BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig1043
         (836 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|Q9SEU7|THM3_ARATH|THM3_ARATH Thioredoxin M-type 3, chloroplast precursor...   150   4e-39   Arabidopsis thaliana [mouse-ear cress]
gb:AK176784_1818772 Arabidopsis thaliana mRNA for putative thior...   149   5e-39   
gb:AK175478_1817466 Arabidopsis thaliana mRNA for putative thior...   148   1e-38   
gb:AF095751_1767783 Arabidopsis thaliana thioredoxin m3 mRNA, co...   148   1e-38   
gb:OSJN00005_1693146 Oryza sativa genomic DNA, chromosome 4, BAC...   117   5e-26   
sp|Q9ZP20|THIM_ORYSA|THIM_ORYSA Thioredoxin M-type, chloroplast precursor (...   111   1e-23   Oryza sativa [red rice]
gb:PSU35831_1702500 Pisum sativum thioredoxin m gene, nuclear ge...   109   6e-23   
sp|P48384|THIM_PEA|THIM_PEA Thioredoxin M-type, chloroplast precursor (TR...   109   6e-23   Pisum sativum [garden pea]
gb:PSA316577_1701973 Pisum sativum chloroplast mRNA for putative...   108   1e-22   
gb:AX155045_1462761 Sequence 91 from Patent WO0138484.                107   4e-22   
sp|Q9SEU6|THM4_ARATH|THM4_ARATH Thioredoxin M-type 4, chloroplast precursor...   105   1e-21   Arabidopsis thaliana [mouse-ear cress]
sp|Q9ZP21|THIM_WHEAT|THIM_WHEAT Thioredoxin M-type, chloroplast precursor (...   105   1e-21   Triticum aestivum [Canadian hard winter wheat]
gb:AP004768_1844711 Oryza sativa (japonica cultivar-group) genom...   103   4e-21   
sp|Q41864|THIM_MAIZE|THIM_MAIZE Thioredoxin M-type, chloroplast precursor (...   103   4e-21   Zea mays [maize]
gb:AF095752_1767784 Arabidopsis thaliana thioredoxin m4 mRNA, co...   103   5e-21   
gb:OSJN00177_1696251 Oryza sativa genomic DNA, chromosome 4, BAC...   102   9e-21   
gb:BX572092_796687 Prochlorococcus marinus MED4 complete genome;...   102   1e-20   
gb:BX569691_775626 Synechococcus sp. WH8102 complete genome; seg...   101   2e-20   
gb:BX572098_798469 Prochlorococcus marinus MIT9313 complete geno...   101   2e-20   
gb:AE017164_395595 Prochlorococcus marinus subsp. marinus str. C...   101   2e-20   
gb:SOTHM4_1715914 Spinach mRNA for thioredoxin m (clone p6SocTRM...   100   3e-20   
pir|I39624|TXAI thioredoxin 1 - Anabaena sp.>pir|AD1813|AD1813 t...   100   3e-20   
sp|P07591|THIM_SPIOL|THIM_SPIOL Thioredoxin M-type, chloroplast precursor (...   100   3e-20   Spinacia oleracea
sp|P06544|THI1_ANASP|THI1_ANASP Thioredoxin 1 (TRX-1) (Thioredoxin M).           100   3e-20   Anabaena sp.
gb:BA000039_726595 Thermosynechococcus elongatus BP-1 DNA, compl...   100   4e-20   
gb:CRTRXM_1673586 C.reinhardtii mRNA for thioredoxin-m.                98   2e-19   
sp|P23400|THIM_CHLRE|THIM_CHLRE Thioredoxin M-type, chloroplast precursor (...    98   2e-19   Chlamydomonas reinhardtii
gb:CRTRX_1673583 C.reinhardtii Trx mRNA for thioredoxin Ch2.           96   8e-19   
gb:BA000045_740955 Gloeobacter violaceus PCC 7421 DNA, complete ...    95   1e-18   
gb:AE013085_288885 Thermoanaerobacter tengcongensis MB4, section...    94   2e-18   
sp|O48737|THM1_ARATH|THM1_ARATH Thioredoxin M-type 1, chloroplast precursor...    94   2e-18   Arabidopsis thaliana [mouse-ear cress]
pir|A32956|A32956 thioredoxin m - Synechococcus sp.>gb:ANITRXM_5...    94   4e-18   Synechococcus sp.
sp|P12243|THI1_SYNP7|THI1_SYNP7 Thioredoxin 1 (TRX-1) (Thioredoxin M).            94   4e-18   Synechococcus sp.
sp|P51225|THIO_PORPU|THIO_PORPU Thioredoxin.>pir|S73146|S73146 thioredoxin ...    93   5e-18   Porphyra purpurea
sp|P50254|THIO_PORYE|THIO_PORYE Thioredoxin.>pir|S46521|S46521 thioredoxin ...    92   9e-18   Pyropia yezoensis
sp|Q9XGS0|THIM_BRANA|THIM_BRANA Thioredoxin M-type, chloroplast precursor (...    92   2e-17   Brassica napus [oilseed rape]
pir|AD2039|AD2039 thioredoxin [imported] - Nostoc sp. (strain PC...    91   2e-17   Nostoc sp. PCC 7120
gb:AP006840_569593 Symbiobacterium thermophilum DNA, complete ge...    91   3e-17   
sp|Q92JR5|THIO_RICCN|THIO_RICCN Thioredoxin (TRX).>pir|B97700|B97700 thiore...    91   3e-17   Rickettsia conorii
gb:AE013598_298003 Xanthomonas oryzae pv. oryzae KACC10331, comp...    90   6e-17   
sp|P50338|THIO_GRIPA|THIO_GRIPA Thioredoxin.>pir|S46522|S46522 thioredoxin ...    90   6e-17   Griffithsia pacifica
gb:AY084496_1569585 Arabidopsis thaliana clone 10950 mRNA, compl...    89   1e-16   
pir|S46958|S46958 thioredoxin A - Synechocystis sp. (strain PCC ...    89   1e-16   Synechocystis sp. PCC 6803
sp|P52231|THIO_SYNY3|THIO_SYNY3 Thioredoxin (TRX).                                89   1e-16   Synechocystis sp.
pir|C81090|C81090 thioredoxin NMB1366 [imported] - Neisseria men...    89   1e-16   Neisseria meningitidis serogroup B
sp|Q9SEU8|THM2_ARATH|THM2_ARATH Thioredoxin M-type 2, chloroplast precursor...    89   1e-16   Arabidopsis thaliana [mouse-ear cress]
gb:CS008403_1455704 Sequence 29 from Patent WO2005007189.              88   2e-16   
gb:CS008401_1455703 Sequence 27 from Patent WO2005007189.              88   2e-16   
gb:CVPTRXFUS_2151987 Fusion cloning vector pTRXFUS, complete seq...    88   2e-16   
gb:AY148193_2143938 Synthetic construct thioredoxin/transketolas...    88   2e-16   
gb:CS008407_1455706 Sequence 33 from Patent WO2005007189.              88   2e-16   
gb:CS008405_1455705 Sequence 31 from Patent WO2005007189.              88   2e-16   
gb:CS008399_1455702 Sequence 25 from Patent WO2005007189.              88   2e-16   
gb:CS008397_1455701 Sequence 23 from Patent WO2005007189.              88   2e-16   
gb:AE016769_328671 Escherichia coli CFT073 section 15 of 18 of t...    88   2e-16   
gb:AE012498_283002 Xanthomonas campestris pv. campestris str. AT...    88   2e-16   
pir|D71707|D71707 thioredoxin (trxA) RP002 - Rickettsia prowazek...    88   2e-16   Rickettsia prowazekii
pir|B91218|B91218 thioredoxin 1 [imported] - Escherichia coli (s...    88   2e-16   Escherichia coli [E. coli]
pir|S35497|S35497 thioredoxin - Salmonella typhimurium>pir|A9151...    88   2e-16   Salmonella enterica subsp. enterica serovar Typhimurium
sp|Q9ZEE0|THIO_RICPR|THIO_RICPR Thioredoxin (TRX).                                88   2e-16   Rickettsia prowazekii
sp|P00274|THIO_ECOLI|THIO_ECOLI Thioredoxin 1 (TRX1) (TRX).                       88   2e-16   Escherichia coli [E. coli]
sp|P37395|THIO_CYACA|THIO_CYACA Thioredoxin.>pir|S31915|S31915 thioredoxin ...    88   2e-16   Cyanidium caldarium
gb:AY657681_2146691 Synthetic construct Peudomonas aeruginosa cl...    87   3e-16   
gb:AF095750_1767782 Arabidopsis thaliana thioredoxin m2 mRNA, co...    87   3e-16   
gb:BX897700_828272 Bartonella quintana str. Toulouse, complete g...    87   3e-16   
sp|Q9X2T1|THIO_PSEAE|THIO_PSEAE Thioredoxin (TRX).>pir|G82991|G82991 thiore...    87   3e-16   Pseudomonas aeruginosa
gb:AE017340_458116 Idiomarina loihiensis L2TR, complete genome.        87   4e-16   
gb:BX321859_773362 Nitrosomonas europaea ATCC 19718, complete ge...    87   5e-16   
pir|G70464|G70464 thioredoxin - Aquifex aeolicus>gb:AE000763_271...    87   5e-16   Aquifex aeolicus
gb:AE016915_356545 Chromobacterium violaceum ATCC 12472 section ...    86   7e-16   
gb:AE017197_401997 Rickettsia typhi str. Wilmington complete gen...    86   9e-16   
gb:AE017156_393164 Haemophilus ducreyi strain 35000HP section 6 ...    86   9e-16   
pir|S33357|S33357 thioredoxin - Streptomyces aureofaciens (fragm...    86   9e-16   Kitasatospora aureofaciens
sp|P33791|THIO_STRAU|THIO_STRAU Thioredoxin (TRX) (Fragment).>gb:SATRX_1719...    86   9e-16   Kitasatospora aureofaciens
gb:AE012032_278743 Xanthomonas axonopodis pv. citri str. 306, se...    86   1e-15   
gb:BX571874_789519 Photorhabdus luminescens subsp. laumondii TTO...    85   1e-15   
