
 Frame = +2

Query: 161 NLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSPLTKC 340
           +L P++++PG GGNQLEARLTA Y+    WC  Y  +KD   +FRLW D   L  P T C
Sbjct: 106 HLAPVVIVPGTGGNQLEARLTADYEANKPWC--YSFRKD---YFRLWLDVKTLFPPFTTC 160

Query: 341 FSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQLX 520
           F++R+            N  GV+TRVP FG+T+ + YLDP+LK ++ YM  LV +L+   
Sbjct: 161 FADRLSLDYNPQSDAYSNIKGVKTRVPFFGTTEGMEYLDPSLKFLTGYMIHLVNALKAHG 220

Query: 521 YEDGKNMFGAPYDFRYGLAAKGHPSQVGSKF 613
           YE+GK+++GAPYDFR+  A   H S V  ++
Sbjct: 221 YENGKSLYGAPYDFRF--APGPHASNVALEY 249



>gb:AC103891_1737310 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1175C11, complete sequence.
          Length = 822

 Score =  113 bits (283), Expect = 2e-24
 Identities = 60/153 (39%), Positives = 87/153 (56%), Gaps = 1/153 (0%)
 Frame = +2

Query: 158 TNLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLW-FDSSVLLSPLT 334
           ++LHP++L+PG G N+L ARLTA Y+P +  C     ++  D WF+LW  D++       
Sbjct: 415 SDLHPVVLVPGYGSNRLYARLTAAYEPAAPRCG---AREGKDEWFQLWPIDAAASEPAQA 471

Query: 335 KCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQ 514
            C +E+M            N  GV TRVP+F ST++L+  DP           LV  LE 
Sbjct: 472 PCLAEKMSLVYDPVADDYRNVAGVVTRVPSFASTRALVGWDP-----------LVRQLEA 520

Query: 515 LXYEDGKNMFGAPYDFRYGLAAKGHPSQVGSKF 613
           + + DG ++F APYDFRY +A +GHPS VG ++
Sbjct: 521 MGHRDGGSLFAAPYDFRYAVAPRGHPSAVGERY 553



>gb:AP005640_1855256 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0006O15.
          Length = 440

 Score =  110 bits (276), Expect = 1e-23
 Identities = 64/152 (42%), Positives = 82/152 (53%), Gaps = 2/152 (1%)
 Frame = +2

Query: 164 LHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLL-SPLTKC 340
           LHP+ L+PG   + LEARLT  Y+P++  C        G GWF LW +++ LL      C
Sbjct: 41  LHPIFLVPGASCSDLEARLTEAYRPSTAHCG----AMKGKGWFGLWENNTELLVHDYADC 96

Query: 341 FSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDP-NLKHISAYMAPLVESLEQL 517
             E+M            N PGVETRVPNFGS  S  Y +P N    +  +  L + LE+L
Sbjct: 97  SLEQMTLVYDPAANEYRNLPGVETRVPNFGSAWSFGYKNPVNRLQRAQCLGKLRDWLEEL 156

Query: 518 XYEDGKNMFGAPYDFRYGLAAKGHPSQVGSKF 613
            Y DG  MFGAPYDFRY     G  S+V S++
Sbjct: 157 GYRDGDTMFGAPYDFRYAPPVPGQTSEVYSRY 188



>gb:AP005643_1855334 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBb0046O12.
          Length = 435

 Score =  105 bits (262), Expect = 6e-22
 Identities = 58/150 (38%), Positives = 84/150 (56%), Gaps = 1/150 (0%)
 Frame = +2

Query: 164 LHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLS-PLTKC 340
           LHP+ L+PG   + +EARLT  Y+P++  C        G GWF LW +++ L +    +C
Sbjct: 42  LHPIFLVPGATCSNVEARLTEAYRPSAAHCG----AMKGKGWFGLWENNTELQAHDYAEC 97

Query: 341 FSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQLX 520
           F E+M            N PGV+TRVPNFGS +S  +   ++ +    +A L+ +LE++ 
Sbjct: 98  FQEQMALVYDPAANEYRNLPGVDTRVPNFGSVRS--FGSKDVFNPEWCLASLIGALEEMG 155

Query: 521 YEDGKNMFGAPYDFRYGLAAKGHPSQVGSK 610
           Y DG NM+G PYD RY     G  SQV S+
Sbjct: 156 YRDGDNMYGVPYDIRYAPPIPGQASQVYSR 185



>gb:AE014134_1129893 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003666_1220000 Drosophila melanogaster
           chromosome 2L, section 75 of 83 of the complete
           sequence.
          Length = 421

 Score = 91.7 bits (226), Expect = 9e-18
 Identities = 44/134 (32%), Positives = 69/134 (51%)
 Frame = +2

Query: 164 LHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSPLTKCF 343
           L P+I +PG+GG+Q++ARL     P       Y + +    W+ LW D   L+ P+  C+
Sbjct: 44  LSPVIFVPGDGGSQMDARLNKPNSP-------YLICQKTHDWYNLWLDLEQLVIPMVYCW 96

Query: 344 SERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQLXY 523
            + +            N PGVETR+P +G+ + + ++DP      AY   +   L +L Y
Sbjct: 97  IDNVKLYYDKVTRTTHNTPGVETRIPGWGNPEVVEWIDPTKNSAGAYFKDIANELVKLGY 156

Query: 524 EDGKNMFGAPYDFR 565
              +N+ GAPYDFR
Sbjct: 157 IRKQNIHGAPYDFR 170



>gb:AE014134_1129891 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003666_1219998 Drosophila melanogaster
           chromosome 2L, section 75 of 83 of the complete
           sequence.>gb:AF145599_1244658 Drosophila melanogaster
           clone GH02384 BcDNA.GH02384 (BcDNA.GH02384) mRNA,
           complete cds.
          Length = 421

 Score = 91.7 bits (226), Expect = 9e-18
 Identities = 44/134 (32%), Positives = 69/134 (51%)
 Frame = +2

Query: 164 LHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSPLTKCF 343
           L P+I +PG+GG+Q++ARL     P       Y + +    W+ LW D   L+ P+  C+
Sbjct: 44  LSPVIFVPGDGGSQMDARLNKPNSP-------YLICQKTHDWYNLWLDLEQLVIPIVYCW 96

Query: 344 SERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQLXY 523
            + +            N PGVETR+P +G+ + + ++DP      AY   +   L +L Y
Sbjct: 97  IDNVKLYYDKVTRTTHNTPGVETRIPGWGNPEVVEWIDPTKNSAGAYFKDIANELVKLGY 156

Query: 524 EDGKNMFGAPYDFR 565
              +N+ GAPYDFR
Sbjct: 157 IRKQNIHGAPYDFR 170



>gb:AY072914_1424595 Bos taurus lysosomal phospholipase A2 (LPLA2)
           mRNA, complete cds.
          Length = 407

 Score = 90.5 bits (223), Expect = 2e-17
 Identities = 49/132 (37%), Positives = 74/132 (56%)
 Frame = +2

Query: 170 PLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSPLTKCFSE 349
           P++L+PG+ GNQLEA+L    KP+ +    Y   K  D +F LW +  +LL  +  C+ +
Sbjct: 34  PVVLVPGDMGNQLEAKLD---KPSVVH---YVCSKRTDHYFTLWLNLELLLPVIIDCWID 87

Query: 350 RMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQLXYED 529
            +               GV+ RVP FG T S+ +LDP+   + +Y+  +VESL    YE 
Sbjct: 88  NVRLIYNQTSHTTQFPEGVDVRVPGFGDTFSMEFLDPSKSSVGSYLHTMVESLVSWGYER 147

Query: 530 GKNMFGAPYDFR 565
           GK++ GAPYD+R
Sbjct: 148 GKDVRGAPYDWR 159



>gb:AY490816_2085589 Rattus norvegicus lysosomal phospholipase A2
           mRNA, complete cds.
          Length = 413

 Score = 86.7 bits (213), Expect = 3e-16
 Identities = 48/132 (36%), Positives = 73/132 (55%)
 Frame = +2

Query: 170 PLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSPLTKCFSE 349
           P++L+PG+ GNQLEA+L    KP  +    Y   K  D +F LW +  +LL  +  C+ +
Sbjct: 39  PVVLVPGDLGNQLEAKLD---KPKVVH---YLCSKRTDSYFTLWLNLELLLPVIIDCWID 92

Query: 350 RMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQLXYED 529
            +               GV+ RVP FG T SL +LDP+ +++ +Y   +VESL    Y  
Sbjct: 93  NIRLVYNRTSRTTQFPDGVDVRVPGFGETFSLEFLDPSKRNVGSYFYTMVESLVGWGYTR 152

Query: 530 GKNMFGAPYDFR 565
           G+++ GAPYD+R
Sbjct: 153 GEDVRGAPYDWR 164



>sp|Q8VEB4|LYA3_MOUSE 1-O-acylceramide synthase precursor (EC
           2.3.1.-) (ACS) (Lysosomal phospholipase A2) (LCAT-like
           lysophospholipase) (LLPL).>gb:AK085194_1174438 Mus
           musculus 13 days embryo stomach cDNA, RIKEN full-length
           enriched library, clone:D530005N19 product:SIMILAR TO
           LCAT-LIKE LYSOPHOSPHOLIPASE homolog [Mus musculus], full
           insert sequence.>gb:AF468958_2066671 Mus musculus
           lysosomal phospholipase A2 (Lpla2) mRNA, complete
           cds.>gb:AY179884_2078205 Mus musculus lysosomal
           phospholipase A2 gene, complete cds.>gb:BC019373_2092868
           Mus musculus lysophospholipase 3, mRNA (cDNA clone
           MGC:25713 IMAGE:3964729), complete cds.
          Length = 412

 Score = 86.3 bits (212), Expect = 4e-16
 Identities = 47/132 (35%), Positives = 73/132 (55%)
 Frame = +2

Query: 170 PLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSPLTKCFSE 349
           P++L+PG+ GNQLEA+L    KP  +    Y   K  D +F LW +  +LL  +  C+ +
Sbjct: 39  PVVLVPGDLGNQLEAKLD---KPKVVH---YLCSKKTDSYFTLWLNLELLLPVIIDCWID 92

Query: 350 RMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQLXYED 529
            +               GV+ RVP FG T S+ +LDP+ +++ +Y   +VESL    Y  
Sbjct: 93  NIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTR 152

Query: 530 GKNMFGAPYDFR 565
           G+++ GAPYD+R
Sbjct: 153 GEDVRGAPYDWR 164



>gb:AY217754_1427290 Canis familiaris lysosomal phospholipase A2
           mRNA, complete cds.
          Length = 408

 Score = 85.9 bits (211), Expect = 5e-16
 Identities = 48/132 (36%), Positives = 72/132 (54%)
 Frame = +2

Query: 170 PLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSPLTKCFSE 349
           P++L+PG+ GNQLEA+L    KPT +    Y   K  + +F LW +  +LL  +  C+ +
Sbjct: 35  PVVLVPGDLGNQLEAKLD---KPTVVH---YLCSKRTESYFTLWLNLELLLPVIIDCWID 88

Query: 350 RMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQLXYED 529
            +               GV+ RVP FG T SL +LDP+   + +Y   +VESL    Y  
Sbjct: 89  NIRLVYNRTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVDWGYIR 148

Query: 530 GKNMFGAPYDFR 565
           G+++ GAPYD+R
Sbjct: 149 GEDVRGAPYDWR 160



>gb:CQ782776_1452142 Sequence 2916 from Patent
           EP1396543.>gb:AK074828_1912719 Homo sapiens cDNA
           FLJ90347 fis, clone NT2RP2003042, moderately similar to
           PHOSPHATIDYLCHOLINE-STEROL ACYLTRANSFERASE PRECURSOR (EC
           2.3.1.43).
          Length = 412

 Score = 85.5 bits (210), Expect = 6e-16
 Identities = 47/132 (35%), Positives = 72/132 (54%)
 Frame = +2

