BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig1190
         (542 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|B71445|B71445 probable glycerol-3-phosphate permease - Arabi...   100   1e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AF466202_1802261 Zea mays putative pol protein gene, partial ...    74   2e-12   
gb:AF360170_1791126 Arabidopsis thaliana unknown protein (At3g47...    63   3e-09   
pir|T12997|T12997 hypothetical protein T21L8.170 - Arabidopsis t...    63   3e-09   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00096_1694834 Oryza sativa genomic DNA, chromosome 4, BAC...    60   2e-08   
gb:BC055147_2551235 Danio rerio zgc:63583, mRNA (cDNA clone MGC:...    56   3e-07   
gb:BT012605_1641675 Arabidopsis thaliana At2g13100 gene, complet...    55   9e-07   
gb:BT014839_1641829 Arabidopsis thaliana At2g13100 gene, complet...    54   2e-06   
pir|D84505|D84505 probable membrane transporter [imported] - Ara...    54   2e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AP004460_1841328 Oryza sativa (japonica cultivar-group) genom...    53   3e-06   
pir|G86430|G86430 T5I8.1 protein - Arabidopsis thaliana>gb:AE005...    50   2e-05   Arabidopsis thaliana [mouse-ear cress]
gb:BC085404_2564354 Danio rerio zgc:101659, mRNA (cDNA clone MGC...    47   2e-04   
gb:AP002485_1822249 Oryza sativa (japonica cultivar-group) genom...    47   2e-04   
gb:OSA307662_1692466 Oryza sativa genomic DNA fragment, chromoso...    47   2e-04   
pir|T05543|T05543 hypothetical protein F24A6.60 - Arabidopsis th...    46   3e-04   Arabidopsis thaliana [mouse-ear cress]
gb:BC051314_1984569 Homo sapiens solute carrier family 37 (glyce...    45   7e-04   
gb:AK074207_1912424 Homo sapiens cDNA FLJ23627 fis, clone ADSU02...    45   7e-04   
gb:AK074100_1912334 Homo sapiens mRNA for FLJ00171 protein.            45   7e-04   
gb:BC063326_2105230 Mus musculus solute carrier family 37 (glyce...    45   0.001   
gb:AK079414_1172690 Mus musculus adult male bone cDNA, RIKEN ful...    45   0.001   
gb:AK031045_1162270 Mus musculus adult male thymus cDNA, RIKEN f...    45   0.001   
gb:AK028984_1161267 Mus musculus 10 days neonate skin cDNA, RIKE...    45   0.001   
gb:BC068927_2555421 Xenopus laevis hypothetical protein MGC83169...    44   0.002   
gb:BC043786_2548245 Xenopus laevis solute carrier family 37 (gly...    44   0.002   
gb:AP003019_1824217 Oryza sativa (japonica cultivar-group) genom...    44   0.002   
gb:AE013599_1133084 Drosophila melanogaster chromosome 2R, compl...    42   0.008   
gb:AE013599_1133083 Drosophila melanogaster chromosome 2R, compl...    42   0.008   
gb:BC088593_2565723 Xenopus tropicalis hypothetical LOC496867, m...    41   0.013   
gb:BC042235_2548057 Xenopus laevis similar to solute carrier fam...    41   0.013   
gb:AF311320_1896254 Homo sapiens glycerol 3-phosphate permease (...    40   0.017   
sp|P57057|GLPT_HUMAN|GLPT_HUMAN Glycerol-3-phosphate transporter (G-3-P tra...    40   0.017   Homo sapiens [man]
gb:AK033656_1163456 Mus musculus adult male cecum cDNA, RIKEN fu...    40   0.023   
gb:BC081990_2108227 Rattus norvegicus solute carrier family 37 (...    40   0.030   
gb:AB188995_2175365 Turnip mosaic virus gene for polyprotein, pa...    33   2.1     
gb:BC005744_2090130 Mus musculus solute carrier family 37 (glyce...    33   2.1     
gb:AK076213_1171307 Mus musculus 15 days embryo head cDNA, RIKEN...    33   2.1     
pir|T19384|T19384 FMRFamide-like peptide 4 - Caenorhabditis eleg...    33   2.8     Caenorhabditis elegans [roundworm]
gb:TMO489259_2455313 Turnip Mosaic Virus partial gene for partia...    33   3.6     
gb:AB093596_2169115 Turnip mosaic virus gene for polyprotein, co...    33   3.6     
gb:AB076519_2166715 Turnip mosaic virus CP gene for polyprotein,...    33   3.6     
gb:AE016787_333014 Pseudomonas putida KT2440 section 14 of 21 of...    32   4.8     
gb:AE016783_331971 Pseudomonas putida KT2440 section 10 of 21 of...    32   6.2     
gb:BC084352_2563733 Xenopus laevis hypothetical LOC495149, mRNA ...    32   8.1     
gb:BC067922_2554908 Xenopus tropicalis hypothetical protein MGC6...    32   8.1     
gb:AJ831809_2279661 Turnip mosaic virus partial gene for polypro...    32   8.1     
gb:AB189009_2175379 Turnip mosaic virus gene for polyprotein, pa...    32   8.1     
gb:AB093613_2169132 Turnip mosaic virus gene for polyprotein, co...    32   8.1     
gb:AB076510_2166706 Turnip mosaic virus CP gene for polyprotein,...    32   8.1     
gb:CET11G6_1367635 Caenorhabditis elegans cosmid T11G6, complete...    32   8.1     
gb:BA000016_675133 Clostridium perfringens str. 13 DNA, complete...    32   8.1     
pir|T24849|T24849 hypothetical protein T11G6.2 - Caenorhabditis ...    32   8.1     Caenorhabditis elegans [roundworm]
pir|T24796|T24796 hypothetical protein T10C6.6a - Caenorhabditis...    32   8.1     Caenorhabditis elegans [roundworm]