gb:AE004969_60408 Neisseria gonorrhoeae FA 1090, complete genome.      85   1e-15   
gb:CP000027_79664 Dehalococcoides ethenogenes 195, complete geno...    85   2e-15   
gb:AE015489_314828 Shewanella oneidensis MR-1 section 38 of 457 ...    84   3e-15   
gb:ECOTRXA1_130453 Escherichia coli thioredoxin (trxA) gene, com...    84   3e-15   
pir|E81850|E81850 thioredoxin I NMA1578 [imported] - Neisseria m...    84   3e-15   Neisseria meningitidis serogroup A
sp|Q7M1B9|THIO_CHLAU|THIO_CHLAU Thioredoxin (TRX).                                84   3e-15   Chloroflexus aurantiacus
gb:BX640446_815876 Bordetella bronchiseptica strain RB50, comple...    84   4e-15   
gb:AE017315_440088 Desulfovibrio vulgaris subsp. vulgaris str. H...    84   4e-15   
gb:BX842652_825305 Bdellovibrio bacteriovorus complete genome, s...    83   6e-15   
gb:BX640414_805687 Bordetella pertussis strain Tohama I, complet...    83   6e-15   
pir|A55124|A55124 thioredoxin - Chloroflexus aurantiacus               83   6e-15   Chloroflexus aurantiacus J-10-fl
sp|Q9CM49|THIO_PASMU|THIO_PASMU Thioredoxin (TRX).>gb:AE006138_215882 Paste...    83   6e-15   Pasteurella multocida
gb:AE016875_354581 Pseudomonas syringae pv. tomato str. DC3000 s...    82   1e-14   
gb:OSJN00083_1694574 Oryza sativa genomic DNA, chromosome 4, BAC...    82   1e-14   
gb:BX950851_842946 Erwinia carotovora subsp. atroseptica SCRI104...    82   1e-14   
gb:AE016966_369261 Coxiella burnetii strain RSA 493, section 7 o...    82   1e-14   
gb:AE012561_285426 Xylella fastidiosa Temecula1, section 9 of 9 ...    82   2e-14   
gb:CR555306_108087 Azoarcus sp. EbN1 complete genome.                  81   2e-14   
gb:AJ749949_531902 Francisella tularensis subsp. tularensis comp...    81   3e-14   
sp|P43785|THIO_HAEIN|THIO_HAEIN Thioredoxin (TRX).>pir|E64047|E64047 thiore...    81   3e-14   Haemophilus influenzae
gb:AY673996_1621513 Gracilaria tenuistipitata var. liui chloropl...    80   4e-14   
gb:CP000009_862647 Gluconobacter oxydans 621H, complete genome.        80   4e-14   
gb:AL646063_546116 Ralstonia solanacearum GMI1000 chromosome, co...    80   4e-14   
gb:AE017282_426894 Methylococcus capsulatus str. Bath, complete ...    80   4e-14   
pir|AD0471|AD0471 thioredoxin 1 [imported] - Yersinia pestis (st...    80   4e-14   Yersinia pestis
sp|P00275|THI1_CORNE|THI1_CORNE Thioredoxin C-1.>pir|A00281|TXFK thioredoxi...    80   4e-14   Corynebacterium nephridii
gb:BX897699_826662 Bartonella henselae strain Houston-1, complet...    80   5e-14   
gb:SME591782_184051 Sinorhizobium meliloti 1021 complete chromos...    80   5e-14   
pir|F82526|F82526 thioredoxin XF2698 [imported] - Xylella fastid...    80   5e-14   Xylella fastidiosa
gb:AE016827_343255 Mannheimia succiniciproducens MBEL55E, comple...    80   6e-14   
gb:AP006618_562064 Nocardia farcinica IFM 10152 DNA, complete ge...    79   1e-13   
gb:AE016822_341357 Leifsonia xyli subsp. xyli str. CTCB07, compl...    79   1e-13   
gb:CR378674_96789 Photobacterium profundum SS9; segment 12/12.         79   1e-13   
gb:AB032759_5171 Actinobacillus actinomycetemcomitans trxA gene ...    79   1e-13   
gb:AP006840_567436 Symbiobacterium thermophilum DNA, complete ge...    79   1e-13   
gb:D63676_1674716 Cyanidium caldarium trnK, trpA, trnT, rps4, tr...    78   2e-13   
gb:BA000037_724008 Vibrio vulnificus YJ016 DNA, chromosome I, co...    78   2e-13   
gb:AE016800_335688 Vibrio vulnificus CMCP6 chromosome I section ...    78   2e-13   
gb:CP000031_87860 Silicibacter pomeroyi DSS-3, complete genome.        78   2e-13   
gb:BX571965_791286 Burkholderia pseudomallei strain K96243, chro...    78   2e-13   
gb:AF279106_495020 Uncultured marine gamma proteobacterium EBAC3...    78   2e-13   
gb:CP000020_870233 Vibrio fischeri ES114 chromosome I, complete ...    77   3e-13   
gb:AE016793_334594 Pseudomonas putida KT2440 section 20 of 21 of...    77   3e-13   
gb:BA000031_708461 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    77   4e-13   
sp|P09857|THIO_CHRVI|THIO_CHRVI Thioredoxin (TRX).>pir|A26622|A26622 thiore...    77   4e-13   Allochromatium vinosum
pir|G75612|G75612 thioredoxin 1 - Deinococcus radiodurans (strai...    77   5e-13   Deinococcus radiodurans
pir|A35135|A35135 thioredoxin - Rhodobacter sphaeroides>gb:RCATR...    77   5e-13   Rhodobacter sphaeroides
sp|P96132|THIO_THIRO|THIO_THIRO Thioredoxin (TRX) (Fragment).>gb:TRU75512_1...    77   5e-13   Thiocapsa roseopersicina
sp|P52233|THIO_THIFE|THIO_THIFE Thioredoxin (TRX).>gb:TFU20361_197592 Thiob...    77   5e-13   Acidithiobacillus ferrooxidans
sp|P08058|THIO_RHOSH|THIO_RHOSH Thioredoxin (TRX).                                77   5e-13   Rhodobacter sphaeroides
gb:BX572593_799688 Rhodopseudomonas palustris CGA009 complete ge...    76   7e-13   
gb:AE008692_240835 Zymomonas mobilis subsp. mobilis ZM4, complet...    76   7e-13   
pir|AH3504|AH3504 thioredoxin C-1 [imported] - Brucella melitens...    76   7e-13   Brucella melitensis
pir|B70851|B70851 probable trxC protein - Mycobacterium tubercul...    76   7e-13   Mycobacterium tuberculosis
sp|P52229|THIO_MYCTU|THIO_MYCTU Thioredoxin (TRX) (MPT46).                        76   7e-13   Mycobacterium tuberculosis
gb:CP000020_871085 Vibrio fischeri ES114 chromosome I, complete ...    76   9e-13   
gb:BX294154_771691 Pirellula sp. strain 1 complete genome; segme...    76   9e-13   
gb:BA000012_669879 Mesorhizobium loti MAFF303099 DNA, complete g...    76   9e-13   
sp|O22022|THIO_CYAME|THIO_CYAME Thioredoxin.>gb:AB002583_1508730 Cyanidiosc...    75   1e-12   Cyanidioschyzon merolae
gb:BA000040_729011 Bradyrhizobium japonicum USDA 110 DNA, comple...    75   2e-12   
gb:BA000030_705129 Streptomyces avermitilis MA-4680 genomic DNA,...    75   2e-12   
gb:CR767821_117118 Ehrlichia ruminantium strain Welgevonden, com...    75   2e-12   
pir|D97279|D97279 thioredoxin [imported] - Clostridium acetobuty...    75   2e-12   Clostridium acetobutylicum
pir|T42061|T42061 thioredoxin - Streptomyces coelicolor>gb:SCO00...    75   2e-12   Streptomyces coelicolor
pir|H69517|H69517 thioredoxin (trx-4) homolog - Archaeoglobus fu...    75   2e-12   Archaeoglobus fulgidus
sp|P46843|TRXB_MYCLE|TRXB_MYCLE Bifunctional thioredoxin reductase/thioredo...    75   2e-12   Mycobacterium leprae
sp|P33636|THI2_ECOLI|THI2_ECOLI Thioredoxin 2 (EC 1.8.1.8) (Protein-disulfi...    75   2e-12   Escherichia coli [E. coli]
gb:AE017180_401568 Geobacter sulfurreducens PCA, complete genome.      75   2e-12   
pir|AH2101|AH2101 thioredoxin [imported] - Nostoc sp. (strain PC...    75   2e-12   Nostoc sp. PCC 7120
gb:BA000030_702193 Streptomyces avermitilis MA-4680 genomic DNA,...    74   3e-12   
gb:AE017242_415045 Mycobacterium avium subsp. paratuberculosis s...    74   3e-12   
gb:AE014296_1134355 Drosophila melanogaster chromosome 3L, compl...    74   3e-12   
gb:AE017172_396428 Porphyromonas gingivalis W83 section 1 of 8 o...    74   3e-12   
pir|D82338|D82338 thioredoxin VC0306 [imported] - Vibrio cholera...    74   3e-12   Vibrio cholerae
gb:AL935252_550242 Lactobacillus plantarum strain WCFS1 complete...    74   4e-12   
pir|G97090|G97090 thioredoxin, trx [imported] - Clostridium acet...    74   4e-12   Clostridium acetobutylicum
sp|O30974|THIO_MYCSM|THIO_MYCSM Thioredoxin (TRX).>gb:AF023161_469984 Mycob...    74   4e-12   Mycolicibacterium smegmatis
gb:AE012852_286319 Chlorobium tepidum TLS section 73 of 194 of t...    73   6e-12   
pir|AB0831|AB0831 thioredoxin 2 [imported] - Salmonella enterica...    73   6e-12   Salmonella enterica subsp. enterica serovar Typhi
sp|Q8KE49|THI2_CHLTE|THI2_CHLTE Thioredoxin 2 (Trx-2).                            73   6e-12   Chlorobaculum tepidum