Query: 170 PLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSPLTKCFSE 349
           P++L+PG+ GNQLEA+L    KPT +    Y   K  + +F +W +  +LL  +  C+ +
Sbjct: 39  PVVLVPGDLGNQLEAKLD---KPTVVH---YLCSKKTESYFTIWLNLELLLPVIIDCWID 92

Query: 350 RMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQLXYED 529
            +               GV+ RVP FG T SL +LDP+   + +Y   +VESL    Y  
Sbjct: 93  NIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTR 152

Query: 530 GKNMFGAPYDFR 565
           G+++ GAPYD+R
Sbjct: 153 GEDVRGAPYDWR 164



>gb:CR859035_1183175 Pongo pygmaeus mRNA; cDNA DKFZp468N192 (from
           clone DKFZp468N192).
          Length = 412

 Score = 85.5 bits (210), Expect = 6e-16
 Identities = 47/132 (35%), Positives = 72/132 (54%)
 Frame = +2

Query: 170 PLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSPLTKCFSE 349
           P++L+PG+ GNQLEA+L    KPT +    Y   K  + +F +W +  +LL  +  C+ +
Sbjct: 39  PVVLVPGDLGNQLEAKLD---KPTVVH---YLCSKKTESYFTIWLNLELLLPVIIDCWID 92

Query: 350 RMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQLXYED 529
            +               GV+ RVP FG T SL +LDP+   + +Y   +VESL    Y  
Sbjct: 93  NIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTR 152

Query: 530 GKNMFGAPYDFR 565
           G+++ GAPYD+R
Sbjct: 153 GEDVRGAPYDWR 164



>sp|Q8NCC3|LYA3_HUMAN 1-O-acylceramide synthase precursor (EC
           2.3.1.-) (ACS) (Lysosomal phospholipase A2) (LCAT-like
           lysophospholipase) (LLPL)
           (UNQ341/PRO540).>gb:AX877345_1476956 Sequence 12250 from
           Patent EP1074617.>gb:AB017494_1864855 Homo sapiens mRNA
           for LCAT-like lysophospholipase (LLPL), complete
           cds.>gb:AY358425_1947304 Homo sapiens clone DNA44189
           LLPL (UNQ341) mRNA, complete cds.>gb:BC062605_1985955
           Homo sapiens lysophospholipase 3 (lysosomal
           phospholipase A2), mRNA (cDNA clone MGC:74676
           IMAGE:5162981), complete cds.
          Length = 412

 Score = 85.5 bits (210), Expect = 6e-16
 Identities = 47/132 (35%), Positives = 72/132 (54%)
 Frame = +2

Query: 170 PLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSPLTKCFSE 349
           P++L+PG+ GNQLEA+L    KPT +    Y   K  + +F +W +  +LL  +  C+ +
Sbjct: 39  PVVLVPGDLGNQLEAKLD---KPTVVH---YLCSKKTESYFTIWLNLELLLPVIIDCWID 92

Query: 350 RMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQLXYED 529
            +               GV+ RVP FG T SL +LDP+   + +Y   +VESL    Y  
Sbjct: 93  NIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTR 152

Query: 530 GKNMFGAPYDFR 565
           G+++ GAPYD+R
Sbjct: 153 GEDVRGAPYDWR 164



>pir|T23726|T23726 hypothetical protein M05B5.4 - Caenorhabditis
           elegans>gb:CEM05B5_1366213 Caenorhabditis elegans cosmid
           M05B5, complete sequence.
          Length = 417

 Score = 85.1 bits (209), Expect = 8e-16
 Identities = 44/132 (33%), Positives = 68/132 (51%)
 Frame = +2

Query: 170 PLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSPLTKCFSE 349
           P+IL+PG+GG+QLE+ LT K       C      K    +F LW +  +    +  C+++
Sbjct: 35  PVILVPGDGGSQLESNLTGKPSVVHYVCS-----KQTADYFDLWLNLQLFTPLVIDCWAD 89

Query: 350 RMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQLXYED 529
            M            N PGV+ RV  FG+T+S+ +LD +      Y   +V+S+    Y  
Sbjct: 90  NMQLVFNTTTGLSENMPGVDIRVAGFGATESVEWLDKSKASQGRYFFDIVDSMVSWGYRR 149

Query: 530 GKNMFGAPYDFR 565
           GKN+ GAP+D+R
Sbjct: 150 GKNVIGAPFDWR 161



>gb:BC066589_2554464 Danio rerio cDNA clone IMAGE:6959873, partial
           cds.
          Length = 453

 Score = 84.3 bits (207), Expect = 1e-15
 Identities = 48/132 (36%), Positives = 70/132 (53%)
 Frame = +2

Query: 170 PLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSPLTKCFSE 349
           P++LIPG+ GNQLEA+L    KP+ +    Y   K  + +F LW +  +L+     C+ +
Sbjct: 80  PVVLIPGDLGNQLEAKLD---KPSVVH---YICYKKTEDYFTLWLNLELLVPVAIDCWID 133

Query: 350 RMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQLXYED 529
            M              PGV+ RVP FG T SL YLDP+ + +  Y   +V+SL    Y  
Sbjct: 134 NMRLLYNRTNHLSEPPPGVDIRVPGFGETYSLEYLDPSKRSVGMYFFTIVQSLVDWGYTR 193

Query: 530 GKNMFGAPYDFR 565
             ++ GAPYD+R
Sbjct: 194 NDDVRGAPYDWR 205



>gb:AP004073_1837337 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0614D08.
          Length = 363

 Score = 79.7 bits (195), Expect = 3e-14
 Identities = 46/109 (42%), Positives = 63/109 (57%), Gaps = 2/109 (1%)
 Frame = +2

Query: 293 RLWFDSSVLLSP--LTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNL 466
           RLW + + L     L+ C+++++            N PGV+TRV +FGST+     DP  
Sbjct: 9   RLWENFTALQEDPALSPCYADQLRLVYDPVAGDYRNVPGVDTRVVSFGSTRGFRSDDPAR 68

Query: 467 KHISAYMAPLVESLEQLXYEDGKNMFGAPYDFRYGLAAKGHPSQVGSKF 613
           K +   M  LVE+LE+  Y +G+N+FGAPYDFRY  AA G PS V S F
Sbjct: 69  KDVC--MERLVEALEEEGYAEGENLFGAPYDFRYAPAAPGLPSGVFSDF 115



>gb:RNU62803_2137559 Rattus norvegicus lecithin:cholesterol
           acyltransferase mRNA, complete cds.
          Length = 440

 Score = 76.3 bits (186), Expect = 4e-13
 Identities = 47/139 (33%), Positives = 72/139 (51%)
 Frame = +2

Query: 149 QATTNLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSP 328
           + + +  P+IL+PG  GN+LEA+L    KP  +   W   +K  D +F +W D ++ L  
Sbjct: 41  ELSNHTRPVILVPGCMGNRLEAKLD---KPNVV--NWLCYRKTED-FFTIWLDFNMFLPL 94

Query: 329 LTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESL 508
              C+ +              NAPGV+ RVP FG T S+ YLD N   ++ Y+  LV++L
Sbjct: 95  GVDCWIDNTRVVYNRSSGHMSNAPGVQIRVPGFGKTYSVEYLDDN--KLAGYLHTLVQNL 152

Query: 509 EQLXYEDGKNMFGAPYDFR 565
               Y   + +  APYD+R
Sbjct: 153 VNNGYVRDETVRAAPYDWR 171



>gb:AF272861_1417415 Tupaia glis lecithin cholesterol
           acyltransferase mRNA, complete cds.
          Length = 440

 Score = 76.3 bits (186), Expect = 4e-13
 Identities = 48/141 (34%), Positives = 72/141 (51%)
 Frame = +2

Query: 149 QATTNLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSP 328
           + + +  P+IL+PG  GNQLEA+L    KP  +   W   +K  D +F +W D ++ L  
Sbjct: 41  ELSNHTRPVILVPGCLGNQLEAKLD---KPDVV--NWMCYRKTED-FFTIWLDLNMFLPL 94

Query: 329 LTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESL 508
              C+ +              NAPGV+ RVP FG T  + YLD +   ++ YM  LV++L
Sbjct: 95  GVDCWIDNTRVTYNHSSGRVSNAPGVQIRVPGFGKTYPVEYLDNS--KLAGYMHTLVQNL 152

Query: 509 EQLXYEDGKNMFGAPYDFRYG 571
               Y   + +  APYD+R G
Sbjct: 153 VNNGYVRDETVRAAPYDWRLG 173



>pir|S11214|XXRTN phosphatidylcholine-sterol O-acyltransferase (EC
           2.3.1.43) precursor - rat
          Length = 440

 Score = 76.3 bits (186), Expect = 4e-13
 Identities = 47/139 (33%), Positives = 72/139 (51%)
 Frame = +2

Query: 149 QATTNLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSP 328
           + + +  P+IL+PG  GN+LEA+L    KP  +   W   +K  D +F +W D ++ L  
Sbjct: 41  ELSNHTRPVILVPGCMGNRLEAKLD---KPNVV--NWLCYRKTED-FFTIWLDFNMFLPL 94

Query: 329 LTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESL 508
              C+ +              NAPGV+ RVP FG T S+ YLD N   ++ Y+  LV++L
Sbjct: 95  GVDCWIDNTRVVYNRSSGHMSNAPGVQIRVPGFGKTYSVEYLDDN--KLAGYLNTLVQNL 152

Query: 509 EQLXYEDGKNMFGAPYDFR 565
               Y   + +  APYD+R
Sbjct: 153 VNNGYVRDETVRAAPYDWR 171



>sp|P18424|LCAT_RAT Phosphatidylcholine-sterol acyltransferase
           precursor (EC 2.3.1.43) (Lecithin-cholesterol
           acyltransferase) (Phospholipid-cholesterol
           acyltransferase).>gb:RNLCATMR_2135162 Rat mRNA for
           lecithin-cholesterol acyltransferase (EC 2.3.1.43)
           (LCAT).
          Length = 440

 Score = 76.3 bits (186), Expect = 4e-13
 Identities = 47/139 (33%), Positives = 72/139 (51%)
 Frame = +2

Query: 149 QATTNLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSP 328
           + + +  P+IL+PG  GN+LEA+L    KP  +   W   +K  D +F +W D ++ L  
Sbjct: 41  ELSNHTRPVILVPGCMGNRLEAKLD---KPNVV--NWLCYRKTED-FFTIWLDFNMFLPL 94

Query: 329 LTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESL 508
              C+ +              NAPGV+ RVP FG T S+ YLD N   ++ Y+  LV++L
Sbjct: 95  GVDCWIDNTRVVYNRSSGHMSNAPGVQIRVPGFGKTYSVEYLDDN--KLAGYLNTLVQNL 152

Query: 509 EQLXYEDGKNMFGAPYDFR 565
               Y   + +  APYD+R
Sbjct: 153 VNNGYVRDETVRAAPYDWR 171



>gb:BC028861_2096355 Mus musculus lecithin cholesterol
           acyltransferase, mRNA (cDNA clone MGC:25630
           IMAGE:4212194), complete cds.
          Length = 438

 Score = 75.5 bits (184), Expect = 7e-13
 Identities = 46/139 (33%), Positives = 73/139 (52%)
 Frame = +2

Query: 149 QATTNLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSP 328
           + + +  P+IL+PG  GN+LEA+L    KP  +   W   +K  D +F +W D ++ L  
Sbjct: 41  ELSNHTRPVILVPGCLGNRLEAKLD---KPDVV--NWMCYRKTED-FFTIWLDFNLFLPL 94

Query: 329 LTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESL 508
              C+ +              NAPGV+ RVP FG T+S+ Y+D N   ++ Y+  LV++L
Sbjct: 95  GVDCWIDNTRIVYNHSSGRVSNAPGVQIRVPGFGKTESVEYVDDN--KLAGYLHTLVQNL 152