>pir|B71445|B71445 probable glycerol-3-phosphate permease -
           Arabidopsis thaliana>gb:ATCHRIV46_1545557 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           46.>gb:ATFCA8_1551805 Arabidopsis thaliana DNA
           chromosome 4, ESSA I FCA contig fragment No. 8.
          Length = 534

 Score =  100 bits (249), Expect = 1e-20
 Identities = 49/83 (59%), Positives = 62/83 (74%), Gaps = 4/83 (4%)
 Frame = +2

Query: 290 RGNPPGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLDPNSSIDX 469
           R  PPGI+L+R +RG++WS KT+RY +LF+TFIAY  YHASRKPSSIVKSVL P+SS   
Sbjct: 7   RKTPPGIALLRRVRGRNWSPKTFRYAILFITFIAYACYHASRKPSSIVKSVLHPDSSTKP 66

Query: 470 ATLSSNF----WPXGDVFVKREL 526
               ++     WP G+VFVKRE+
Sbjct: 67  PQEHNSDKIYPWPMGNVFVKREI 89



>gb:AF466202_1802261 Zea mays putative pol protein gene, partial
           cds; and putative gag-pol precursor -orf2, putative
           Fourf gag/pol protein, putative NADP-dependent malic
           enzyme, putative argonaute protein, putative pinhead
           protein, putative pol protein, putative gag protein,
           putative TNP2, r1-B73 proteins, putative genetic
           modifier, putative S-receptor kinase, putative aldose
           reductase-related protein, putative glutathione
           peroxidase, putative glycerol 3-phosphate permease,
           putative response regulator, and putative
           4-coumarate-CoA ligase-like protein genes, complete cds.
          Length = 1279

 Score = 73.6 bits (179), Expect = 2e-12
 Identities = 33/76 (43%), Positives = 51/76 (67%)
 Frame = +2

Query: 299 PPGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLDPNSSIDXATL 478
           P GI L+  +RG   SF++ + +VL +TF++Y SYHA+RK +S+VKSVLDP +  +  T 
Sbjct: 765 PLGIQLLERVRGSPISFRSCQALVLVLTFLSYASYHATRKTTSVVKSVLDPKTKTNLGTS 824

Query: 479 SSNFWPXGDVFVKREL 526
           S+++WP   +F    L
Sbjct: 825 SAHYWPPSHLFYLHNL 840



>gb:AF360170_1791126 Arabidopsis thaliana unknown protein
           (At3g47420) mRNA, complete cds.
          Length = 523

 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 29/53 (54%), Positives = 37/53 (69%)
 Frame = +2

Query: 299 PPGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLDPNS 457
           P GI  +  I+G   S+  Y+ +VL VTF+AY SYHA+RK +SIVKS LDP S
Sbjct: 15  PIGIRFLERIKGSKLSYSAYQAIVLIVTFLAYASYHAARKTTSIVKSALDPQS 67



>pir|T12997|T12997 hypothetical protein T21L8.170 - Arabidopsis
           thaliana>gb:ATT21L8_1555162 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T21L8.>gb:AF325105_1786559
           Arabidopsis thaliana putative protein (T21L8.170) mRNA,
           complete cds.
          Length = 513

 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 29/53 (54%), Positives = 37/53 (69%)
 Frame = +2

Query: 299 PPGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLDPNS 457
           P GI  +  I+G   S+  Y+ +VL VTF+AY SYHA+RK +SIVKS LDP S
Sbjct: 5   PIGIRFLERIKGSKLSYSAYQAIVLIVTFLAYASYHAARKTTSIVKSALDPQS 57



>gb:OSJN00096_1694834 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0012E24, complete sequence.
          Length = 515

 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 32/69 (46%), Positives = 42/69 (60%)
 Frame = +2

Query: 290 RGNPPGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLDPNSSIDX 469
           R  P GI L    RG   SF++ + +VL +TF++Y SYHA+RK +SIVKSVLDP +    
Sbjct: 9   RMKPLGIQLYECARGSPISFRSCQALVLILTFLSYASYHATRKTTSIVKSVLDPKTE--- 65

Query: 470 ATLSSNFWP 496
             L    WP
Sbjct: 66  -NLGMLHWP 73



>gb:BC055147_2551235 Danio rerio zgc:63583, mRNA (cDNA clone
           MGC:63583 IMAGE:5410462), complete cds.
          Length = 494

 Score = 56.2 bits (134), Expect = 3e-07
 Identities = 29/53 (54%), Positives = 34/53 (64%)
 Frame = +2

Query: 302 PGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLDPNSS 460
           PGI LI +     W    YR+ +LF+TF+ YTSYH SRKP SIVKS L  N S
Sbjct: 6   PGIKLITSFSRDSW----YRFSILFLTFVFYTSYHLSRKPISIVKSQLHRNCS 54