gb:AY184796_1587990 Chlamydomonas reinhardtii thioredoxin y (TRX...    73   8e-12   
gb:CP000025_877920 Campylobacter jejuni RM1221, complete genome.       73   8e-12   
gb:AY619685_637090 Uncultured gamma proteobacterium eBACHOT4E07 ...    73   8e-12   
gb:CP000026_75175 Salmonella enterica subsp. enterica serovar Pa...    73   8e-12   
pir|F97361|F97361 thioredoxin c-1 [imported] - Agrobacterium tum...    73   8e-12   Agrobacterium tumefaciens
sp|P52230|THIO_STRCO|THIO_STRCO Thioredoxin (TRX).>pir|T36576|T36576 thiore...    73   8e-12   
gb:BX571658_777849 Wolinella succinogenes, complete genome; segm...    72   1e-11   
gb:AY552545_627809 Uncultured marine gamma proteobacterium EBAC2...    72   1e-11   
gb:CR628336_113120 Legionella pneumophila str. Paris complete ge...    72   1e-11   
gb:AP008226_578938 Thermus thermophilus HB8 genomic DNA, complet...    72   1e-11   
pir|AG2579|AG2579 thioredoxin C-1 trxA [imported] - Agrobacteriu...    72   1e-11   Agrobacterium tumefaciens
gb:AJ749949_531433 Francisella tularensis subsp. tularensis comp...    72   2e-11   
gb:AE016935_361597 Bacteroides thetaiotaomicron VPI-5482, sectio...    72   2e-11   
pir|C81432|C81432 thioredoxin Cj0147c [imported] - Campylobacter...    72   2e-11   Campylobacter jejuni
pir|AG2042|AG2042 thioredoxin [imported] - Nostoc sp. (strain PC...    72   2e-11   Nostoc sp. PCC 7120
sp|Q8CPL5|THIO_STAEP|THIO_STAEP Thioredoxin (TRX).>gb:CP000029_81339 Staphy...    72   2e-11   Staphylococcus epidermidis
gb:BX248361_763622 Corynebacterium diphtheriae gravis NCTC13129,...    71   2e-11   
gb:AE015945_321575 Clostridium tetani E88, section 10 of 10 of t...    71   2e-11   
gb:AE012374_281850 Xanthomonas campestris pv. campestris str. AT...    71   2e-11   
pir|B96796|B96796 thioredoxin-like protein, 49720-48645 [importe...    71   2e-11   Arabidopsis thaliana [mouse-ear cress]
sp|Q9ZEH4|THIO_STAAM|THIO_STAAM Thioredoxin (TRX).>pir|E89885|E89885 thiore...    71   2e-11   Staphylococcus aureus
gb:BT010677_1640623 Arabidopsis thaliana At1g76760 mRNA, complet...    71   3e-11   
gb:BX927157_834634 Corynebacterium glutamicum ATCC 13032, IS fin...    71   3e-11   
gb:BA000036_720818 Corynebacterium glutamicum ATCC 13032 DNA, co...    71   3e-11   
gb:BA000035_717711 Corynebacterium efficiens YS-314 DNA, complet...    71   3e-11   
gb:CORTC2_850604 Corynebacterium nephridii thioredoxin C-2 gene.       70   4e-11   
gb:BAP426489_747034 Buchnera aphidicola (Pemphigus spyrothecae) ...    70   4e-11   
gb:AY552334_627679 Rhizobium etli nucelotidyl transferase, AddB ...    70   4e-11   
gb:AE017305_437019 Thermus thermophilus HB27 section 5 of 7 of t...    70   4e-11   
gb:AE017304_436751 Thermus thermophilus HB27 section 4 of 7 of t...    70   4e-11   
pir|A28215|A28215 thioredoxin - Rhodospirillum rubrum                  70   4e-11   Rhodospirillum rubrum
pir|S02802|S02802 thioredoxin C-2 - coryneform bacterium>gb:CNTH...    70   4e-11   coryneform bacterium
sp|P07887|THI2_CORNE|THI2_CORNE Thioredoxin C-2.                                  70   4e-11   Corynebacterium nephridii
gb:AY184799_1587993 Chlamydomonas reinhardtii thioredoxin x (TRX...    70   5e-11   
gb:AX951400_1484096 Sequence 57 from Patent EP1367064.>gb:AX9599...    70   5e-11   
gb:AX951386_1484089 Sequence 43 from Patent EP1367064.>gb:AX9599...    70   5e-11   
gb:AP006841_571237 Bacteroides fragilis YCH46 DNA, complete genome.    70   5e-11   
gb:AE008921_246387 Uncultured proteobacterium clone EBAC000-60D0...    70   5e-11   
pir|B55124|B55124 thioredoxin - Chlorobium limicola f.sp. thiosu...    70   5e-11   Chlorobaculum thiosulfatiphilum
gb:CR382139_1672186 Debaryomyces hansenii chromosome G of strain...    70   6e-11   
gb:AX951398_1484095 Sequence 55 from Patent EP1367064.>gb:AX9599...    70   6e-11   
gb:AX951384_1484088 Sequence 41 from Patent EP1367064.>gb:AX9599...    70   6e-11   
gb:AX461034_1469006 Sequence 24 from Patent WO0222823.                 70   6e-11   
gb:AE013599_1132872 Drosophila melanogaster chromosome 2R, compl...    70   6e-11   
gb:BX572594_799989 Rhodopseudomonas palustris CGA009 complete ge...    70   6e-11   
sp|P80579|THIO_ALIAC|THIO_ALIAC Thioredoxin (TRX).                                70   6e-11   Alicyclobacillus acidocaldarius
gb:AX951372_1484082 Sequence 29 from Patent EP1367064.>gb:AX9599...    69   8e-11   
gb:AE017144_389808 Helicobacter hepaticus ATCC 51449 section 1 o...    69   8e-11   
gb:AX951396_1484094 Sequence 53 from Patent EP1367064.>gb:AX9599...    69   1e-10   
gb:AX951382_1484087 Sequence 39 from Patent EP1367064.>gb:AX9599...    69   1e-10   
gb:AX951370_1484081 Sequence 27 from Patent EP1367064.>gb:AX9599...    69   1e-10   
sp|Q95108|THI2_BOVIN|THI2_BOVIN Thioredoxin, mitochondrial precursor (MT-TR...    69   1e-10   Bos taurus [bovine]
gb:BA000043_739262 Geobacillus kaustophilus HTA426 DNA, complete...    69   1e-10   
gb:BA000016_673779 Clostridium perfringens str. 13 DNA, complete...    69   1e-10   
gb:AP006841_573199 Bacteroides fragilis YCH46 DNA, complete genome.    69   1e-10   
gb:AE016926_359587 Bacteroides thetaiotaomicron VPI-5482, sectio...    69   1e-10   
sp|P56430|THIO_HELPY|THIO_HELPY Thioredoxin (TRX).>pir|H64622|H64622 thiore...    69   1e-10   Helicobacter pylori
sp|P59527|THIO_BUCBP|THIO_BUCBP Thioredoxin (TRX).>gb:AE014017_302922 Buchn...    69   1e-10   
sp|Q8KEA4|THI1_CHLTE|THI1_CHLTE Thioredoxin 1 (Trx-1).>gb:AE012847_286264 C...    69   1e-10   Chlorobaculum tepidum
gb:AP003263_1826662 Oryza sativa (japonica cultivar-group) genom...    68   2e-10   
gb:AY128276_1580578 Arabidopsis thaliana At1g43560/T10P12_4 mRNA...    68   2e-10   
gb:AX951394_1484093 Sequence 51 from Patent EP1367064.>gb:AX9599...    68   2e-10   
gb:AX951380_1484086 Sequence 37 from Patent EP1367064.>gb:AX9599...    68   2e-10   
gb:AX951368_1484080 Sequence 25 from Patent EP1367064.>gb:AX9599...    68   2e-10   
gb:BA000030_700694 Streptomyces avermitilis MA-4680 genomic DNA,...    68   2e-10   
gb:CR522870_99655 Desulfotalea psychrophila LSv54 chromosome.          68   2e-10   
pir|A96499|A96499 hypothetical protein T10P12.4 [imported] - Ara...    68   2e-10   Arabidopsis thaliana [mouse-ear cress]
pir|T48127|T48127 hypothetical protein T4C9.10 - Arabidopsis tha...    68   2e-10   Arabidopsis thaliana [mouse-ear cress]
sp|Q17424|THI2_CAEEL|THI2_CAEEL Probable thioredoxin B0024.9.>pir|T18644|T1...    68   2e-10   Caenorhabditis elegans [roundworm]
sp|P10473|THIO_RHORU|THIO_RHORU Thioredoxin (TRX).                                68   2e-10   Rhodospirillum rubrum
gb:AE016816_1746561 Ashbya gossypii (= Eremothecium gossypii) AT...    67   3e-10   
gb:AX951392_1484092 Sequence 49 from Patent EP1367064.>gb:AX9599...    67   3e-10   
gb:AX951378_1484085 Sequence 35 from Patent EP1367064.>gb:AX9599...    67   3e-10   
gb:AX951366_1484079 Sequence 23 from Patent EP1367064.>gb:AX9599...    67   3e-10   
gb:AY826134_1180094 Aedes albopictus clone AL_166 mitochondrial ...    67   3e-10   
gb:BA000038_724995 Vibrio vulnificus YJ016 DNA, chromosome II, c...    67   3e-10   
gb:AE016809_338099 Vibrio vulnificus CMCP6 chromosome II section...    67   3e-10   
pir|AD2300|AD2300 thioredoxin [imported] - Nostoc sp. (strain PC...    67   3e-10   Nostoc sp. PCC 7120
sp|P57653|THIO_BUCAI|THIO_BUCAI Thioredoxin (TRX).>pir|B84999|B84999 thiore...    67   3e-10   
sp|P97615|THI2_RAT|THI2_RAT Thioredoxin, mitochondrial precursor (Mt-TRX)...    67   3e-10   Rattus norvegicus [brown rat]
gb:CR382125_1657949 Kluyveromyces lactis strain NRRL Y-1140 chro...    67   4e-10   
gb:AX951402_1484097 Sequence 59 from Patent EP1367064.>gb:AX9599...    67   4e-10   