Query: 509 EQLXYEDGKNMFGAPYDFR 565
               Y   + +  APYD+R
Sbjct: 153 VNNGYVRDETVRAAPYDWR 171



>gb:AK004914_1152689 Mus musculus adult male liver cDNA, RIKEN
           full-length enriched library, clone:1300006D18
           product:lecithin cholesterol acyltransferase, full
           insert sequence.
          Length = 444

 Score = 75.5 bits (184), Expect = 7e-13
 Identities = 46/139 (33%), Positives = 73/139 (52%)
 Frame = +2

Query: 149 QATTNLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSP 328
           + + +  P+IL+PG  GN+LEA+L    KP  +   W   +K  D +F +W D ++ L  
Sbjct: 47  ELSNHTRPVILVPGCLGNRLEAKLD---KPDVV--NWMCYRKTED-FFTIWLDFNLFLPL 100

Query: 329 LTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESL 508
              C+ +              NAPGV+ RVP FG T+S+ Y+D N   ++ Y+  LV++L
Sbjct: 101 GVDCWIDNTRIVYNHSSGRVSNAPGVQIRVPGFGKTESVEYVDDN--KLAGYLHTLVQNL 158

Query: 509 EQLXYEDGKNMFGAPYDFR 565
               Y   + +  APYD+R
Sbjct: 159 VNNGYVRDETVRAAPYDWR 177



>sp|P16301|LCAT_MOUSE Phosphatidylcholine-sterol acyltransferase
           precursor (EC 2.3.1.43) (Lecithin-cholesterol
           acyltransferase) (Phospholipid-cholesterol
           acyltransferase).>pir|A34158|XXMSN
           phosphatidylcholine-sterol O-acyltransferase (EC
           2.3.1.43) precursor - mouse>gb:AF236363S4_2060186 Mus
           musculus prosome Mecl1 (Psmb10) gene, exons 1 and 2 and
           partial cds; lecithin-cholesterol acyltransferase Lcat
           (Lcat) gene, exons 1 through 6 and complete cds; and
           Slc12a4 (Slc12a4) gene, last exon and partial
           cds.>gb:MUSLCATX_2128714 Murine cholesterol
           acyltransferase (LCAT) mRNA, complete cds.
          Length = 438

 Score = 75.5 bits (184), Expect = 7e-13
 Identities = 46/139 (33%), Positives = 73/139 (52%)
 Frame = +2

Query: 149 QATTNLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSP 328
           + + +  P+IL+PG  GN+LEA+L    KP  +   W   +K  D +F +W D ++ L  
Sbjct: 41  ELSNHTRPVILVPGCLGNRLEAKLD---KPDVV--NWMCYRKTED-FFTIWLDFNLFLPL 94

Query: 329 LTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESL 508
              C+ +              NAPGV+ RVP FG T+S+ Y+D N   ++ Y+  LV++L
Sbjct: 95  GVDCWIDNTRIVYNHSSGRVSNAPGVQIRVPGFGKTESVEYVDDN--KLAGYLHTLVQNL 152

Query: 509 EQLXYEDGKNMFGAPYDFR 565
               Y   + +  APYD+R
Sbjct: 153 VNNGYVRDETVRAAPYDWR 171



>gb:BT009747_2151240 Synthetic construct Homo sapiens
           lecithin-cholesterol acyltransferase mRNA, partial cds.
          Length = 441

 Score = 75.1 bits (183), Expect = 9e-13
 Identities = 47/139 (33%), Positives = 72/139 (51%)
 Frame = +2

Query: 149 QATTNLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSP 328
           + + +  P+IL+PG  GNQLEA+L    KP  +   W   +K  D +F +W D ++ L  
Sbjct: 41  ELSNHTRPVILVPGCLGNQLEAKLD---KPDVV--NWMCYRKTED-FFTIWLDLNMFLPL 94

Query: 329 LTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESL 508
              C+ +              NAPGV+ RVP FG T S+ YLD +   ++ Y+  LV++L
Sbjct: 95  GVDCWIDNTRVVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLDSS--KLAGYLHTLVQNL 152

Query: 509 EQLXYEDGKNMFGAPYDFR 565
               Y   + +  APYD+R
Sbjct: 153 VNNGYVRDETVRAAPYDWR 171



>gb:HUMLCATGA_2034023 Human lecithin-cholesterol acyltransferase
           (LCAT) gene, 3' end.
          Length = 428

 Score = 75.1 bits (183), Expect = 9e-13
 Identities = 47/139 (33%), Positives = 72/139 (51%)
 Frame = +2

Query: 149 QATTNLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSP 328
           + + +  P+IL+PG  GNQLEA+L    KP  +   W   +K  D +F +W D ++ L  
Sbjct: 29  ELSNHTRPVILVPGCLGNQLEAKLD---KPDVV--NWMCYRKTED-FFTIWLDLNMFLPL 82

Query: 329 LTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESL 508
              C+ +              NAPGV+ RVP FG T S+ YLD +   ++ Y+  LV++L
Sbjct: 83  GVDCWIDNTRVVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLDSS--KLAGYLHTLVQNL 140

Query: 509 EQLXYEDGKNMFGAPYDFR 565
               Y   + +  APYD+R
Sbjct: 141 VNNGYVRDETVRAAPYDWR 159



>gb:HSLCAT1_2016956 Human mRNA for lecithin:cholesterol
           acyltransferase (LCAT); EC 2.3.1.43.>gb:HUMLCATA_2034022
           Human lecithin:cholesterol acyltransferase (LCAT) mRNA,
           3' end.
          Length = 424

 Score = 75.1 bits (183), Expect = 9e-13
 Identities = 47/139 (33%), Positives = 72/139 (51%)
 Frame = +2

Query: 149 QATTNLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSP 328
           + + +  P+IL+PG  GNQLEA+L    KP  +   W   +K  D +F +W D ++ L  
Sbjct: 25  ELSNHTRPVILVPGCLGNQLEAKLD---KPDVV--NWMCYRKTED-FFTIWLDLNMFLPL 78

Query: 329 LTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESL 508
              C+ +              NAPGV+ RVP FG T S+ YLD +   ++ Y+  LV++L
Sbjct: 79  GVDCWIDNTRVVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLDSS--KLAGYLHTLVQNL 136

Query: 509 EQLXYEDGKNMFGAPYDFR 565
               Y   + +  APYD+R
Sbjct: 137 VNNGYVRDETVRAAPYDWR 155



>sp|Q08758|LCAT_PAPAN Phosphatidylcholine-sterol acyltransferase
           precursor (EC 2.3.1.43) (Lecithin-cholesterol
           acyltransferase) (Phospholipid-cholesterol
           acyltransferase).>pir|JC1502|JC1502
           phosphatidylcholine-sterol O-acyltransferase (EC
           2.3.1.43) precursor - baboon>gb:BABLCAT_1966310 Papio
           anubis lecithin cholesterol acyltransferase mRNA,
           complete cds.
          Length = 440

 Score = 75.1 bits (183), Expect = 9e-13
 Identities = 47/139 (33%), Positives = 72/139 (51%)
 Frame = +2

Query: 149 QATTNLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSP 328
           + + +  P+IL+PG  GNQLEA+L    KP  +   W   +K  D +F +W D ++ L  
Sbjct: 41  ELSNHTRPVILVPGCLGNQLEAKLD---KPDVV--NWMCYRKTED-FFTIWLDLNMFLPL 94

Query: 329 LTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESL 508
              C+ +              NAPGV+ RVP FG T S+ YLD +   ++ Y+  LV++L
Sbjct: 95  GVDCWIDNTRVVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLDSS--KLAGYLHTLVQNL 152

Query: 509 EQLXYEDGKNMFGAPYDFR 565
               Y   + +  APYD+R
Sbjct: 153 VNNGYVRDETVRAAPYDWR 171



>sp|P04180|LCAT_HUMAN Phosphatidylcholine-sterol acyltransferase
           precursor (EC 2.3.1.43) (Lecithin-cholesterol
           acyltransferase) (Phospholipid-cholesterol
           acyltransferase).>pir|A00571|XXHUN
           phosphatidylcholine-sterol O-acyltransferase (EC
           2.3.1.43) precursor [validated] -
           human>gb:AX077318_1460683 Sequence 1 from Patent
           WO0105943.>gb:AY422210_1949813 Homo sapiens
           lecithin-cholesterol acyltransferase (LCAT) gene,
           complete cds.>gb:BC014781_1974782 Homo sapiens
           lecithin-cholesterol acyltransferase, mRNA (cDNA clone
           MGC:17087 IMAGE:4155094), complete
           cds.>gb:BT009748_1990898 Homo sapiens
           lecithin-cholesterol acyltransferase mRNA, complete
           cds.>gb:HSLCATG_2016957 H.sapiens gene for
           lecithin-cholesterol acyltransferase
           (LCAT).>gb:HUMLCAT_2034021 Human lecithin-cholesterol
           acyltransferase mRNA, complete cds, with 5' and 3'
           flanking DNA sequences.
          Length = 440

 Score = 75.1 bits (183), Expect = 9e-13
 Identities = 47/139 (33%), Positives = 72/139 (51%)
 Frame = +2

Query: 149 QATTNLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSP 328
           + + +  P+IL+PG  GNQLEA+L    KP  +   W   +K  D +F +W D ++ L  
Sbjct: 41  ELSNHTRPVILVPGCLGNQLEAKLD---KPDVV--NWMCYRKTED-FFTIWLDLNMFLPL 94

Query: 329 LTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESL 508
              C+ +              NAPGV+ RVP FG T S+ YLD +   ++ Y+  LV++L
Sbjct: 95  GVDCWIDNTRVVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLDSS--KLAGYLHTLVQNL 152

Query: 509 EQLXYEDGKNMFGAPYDFR 565
               Y   + +  APYD+R
Sbjct: 153 VNNGYVRDETVRAAPYDWR 171



>gb:AF324887_2487737 Anas platyrhynchos lecithin cholesterol
           acyltransferase mRNA, complete cds.
          Length = 451

 Score = 74.7 bits (182), Expect = 1e-12
 Identities = 47/139 (33%), Positives = 70/139 (50%)
 Frame = +2

Query: 155 TTNLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSPLT 334
           T +  P++L+PG  GNQLEA+L    KP  +   W   +K  D +F +W + +  L    
Sbjct: 42  TNSTPPVVLVPGCLGNQLEAKLD---KPDVV--NWMCYRKTED-YFTIWLNLNTFLPVGV 95

Query: 335 KCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQ 514
            C+ +              NAPGV  RVP FG T S+ YLD +   ++ Y+  LV++L  
Sbjct: 96  DCWIDNTRVVYNRTSRKMSNAPGVHIRVPGFGKTYSVEYLDQS--KLAGYLHTLVQNLVN 153

Query: 515 LXYEDGKNMFGAPYDFRYG 571
             Y   + +  APYD+R G
Sbjct: 154 NGYVRDQTVRAAPYDWRVG 172



>gb:AY092004_1936305 Macaca sp. lecithin cholesterol acyltransferase
           gene, partial cds.
          Length = 209

 Score = 73.9 bits (180), Expect = 2e-12
 Identities = 46/139 (33%), Positives = 72/139 (51%)
 Frame = +2

Query: 149 QATTNLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSP 328
           + + +  P+IL+PG  GNQLEA+L    KP  +   W   +K  D +F +W D ++ L  
Sbjct: 11  ELSNHTRPVILVPGCLGNQLEAKLD---KPEVV--NWMCYRKTED-FFTIWLDLNMXLPL 64

Query: 329 LTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESL 508
              C+ +              NAPGV+ RVP FG T S+ YLD +   ++ Y+  LV++L
Sbjct: 65  GVDCWIDNTRVVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLDSS--KLAGYLHTLVQNL 122

Query: 509 EQLXYEDGKNMFGAPYDFR 565
               Y   + +  APY++R
Sbjct: 123 VNNGYVRDETVRAAPYBWR 141



>gb:AY092002_1936303 Gorilla gorilla lecithin cholesterol
           acyltransferase gene, partial cds.
          Length = 209