>gb:BT012605_1641675 Arabidopsis thaliana At2g13100 gene, complete
           cds.
          Length = 307

 Score = 54.7 bits (130), Expect = 9e-07
 Identities = 30/79 (37%), Positives = 45/79 (56%)
 Frame = +2

Query: 293 GNPPGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLDPNSSIDXA 472
           G  P  SL   +     +F  ++ +VL +TF AY S+HASRKP SIVKSVL P  S++ +
Sbjct: 7   GLAPAFSLFPNLNTPHKTFTFHQILVLIITFTAYASFHASRKPPSIVKSVLGP-PSLNSS 65

Query: 473 TLSSNFWPXGDVFVKRELD 529
           ++ + + P       + LD
Sbjct: 66  SIDNGWAPFNGTQGTKRLD 84



>gb:BT014839_1641829 Arabidopsis thaliana At2g13100 gene, complete
           cds.
          Length = 329

 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 30/62 (48%), Positives = 38/62 (61%), Gaps = 4/62 (6%)
 Frame = +2

Query: 293 GNPPGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLDP----NSS 460
           G  P  SL   +     +F  ++ +VL +TF AY S+HASRKP SIVKSVL P    +SS
Sbjct: 7   GLAPAFSLFPNLNTPHKTFTFHQILVLIITFTAYASFHASRKPPSIVKSVLGPPSLNSSS 66

Query: 461 ID 466
           ID
Sbjct: 67  ID 68



>pir|D84505|D84505 probable membrane transporter [imported] -
           Arabidopsis thaliana>gb:AC006194_1533549 Arabidopsis
           thaliana chromosome 2 clone T17A11 map GPC6, complete
           sequence.
          Length = 476

 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 30/62 (48%), Positives = 38/62 (61%), Gaps = 4/62 (6%)
 Frame = +2

Query: 293 GNPPGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLDP----NSS 460
           G  P  SL   +     +F  ++ +VL +TF AY S+HASRKP SIVKSVL P    +SS
Sbjct: 7   GLAPAFSLFPNLNTPHKTFTFHQILVLIITFTAYASFHASRKPPSIVKSVLGPPSLNSSS 66

Query: 461 ID 466
           ID
Sbjct: 67  ID 68



>gb:AP004460_1841328 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0438H08.
          Length = 493

 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 28/60 (46%), Positives = 38/60 (63%)
 Frame = +2

Query: 284 ITRGNPPGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLDPNSSI 463
           +T   PPGI L   I       +TY+ +VL +TF+AYT +H +RK  SIVKSVLDP + +
Sbjct: 1   MTSRKPPGIRLFGGIT----VLRTYQTLVLVLTFVAYTCFHMTRKIPSIVKSVLDPQTKL 56



>pir|G86430|G86430 T5I8.1 protein - Arabidopsis
           thaliana>gb:AE005172_891903 Arabidopsis thaliana
           chromosome 1, top arm complete sequence.>gb:T5I8_1724091
           Arabidopsis thaliana chromosome 1 BAC T5I8 sequence,
           complete sequence.
          Length = 510

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 27/51 (52%), Positives = 35/51 (68%), Gaps = 2/51 (3%)
 Frame = +2

Query: 299 PPGISLIRTIR--GKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVL 445
           PPGI  +   R  GK  SFK Y+ +V  +TFIAY ++HA+RKP+SIVK  L
Sbjct: 16  PPGIHFLERFRRSGK-LSFKQYQAMVFVLTFIAYIAFHATRKPNSIVKGTL 65



>gb:BC085404_2564354 Danio rerio zgc:101659, mRNA (cDNA clone
           MGC:101659 IMAGE:7226502), complete cds.
          Length = 529

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 24/54 (44%), Positives = 30/54 (55%)
 Frame = +2

Query: 299 PPGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLDPNSS 460
           PPGI  + +     W    Y+     +TF+ YTS+H SRKP SIVKS L  N S
Sbjct: 5   PPGIRFLASFNRDQW----YKAFTFALTFLLYTSFHLSRKPISIVKSELHKNCS 54



>gb:AP002485_1822249 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:P0491E01.
          Length = 494

 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 24/49 (48%), Positives = 32/49 (65%)
 Frame = +2

Query: 299 PPGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVL 445
           PPG+  +  I     S+ ++R +VL +TF+AY  YHASRKP SIVK  L
Sbjct: 15  PPGLCALPAI-----SYNSHRGLVLGLTFVAYALYHASRKPPSIVKRAL 58



>gb:OSA307662_1692466 Oryza sativa genomic DNA fragment, chromosome
           2.
          Length = 525

 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 24/49 (48%), Positives = 32/49 (65%)
 Frame = +2

Query: 299 PPGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVL 445
           PPG+  +  I     S+ ++R +VL +TF+AY  YHASRKP SIVK  L
Sbjct: 15  PPGLCALPAI-----SYNSHRGLVLGLTFVAYALYHASRKPPSIVKRAL 58



>pir|T05543|T05543 hypothetical protein F24A6.60 - Arabidopsis
           thaliana>gb:ATCHRIV62_1546404 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 62.>gb:ATF24A6_1549802
           Arabidopsis thaliana DNA chromosome 4, BAC clone F24A6
           (ESSAII project).
          Length = 504