gb:AX951388_1484090 Sequence 45 from Patent EP1367064.>gb:AX9599...    67   4e-10   
gb:AE016858_350140 Pseudomonas syringae pv. tomato str. DC3000 s...    67   4e-10   
gb:AE013598_297033 Xanthomonas oryzae pv. oryzae KACC10331, comp...    67   4e-10   
gb:AE011919_277699 Xanthomonas axonopodis pv. citri str. 306, se...    67   4e-10   
pir|C69410|C69410 thioredoxin (trx-3) homolog - Archaeoglobus fu...    67   4e-10   Archaeoglobus fulgidus
pir|B82423|B82423 thioredoxin 2 VCA0752 [imported] - Vibrio chol...    67   4e-10   Vibrio cholerae
pir|B59394|A59394 thioredoxin - Clostridium pasteurianum               67   4e-10   Clostridium pasteurianum
gb:AX951390_1484091 Sequence 47 from Patent EP1367064.>gb:AX9599...    67   5e-10   
gb:AX951376_1484084 Sequence 33 from Patent EP1367064.>gb:AX9599...    67   5e-10   
gb:AX951364_1484078 Sequence 21 from Patent EP1367064.>gb:AX9599...    67   5e-10   
gb:AE014296_1136277 Drosophila melanogaster chromosome 3L, compl...    67   5e-10   
gb:AX951374_1484083 Sequence 31 from Patent EP1367064.>gb:AX9599...    66   7e-10   
gb:AY714831_1189009 Uncultured archaeon GZfos19C8 clone GZfos19C...    66   7e-10   
gb:AE016931_360824 Bacteroides thetaiotaomicron VPI-5482, sectio...    66   7e-10   
pir|E83138|E83138 probable thioredoxin PA4061 [imported] - Pseud...    66   7e-10   Pseudomonas aeruginosa
sp|Q05739|THIO_STRCL|THIO_STRCL Thioredoxin (TRX).>pir|B53307|B53307 thiore...    66   7e-10   Streptomyces clavuligerus
gb:AJ720298_2502485 Gallus gallus mRNA for hypothetical protein,...    66   9e-10   
gb:AX951362_1484077 Sequence 19 from Patent EP1367064.>gb:AX9599...    66   9e-10   
gb:BX936398_835498 Yersinia pseudotuberculosis IP32953 genome, c...    66   9e-10   
gb:BX248586_764179 Blochmannia floridanus complete genome; segme...    66   9e-10   
gb:CR543861_104834 Acinetobacter sp. ADP1 complete genome.             66   9e-10   
pir|AD0397|AD0397 thioredoxin 2 [imported] - Yersinia pestis (st...    66   9e-10   Yersinia pestis
sp|P97493|THI2_MOUSE|THI2_MOUSE Thioredoxin, mitochondrial precursor (Mt-TR...    66   9e-10   Mus musculus [mouse]
gb:HS1119A7_1996816 Human DNA sequence from clone RP5-1119A7 on ...    65   1e-09   
gb:AF276920_1894397 Homo sapiens thioredoxin 2 (TRX2) mRNA, comp...    65   1e-09   
gb:AC019018_1538505 Arabidopsis thaliana chromosome 1 BAC F14G24...    65   1e-09   
gb:BX571965_790636 Burkholderia pseudomallei strain K96243, chro...    65   1e-09   
gb:AP008231_581995 Synechococcus elongatus PCC 6301 DNA, complet...    65   1e-09   
sp|Q99757|THI2_HUMAN|THI2_HUMAN Thioredoxin, mitochondrial precursor (Mt-TR...    65   1e-09   Homo sapiens [man]
gb:BA000012_670449 Mesorhizobium loti MAFF303099 DNA, complete g...    65   2e-09   
gb:AL646061_545707 Ralstonia solanacearum GMI1000 chromosome, co...    65   2e-09   
gb:AE017282_428857 Methylococcus capsulatus str. Bath, complete ...    65   2e-09   
pir|T27039|T27039 hypothetical protein Y49E10.4 - Caenorhabditis...    65   2e-09   Caenorhabditis elegans [roundworm]
gb:AE014298_1123853 Drosophila melanogaster chromosome X, comple...    65   2e-09   
pir|G75455|G75455 thioredoxin - Deinococcus radiodurans (strain ...    65   2e-09   Deinococcus radiodurans
sp|Q8IFW4|THIT_DROME|THIT_DROME Thioredoxin T (ThioredoxinT).>gb:DME507731_...    65   2e-09   Drosophila melanogaster
sp|P52232|THI1_SYNY3|THI1_SYNY3 Thioredoxin-like protein slr0233.>pir|S7638...    65   2e-09   Synechocystis sp.
gb:BC065316_2553935 Danio rerio zgc:77127, mRNA (cDNA clone MGC:...    64   3e-09   
gb:AE014298_1124361 Drosophila melanogaster chromosome X, comple...    64   3e-09   
gb:AE016775_329952 Pseudomonas putida KT2440 section 2 of 21 of ...    64   3e-09   
gb:MYCRRN1_152151 Mycoplasma gallisepticum strain A5969 genomic ...    64   3e-09   
gb:CP000030_83183 Anaplasma marginale str. St. Maries, complete ...    64   3e-09   
pir|A82870|A82870 thioredoxin UU589 [imported] - Ureaplasma urea...    64   3e-09   
sp|O51890|THIO_BUCAP|THIO_BUCAP Thioredoxin (TRX).>gb:AE014131_303467 Buchn...    64   3e-09   
gb:BX908798_829935 Parachlamydia-related symbiont UWE25, complet...    64   4e-09   
gb:SCO939123_179109 Streptomyces coelicolor A3(2) complete genom...    64   4e-09   
gb:CR378680_98605 Photobacterium profundum SS9 chromosome 2; seg...    64   4e-09   
gb:AY242061_2521692 Melopsittacus undulatus thioredoxin 2 (Tnx2)...    64   5e-09   
gb:AY714814_1188348 Uncultured archaeon GZfos10C7 clone GZfos10C...    64   5e-09   
gb:AE017294_434163 Leptospira interrogans serovar Copenhageni st...    64   5e-09   
gb:AE011366_272165 Leptospira interrogans serovar lai str. 56601...    64   5e-09   
gb:AE017343_1755356 Cryptococcus neoformans var. neoformans JEC2...    63   6e-09   
gb:AX155035_1462756 Sequence 81 from Patent WO0138484.                 63   6e-09   
gb:AP006841_573697 Bacteroides fragilis YCH46 DNA, complete genome.    63   6e-09   
gb:AE016969_369902 Mycoplasma gallisepticum strain R section 3 o...    63   6e-09   
gb:AE012882_286689 Chlorobium tepidum TLS section 103 of 194 of ...    63   6e-09   
gb:AB034941_5464 Staphylococcus warneri nukM, nukA, ORF1, ORF3, ...    63   6e-09   
gb:BC043794_2548253 Xenopus laevis thioredoxin 2, mRNA (cDNA clo...    63   8e-09   
gb:CR380957_1652546 Candida glabrata strain CBS138 chromosome K ...    63   8e-09   
gb:AX951344_1484068 Sequence 1 from Patent EP1367064.>gb:AX95992...    63   8e-09   
pir|C90180|C90180 thioredoxin (trxA-1) [imported] - Sulfolobus s...    63   8e-09   
sp|Q9R6P9|THIO_MYCGA|THIO_MYCGA Thioredoxin (Trx).                                63   8e-09   
sp|P73263|THI2_SYNY3|THI2_SYNY3 Thioredoxin-like protein slr1139.>pir|S7744...    63   8e-09   
gb:BC082341_2562578 Xenopus tropicalis txn2-prov protein, mRNA (...    62   1e-08   
gb:BX950851_842252 Erwinia carotovora subsp. atroseptica SCRI104...    62   1e-08   
gb:AY596296_631309 Haloarcula marismortui ATCC 43049 plasmid pNG...    62   1e-08   
gb:AL935258_551953 Lactobacillus plantarum strain WCFS1 complete...    62   1e-08   
pir|C82590|C82590 thioredoxin XF2174 [imported] - Xylella fastid...    62   1e-08   
sp|Q9Z7P5|THIO_CHLPN|THIO_CHLPN Thioredoxin (TRX).>pir|H86572|H86572 thiore...    62   1e-08   
gb:AF095753_1767785 Arabidopsis thaliana thioredoxin x mRNA, com...    62   1e-08   
gb:BX569694_776780 Synechococcus sp. WH8102 complete genome; seg...    62   1e-08   
gb:AE017308_437764 Mycoplasma mobile 163K complete genome.             62   1e-08   
gb:AE012557_284626 Xylella fastidiosa Temecula1, section 5 of 9 ...    62   1e-08   
gb:MYCRRN1_152137 Mycoplasma gallisepticum strain A5969 genomic ...    62   1e-08   
pir|E96539|E96539 hypothetical protein F14I3.8 [imported] - Arab...    62   1e-08   
pir|C90393|C90393 thioredoxin (trxA-2) [imported] - Sulfolobus s...    62   1e-08   
pir|S57775|S57775 thioredoxin h, cytosolic [validated] - Chlamyd...    62   1e-08   
sp|P80028|THIH_CHLRE|THIH_CHLRE Thioredoxin H-type (TRX-H) (Thioredoxin CH1).     62   1e-08   
gb:AE014134_1129392 Drosophila melanogaster chromosome 2L, compl...    62   2e-08   
gb:BA000032_709512 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    62   2e-08   
gb:BA000028_696504 Oceanobacillus iheyensis HTE831 DNA, complete...    62   2e-08   
gb:AE017173_396635 Porphyromonas gingivalis W83 section 2 of 8 o...    62   2e-08   
pir|G98272|G98272 probable thioredoxin PA4061 [imported] - Agrob...    62   2e-08   
pir|AH3011|AH3011 thioredoxin trxA [imported] - Agrobacterium tu...    62   2e-08   
pir|AF2098|AF2098 thioredoxin 2 [imported] - Nostoc sp. (strain ...    62   2e-08   