 Score = 73.6 bits (179), Expect = 2e-12
 Identities = 47/139 (33%), Positives = 70/139 (50%)
 Frame = +2

Query: 149 QATTNLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSP 328
           + + +  P+IL+PG  GNQLEA+L    KP  +   W   +K  D +F +W D ++ L  
Sbjct: 11  ELSNHTRPVILVPGCLGNQLEAKLD---KPDVV--NWMCYRKTED-FFTIWLDLNMFLPL 64

Query: 329 LTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESL 508
              C                 NAPGV+ RVP FG T S+ YLD +   ++ Y+  LV++L
Sbjct: 65  GVDCXXXXXXVVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLDSS--KLAGYLHTLVQNL 122

Query: 509 EQLXYEDGKNMFGAPYDFR 565
               Y   + +  APYD+R
Sbjct: 123 VNNGYVRDETVRAAPYDWR 141



>sp|P53761|LCAT_RABIT Phosphatidylcholine-sterol acyltransferase
           precursor (EC 2.3.1.43) (Lecithin-cholesterol
           acyltransferase) (Phospholipid-cholesterol
           acyltransferase).>gb:RABLCAT_1443964 Oryctolagus
           cuniculus mRNA for lecithin-cholesterol acyltransferase,
           complete cds.
          Length = 440

 Score = 73.6 bits (179), Expect = 2e-12
 Identities = 47/139 (33%), Positives = 72/139 (51%)
 Frame = +2

Query: 149 QATTNLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSP 328
           + + +  P+IL+PG  GNQLEA+L    KP+ +   W   +K  D +F +W D ++ L  
Sbjct: 41  ELSNHTRPVILVPGCLGNQLEAKLD---KPSVV--NWMCYRKTED-FFTIWLDLNMFLPL 94

Query: 329 LTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESL 508
              C+ +               +PGV+ RVP FG T S+ YLD N   ++ YM  LV++L
Sbjct: 95  GVDCWIDNTRVVYNRSSGRVVISPGVQIRVPGFGKTYSVEYLDNN--KLAGYMHTLVQNL 152

Query: 509 EQLXYEDGKNMFGAPYDFR 565
               Y   + +  APYD+R
Sbjct: 153 VNNGYVRDETVRAAPYDWR 171



>gb:AY092003_1936304 Pongo pygmaeus lecithin cholesterol
           acyltransferase gene, partial cds.
          Length = 209

 Score = 72.4 bits (176), Expect = 6e-12
 Identities = 46/139 (33%), Positives = 71/139 (51%)
 Frame = +2

Query: 149 QATTNLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSP 328
           + + +  P+IL+PG  GNQLEA+L    KP  +   W   +K  D +F +W D ++ L  
Sbjct: 11  ELSNHTRPVILVPGCLGNQLEAKLD---KPDVV--NWMCYRKTED-FFTIWLDLNMFLPL 64

Query: 329 LTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESL 508
              C+ +              NAPGV+ RVP FG T S+ YLD +   ++ Y+  LV++L
Sbjct: 65  GVDCWIDNTRVVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLDSS--KLAGYLHTLVQNL 122

Query: 509 EQLXYEDGKNMFGAPYDFR 565
               Y   + +  APY +R
Sbjct: 123 VNNGYVRDETVRAAPYGWR 141



>pir|I50662|I50662 lecithin-cholesterol acyltransferase - chicken
           (fragment)
          Length = 413

 Score = 72.0 bits (175), Expect = 7e-12
 Identities = 47/139 (33%), Positives = 68/139 (48%)
 Frame = +2

Query: 155 TTNLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSPLT 334
           T +  P  L+PG  GNQLEA+L    KP  +   W   +K  D +F +W + +  L    
Sbjct: 41  TNSTPPWCLVPGFLGNQLEAKLD---KPDVV--NWMCYRKTED-YFTIWLNLNTFLPVGV 94

Query: 335 KCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQ 514
            C+ +              NAPGV  RVP FG T S+ YLD +   ++ Y+  LV++L  
Sbjct: 95  DCWIDNTRVVYNRTARKMTNAPGVHIRVPGFGKTYSVEYLDQS--KLAGYLHTLVQNLVN 152

Query: 515 LXYEDGKNMFGAPYDFRYG 571
             Y   + +  APYD+R G
Sbjct: 153 NGYVRDQTVRAAPYDWRVG 171



>sp|P53760|LCAT_CHICK Phosphatidylcholine-sterol acyltransferase
           precursor (EC 2.3.1.43) (Lecithin-cholesterol
           acyltransferase) (Phospholipid-cholesterol
           acyltransferase) (Fragment).>gb:GGLECCHAC_2573263
           G.gallus mRNA for lecithin-cholesterol acyltransferase.
          Length = 413

 Score = 72.0 bits (175), Expect = 7e-12
 Identities = 47/139 (33%), Positives = 68/139 (48%)
 Frame = +2

Query: 155 TTNLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSPLT 334
           T +  P  L+PG  GNQLEA+L    KP  +   W   +K  D +F +W + +  L    
Sbjct: 41  TNSTPPWCLVPGFLGNQLEAKLD---KPDVV--NWMCYRKTED-YFTIWLNLNTFLPVGV 94

Query: 335 KCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQ 514
            C+ +              NAPGV  RVP FG T S+ YLD +   ++ Y+  LV++L  
Sbjct: 95  DCWIDNTRVVYNRTARKMTNAPGVHIRVPGFGKTYSVEYLDQS--KLAGYLHTLVQNLVN 152

Query: 515 LXYEDGKNMFGAPYDFRYG 571
             Y   + +  APYD+R G
Sbjct: 153 NGYVRDQTVRAAPYDWRVG 171



>gb:BC081072_2561980 Xenopus laevis MGC82035 protein, mRNA (cDNA
           clone MGC:82035 IMAGE:7010984), complete cds.
          Length = 426

 Score = 71.6 bits (174), Expect = 9e-12
 Identities = 43/137 (31%), Positives = 69/137 (50%)
 Frame = +2

Query: 155 TTNLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSPLT 334
           T +  P++L+PG  GNQLEA++  +         W   KK  D +F +W + ++ L    
Sbjct: 45  TNSTPPVVLVPGCFGNQLEAKVDKEDV-----VNWVCYKKTDD-YFTIWLNLNMFLPLGI 98

Query: 335 KCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQ 514
            C+ + +            NAPGV+ +VP FG T S+ YLD +   ++ Y   LV++L  
Sbjct: 99  DCWIDNIRVVYNKTTRMASNAPGVDVQVPGFGKTHSVEYLDKS--KLAGYFHTLVQNLVN 156

Query: 515 LXYEDGKNMFGAPYDFR 565
             Y   + +  APYD+R
Sbjct: 157 NGYVRDQTVRAAPYDWR 173



>gb:BC075304_2558409 Xenopus tropicalis lecithin-cholesterol
           acyltransferase, mRNA (cDNA clone MGC:88964
           IMAGE:7003422), complete cds.
          Length = 426

 Score = 68.6 bits (166), Expect = 8e-11
 Identities = 41/132 (31%), Positives = 66/132 (50%)
 Frame = +2

Query: 170 PLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSPLTKCFSE 349
           P++L+PG  GNQLEA++  +         W   +K  D +F +W + ++ L     C+ +
Sbjct: 50  PVVLVPGCFGNQLEAKVDKEDV-----VNWMCYRKTDD-YFTIWLNLNMFLPLGIDCWID 103

Query: 350 RMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQLXYED 529
            +            NAPGV+  VP FG T S+ YLD +   ++ Y   LV++L    Y  
Sbjct: 104 NIRVVYNKTTRMASNAPGVDVHVPGFGKTYSVEYLDKS--KLAGYFHTLVQNLVNNGYVR 161

Query: 530 GKNMFGAPYDFR 565
            + +  APYD+R
Sbjct: 162 DQTVRAAPYDWR 173



>gb:AF183897_1415624 Didelphis marsupialis lecithin: cholesterol
           acyl-transferase (LCAT) gene, partial cds.
          Length = 148

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 36/103 (34%), Positives = 53/103 (51%)
 Frame = +2

Query: 257 WYPVKKDGDGWFRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGST 436
           W   +K  D +F +W D ++ L     C+ +              NAPGV+ RVP FG T
Sbjct: 1   WMCYRKTED-FFTIWMDLNMFLPLGADCWIDNTRVVYNRTTGQMSNAPGVQIRVPGFGKT 59

Query: 437 QSLLYLDPNLKHISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
            S+ YLDPN   +++YM  LV++L    Y   + +  APYD+R
Sbjct: 60  YSVEYLDPN--KLASYMHTLVQNLVNNGYVRDETVRAAPYDWR 100



>gb:AE016959_1021069 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC078944_1541608
           Genomic Sequence for Oryza sativa, Nipponbare strain,
           clone OSJNBa0089D15, from Chromosome 10, complete
           sequence.>gb:AE017061_1750888 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 15 of 77 of the
           complete sequence.
          Length = 139

 Score = 63.5 bits (153), Expect = 3e-09
 Identities = 36/107 (33%), Positives = 55/107 (51%), Gaps = 11/107 (10%)
 Frame = +2

Query: 152 ATTNLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDG----------WFRLW 301
           A  +LHP++L+PGNG +QL+A LT  Y+P+     W P    G            WFRLW
Sbjct: 24  AAVDLHPIVLLPGNGCSQLDAELTEHYEPS----PWAPASCGGAAAAGKGKGRRRWFRLW 79

Query: 302 FDSSVLLSP-LTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQ 439
            +S+ L  P +  C+++++            N   V TRV +FG+T+
Sbjct: 80  KNSTALGDPAVALCYADQLRVVYDRAVADYRNVARVWTRVVSFGTTR 126



>gb:MGLCAT02_2113645 Myoxus glis lecithin:cholesterol acyl
           transferase (LCAT) gene, exon 6 and partial cds.
          Length = 297

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 33/95 (34%), Positives = 48/95 (50%)
 Frame = +2

Query: 281 DGWFRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDP 460
           + +F +W D ++ L     C+ +              NAPGVE RVP FG T S+ YLD 
Sbjct: 1   EDFFTVWLDLNMFLPLGVNCWIDNTRVIYNRSSGYMSNAPGVEIRVPGFGKTYSIEYLDD 60

Query: 461 NLKHISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
           N   ++ YM  LV++L    Y   + +  APYD+R
Sbjct: 61  N--KLAGYMHTLVQNLVNNGYVRDETVRAAPYDWR 93



>gb:AP005640_1855253 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0006O15.
          Length = 135

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 39/91 (42%), Positives = 50/91 (54%), Gaps = 1/91 (1%)
 Frame = +2

Query: 161 NLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLS-PLTK 337
           +LH + ++PG G + LEARLT  Y+P S+      +K  G GWF LW +SS L +     
Sbjct: 35  DLHLIFVVPGVGCSNLEARLTEAYRP-SVQPSCGALK--GKGWFGLWDNSSDLSTYHYGD 91

Query: 338 CFSERMMXXXXXXXXXXXNAPGVETRVPNFG 430
           CF E+M            N PGVETRV NFG
Sbjct: 92  CFKEQMSLVYDPVSNDYRNLPGVETRVANFG 122



>gb:AF183898_1415625 Erinaceus europaeus lecithin: cholesterol
           acyl-transferase (LCAT) gene, partial cds.
          Length = 141

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 33/93 (35%), Positives = 47/93 (50%)
 Frame = +2

Query: 287 WFRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNL 466
           +F +W D ++ L     C+ +              NAPGVE RVP FG T S+ YLD N 
Sbjct: 3   FFTIWLDLNIFLPLGIDCWIDNTRVIYNHTTGYLSNAPGVEIRVPGFGKTYSIEYLDKN- 61

Query: 467 KHISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
             ++ YM  LV++L    Y   + +  APYD+R
Sbjct: 62  -KLAGYMHTLVQNLVNNGYVRDETVRAAPYDWR 93