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 23/54 (42%), Positives = 34/54 (62%), Gaps = 1/54 (1%)
 Frame = +2

Query: 299 PPGISLIRTI-RGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLDPNS 457
           P GI  +    R    SFK Y+ +V  +TF+AY ++HA+RKP+SIVK  L  ++
Sbjct: 16  PWGIQFLEKFKRSGRLSFKQYQALVFILTFVAYIAFHAARKPNSIVKGTLSAST 69



>gb:BC051314_1984569 Homo sapiens solute carrier family 37
           (glycerol-3-phosphate transporter), member 2, mRNA (cDNA
           clone MGC:59929 IMAGE:6207707), complete cds.
          Length = 505

 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 26/70 (37%), Positives = 34/70 (48%), Gaps = 6/70 (8%)
 Frame = +2

Query: 302 PGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLDPNSS------I 463
           PG+   R      W    +R ++L +TF+ Y  YH SRKP SIVKS L  N S       
Sbjct: 7   PGVWFFRAFSRDSW----FRGLILLLTFLIYACYHMSRKPISIVKSRLHQNCSEQIKPIN 62

Query: 464 DXATLSSNFW 493
           D  +L+   W
Sbjct: 63  DTHSLNDTMW 72



>gb:AK074207_1912424 Homo sapiens cDNA FLJ23627 fis, clone
           ADSU02391, highly similar to Mus musculus cAMP inducible
           2 protein (Ci2) mRNA.
          Length = 501

 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 26/70 (37%), Positives = 34/70 (48%), Gaps = 6/70 (8%)
 Frame = +2

Query: 302 PGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLDPNSS------I 463
           PG+   R      W    +R ++L +TF+ Y  YH SRKP SIVKS L  N S       
Sbjct: 7   PGVWFFRAFSRDSW----FRGLILLLTFLIYACYHMSRKPISIVKSRLHQNCSEQIKPIN 62

Query: 464 DXATLSSNFW 493
           D  +L+   W
Sbjct: 63  DTHSLNDTMW 72



>gb:AK074100_1912334 Homo sapiens mRNA for FLJ00171 protein.
          Length = 396

 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 26/70 (37%), Positives = 34/70 (48%), Gaps = 6/70 (8%)
 Frame = +2

Query: 302 PGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLDPNSS------I 463
           PG+   R      W    +R ++L +TF+ Y  YH SRKP SIVKS L  N S       
Sbjct: 18  PGVWFFRAFSRDSW----FRGLILLLTFLIYACYHMSRKPISIVKSRLHQNCSEQIKPIN 73

Query: 464 DXATLSSNFW 493
           D  +L+   W
Sbjct: 74  DTHSLNDTMW 83



>gb:BC063326_2105230 Mus musculus solute carrier family 37
           (glycerol-3-phosphate transporter), member 2, mRNA (cDNA
           clone MGC:74230 IMAGE:30301217), complete cds.
          Length = 501

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 23/53 (43%), Positives = 29/53 (54%)
 Frame = +2

Query: 302 PGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLDPNSS 460
           PG+  +R      W    +R  +L +TF+ Y  YH SRKP SIVKS L  N S
Sbjct: 7   PGVWFLRAFSRDSW----FRGFILLLTFLIYACYHMSRKPISIVKSRLHQNCS 55



>gb:AK079414_1172690 Mus musculus adult male bone cDNA, RIKEN
           full-length enriched library, clone:9830146N24
           product:solute carrier family 37 (glycerol-3-phosphate
           transporter), member 1, full insert sequence.
          Length = 501

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 23/53 (43%), Positives = 29/53 (54%)
 Frame = +2

Query: 302 PGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLDPNSS 460
           PG+  +R      W    +R  +L +TF+ Y  YH SRKP SIVKS L  N S
Sbjct: 7   PGVWFLRAFSRDSW----FRGFILLLTFLIYACYHMSRKPISIVKSRLHQNCS 55



>gb:AK031045_1162270 Mus musculus adult male thymus cDNA, RIKEN
           full-length enriched library, clone:5832433D20
           product:solute carrier family 37 (glycerol-3-phosphate
           transporter), member 1, full insert
           sequence.>gb:AK079823_1172809 Mus musculus 0 day neonate
           thymus cDNA, RIKEN full-length enriched library,
           clone:A430076K14 product:solute carrier family 37
           (glycerol-3-phosphate transporter), member 1, full
           insert sequence.>gb:AF121081_2055356 Mus musculus cAMP
           inducible 2 protein (Ci2) mRNA, complete cds.
          Length = 501

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 23/53 (43%), Positives = 29/53 (54%)
 Frame = +2

Query: 302 PGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLDPNSS 460
           PG+  +R      W    +R  +L +TF+ Y  YH SRKP SIVKS L  N S
Sbjct: 7   PGVWFLRAFSRDSW----FRGFILLLTFLIYACYHMSRKPISIVKSRLHQNCS 55



>gb:AK028984_1161267 Mus musculus 10 days neonate skin cDNA, RIKEN
           full-length enriched library, clone:4732478E01
           product:solute carrier family 37 (glycerol-3-phosphate
           transporter), member 1, full insert sequence.
          Length = 506

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 23/53 (43%), Positives = 29/53 (54%)
 Frame = +2