pir|A32233|A32233 thioredoxin 2 [validated] - Anabaena sp. (stra...    62   2e-08   
sp|P20857|THI2_ANASP|THI2_ANASP Thioredoxin 2 (Trx-2).                            62   2e-08   
gb:BA000016_675395 Clostridium perfringens str. 13 DNA, complete...    61   2e-08   
pir|B84037|B84037 thioredoxin trxA [imported] - Bacillus halodur...    61   2e-08   
pir|B37192|B37192 thioredoxin - Bacillus subtilis>gb:BACAPKII_74...    61   2e-08   
sp|P10472|THIO_CHLLT|THIO_CHLLT Thioredoxin (TRX).                                61   2e-08   
sp|P14949|THIO_BACSU|THIO_BACSU Thioredoxin (TRX).                                61   2e-08   
sp|P38661|PDA6_MEDSA|PDA6_MEDSA Probable protein disulfide isomerase A6 pre...    61   2e-08   
gb:AY245454_1592546 Hordeum vulgare subsp. vulgare thioredoxin h...    61   3e-08   
gb:AY744381_644906 Buchnera aphidicola (Cinara cedri) ferredoxin...    61   3e-08   
gb:AE017333_448827 Bacillus licheniformis DSM 13, complete genom...    61   3e-08   
pir|A87688|A87688 thioredoxin [imported] - Caulobacter crescentu...    61   3e-08   
pir|S15048|TXBY2 thioredoxin II - yeast (Saccharomyces cerevisia...    61   3e-08   
sp|P22217|TRX2_YEAST|TRX2_YEAST Thioredoxin II (TR-II).                           61   3e-08   
sp|Q9S386|THIO_LISMO|THIO_LISMO Thioredoxin (Trx).>pir|AI1228|AI1228 thiore...    61   3e-08   
gb:AP006627_564987 Bacillus clausii KSM-K16 DNA, complete genome.      60   4e-08   
gb:AE017012_379387 Bacillus cereus ATCC 14579 section 15 of 18 o...    60   4e-08   
gb:MC064_143000 M.capricolum DNA for CONTIG MC064.                     60   4e-08   
pir|S77780|S77780 thioredoxin - Mycoplasma capricolum (fragment)       60   4e-08   
gb:BA000039_727871 Thermosynechococcus elongatus BP-1 DNA, compl...    60   5e-08   
gb:AP008231_581813 Synechococcus elongatus PCC 6301 DNA, complet...    60   5e-08   
gb:AE013269_290766 Methanosarcina mazei strain Goe1, section 51 ...    60   5e-08   
gb:PVI488196_162100 Uncultured bacterium gene for putative thior...    60   5e-08   
gb:AC087425_1734051 Oryza sativa (japonica cultivar-group) chrom...    60   7e-08   
gb:CR382131_1663578 Yarrowia lipolytica chromosome E of strain C...    60   7e-08   
gb:AY232202_1177495 Drosophila yakuba clone yak-ad_thioredoxin m...    60   7e-08   
gb:AE011025_268519 Methanosarcina acetivorans str. C2A, section ...    60   7e-08   
pir|S74493|S74493 thioredoxin M-2 - Synechocystis sp. (strain PC...    60   7e-08   
gb:BA000039_728070 Thermosynechococcus elongatus BP-1 DNA, compl...    59   9e-08   
gb:AY596298_634911 Haloarcula marismortui ATCC 43049 chromosome ...    59   9e-08   
gb:AE016793_334448 Pseudomonas putida KT2440 section 20 of 21 of...    59   9e-08   
gb:AE015494_314873 Shewanella oneidensis MR-1 section 43 of 457 ...    59   9e-08   
gb:SME591793_187202 Sinorhizobium meliloti 1021 complete chromos...    59   9e-08   
gb:CR382126_1658815 Kluyveromyces lactis strain NRRL Y-1140 chro...    59   1e-07   
gb:BA000040_734035 Bradyrhizobium japonicum USDA 110 DNA, comple...    59   1e-07   
gb:BA000012_671139 Mesorhizobium loti MAFF303099 DNA, complete g...    59   1e-07   
gb:AE017340_457748 Idiomarina loihiensis L2TR, complete genome.        59   1e-07   
gb:AE010523_264007 Fusobacterium nucleatum subsp. nucleatum ATCC...    59   1e-07   
pir|T03644|T03644 probable protein disulfide-isomerase (EC 5.3.4...    59   1e-07   
sp|O83889|THIO_TREPA|THIO_TREPA Thioredoxin (TRX).>pir|D71265|D71265 probab...    59   1e-07   
gb:AF091538_1240216 Schistosoma japonicum thioredoxin mRNA, comp...    59   1e-07   
gb:AC116305_1206105 Dictyostelium discoideum chromosome 2 map 10...    59   1e-07   
gb:BX950851_840014 Erwinia carotovora subsp. atroseptica SCRI104...    59   1e-07   
gb:BA000023_692810 Sulfolobus tokodaii str. 7 DNA, complete genome.    59   1e-07   
gb:AE017282_429315 Methylococcus capsulatus str. Bath, complete ...    59   1e-07   
gb:AE017259_418614 Wolbachia endosymbiont of Drosophila melanoga...    59   1e-07   
pir|T33843|T33843 hypothetical protein Y44E3A.3 - Caenorhabditis...    59   1e-07   
gb:AY596502S1_1616767 Helicosporidium sp. ex Simulium jonesii pl...    58   2e-07   
gb:CP000003_861496 Streptococcus pyogenes MGAS10394, complete ge...    58   2e-07   
gb:BA000034_713205 Streptococcus pyogenes SSI-1 DNA, complete ge...    58   2e-07   
gb:AE017263_420731 Mesoplasma florum L1 complete genome.               58   2e-07   
gb:AE010096_259289 Streptococcus pyogenes strain MGAS8232, secti...    58   2e-07   
gb:SAG766853_171290 Streptococcus agalactiae NEM316 complete gen...    58   2e-07   
gb:CR555306_107770 Azoarcus sp. EbN1 complete genome.                  58   2e-07   
pir|T08271|T08271 probable thioredoxin - Halobacterium sp. (stra...    58   2e-07   
gb:BC054954_2551160 Xenopus laevis hypothetical protein MGC64309...    58   3e-07   
gb:AY086205_1571260 Arabidopsis thaliana clone 22429 mRNA, compl...    58   3e-07   
gb:BA000028_694980 Oceanobacillus iheyensis HTE831 DNA, complete...    58   3e-07   
pir|S49353|S49353 protein S2 - Phalaris coerulescens                   58   3e-07   
pir|S49352|S49352 protein S1 - Phalaris coerulescens                   58   3e-07   
pir|T50862|T50862 thioredoxin-like protein [imported] - Phalaris...    58   3e-07   
pir|AE1428|AE1428 thioredoxin homolog lmo2830 [imported] - Liste...    58   3e-07   
pir|S15049|TXBY1 thioredoxin I - yeast (Saccharomyces cerevisiae...    58   3e-07   
sp|P22803|TRX1_YEAST|TRX1_YEAST Thioredoxin I (TR-I).                             58   3e-07   
gb:AY525378_1611610 Paxillus involutus thioredoxin mRNA, complet...    57   3e-07   
gb:AY072771_1567391 Triticum aestivum cultivar Soissons thioredo...    57   3e-07   
gb:AY673828_1345537 Schistosoma mansoni thioredoxin 2 (Trx-2) mR...    57   3e-07   
gb:BX842642_822108 Mycoplasma mycoides subsp. mycoides SC genomi...    57   3e-07   
gb:BX294151_770738 Pirellula sp. strain 1 complete genome; segme...    57   3e-07   
gb:AE017331_445236 Listeria monocytogenes str. 4b F2365, section...    57   3e-07   
gb:AE017321_442240 Wolbachia endosymbiont strain TRS of Brugia m...    57   3e-07   
gb:AE014292_310443 Brucella suis 1330 chromosome II, complete se...    57   3e-07   
pir|AH3559|AH3559 thioredoxin [imported] - Brucella melitensis (...    57   3e-07   
pir|T01115|T01115 probable protein disulfide isomerase [imported...    57   3e-07   
sp|P52227|THIO_CHLCV|THIO_CHLCV Thioredoxin (TRX).>gb:AE016994_374147 Chlam...    57   3e-07   
sp|P13667|PDA4_HUMAN|PDA4_HUMAN Protein disulfide isomerase A4 precursor (E...    57   3e-07   
gb:BC046867_2549767 Xenopus laevis protein disulfide isomerase-r...    57   4e-07   
gb:AC012562_1537728 Arabidopsis thaliana chromosome 3 BAC F17O14...    57   4e-07   
gb:AY582129_1339005 Ancylostoma caninum protein disulfide isomer...    57   4e-07   
gb:AP006841_573698 Bacteroides fragilis YCH46 DNA, complete genome.    57   4e-07   
gb:AE016926_359586 Bacteroides thetaiotaomicron VPI-5482, sectio...    57   4e-07   
pir|C69772|C69772 thioredoxin homolog ydbP - Bacillus subtilis>g...    57   4e-07   
sp|P42115|THIO_NEUCR|THIO_NEUCR Thioredoxin.>gb:NEUTRX_1690886 Neurospora c...    57   4e-07   
sp|P29429|THIO_EMENI|THIO_EMENI Thioredoxin.>pir|S27053|S27053 thioredoxin ...    57   4e-07   
gb:AJ844023_1814715 Plantago major mRNA for thioredoxin 3 (trx3 ...    57   6e-07   
gb:AF435815_1799848 Hordeum vulgare thioredoxin h-like protein m...    57   6e-07   
gb:AF186240_1775131 Secale cereale thioredoxin-like protein (Trx...    57   6e-07   
gb:AY204511_1589099 Leymus chinensis thioredoxin h gene, complet...    57   6e-07   
gb:AF473536_1274078 Schistosoma mansoni thioredoxin mRNA, comple...    57   6e-07   