>gb:NLLCAT02_2130909 Nannospalax leucodon lecithin:cholesterol acyl
           transferase (LCAT) gene, exon 6 and partial cds.
          Length = 296

 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 33/93 (35%), Positives = 48/93 (51%)
 Frame = +2

Query: 287 WFRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNL 466
           +F +W D ++ LS    C+ +              NAPGV+ RVP FG T S+ YLD N 
Sbjct: 1   FFTIWLDLNMFLSLGVDCWIDNTRVVYNRSSGRVSNAPGVQIRVPGFGKTYSVEYLDNN- 59

Query: 467 KHISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
             ++ YM  LV++L    Y   + +  APYD+R
Sbjct: 60  -KLAGYMHTLVQNLVNNRYVRDETVRAAPYDWR 91



>gb:SGLCAT02_2139953 Sciurus griseus lecithin:cholesterol acyl
           transferase (LCAT) gene, exon 6 and partial cds.
          Length = 292

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 32/93 (34%), Positives = 48/93 (51%)
 Frame = +2

Query: 287 WFRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNL 466
           +F +W D ++ L     C+ + +            NAPGV+ RVP FG T S+ YLD N 
Sbjct: 2   FFTIWLDLNMFLPLGIDCWIDNIRVVYNRSSGRVSNAPGVQIRVPGFGKTYSVEYLDSN- 60

Query: 467 KHISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
             ++ YM  LV++L    Y   + +  APYD+R
Sbjct: 61  -KLAGYMHTLVQNLVNNGYVQDETVRAAPYDWR 92



>gb:GLO536381_2112916 Graphiurus lorraineus partial lcat gene for
           lecithin cholesterol acyl transferase, exons
           1-5.>gb:GMI536377_2112918 Graphiurus microtis partial
           lcat gene for lecithin cholesterol acyl transferase,
           exons 1-5.>gb:GMU536376_2112922 Graphiurus murinus
           partial lcat gene for lecithin cholesterol acyl
           transferase, exons 1-5.>gb:GPA536380_2112931 Graphiurus
           parvus partial lcat gene for lecithin cholesterol acyl
           transferase, exons 1-5.
          Length = 136

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 32/92 (34%), Positives = 46/92 (50%)
 Frame = +2

Query: 290 FRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLK 469
           F +W D ++ L     C+ +              NAPGV+ RVP FG T S+ YLD N  
Sbjct: 1   FTIWLDLNIFLPLGVNCWIDNTRVIYNRSSGYMSNAPGVQIRVPGFGKTYSIEYLDDN-- 58

Query: 470 HISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
            ++ YM  LV++L    Y   + +  APYD+R
Sbjct: 59  KLAGYMHTLVQNLVNNGYVRDETVRAAPYDWR 90



>gb:GHLCAT02_2112913 Gerbillus henleyi lecithin:cholesterol acyl
           transferase (LCAT) gene, exon 6 and partial cds.
          Length = 295

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 33/93 (35%), Positives = 47/93 (50%)
 Frame = +2

Query: 287 WFRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNL 466
           +F +W D ++ L     C+ +              NAPGVE RVP FG T S+ YLD N 
Sbjct: 2   FFTIWLDLNMFLPLGVDCWIDNTRVVYNRSSGRVSNAPGVEIRVPGFGKTYSVEYLDDN- 60

Query: 467 KHISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
             ++ YM  LV++L    Y   + +  APYD+R
Sbjct: 61  -KLAGYMHTLVQNLVNNGYVRDETVRAAPYDWR 92



>gb:EME536373_2112818 Eliomys melanurus partial lcat gene for
           lecithin cholesterol acyl transferase, exons 1-5.
          Length = 136

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 32/92 (34%), Positives = 46/92 (50%)
 Frame = +2

Query: 290 FRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLK 469
           F +W D ++ L     C+ +              NAPGV+ RVP FG T S+ YLD N  
Sbjct: 1   FTIWLDLNIFLPLGVNCWIDNTRVIYNRSSGYMSNAPGVQIRVPGFGKTYSIEYLDDN-- 58

Query: 470 HISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
            ++ YM  LV++L    Y   + +  APYD+R
Sbjct: 59  KLAGYMHTLVQNLVNNGYVRDETVRAAPYDWR 90



>gb:DLA536374_2112751 Dryomys laniger partial lcat gene for lecithin
           cholesterol acyl transferase, exons 1-5.
          Length = 125

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 32/92 (34%), Positives = 46/92 (50%)
 Frame = +2

Query: 290 FRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLK 469
           F +W D ++ L     C+ +              NAPGV+ RVP FG T S+ YLD N  
Sbjct: 1   FTIWLDLNIFLPLGVNCWIDNTRVIYNRSSGYMSNAPGVQIRVPGFGKTYSIEYLDDN-- 58

Query: 470 HISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
            ++ YM  LV++L    Y   + +  APYD+R
Sbjct: 59  KLAGYMHTLVQNLVNNGYVRDETVRAAPYDWR 90



>sp|O35573|LCAT_ELIQU Phosphatidylcholine-sterol acyltransferase (EC
           2.3.1.43) (Lecithin- cholesterol acyltransferase)
           (Phospholipid-cholesterol acyltransferase)
           (Fragment).>gb:EQLCAT02_2112822 Eliomys quercinus
           lecithin:cholesterol acyl transferase (LCAT) gene, exon
           6 and partial cds.
          Length = 299

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 32/92 (34%), Positives = 46/92 (50%)
 Frame = +2

Query: 290 FRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLK 469
           F +W D ++ LS    C+ +              NAPGV+ RVP FG T S+ YLD N  
Sbjct: 4   FTIWLDLNIFLSLGVDCWIDNTRVIYNRSSGYMSNAPGVQIRVPGFGKTYSIEYLDDN-- 61

Query: 470 HISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
            ++ YM  LV++L    Y   + +   PYD+R
Sbjct: 62  KLAGYMHTLVQNLVNNAYVRDETVRAPPYDWR 93



>gb:OLLCAT01_2130970 Octodon lunatus lecithin:cholesterol acyl
           transferase (LCAT) gene, exons 2 to 5 and partial cds.
          Length = 134

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 33/93 (35%), Positives = 47/93 (50%)
 Frame = +2

Query: 287 WFRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNL 466
           +F +W D ++ L     C+ +              NAPGVE RVP FG T S+ YLD N 
Sbjct: 2   FFTIWLDLNMFLPFGVDCWIDNTRVVYNRSSGRVSNAPGVEIRVPGFGKTYSVEYLDSN- 60

Query: 467 KHISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
             ++ YM  LV++L    Y   + +  APYD+R
Sbjct: 61  -KLAGYMHTLVQNLVNNGYVRDETVRAAPYDWR 92



>gb:MSP275583_2124774 Myospalax sp. partial lcat gene for lecithin
           cholesterol acyl transferase, exon 2 and joined CDS.
          Length = 268

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 34/92 (36%), Positives = 46/92 (50%)
 Frame = +2

Query: 290 FRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLK 469
           F +W D ++ LS    C+ +              NAPGV+ RVP FG T S+ YLD N  
Sbjct: 2   FTIWLDLNMFLSLGVDCWIDNTRVVYNRSSGHVSNAPGVQIRVPGFGKTYSVEYLDDNK- 60

Query: 470 HISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
              AYM  LV++L    Y   + +  APYD+R
Sbjct: 61  --LAYMHTLVQNLVNNGYVRDETVRAAPYDWR 90



>gb:MMARLCAT2_2114203 Marmota marmota lecithin:cholesterol acyl
           transferase (LCAT) gene, exon 6 and partial cds.
          Length = 298

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 32/95 (33%), Positives = 48/95 (50%)
 Frame = +2

Query: 281 DGWFRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDP 460
           + +F +W D ++ L     C+ +              NAPGV+ RVP FG T S+ YLD 
Sbjct: 2   EDFFTIWLDLNMFLPLGVDCWIDNTRVVYNRSSGRVSNAPGVQIRVPGFGKTYSVEYLDS 61

Query: 461 NLKHISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
           N   ++ YM  LV++L    Y   + +  APYD+R
Sbjct: 62  N--KLAGYMHTLVQNLVNNGYGRDETVRAAPYDWR 94



>sp|O35840|LCAT_TATKG Phosphatidylcholine-sterol acyltransferase (EC
           2.3.1.43) (Lecithin- cholesterol acyltransferase)
           (Phospholipid-cholesterol acyltransferase)
           (Fragment).>gb:TKLCAT02_2140110 Tatera kempi gambiana
           lecithin-cholesterol acyl transferase (LCAT) gene, exon
           6 and partial cds.
          Length = 293

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 33/90 (36%), Positives = 46/90 (51%)
 Frame = +2

Query: 296 LWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHI 475
           +W D ++ LS    C+ +              NAPGVE RVP FG T S+ YLD N   +
Sbjct: 2   IWLDLNMFLSLGVDCWIDNTRVVYNRSSGRVSNAPGVEIRVPGFGKTYSVEYLDDN--KL 59

Query: 476 SAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
           + YM  LV++L    Y   + +  APYD+R
Sbjct: 60  AEYMHTLVQNLVNNGYVRDETVRAAPYDWR 89



>gb:NELCAT02_2130897 Nannospalax ehrenbergi lecithin:cholesterol
           acyl transferase (LCAT) gene, exon 6 and partial cds.
          Length = 291

 Score = 58.9 bits (141), Expect = 6e-08
 Identities = 32/93 (34%), Positives = 47/93 (50%)
 Frame = +2

Query: 287 WFRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNL 466
           +F +W D ++ L     C+ +              NAPGV+ RVP FG T S+ YLD N 
Sbjct: 1   FFTIWLDLNMFLPLGVDCWIDNTRVVYNRSSGRVSNAPGVQIRVPGFGKTYSVEYLDNN- 59

Query: 467 KHISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
             ++ YM  LV++L    Y   + +  APYD+R
Sbjct: 60  -KLAGYMHTLVQNLVNNGYVRDETVRAAPYDWR 91



>gb:CMY275538_2111824 Calomyscus mystax partial lcat gene for
           lecithin cholesterol acyl transferase, exon 2 and joined
           CDS.
          Length = 268

 Score = 58.9 bits (141), Expect = 6e-08
 Identities = 34/92 (36%), Positives = 45/92 (48%)
 Frame = +2

Query: 290 FRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLK 469
           F +W D ++ L     C+ +              NAPGVE RVP FG T S+ YLD N  
Sbjct: 2   FTIWLDLNMFLPLGVDCWIDNTSVVYNRSSGRVSNAPGVEIRVPGFGKTYSVEYLDDNK- 60

Query: 470 HISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
              AYM  LV++L    Y   + +  APYD+R
Sbjct: 61  --LAYMHTLVQNLVNNGYVRDETVRAAPYDWR 90



>sp|O35724|LCAT_MICMN Phosphatidylcholine-sterol acyltransferase (EC
           2.3.1.43) (Lecithin- cholesterol acyltransferase)
           (Phospholipid-cholesterol acyltransferase)
           (Fragment).>gb:MMLCAT02_2116258 Micromys minutus
           lecithin-cholesterol acyl transferase (LCAT) gene, exon
           6 and partial cds.
          Length = 299

 Score = 58.5 bits (140), Expect = 8e-08
 Identities = 31/93 (33%), Positives = 47/93 (50%)
 Frame = +2

Query: 287 WFRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNL 466
           +F +W D ++ L     C+ +              NAPGV+ RVP FG T S+ YLD N 
Sbjct: 1   FFTIWLDINMFLPLGVDCWIDNTRVVYNRSSGRMSNAPGVQIRVPGFGKTYSVEYLDDN- 59

Query: 467 KHISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
             ++ Y+  LV++L    Y   + +  APYD+R
Sbjct: 60  -KLAGYLHTLVQNLVNNAYVRDETVRAAPYDWR 91