Query: 302 PGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLDPNSS 460
           PG+  +R      W    +R  +L +TF+ Y  YH SRKP SIVKS L  N S
Sbjct: 7   PGVWFLRAFSRDSW----FRGFILLLTFLIYACYHMSRKPISIVKSRLHQNCS 55



>gb:BC068927_2555421 Xenopus laevis hypothetical protein MGC83169,
           mRNA (cDNA clone MGC:83169 IMAGE:6631178), complete cds.
          Length = 526

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 23/54 (42%), Positives = 32/54 (59%)
 Frame = +2

Query: 299 PPGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLDPNSS 460
           PPGI L  ++    W    +R +VL +TF+ Y S+H SRKP +IVK  L  + S
Sbjct: 5   PPGIRLFLSLSRDQW----FRALVLVLTFLFYCSFHLSRKPITIVKGELHRHCS 54



>gb:BC043786_2548245 Xenopus laevis solute carrier family 37
           (glycerol-3-phosphate transporter), member 1, mRNA (cDNA
           clone MGC:53019 IMAGE:5537165), complete cds.
          Length = 526

 Score = 43.5 bits (101), Expect = 0.002
 Identities = 23/54 (42%), Positives = 32/54 (59%)
 Frame = +2

Query: 299 PPGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLDPNSS 460
           PPGI L  ++    W    +R +VL +TF+ Y S+H SRKP +IVK  L  + S
Sbjct: 5   PPGIRLFVSLSRDQW----FRALVLVLTFLFYCSFHLSRKPITIVKGELHRHCS 54



>gb:AP003019_1824217 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:OSJNBa0035I03.>gb:AP007257_1863422 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBb0019L07.
          Length = 471

 Score = 43.5 bits (101), Expect = 0.002
 Identities = 20/32 (62%), Positives = 26/32 (81%)
 Frame = +2

Query: 350 KTYRYVVLFVTFIAYTSYHASRKPSSIVKSVL 445
           ++ +Y VL +TF AY S+HASRKP SIVK+VL
Sbjct: 18  RSRQYAVLGLTFAAYASFHASRKPPSIVKAVL 49



>gb:AE013599_1133084 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE013599_1133085 Drosophila melanogaster
           chromosome 2R, complete sequence.>gb:AE003453_1210383
           Drosophila melanogaster chromosome 2R, section 61 of 74
           of the complete sequence.>gb:AE003453_1210384 Drosophila
           melanogaster chromosome 2R, section 61 of 74 of the
           complete sequence.>gb:AY052136_1290730 Drosophila
           melanogaster SD09370 full length cDNA.
          Length = 528

 Score = 41.6 bits (96), Expect = 0.008
 Identities = 19/35 (54%), Positives = 23/35 (65%)
 Frame = +2

Query: 356 YRYVVLFVTFIAYTSYHASRKPSSIVKSVLDPNSS 460
           Y+  V  +TF+AY  YH  RKP S+VKSVL  N S
Sbjct: 46  YKMSVFVLTFLAYACYHMCRKPISVVKSVLQGNCS 80



>gb:AE013599_1133083 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003453_1210382 Drosophila melanogaster
           chromosome 2R, section 61 of 74 of the complete
           sequence.>gb:BT001590_1356363 Drosophila melanogaster
           RE26973 full insert cDNA.
          Length = 566

 Score = 41.6 bits (96), Expect = 0.008
 Identities = 19/35 (54%), Positives = 23/35 (65%)
 Frame = +2

Query: 356 YRYVVLFVTFIAYTSYHASRKPSSIVKSVLDPNSS 460
           Y+  V  +TF+AY  YH  RKP S+VKSVL  N S
Sbjct: 84  YKMSVFVLTFLAYACYHMCRKPISVVKSVLQGNCS 118



>gb:BC088593_2565723 Xenopus tropicalis hypothetical LOC496867, mRNA
           (cDNA clone MGC:97825 IMAGE:6992027), complete cds.
          Length = 499

 Score = 40.8 bits (94), Expect = 0.013
 Identities = 23/53 (43%), Positives = 32/53 (60%)
 Frame = +2

Query: 302 PGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLDPNSS 460
           P I L++++  +D     YR  ++ +TF+ YT YH SRKP SIVK  L  N S
Sbjct: 7   PAIRLMQSV-SRD---SCYRGFIIVMTFLFYTCYHMSRKPISIVKGQLHRNCS 55



>gb:BC042235_2548057 Xenopus laevis similar to solute carrier family
           37 (glycerol-3-phosphate transporter), member 1, mRNA
           (cDNA clone MGC:53961 IMAGE:5570697), complete cds.
          Length = 499

 Score = 40.8 bits (94), Expect = 0.013
 Identities = 23/53 (43%), Positives = 32/53 (60%)
 Frame = +2

Query: 302 PGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLDPNSS 460
           P I L++++  +D     YR  ++ +TF+ YT YH SRKP SIVK  L  N S
Sbjct: 7   PAIRLMQSV-SRD---SCYRGFIIVMTFLFYTCYHLSRKPISIVKGQLHRNCS 55



>gb:AF311320_1896254 Homo sapiens glycerol 3-phosphate permease
           (SLC37A1) mRNA, complete cds.
          Length = 533