gb:AE014134_1128390 Drosophila melanogaster chromosome 2L, compl...    57   6e-07   
gb:BA000040_728854 Bradyrhizobium japonicum USDA 110 DNA, comple...    57   6e-07   
gb:BA000012_669376 Mesorhizobium loti MAFF303099 DNA, complete g...    57   6e-07   
gb:AE017340_455831 Idiomarina loihiensis L2TR, complete genome.        57   6e-07   
gb:AE017333_446460 Bacillus licheniformis DSM 13, complete genom...    57   6e-07   
gb:AE017283_432052 Propionibacterium acnes KPA171202, complete g...    57   6e-07   
gb:SCO939123_179090 Streptomyces coelicolor A3(2) complete genom...    57   6e-07   
pir|T31557|T31557 hypothetical protein F56G4.5 - Caenorhabditis ...    57   6e-07   
pir|E87921|E87921 protein F56G4.5 [imported] - Caenorhabditis el...    57   6e-07   
pir|T50867|T50867 thioredoxin-like protein [imported] - rye (fra...    57   6e-07   
pir|H89854|H89854 hypothetical protein SA0758 [imported] - Staph...    57   6e-07   
sp|Q9UW02|THIO_COPCM|THIO_COPCM Thioredoxin (Allergen Cop c 2).>gb:CCO24279...    57   6e-07   
sp|Q9V429|THI2_DROME|THI2_DROME Thioredoxin 2 (DmTrx-2).>gb:AY060458_129237...    57   6e-07   
gb:BC064877_2553918 Xenopus tropicalis hypothetical protein LOC3...    56   7e-07   
gb:CR382132_1664989 Yarrowia lipolytica chromosome F of strain C...    56   7e-07   
gb:AF117573_1242580 Manduca sexta clone pMsmaB2 thioredoxin-like...    56   7e-07   
gb:BX571856_780315 Staphylococcus aureus subsp. aureus strain MR...    56   7e-07   
gb:BA000030_700716 Streptomyces avermitilis MA-4680 genomic DNA,...    56   7e-07   
gb:AE016951_365457 Enterococcus faecalis V583, section 5 of 11 o...    56   7e-07   
gb:CP000046_91026 Staphylococcus aureus subsp. aureus COL, compl...    56   7e-07   
pir|D86183|D86183 hypothetical protein [imported] - Arabidopsis ...    56   7e-07   
pir|D86830|D86830 thioredoxin [imported] - Lactococcus lactis su...    56   7e-07   
sp|O84544|THIO_CHLTR|THIO_CHLTR Thioredoxin (TRX).>pir|B71503|B71503 probab...    56   7e-07   
sp|O22263|PDA6_ARATH|PDA6_ARATH Probable protein disulfide isomerase A6 pre...    56   7e-07   
gb:AF435816_1799849 Zea mays thioredoxin h-like protein mRNA, co...    56   1e-06   
gb:U23168_1402099 Caenorhabditis elegans cosmid B0228, complete ...    56   1e-06   
gb:BA000033_711076 Staphylococcus aureus subsp. aureus MW2 DNA, ...    56   1e-06   
pir|T50864|T50864 thioredoxin-like protein [imported] - Hordeum ...    56   1e-06   
pir|AD1802|AD1802 thioredoxin homolog lin2963 [imported] - Liste...    56   1e-06   
sp|P47370|THIO_MYCGE|THIO_MYCGE Thioredoxin (Trx).>pir|G64213|G64213 thiore...    56   1e-06   
sp|O17486|THIO_ECHGR|THIO_ECHGR Thioredoxin.>gb:AF034637_1234778 Echinococc...    56   1e-06   
sp|Q09433|THI1_CAEEL|THI1_CAEEL Probable thioredoxin B0228.5.>pir|T29044|T2...    56   1e-06   
sp|Q9XI01|PDI1_ARATH|PDI1_ARATH Probable protein disulfide isomerase 1 prec...    56   1e-06   
gb:BC077228_2559945 Xenopus laevis MGC79068 protein, mRNA (cDNA ...    55   1e-06   
gb:AP004675_1843174 Oryza sativa (japonica cultivar-group) genom...    55   1e-06   
gb:AF192765_1775522 Schizosaccharomyces pombe thioredoxin mRNA, ...    55   1e-06   
gb:OOS419174_1391346 Ostertagia ostertagi mRNA for disulfide iso...    55   1e-06   
gb:OOS315903_1391327 Ostertagia ostertagi partial mRNA for disul...    55   1e-06   
gb:AY155573_1304765 Leishmania major disulfide isomerase PDI (pd...    55   1e-06   
gb:AE017355_463397 Bacillus thuringiensis serovar konkukian str....    55   1e-06   
gb:AE017271_423561 Bacillus cereus ATCC 10987, section 8 of 18 o...    55   1e-06   
gb:AE017005_377182 Bacillus cereus ATCC 14579 section 8 of 18 of...    55   1e-06   
pir|T39085|T39085 thioredoxin II - fission yeast (Schizosaccharo...    55   1e-06   
sp|O14463|THIO_SCHPO|THIO_SCHPO Thioredoxin (TR).                                 55   1e-06   
sp|Q42443|THIH_ORYSA|THIH_ORYSA Thioredoxin H-type (TRX-H) (Phloem sap 13 k...    55   1e-06   
gb:BC080483_2561765 Xenopus tropicalis MGC89831 protein, mRNA (c...    55   2e-06   
gb:BC061535_2104517 Rattus norvegicus protein disulfide isomeras...    55   2e-06   
gb:AP005173_1848762 Oryza sativa (japonica cultivar-group) genom...    55   2e-06   
gb:AP003331_1828047 Oryza sativa (japonica cultivar-group) genom...    55   2e-06   
gb:BX842641_1644180 Neurospora crassa DNA linkage group I BAC co...    55   2e-06   
gb:AY170651_1586600 Pisum sativum clone 4 thioredoxin h mRNA, co...    55   2e-06   
gb:NFU42760_1390812 Naegleria fowleri thioredoxin homolog mRNA, ...    55   2e-06   
gb:AJ605808_1282768 Mesobuthus eupeus partial trxt gene for thio...    55   2e-06   
gb:AY570240_1178663 Brassica napus var. napus clone BNPE BA11 pu...    55   2e-06   
gb:BA000011_665233 Thermoplasma volcanium GSS1 DNA, complete gen...    55   2e-06   
gb:CR378677_97671 Photobacterium profundum SS9 chromosome 2; seg...    55   2e-06   
pir|T50865|T50865 thioredoxin-like protein [imported] - perennia...    55   2e-06   
pir|S32476|S32476 protein disulfide-isomerase (EC 5.3.4.1) ERp72...    55   2e-06   
sp|P38659|PDA4_RAT|PDA4_RAT Protein disulfide isomerase A4 precursor (EC ...    55   2e-06   
gb:BC076090_2558968 Danio rerio zgc:56374, mRNA (cDNA clone MGC:...    55   2e-06   
gb:BC066857_2105870 Mus musculus calcium binding protein, intest...    55   2e-06   
gb:HSU79278_2026244 Human protein disulfide isomerase-related pr...    55   2e-06   
gb:AK127433_1916745 Homo sapiens cDNA FLJ45525 fis, clone BRTHA2...    55   2e-06   
gb:PSA319808_1701974 Pisum sativum mRNA for thioredoxin h (trxh ...    55   2e-06   
gb:AY344228_1600937 Ipomoea batatas thioredoxin H2 mRNA, complet...    55   2e-06   
gb:AY543007_1334463 Bigelowiella natans protein disulfide isomer...    55   2e-06   
gb:AF236124_1253738 Anopheles gambiae thioredoxin 1 mRNA, comple...    55   2e-06   
gb:AK028292_1160906 Mus musculus 14, 17 days embryo head cDNA, R...    55   2e-06   
gb:CP000023_875650 Streptococcus thermophilus LMG 18311, complet...    55   2e-06   
gb:BX294137_766521 Pirellula sp. strain 1 complete genome; segme...    55   2e-06   
gb:AE017195_401960 Bacillus cereus ATCC 10987 plasmid pBc10987, ...    55   2e-06   
gb:AE016928_360045 Bacteroides thetaiotaomicron VPI-5482, sectio...    55   2e-06   
gb:AE015013_314159 Streptococcus mutans UA159 section 161 of 185...    55   2e-06   
gb:CP000031_87417 Silicibacter pomeroyi DSS-3, complete genome.        55   2e-06   
sp|P08003|PDA4_MOUSE|PDA4_MOUSE Protein disulfide isomerase A4 precursor (E...    55   2e-06   
gb:BC077772_2560426 Xenopus laevis similar to procollagen-prolin...    54   3e-06   
gb:BC046736_2549723 Xenopus laevis similar to procollagen-prolin...    54   3e-06   
gb:AY123101_1579969 Griffithsia japonica protein disulfide isome...    54   3e-06   
gb:AY688958_1346608 Trypanosoma cruzi strain Tulahuen O thioredo...    54   3e-06   
gb:BX572593_799883 Rhodopseudomonas palustris CGA009 complete ge...    54   3e-06   
gb:BA000043_737436 Geobacillus kaustophilus HTA426 DNA, complete...    54   3e-06   
gb:BA000021_687050 Wigglesworthia glossinidia endosymbiont of Gl...    54   3e-06   
gb:AP006841_572705 Bacteroides fragilis YCH46 DNA, complete genome.    54   3e-06   
gb:AF401671_507591 Lactobacillus sakei rrnE operon, partial sequ...    54   3e-06   
gb:AE017261_419138 Picrophilus torridus DSM 9790, complete genome.     54   3e-06   
pir|T50863|T50863 thioredoxin-like protein [imported] - rye>gb:A...    54   3e-06   
pir|H98071|H98071 thioredoxin-disulfide reductase (EC 1.8.1.9) [...    54   3e-06   
pir|H95206|H95206 thioredoxin [imported] - Streptococcus pneumon...    54   3e-06   