>gb:MCLCAT02_2113455 Myocastor coypus lecithin:cholesterol acyl
           transferase (LCAT) gene, exon 6 and partial cds.
          Length = 274

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 32/93 (34%), Positives = 47/93 (50%)
 Frame = +2

Query: 287 WFRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNL 466
           +F +W D ++ L     C+ ++             NA GVE RVP FG T S+ YLD N 
Sbjct: 1   FFTIWLDLNMFLPLWVDCWIDKTRVVYNRSSERVSNARGVEIRVPGFGKTYSVEYLDNN- 59

Query: 467 KHISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
             ++ YM  LV++L    Y   + +  APYD+R
Sbjct: 60  -KLAGYMHTLVQNLVNNGYVRDETVRAAPYDWR 91



>gb:LSI275593_2113263 Lophuromys sikapusi partial lcat gene for
           lecithin cholesterol acyl transferase, exon 2 and joined
           CDS.
          Length = 268

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 33/92 (35%), Positives = 45/92 (48%)
 Frame = +2

Query: 290 FRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLK 469
           F +W D ++ L     C+ +              NAPGV+ RVP FG T S+ YLD N  
Sbjct: 2   FTIWLDLNMFLPLGVNCWIDNTRVVYNRSSGNVTNAPGVQIRVPGFGKTYSVEYLDDNK- 60

Query: 470 HISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
              AYM  LV++L    Y   + +  APYD+R
Sbjct: 61  --LAYMHTLVQNLVNNGYVRDETVRAAPYDWR 90



>gb:CMLCAT02_2111815 Cricetulus migratorius lecithin:cholesterol
           acyl transferase (LCAT) gene, exon 6 and partial cds.
          Length = 307

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 32/90 (35%), Positives = 46/90 (51%)
 Frame = +2

Query: 296 LWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHI 475
           +W D ++LLS    C+ +              NAPGV+ RVP FG   S+ YLD N   +
Sbjct: 8   IWLDLNMLLSLGIDCWIDNTRVVYNRSSGHVSNAPGVQIRVPGFGKIYSVEYLDDN--KL 65

Query: 476 SAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
           + YM  LV++L    Y   + +  APYD+R
Sbjct: 66  AGYMHTLVQNLVNNGYVPDETVRAAPYDWR 95



>gb:PRO275573_2131210 Phodopus roborowski partial lcat gene for
           lecithin cholesterol acyl transferase, exon 2 and joined
           CDS.
          Length = 268

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 33/92 (35%), Positives = 45/92 (48%)
 Frame = +2

Query: 290 FRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLK 469
           F +W D ++ L     C+ +              NAPGV+ RVP FG T S+ YLD N  
Sbjct: 2   FTIWLDLNMFLPLGVDCWIDNTRVVYNRSSGHVSNAPGVQIRVPGFGKTYSVEYLDDNK- 60

Query: 470 HISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
              AYM  LV++L    Y   + +  APYD+R
Sbjct: 61  --LAYMHTLVQNLVNNGYVRDETVRAAPYDWR 90



>gb:NFU275613_2130902 Neotoma fuscipes partial lcat gene for
           lecithin cholesterol acyl transferase, exon 2 and joined
           CDS.
          Length = 268

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 33/92 (35%), Positives = 45/92 (48%)
 Frame = +2

Query: 290 FRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLK 469
           F +W D ++ L     C+ +              NAPGV+ RVP FG T S+ YLD N  
Sbjct: 2   FTIWLDLNMFLPLGVDCWIDNTRVVYNRSSGRVSNAPGVQIRVPGFGKTYSVEYLDDNK- 60

Query: 470 HISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
              AYM  LV++L    Y   + +  APYD+R
Sbjct: 61  --LAYMHTLVQNLVNNGYVRDETVRAAPYDWR 90



>gb:MAL275558_2113311 Mystromys albicaudatus partial lcat gene for
           lecithin cholesterol acyl transferase, exon 2 and joined
           CDS.
          Length = 268

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 33/92 (35%), Positives = 45/92 (48%)
 Frame = +2

Query: 290 FRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLK 469
           F +W D ++ L     C+ +              NAPGV+ RVP FG T S+ YLD N  
Sbjct: 2   FTIWLDLNMFLPLGVDCWIDNTRVVYNRSSGRVSNAPGVQIRVPGFGKTYSVEYLDNNK- 60

Query: 470 HISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
              AYM  LV++L    Y   + +  APYD+R
Sbjct: 61  --LAYMHTLVQNLVNNGYVRDETVRAAPYDWR 90



>gb:JJA275533_2113217 Jaculus jaculus partial lcat gene for lecithin
           cholesterol acyl transferase, exon 2 and joined CDS.
          Length = 268

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 33/92 (35%), Positives = 45/92 (48%)
 Frame = +2

Query: 290 FRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLK 469
           F +W D ++ L     C+ +              NAPGV+ RVP FG T S+ YLD N  
Sbjct: 2   FTIWLDLNMFLPLGVDCWIDNTRVVYNRSSGRVSNAPGVQIRVPGFGKTYSVEYLDNNK- 60

Query: 470 HISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
              AYM  LV++L    Y   + +  APYD+R
Sbjct: 61  --LAYMHTLVQNLVNNGYVRDETVRAAPYDWR 90



>gb:DSA275528_2112771 Dipus sagitta partial lcat gene for lecithin
           cholesterol acyl transferase, exon 2 and joined CDS.
          Length = 268

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 33/92 (35%), Positives = 45/92 (48%)
 Frame = +2

Query: 290 FRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLK 469
           F +W D ++ L     C+ +              NAPGV+ RVP FG T S+ YLD N  
Sbjct: 2   FTIWLDLNMFLPLGVDCWIDNTRVVYNRSSGRVSNAPGVQIRVPGFGKTYSVEYLDNNK- 60

Query: 470 HISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
              AYM  LV++L    Y   + +  APYD+R
Sbjct: 61  --LAYMHTLVQNLVNNGYVRDETVRAAPYDWR 90



>gb:ACA275603_2049824 Acomys cahirinus partial lcat gene for
           lecithin cholesterol acyl transferase, exon 2 and joined
           CDS.
          Length = 268

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 32/92 (34%), Positives = 45/92 (48%)
 Frame = +2

Query: 290 FRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLK 469
           F +W D ++ L     C+ +              NAPGV+ RVP FG T S+ YLD N  
Sbjct: 2   FTIWLDLNMFLPLGVNCWIDNTRVVYNRSSGSVTNAPGVQIRVPGFGKTYSVEYLDDNK- 60

Query: 470 HISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
              AYM  L+++L    Y   + +  APYD+R
Sbjct: 61  --LAYMHTLLQNLVNNGYVRDETVRAAPYDWR 90



>gb:PMLCAT01_2131131 Peromyscus maniculatus lecithin:cholesterol
           acyl transferase (LCAT) gene, exons 2 to 5 and partial
           cds.
          Length = 140

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 31/95 (32%), Positives = 47/95 (49%)
 Frame = +2

Query: 281 DGWFRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDP 460
           + +F +W D ++       C+ +              NAPGV+ RVP FG T S+ YLD 
Sbjct: 2   EDFFTIWLDLNMFPPLGVDCWIDNTRVVYNRSSGRVANAPGVQIRVPGFGKTYSVEYLDD 61

Query: 461 NLKHISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
           N   ++ YM  LV++L    Y   + +  APYD+R
Sbjct: 62  N--KLAGYMHTLVQNLVNNGYVRDETVRAAPYDWR 94



>gb:ARU536382_2073230 Aplodontia rufa partial lcat gene for lecithin
           cholesterol acyl transferase, exons 1-5.
          Length = 134

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 31/92 (33%), Positives = 46/92 (50%)
 Frame = +2

Query: 290 FRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLK 469
           F +W D ++ L     C+ +              NAPGV+ RVP FG T S+ YLD +  
Sbjct: 1   FTIWLDLNMFLPLGVDCWIDNTRVVYNRSSGRVSNAPGVQIRVPGFGKTYSVEYLDSS-- 58

Query: 470 HISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
            ++ YM  LV++L    Y   + +  APYD+R
Sbjct: 59  KLAGYMHTLVQNLVNNGYVRDETVRAAPYDWR 90



>gb:AEL275518_2049956 Allactaga elater partial lcat gene for
           Lecithin-cholesterol acyl transferase, exon 2 and joined
           CDS.
          Length = 268

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 32/92 (34%), Positives = 46/92 (50%)
 Frame = +2

Query: 290 FRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLK 469
           F +W D ++ L     C+ + +            NAPGV+ RVP FG T S+ YLD N  
Sbjct: 2   FTIWLDLNMFLPLGVNCWIDNIRVVYNRSSGRVSNAPGVQIRVPGFGKTCSVEYLDNNK- 60

Query: 470 HISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
              AYM  LV+++    Y   + +  APYD+R
Sbjct: 61  --IAYMHTLVQNMVNNGYVRDETVRAAPYDWR 90



>gb:CGA277518_2111618 Cricetomys gambianus partial LCAT gene for
           lecithin cholesterol acyl transferase, exon 2 and joined
           CDS.
          Length = 268

 Score = 56.6 bits (135), Expect = 3e-07
 Identities = 32/93 (34%), Positives = 45/93 (48%)
 Frame = +2

Query: 287 WFRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNL 466
           +F +W D ++ L     C+ +              NAPGV+ RVP FG T S+ YLD N 
Sbjct: 1   FFTIWLDFNMFLPLGVNCWIDNTRVVYNRSSGRVSNAPGVQIRVPGFGKTYSVEYLDNNK 60

Query: 467 KHISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
                YM  LV++L    Y   + +  APYD+R
Sbjct: 61  ---LVYMHTLVQNLVNNGYVRDETVRAAPYDWR 90



>gb:MNLCAT01_2124671 Microtus nivalis lecithin:cholesterol acyl
           transferase (LCAT) gene, exons 2 to 5 and partial cds.
          Length = 138

 Score = 55.8 bits (133), Expect = 5e-07
 Identities = 31/95 (32%), Positives = 48/95 (50%)
 Frame = +2

Query: 281 DGWFRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDP 460
           + +F ++ D ++ L     C+ +              NAPGV+ RVP FG T S+ YLD 
Sbjct: 1   EDFFTIFLDLNMFLPLGVDCWIDNTRVVYNRSSGRVSNAPGVQIRVPGFGKTYSVEYLDD 60

Query: 461 NLKHISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
           N   ++ YM  LV++L    Y   + +  APYD+R
Sbjct: 61  N--KLAGYMHTLVQNLVNNGYVRDETVRAAPYDWR 93



>gb:ATLCAT02_2073381 Akodon torques lecithin:cholesterol acyl
           transferase (LCAT) gene, exon 6 and partial cds.
          Length = 294

 Score = 55.8 bits (133), Expect = 5e-07
 Identities = 31/90 (34%), Positives = 44/90 (48%)
 Frame = +2

Query: 296 LWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHI 475
           +W D +V L     C+ +              NAPGV+ RVP FG T S+ YLD N   +
Sbjct: 2   IWLDLNVFLPLGVDCWIDNTRVVYNRSSGRVSNAPGVQIRVPGFGKTYSVEYLDDN--KL 59

Query: 476 SAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
           + YM  LV++L    Y   + +   PYD+R
Sbjct: 60  AEYMHTLVQNLVNNGYVRDETVRALPYDWR 89



>gb:SCA277513_2139924 Saccostomus campestris partial LCAT gene for
           lecithin cholesterol acyl transferase, exon 2 and joined
           CDS.
          Length = 265

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 32/90 (35%), Positives = 44/90 (48%)
 Frame = +2

Query: 296 LWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHI 475
           +W D ++ L     C+ +              NAPGV+ RVP FG T S+ YLD N    
Sbjct: 1   IWLDLNMFLPLGMNCWIDNTRVVYNRSSGRVSNAPGVQIRVPGFGKTYSVEYLDNNK--- 57