 Score = 40.4 bits (93), Expect = 0.017
 Identities = 21/49 (42%), Positives = 26/49 (53%)
 Frame = +2

Query: 299 PPGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVL 445
           P GI  I +     W    YR  +  +TF+ Y S+H SRKP SIVK  L
Sbjct: 5   PAGIRFIISFSRDQW----YRAFIFILTFLLYASFHLSRKPISIVKGEL 49



>sp|P57057|GLPT_HUMAN Glycerol-3-phosphate transporter (G-3-P
           transporter) (G-3-P permease) (Solute carrier family 37
           member 1).>gb:HSA269529_2001805 Homo sapiens mRNA for
           glycerol 3-phosphate permease (SLC37A1 gene).
          Length = 533

 Score = 40.4 bits (93), Expect = 0.017
 Identities = 21/49 (42%), Positives = 26/49 (53%)
 Frame = +2

Query: 299 PPGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVL 445
           P GI  I +     W    YR  +  +TF+ Y S+H SRKP SIVK  L
Sbjct: 5   PAGIRFIISFSRDQW----YRAFIFILTFLLYASFHLSRKPISIVKGEL 49



>gb:AK033656_1163456 Mus musculus adult male cecum cDNA, RIKEN
           full-length enriched library, clone:9130209C10
           product:GLYCEROL-3-PHOSPHATE TRANSPORTER (G-3-P
           TRANSPORTER) (G-3-P PERMEASE) homolog [Homo sapiens],
           full insert sequence.>gb:BC027294_2095885 Mus musculus
           solute carrier family 37 (glycerol-3-phosphate
           transporter), member 1, mRNA (cDNA clone MGC:28167
           IMAGE:3985469), complete cds.
          Length = 531

 Score = 40.0 bits (92), Expect = 0.023
 Identities = 21/49 (42%), Positives = 26/49 (53%)
 Frame = +2

Query: 299 PPGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVL 445
           P GI  I +     W    YR  +  +TF+ Y S+H SRKP SIVK  L
Sbjct: 5   PVGIRFIISFSRDQW----YRAFIFMLTFLLYASFHLSRKPISIVKGEL 49



>gb:BC081990_2108227 Rattus norvegicus solute carrier family 37
           (glycerol-3-phosphate transporter), member 1
           (predicted), mRNA (cDNA clone MGC:94188 IMAGE:7129340),
           complete cds.
          Length = 537

 Score = 39.7 bits (91), Expect = 0.030
 Identities = 20/49 (40%), Positives = 26/49 (53%)
 Frame = +2

Query: 299 PPGISLIRTIRGKDWSFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVL 445
           P G+  I +     W    YR  +  +TF+ Y S+H SRKP SIVK  L
Sbjct: 5   PMGVRFIISFSRDQW----YRAFIFMLTFLLYASFHLSRKPISIVKGEL 49



>gb:AB188995_2175365 Turnip mosaic virus gene for polyprotein,
           partial cds, isolate: GBR51.
          Length = 288

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 15/43 (34%), Positives = 28/43 (65%)
 Frame = -3

Query: 129 RERVRKEKAVGERERERESMDVRNERLEFGNGERDREGSVATT 1
           +E+  KE+A  ERER+++    + + +E G G+RD+E +  T+
Sbjct: 18  KEKKEKERAEKERERQKQLALKKGKDVEQGEGKRDKEVNAGTS 60



>gb:BC005744_2090130 Mus musculus solute carrier family 37
           (glycerol-3-phosphate transporter), member 3, mRNA (cDNA
           clone IMAGE:3599603), complete cds.
          Length = 156

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 4/64 (6%)
 Frame = +2

Query: 344 SFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLD----PNSSIDXATLSSNFWPXGDVF 511
           SF  +   V  +TF +Y+  HASRK  S VK  +     PN+      L +  W    +F
Sbjct: 15  SFSHHHLAVFLLTFFSYSLLHASRKTFSNVKVSISKQWTPNAFNTSLDLPAEIWSSNHLF 74

Query: 512 VKRE 523
              E
Sbjct: 75  PSTE 78



>gb:AK076213_1171307 Mus musculus 15 days embryo head cDNA, RIKEN
           full-length enriched library, clone:4021402N16
           product:similar to TRANSMEMBRANE PROTEIN QUICKEN
           [Xenopus laevis], full insert sequence.
          Length = 494

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 4/64 (6%)
 Frame = +2

Query: 344 SFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVLD----PNSSIDXATLSSNFWPXGDVF 511
           SF  +   V  +TF +Y+  HASRK  S VK  +     PN+      L +  W    +F
Sbjct: 15  SFSHHHLAVFLLTFFSYSLLHASRKTFSNVKVSISKQWTPNAFNTSLDLPAEIWSSNHLF 74

Query: 512 VKRE 523
              E
Sbjct: 75  PSTE 78



>pir|T19384|T19384 FMRFamide-like peptide 4 - Caenorhabditis
           elegans>gb:AF042390_1235813 Caenorhabditis elegans
           FMRFamide-like peptide 4 (flp-4) mRNA, complete
           cds.>gb:CEC18D1_1360565 Caenorhabditis elegans cosmid
           C18D1, complete sequence.
          Length = 93

 Score = 33.1 bits (74), Expect = 2.8
 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 4/55 (7%)
 Frame = +2