>sp|Q9SEU7|THM3_ARATH Thioredoxin M-type 3, chloroplast precursor
           (TRX-M3).>pir|F84530|F84530 probable thioredoxin M
           [imported] - Arabidopsis thaliana>gb:AC006248_1533845
           Arabidopsis thaliana chromosome 2 clone F9O13 map mi398,
           complete sequence.>gb:AK176140_1818128 Arabidopsis
           thaliana mRNA for putative thioredoxin M, complete cds,
           clone: RAFL22-95-M18.
          Length = 173

 Score =  150 bits (378), Expect(2) = 4e-39
 Identities = 66/105 (62%), Positives = 87/105 (82%)
 Frame = +2

Query: 266 SKSPFHLRVVCHRDAKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIAT 445
           S S   L  +C RD++AA VT +SW+  +L S+ PVLVEFY SWCGPCRMVHR++DEIA 
Sbjct: 52  SASRLRLSPLCVRDSRAAEVTQRSWEDSVLKSETPVLVEFYTSWCGPCRMVHRIIDEIAG 111

Query: 446 DYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           DY+G+L C++LNAD+D+ +AE+Y+IKAVPVV+LFKNGEKR S++G
Sbjct: 112 DYAGKLNCYLLNADNDLPVAEEYEIKAVPVVLLFKNGEKRESIMG 156