Query: 476 SAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
            AYM  LV++L    Y   + +  APYD+R
Sbjct: 58  LAYMHTLVQNLVNNGYVRDETVRAAPYDWR 87



>gb:OAN275608_2130926 Otomys angoniensis partial lcat gene for
           lecithin cholesterol acyl transferase, exon 2 and joined
           CDS.
          Length = 268

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 31/92 (33%), Positives = 45/92 (48%)
 Frame = +2

Query: 290 FRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLK 469
           F +W D ++ L     C+ +              NAPGV+ RVP FG T S+ Y+D N  
Sbjct: 2   FTIWLDFNMFLPLGVDCWIDNTRIVYNRSSGRVSNAPGVQIRVPGFGKTYSVEYVDDNK- 60

Query: 470 HISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
              AY+  LV++L    Y   + +  APYD+R
Sbjct: 61  --LAYLHTLVQNLVNNGYVRDETVRAAPYDWR 90



>gb:DMY275553_2112761 Dendromus mystacalis partial lcat gene for
           lecithin cholesterol acyl transferase, exon 2 and joined
           CDS.
          Length = 268

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 34/92 (36%), Positives = 46/92 (50%)
 Frame = +2

Query: 290 FRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLK 469
           F +W D ++ L     C+ +              NAPGV+ RVP FG T S+ YLD N K
Sbjct: 2   FTVWLDLNMFLPLGVDCWIDNTRVVYNRSSGRVSNAPGVQIRVPGFGKTYSVEYLD-NSK 60

Query: 470 HISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
              AYM  LV++L    Y   + +  APYD+R
Sbjct: 61  --LAYMHTLVQNLVNNGYVRDETVRAAPYDWR 90



>gb:SKA275513_2139963 Sicista kazbegica partial lcat gene for
           lecithin cholesterol acyl transferase, exon 2 and joined
           CDS.
          Length = 268

 Score = 55.1 bits (131), Expect = 9e-07
 Identities = 32/90 (35%), Positives = 44/90 (48%)
 Frame = +2

Query: 296 LWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHI 475
           +W D ++ L     C+ +              NAPGV+ RVP FG T S+ YLD N    
Sbjct: 4   IWLDLNMFLPLGVDCWIDNTRVVYNRSSGRVSNAPGVQIRVPGFGRTYSVEYLDNNK--- 60

Query: 476 SAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
            AYM  LV++L    Y   + +  APYD+R
Sbjct: 61  LAYMHTLVQNLVNNGYVRDETVRAAPYDWR 90



>gb:DTO275588_2112787 Dicrostonyx torquatus partial lcat gene for
           lecithin cholesterol acyl transferase, exon 2 and joined
           CDS.
          Length = 268

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 32/92 (34%), Positives = 44/92 (47%)
 Frame = +2

Query: 290 FRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLK 469
           F +W D ++ L     C+ +              NAPGV+ RV  FG T S+ YLD N  
Sbjct: 2   FTIWLDLNMFLPLGVDCWIDNTRVVYNRSSGRVSNAPGVQIRVRGFGKTYSVEYLDDNK- 60

Query: 470 HISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
              AYM  LV++L    Y   + +  APYD+R
Sbjct: 61  --LAYMHTLVQNLVNNGYVRDETVRAAPYDWR 90



>sp|O35502|LCAT_CLEGL Phosphatidylcholine-sterol acyltransferase (EC
           2.3.1.43) (Lecithin- cholesterol acyltransferase)
           (Phospholipid-cholesterol acyltransferase)
           (Fragment).>gb:CGLCAT02_2111640 Clethrionomys glareolus
           lecithin:cholesterol acyl transferase (LCAT) gene, exon
           6 and partial cds.
          Length = 291

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 30/93 (32%), Positives = 47/93 (50%)
 Frame = +2

Query: 287 WFRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNL 466
           +F ++ D ++ L+    C+ +              NAP V+ RVP FG T S+ YLD N 
Sbjct: 1   FFTIFLDLNMFLALGVNCWIDNTRVVYNRSSGRMSNAPCVQIRVPGFGKTYSVEYLDDN- 59

Query: 467 KHISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
             ++ YM  LV++L    Y   + +  APYD+R
Sbjct: 60  -KLAGYMHTLVQNLVNNGYVRDETVLAAPYDWR 91



>gb:AF183896_2058171 Cavia porcellus lecithin: cholesterol
           acyl-transferase (LCAT) gene, partial cds.
          Length = 135

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 31/87 (35%), Positives = 44/87 (50%)
 Frame = +2

Query: 305 DSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAY 484
           D ++ L+    C+ +              NAPGVE RVP FG T S+ YLD N   ++ Y
Sbjct: 2   DLNMFLAFGVDCWIDNTRVVYNRSSGRVSNAPGVEIRVPGFGKTYSVEYLDSN--KLAGY 59

Query: 485 MAPLVESLEQLXYEDGKNMFGAPYDFR 565
           M  LV++L    Y   + +  APYD+R
Sbjct: 60  MHTLVQNLVNNGYVRDETVRAAPYDWR 86



>gb:URU275598_2140354 Uranomys ruddi partial lcat gene for lecithin
           cholesterol acyl transferase, exon 2 and joined CDS.
          Length = 268

 Score = 52.4 bits (124), Expect = 6e-06
 Identities = 31/89 (34%), Positives = 42/89 (47%)
 Frame = +2

Query: 299 WFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHIS 478
           W D ++ L     C+ +              NAPGV+ RVP FG T S+ YL  N     
Sbjct: 5   WLDLNMFLRLGVNCWIDNTRVVYNRSSGSVTNAPGVQIRVPGFGKTYSVEYLYDNK---L 61

Query: 479 AYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
           AYM  LV++L    Y   + +  APYD+R
Sbjct: 62  AYMHTLVQNLVNNGYVRDETVRAAPYDWR 90



>gb:GOC536379_2112927 Graphiurus ocularis partial lcat gene for
           lecithin cholesterol acyl transferase, exons 1-5.
          Length = 126

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 27/58 (46%), Positives = 36/58 (62%)
 Frame = +2

Query: 392 NAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
           NAPGV+ RVP FG T S+ YLD N   ++ YM  LV++L    Y   + +  APYD+R
Sbjct: 28  NAPGVQIRVPGFGKTYSIEYLDDN--KLAGYMHTLVQNLVNNGYVRDETVRAAPYDWR 83



>gb:DFE275548_2112728 Deomys ferrugineus partial lcat gene for
           lecithin cholesterol acyl transferase, exon 2 and joined
           CDS.
          Length = 268

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 31/87 (35%), Positives = 42/87 (48%)
 Frame = +2

Query: 305 DSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAY 484
           D ++ L     C+ +              NAPGV+ RVP FG T S+ YLD N     AY
Sbjct: 7   DLNMFLPLGVNCWIDNTRVVYNRSSGSVTNAPGVQIRVPGFGKTYSVEYLDDNK---LAY 63

Query: 485 MAPLVESLEQLXYEDGKNMFGAPYDFR 565
           M  LV++L    Y   + +  APYD+R
Sbjct: 64  MHTLVQNLVNSGYVRDETVRAAPYDWR 90



>gb:MIN275563_2113660 Macrotarsomys ingens partial lcat gene for
           lecithin cholesterol acyl transferase, exon 2 and joined
           CDS.
          Length = 268

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 31/87 (35%), Positives = 42/87 (48%)
 Frame = +2

Query: 305 DSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAY 484
           D ++ L     C+ +              NAPGV+ RVP FG T S+ YLD N     AY
Sbjct: 7   DLNMFLPLGVNCWIDNTRVVYNRSSGHVSNAPGVQIRVPGFGKTYSVEYLDNNK---LAY 63

Query: 485 MAPLVESLEQLXYEDGKNMFGAPYDFR 565
           M  LV++L    Y   + +  APYD+R
Sbjct: 64  MHTLVQNLVNNGYVRDETVRAAPYDWR 90



>gb:SSP275543_2140002 Steatomys sp. partial lcat gene for lecithin
           cholesterol acyl transferase, exon 2 and joined CDS.
          Length = 268

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 31/87 (35%), Positives = 42/87 (48%)
 Frame = +2

Query: 305 DSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAY 484
           D ++ L     C+ +              NAPGV+ RVP FG T S+ YLD N     AY
Sbjct: 7   DLNMFLPLGVDCWIDNTRVVYNRSSGHVSNAPGVQIRVPGFGKTYSVEYLDNNK---LAY 63

Query: 485 MAPLVESLEQLXYEDGKNMFGAPYDFR 565
           M  LV++L    Y   + +  APYD+R
Sbjct: 64  MHTLVQNLVNNGYVRDETVRAAPYDWR 90



>gb:MAU275578_2113369 Mesocricetus auratus partial lcat gene for
           lecithin cholesterol acyl transferase, exon 2 and joined
           CDS.
          Length = 268

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 28/58 (48%), Positives = 35/58 (60%)
 Frame = +2

Query: 392 NAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
           NAPGV+ RVP FG T S+ YLD N     AYM  LV++L    Y   + +  APYD+R
Sbjct: 36  NAPGVQIRVPGFGKTYSVEYLDDNK---LAYMHTLVQNLVNNGYVRDETVRAAPYDWR 90



>gb:NIN275523_2130907 Napaeozapus insignis partial lcat gene for
           lecithin cholesterol acyl transferase, exon 2 and joined
           CDS.
          Length = 268

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 28/58 (48%), Positives = 35/58 (60%)
 Frame = +2

Query: 392 NAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
           NAPGV+ RVP FG T S+ YLD N     AYM  LV++L    Y   + +  APYD+R
Sbjct: 36  NAPGVQIRVPGFGKTYSVEYLDNNK---LAYMHTLVQNLVNNGYVRDETVRAAPYDWR 90



>gb:MRO536375_2124717 Myomimus roachi partial lcat gene for lecithin
           cholesterol acyl transferase, exons 1-5.
          Length = 124

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 27/78 (34%), Positives = 38/78 (48%)
 Frame = +2

Query: 290 FRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLK 469
           F +W D ++ L     C+ +              NAPGV+ RVP FG T S+ YLD N  
Sbjct: 1   FTVWLDLNMFLPLGVNCWIDNTRVVYNRSSGYMSNAPGVQIRVPGFGKTYSIEYLDDN-- 58

Query: 470 HISAYMAPLVESLEQLXY 523
            ++ YM  LV++L    Y
Sbjct: 59  KLAGYMHTLVQNLVNNGY 76



>gb:CR382401_1375114 Plasmodium falciparum chromosome 6, complete
           sequence; segment 4/5.
          Length = 863

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 42/143 (29%), Positives = 65/143 (45%), Gaps = 6/143 (4%)
 Frame = +2

Query: 179 LIPGNGGNQLEARLTAKYKPTSLW-CKWYPVKKDGDGWFRLWFDSSVLLSPLTK--CFSE 349
           L+PG GG+ L     A+YK  ++  C  Y +       FR+W   S LLS  +   C  +
Sbjct: 448 LLPGLGGSTL----IAEYKNATIHSCSRYLLNSKP---FRIWISLSRLLSIQSNIYCTFD 500

Query: 350 RMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKH---ISAYMAPLVESLEQLX 520
            +            N PGV   V  FG+ + + YLD        I+ Y   + +      
Sbjct: 501 TIRLKYDEKKNIYYNQPGVFIDVEKFGNLKGIEYLDYFNNTGIGITKYFNVVGQYFTSHG 560

Query: 521 YEDGKNMFGAPYDFRYGLAAKGH 589
           Y DG+++ GAPYD+RY L+ + +
Sbjct: 561 YVDGESIIGAPYDWRYPLSQQNY 583



>gb:RPLCAT02_2138089 Rhizomys pruinosus lecithin:cholesterol acyl
           transferase (LCAT) gene, exon 6 and partial cds.
          Length = 272

 Score = 48.9 bits (115), Expect = 7e-05
 Identities = 27/58 (46%), Positives = 33/58 (56%)
 Frame = +2