Query: 344 SFKTYRYVVLFVTFIAYTSYHASRKPSSIV----KSVLDPNSSIDXATLSSNFWP 496
           S KT+ + +LF T +A T+ H       I     K++  P+  I       NFWP
Sbjct: 7   SLKTFIFSLLFATLLALTAAHPPSSGEEIAEQEEKNIASPDELIPEIVEQQNFWP 61



>gb:TMO489259_2455313 Turnip Mosaic Virus partial gene for partial
           polyprotein, genomic RNA.
          Length = 499

 Score = 32.7 bits (73), Expect = 3.6
 Identities = 16/43 (37%), Positives = 27/43 (62%)
 Frame = -3

Query: 129 RERVRKEKAVGERERERESMDVRNERLEFGNGERDREGSVATT 1
           +ER  KEKA  ERE++++    + + +E   G+RDRE +  T+
Sbjct: 229 KERKEKEKAEKEREKQKQLALKKGKDVEKEEGKRDREVNAGTS 271



>gb:AB093596_2169115 Turnip mosaic virus gene for polyprotein,
            complete cds, isolate:St48.
          Length = 3164

 Score = 32.7 bits (73), Expect = 3.6
 Identities = 16/43 (37%), Positives = 27/43 (62%)
 Frame = -3

Query: 129  RERVRKEKAVGERERERESMDVRNERLEFGNGERDREGSVATT 1
            RER  KEKA  ERE++++    + +    G+G+RD+E +  T+
Sbjct: 2894 RERKEKEKAEKEREKQKQLALNKGKEPAQGDGKRDKEVNAGTS 2936



>gb:AB076519_2166715 Turnip mosaic virus CP gene for polyprotein,
           partial cds, isolate:St48.
          Length = 288

 Score = 32.7 bits (73), Expect = 3.6
 Identities = 16/43 (37%), Positives = 27/43 (62%)
 Frame = -3

Query: 129 RERVRKEKAVGERERERESMDVRNERLEFGNGERDREGSVATT 1
           RER  KEKA  ERE++++    + +    G+G+RD+E +  T+
Sbjct: 18  RERKEKEKAEKEREKQKQLALNKGKEPAQGDGKRDKEVNAGTS 60



>gb:AE016787_333014 Pseudomonas putida KT2440 section 14 of 21 of
           the complete genome.>gb:AE015451_948091 Pseudomonas
           putida KT2440 complete genome.
          Length = 454

 Score = 32.3 bits (72), Expect = 4.8
 Identities = 18/56 (32%), Positives = 28/56 (50%)
 Frame = +2

Query: 359 RYVVLFVTFIAYTSYHASRKPSSIVKSVLDPNSSIDXATLSSNFWPXGDVFVKREL 526
           RY++LF+ F+  T  +A R   +I  S L  +  ID  TL   F   G  +V  ++
Sbjct: 10  RYLILFMLFLVTTINYADRATIAIAGSSLQKDLGIDAVTLGYIFSAFGWAYVAGQI 65



>gb:AE016783_331971 Pseudomonas putida KT2440 section 10 of 21 of
           the complete genome.>gb:AE015451_947048 Pseudomonas
           putida KT2440 complete genome.
          Length = 438

 Score = 32.0 bits (71), Expect = 6.2
 Identities = 14/49 (28%), Positives = 30/49 (61%), Gaps = 2/49 (4%)
 Frame = +2

Query: 344 SFKTYRYVVLFVTFIAYTSYHASRKPSSIVKSVL--DPNSSIDXATLSS 484
           +FK +R  +  +T++AY +++ +RK  S+ K  +  DP   +D A +++
Sbjct: 7   AFKRWRIQIFAITWLAYAAFYFTRKAFSVAKLGIAEDPGFMLDKAAMAN 55



>gb:BC084352_2563733 Xenopus laevis hypothetical LOC495149, mRNA
           (cDNA clone IMAGE:5078020), partial cds.
          Length = 1029

 Score = 31.6 bits (70), Expect = 8.1
 Identities = 17/37 (45%), Positives = 21/37 (56%)
 Frame = -3

Query: 129 RERVRKEKAVGERERERESMDVRNERLEFGNGERDRE 19
           RE+ R+ +   ERERERE  +   ER      ERDRE
Sbjct: 759 REKDREREREKEREREREERERERERERERERERDRE 795



>gb:BC067922_2554908 Xenopus tropicalis hypothetical protein
           MGC69319, mRNA (cDNA clone MGC:69319 IMAGE:5308817),
           complete cds.
          Length = 769

 Score = 31.6 bits (70), Expect = 8.1
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = -3

Query: 156 ESKGFFFWFRERVRKEKAVGERERERESMDVRNERLEFGNGERDRE 19
           E KG     R+ + KE+   ERERERE  +   ER +    E++RE
Sbjct: 239 EEKGKKEKERQEIEKERRERERERERERREREREREKEREKEKERE 284



>gb:AJ831809_2279661 Turnip mosaic virus partial gene for
           polyprotein, genomic RNA, isolate HZWJ.
          Length = 288

 Score = 31.6 bits (70), Expect = 8.1
 Identities = 15/43 (34%), Positives = 26/43 (60%)
 Frame = -3