Query: 392 NAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
           NAPGVE RVP FG T S+ YLD N   +  YM  LV++L    Y     +  A YD+R
Sbjct: 12  NAPGVEIRVPGFGKTYSVEYLDDN--KLPGYMHTLVQNLVNNGYVQDMTVRAASYDWR 67



>gb:AY092001_1936302 Pan troglodytes lecithin cholesterol
           acyltransferase gene, partial cds.
          Length = 209

 Score = 48.5 bits (114), Expect = 9e-05
 Identities = 25/58 (43%), Positives = 36/58 (62%)
 Frame = +2

Query: 392 NAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
           NAPGV+ RVP FG T S+ YLD +   ++ Y+  LV++L    Y   + +  APYD+R
Sbjct: 86  NAPGVQIRVPGFGKTYSVEYLDSS--KLAGYLHTLVQNLVNNGYVRDETVRAAPYDWR 141



>gb:NRU275568_2130917 Nesomys rufus partial lcat gene for lecithin
           cholesterol acyl transferase, exon 2 and joined CDS.
          Length = 268

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 28/58 (48%), Positives = 34/58 (58%)
 Frame = +2

Query: 392 NAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQLXYEDGKNMFGAPYDFR 565
           NAPGV  RVP FG T S+ YLD N     AYM  LV++L    Y   + +  APYD+R
Sbjct: 36  NAPGVXIRVPCFGKTYSVEYLDNNK---LAYMHTLVQNLVNNGYVRDETVRAAPYDWR 90



>gb:GPL536378_2113022 Graphiurus platyops partial lcat gene for
           lecithin cholesterol acyl transferase, exons 1-5.
          Length = 105

 Score = 45.8 bits (107), Expect = 6e-04
 Identities = 21/58 (36%), Positives = 28/58 (48%)
 Frame = +2

Query: 290 FRLWFDSSVLLSPLTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPN 463
           F +W D ++ L     C+ +              NAPGV+ RVP FG T S+ YLD N
Sbjct: 1   FTIWLDLNIFLPLGVNCWIDNTRVIYNRSSGYMSNAPGVQIRVPGFGKTYSIEYLDDN 58



>gb:AP005640_1855251 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0006O15.
          Length = 300

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 19/36 (52%), Positives = 24/36 (66%)
 Frame = +2

Query: 506 LEQLXYEDGKNMFGAPYDFRYGLAAKGHPSQVGSKF 613
           LE+L Y DG  +FGAPYDFRY     G  S+V S++
Sbjct: 138 LEELRYRDGDTLFGAPYDFRYAPPVPGQTSEVYSRY 173



>gb:AP005640_1855248 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0006O15.
          Length = 100

 Score = 42.4 bits (98), Expect = 0.006
 Identities = 22/50 (44%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = +2

Query: 284 GWFRLWFDSSVLLSP-LTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFG 430
           GWF LW +SS L +    +CF E+M            N PG+ETRV NFG
Sbjct: 45  GWFGLWENSSDLSAHHYNECFKEQMSLVYDPVANDYRNFPGIETRVANFG 94



>gb:AE016959_1021078 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC078944_1541617
           Genomic Sequence for Oryza sativa, Nipponbare strain,
           clone OSJNBa0089D15, from Chromosome 10, complete
           sequence.>gb:AE017061_1750897 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 15 of 77 of the
           complete sequence.
          Length = 96

 Score = 42.0 bits (97), Expect = 0.008
 Identities = 17/42 (40%), Positives = 28/42 (66%)
 Frame = +2

Query: 152 ATTNLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKD 277
           A  ++HP++L+PGNG ++ +A LT  YKP+     W PV ++
Sbjct: 37  AVVDIHPIVLLPGNGCSKFDAELTKHYKPS----PWAPVPRE 74



>gb:AY223006_1176471 Schistosoma japonicum clone ZZD1085 mRNA
           sequence.
          Length = 380

 Score = 40.4 bits (93), Expect = 0.023
 Identities = 40/134 (29%), Positives = 53/134 (39%), Gaps = 5/134 (3%)
 Frame = +2

Query: 179 LIPGNGGNQLEARLTAK--YKPTSLWC--KWYPVKKDGDGWFRLWFDSSVLLSPLTKCFS 346
           +IPG  G Q  A L  +   KP  +W   K +   K    +F+L +D+   LS       
Sbjct: 1   MIPGTAGCQAFAVLKNEPDQKPLPVWLNLKLFAFIKHFTDYFKLQYDAKTGLS------- 53

Query: 347 ERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISAYMAPLVESLEQ-LXY 523
                          +A GV+   P +G T S+  LD      S Y   LV  L +   Y
Sbjct: 54  --------------YDADGVDIIFPGWGETWSIENLDETPNMFSEYFGALVYVLRKDPFY 99

Query: 524 EDGKNMFGAPYDFR 565
                M GAPYDFR
Sbjct: 100 VSNFTMRGAPYDFR 113



>gb:AE016959_1021068 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC078944_1541607
           Genomic Sequence for Oryza sativa, Nipponbare strain,
           clone OSJNBa0089D15, from Chromosome 10, complete
           sequence.>gb:AE017061_1750887 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 15 of 77 of the
           complete sequence.
          Length = 443

 Score = 40.0 bits (92), Expect = 0.031
 Identities = 16/32 (50%), Positives = 24/32 (75%)
 Frame = +2

Query: 500 ESLEQLXYEDGKNMFGAPYDFRYGLAAKGHPS 595
           E+L ++ Y++G+N+FGAPYD RY  A  G P+
Sbjct: 89  EALGRISYKEGENLFGAPYDSRYVAAPPGMPA 120



>gb:AP005640_1855252 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0006O15.
          Length = 308

 Score = 39.3 bits (90), Expect = 0.052
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +2

Query: 515 LXYEDGKNMFGAPYDFRYGLAAKGHPSQVGSK 610
           + Y DG NM G PYDFRY     G  SQV S+
Sbjct: 1   MGYHDGDNMHGVPYDFRYAAPIPGQASQVYSR 32



>gb:AY092005_1936306 Saguinus oedipus lecithin cholesterol
           acyltransferase gene, partial cds.
          Length = 210

 Score = 37.4 bits (85), Expect = 0.20
 Identities = 37/140 (26%), Positives = 58/140 (41%), Gaps = 1/140 (0%)
 Frame = +2

Query: 149 QATTNLHPLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVLLSP 328
           + + +  P+IL+PG  GNQLEA+L    KP  +   W   +K  D +F +W D ++ L  
Sbjct: 11  ELSNHTRPVILVPGCLGNQLEAKLD---KPDVV--NWMCYRKTED-FFTIWLDLNMFLPL 64

Query: 329 LTKCFSERMMXXXXXXXXXXXNAPGVETRVPNFGSTQSLLYLDPNLKHISA-YMAPLVES 505
              C+ +                P      P     Q LL      +     Y+  LV++
Sbjct: 65  GVDCWIDNTRVGLQPELWACVQCPWCPDPCP--WLWQDLLCGVSGQQQAGRWYLHTLVQN 122

Query: 506 LEQLXYEDGKNMFGAPYDFR 565
           L    Y   + +  APYD+R
Sbjct: 123 LVNNGYVRDETVRAAPYDWR 142



>gb:BLU35855_749089 Bacillus licheniformis esterase (est) gene,
           complete cds.
          Length = 715

 Score = 36.2 bits (82), Expect = 0.44
 Identities = 40/151 (26%), Positives = 59/151 (39%), Gaps = 15/151 (9%)
 Frame = +2

Query: 170 PLILIPGNGGNQLEARLTAKYKPTSLWCKWYPVKKDG---DGWFRLWFDSSVLLSPLTKC 340
           P+ILIPG GG++LE                  V++DG   + W  LW     +  P    
Sbjct: 228 PVILIPGIGGSRLE------------------VEEDGKTSEIWLGLWDMGVGIRDP---- 265

Query: 341 FSERMMXXXXXXXXXXXNA----PGV----ETRVPNFGSTQSLLY----LDPNLKHISAY 484
              R +           N     PG+    E     F + + L Y    LD   K +  Y
Sbjct: 266 -RHRRILSLEPVKNGSVNVQPRQPGIKVFPERADGGFRAIEYLSYTKLDLDVIKKQVEQY 324

Query: 485 MAPLVESLEQLXYEDGKNMFGAPYDFRYGLA 577
            A + + LE++ Y   + +F  PYD+RY  A
Sbjct: 325 -ASMAKHLEKMGYRKNRTLFAMPYDWRYSNA 354



>gb:AY448010S4_1606585 Ipomoea trifida haplotype S1
           self-incompatibility (S-) locus, contig SR4.
          Length = 667

 Score = 33.9 bits (76), Expect = 2.2
 Identities = 41/143 (28%), Positives = 60/143 (41%), Gaps = 4/143 (2%)
 Frame = +2

Query: 149 QATTNLHPLILIPG--NGGNQL-EARLTAKYKPTSLWCKWYPVKKDGDGWFRLWFDSSVL 319
           +  T  HP++L+PG   GG +L E R  A+     L+ K            RLW  S V 
Sbjct: 89  EGLTGFHPVVLVPGIVTGGLELWEGRPCAQ----GLFRK------------RLWGGSFVE 132

Query: 320 LSPLTKCFSERMMXXXXXXXXXXXNAPGVETR-VPNFGSTQSLLYLDPNLKHISAYMAPL 496
           +     C+ E +            + PG+  R VP   +     Y  P         A L
Sbjct: 133 MFKRPLCWLEHL----SLDNETGLDPPGIRVRAVPGLVAAD---YFAPGY----FVWAVL 181

Query: 497 VESLEQLXYEDGKNMFGAPYDFR 565
           +E+L ++ YE  KNM+ A YD+R
Sbjct: 182 IENLARIGYEQ-KNMYMAAYDWR 203



>gb:AP008227_579588 Thermus thermophilus HB8 plasmid pTT27 DNA,
           complete sequence.
          Length = 321

 Score = 32.3 bits (72), Expect = 6.4
 Identities = 14/37 (37%), Positives = 21/37 (56%)
 Frame = -1

Query: 336 LVRGDKRTLESNHSLNQPSPSFLTGYHLHHKLVGLYF 226
           LVR  ++ LE     ++P+P    GYH  + L+GL F
Sbjct: 68  LVRHQRKALEKVVGQDEPTPEVFGGYHFRYGLLGLVF 104



>gb:AE017222_405303 Thermus thermophilus HB27 plasmid pTT27,
           complete sequence.
          Length = 321

 Score = 32.3 bits (72), Expect = 6.4
 Identities = 14/37 (37%), Positives = 21/37 (56%)
 Frame = -1

Query: 336 LVRGDKRTLESNHSLNQPSPSFLTGYHLHHKLVGLYF 226
           LVR  ++ LE     ++P+P    GYH  + L+GL F
Sbjct: 68  LVRHQRKALEKVVGQDEPTPEVFGGYHFRYGLLGLVF 104



>pir|T23939|T23939 hypothetical protein R05H5.3 - Caenorhabditis
           elegans>gb:CER05H5_1366505 Caenorhabditis elegans cosmid
           R05H5, complete sequence.
          Length = 149

 Score = 32.0 bits (71), Expect = 8.3
 Identities = 16/34 (47%), Positives = 20/34 (58%)
 Frame = -1

Query: 294 LNQPSPSFLTGYHLHHKLVGLYFAVNLASSWFPP 193
           +NQ S     G HL  K+VGLYF    ++SW PP
Sbjct: 11  INQDSEELDAGEHLKGKVVGLYF----SASWCPP 40


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 644,848,060
Number of Sequences: 1806583
Number of extensions: 12040432
Number of successful extensions: 29587
Number of sequences better than 10.0: 106
Number of HSP's better than 10.0 without gapping: 28432
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29418
length of database: 581,917,975
effective HSP length: 119
effective length of database: 366,934,598
effective search space used: 31189440830
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)