Query: 129 RERVRKEKAVGERERERESMDVRNERLEFGNGERDREGSVATT 1
           +E+  +EKA  ERER+++    R + +    GERD+E +  T+
Sbjct: 18  KEKKEREKAEKERERQKQLALKRGKNVAQEEGERDKEVNAGTS 60



>gb:AB189009_2175379 Turnip mosaic virus gene for polyprotein,
           partial cds, isolate: GRC45.
          Length = 287

 Score = 31.6 bits (70), Expect = 8.1
 Identities = 17/43 (39%), Positives = 27/43 (62%)
 Frame = -3

Query: 129 RERVRKEKAVGERERERESMDVRNERLEFGNGERDREGSVATT 1
           +ER  KEKA  ERER+++ + ++  +     GERDRE +  T+
Sbjct: 18  KERKEKEKAEKERERQKQ-LALKKGKNSQEEGERDREVNAGTS 59



>gb:AB093613_2169132 Turnip mosaic virus gene for polyprotein,
            complete cds, isolate:KYD81J.
          Length = 3164

 Score = 31.6 bits (70), Expect = 8.1
 Identities = 15/43 (34%), Positives = 25/43 (58%)
 Frame = -3

Query: 129  RERVRKEKAVGERERERESMDVRNERLEFGNGERDREGSVATT 1
            +ER  +E+A  ERE++R+    + +      GERD E + AT+
Sbjct: 2894 KERKERERAEKEREKQRQLALKKGKNAALEEGERDNEVNAATS 2936



>gb:AB076510_2166706 Turnip mosaic virus CP gene for polyprotein,
           partial cds, isolate:KYD81J.
          Length = 288

 Score = 31.6 bits (70), Expect = 8.1
 Identities = 15/43 (34%), Positives = 25/43 (58%)
 Frame = -3

Query: 129 RERVRKEKAVGERERERESMDVRNERLEFGNGERDREGSVATT 1
           +ER  +E+A  ERE++R+    + +      GERD E + AT+
Sbjct: 18  KERKERERAEKEREKQRQLALKKGKNAALEEGERDNEVNAATS 60



>gb:CET11G6_1367635 Caenorhabditis elegans cosmid T11G6, complete
           sequence.
          Length = 502

 Score = 31.6 bits (70), Expect = 8.1
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 1/67 (1%)
 Frame = +2

Query: 326 IRGKDWSFKTYRYVVLFV-TFIAYTSYHASRKPSSIVKSVLDPNSSIDXATLSSNFWPXG 502
           I G+ WS     +V +FV TF++Y   HA+RK  S VK       S+    +S+   P G
Sbjct: 26  ITGQKWS---KHHVFIFVHTFMSYAMLHATRKTLSTVK------PSLIHTWISNTSTPDG 76

Query: 503 DVFVKRE 523
            VF  ++
Sbjct: 77  PVFPSQQ 83



>gb:BA000016_675133 Clostridium perfringens str. 13 DNA, complete
           genome.
          Length = 502

 Score = 31.6 bits (70), Expect = 8.1
 Identities = 21/68 (30%), Positives = 34/68 (50%)
 Frame = -3

Query: 480 LKVAXSIDEFGSKTLLTMLLGFLEAW*DVYAINVTNKTTYLYVLKLQSLPLMVLIREIPG 301
           + V  S+  FG   +L +++G   A   VY I V  +   +Y+   +  PL+V +  +  
Sbjct: 301 INVTISLSVFGM--ILGLIVGIALAMIRVYKIPVLKQIAEVYISFFRGTPLLVQLFLLYF 358

Query: 300 GFPLVIPS 277
           G P VIPS
Sbjct: 359 GVPQVIPS 366



>pir|T24849|T24849 hypothetical protein T11G6.2 - Caenorhabditis
           elegans
          Length = 495

 Score = 31.6 bits (70), Expect = 8.1
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 1/67 (1%)
 Frame = +2

Query: 326 IRGKDWSFKTYRYVVLFV-TFIAYTSYHASRKPSSIVKSVLDPNSSIDXATLSSNFWPXG 502
           I G+ WS     +V +FV TF++Y   HA+RK  S VK       S+    +S+   P G
Sbjct: 19  ITGQKWS---KHHVFIFVHTFMSYAMLHATRKTLSTVK------PSLIHTWISNTSTPDG 69

Query: 503 DVFVKRE 523
            VF  ++
Sbjct: 70  PVFPSQQ 76



>pir|T24796|T24796 hypothetical protein T10C6.6a - Caenorhabditis
           elegans>gb:CET10C6_1367571 Caenorhabditis elegans cosmid
           T10C6, complete sequence.
          Length = 456

 Score = 31.6 bits (70), Expect = 8.1
 Identities = 15/27 (55%), Positives = 19/27 (70%)
 Frame = +2

Query: 359 RYVVLFVTFIAYTSYHASRKPSSIVKS 439
           + +V  VTF++Y  YHASRK  S VKS
Sbjct: 9   KVMVFVVTFVSYGLYHASRKALSGVKS 35


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 502,272,152
Number of Sequences: 1806583
Number of extensions: 9367956
Number of successful extensions: 39021
Number of sequences better than 10.0: 52
Number of HSP's better than 10.0 without gapping: 35574
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 38213
length of database: 581,917,975
effective HSP length: 117
effective length of database: 370,547,764
effective search space used: 23344509132
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)