 Score = 34.7 bits (78), Expect(2) = 4e-39
 Identities = 15/18 (83%), Positives = 17/18 (94%)
 Frame = +3

Query: 579 GTMPKEFYVNAIERVLAS 632
           GTMPKEFY++AIERVL S
Sbjct: 156 GTMPKEFYISAIERVLNS 173



>gb:AK176784_1818772 Arabidopsis thaliana mRNA for putative
           thioredoxin M, complete cds, clone: RAFL25-33-D08.
          Length = 173

 Score =  149 bits (377), Expect(2) = 5e-39
 Identities = 65/105 (61%), Positives = 87/105 (82%)
 Frame = +2

Query: 266 SKSPFHLRVVCHRDAKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIAT 445
           S S   L  +C RD++AA VT +SW+  +L S+ PVLVEFY SWCGPCRMVHR++DEIA 
Sbjct: 52  SASRLRLSPLCVRDSRAAEVTQRSWEDSVLKSETPVLVEFYTSWCGPCRMVHRIIDEIAG 111

Query: 446 DYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           DY+G+L C++LNAD+D+ +AE+Y++KAVPVV+LFKNGEKR S++G
Sbjct: 112 DYAGKLNCYLLNADNDLPVAEEYEVKAVPVVLLFKNGEKRESIMG 156



 Score = 34.7 bits (78), Expect(2) = 5e-39
 Identities = 15/18 (83%), Positives = 17/18 (94%)
 Frame = +3

Query: 579 GTMPKEFYVNAIERVLAS 632
           GTMPKEFY++AIERVL S
Sbjct: 156 GTMPKEFYISAIERVLNS 173



>gb:AK175478_1817466 Arabidopsis thaliana mRNA for putative
           thioredoxin M, complete cds, clone: RAFL21-91-D09.
          Length = 173

 Score =  148 bits (374), Expect(2) = 1e-38
 Identities = 65/105 (61%), Positives = 86/105 (81%)
 Frame = +2

Query: 266 SKSPFHLRVVCHRDAKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIAT 445
           S S   L  +C RD++AA VT +SW+  +L S+ PVLVEFY SWCGPCRMVHR++DEI  
Sbjct: 52  SASRLRLSPLCVRDSRAAEVTQRSWEDSVLKSETPVLVEFYTSWCGPCRMVHRIIDEITG 111

Query: 446 DYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           DY+G+L C++LNAD+D+ +AE+Y+IKAVPVV+LFKNGEKR S++G
Sbjct: 112 DYAGKLNCYLLNADNDLPVAEEYEIKAVPVVLLFKNGEKRESIMG 156



 Score = 34.7 bits (78), Expect(2) = 1e-38
 Identities = 15/18 (83%), Positives = 17/18 (94%)
 Frame = +3

Query: 579 GTMPKEFYVNAIERVLAS 632
           GTMPKEFY++AIERVL S
Sbjct: 156 GTMPKEFYISAIERVLNS 173



>gb:AF095751_1767783 Arabidopsis thaliana thioredoxin m3 mRNA,
           complete cds.
          Length = 173

 Score =  148 bits (373), Expect(2) = 1e-38
 Identities = 65/105 (61%), Positives = 86/105 (81%)
 Frame = +2

Query: 266 SKSPFHLRVVCHRDAKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIAT 445
           S S   L  +C RD++AA VT +SW+  +L S+ PVLVEFY SWCGPCRMVHR++DEIA 
Sbjct: 52  SASRLRLSPLCVRDSRAAEVTQRSWEDSVLKSETPVLVEFYTSWCGPCRMVHRIIDEIAG 111

Query: 446 DYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           DY+G+L C++LN D+D+ +AE+Y+IKAVPVV+LFKNGEKR S++G
Sbjct: 112 DYAGKLNCYLLNEDNDLPVAEEYEIKAVPVVLLFKNGEKRESIMG 156



 Score = 34.7 bits (78), Expect(2) = 1e-38
 Identities = 15/18 (83%), Positives = 17/18 (94%)
 Frame = +3

Query: 579 GTMPKEFYVNAIERVLAS 632
           GTMPKEFY++AIERVL S
Sbjct: 156 GTMPKEFYISAIERVLNS 173



>gb:OSJN00005_1693146 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0084A10, complete sequence.
          Length = 175

 Score =  117 bits (292), Expect(2) = 5e-26
 Identities = 48/89 (53%), Positives = 69/89 (77%)
 Frame = +2

Query: 314 AAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSD 493
           A  +T  SW++ ++ SD+PVL+EF+ASWCGPCRMVHR++DEIA +Y+GR+KC+ L+ D  
Sbjct: 67  AKTITACSWNEYVICSDIPVLIEFWASWCGPCRMVHRIVDEIAQEYAGRIKCYKLDTDDY 126

Query: 494 VQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
            Q+A  Y I+ +P V+LFK+GEK  S+ G
Sbjct: 127 PQVATSYSIERIPTVLLFKDGEKTHSITG 155



 Score = 23.9 bits (50), Expect(2) = 5e-26
 Identities = 9/17 (52%), Positives = 13/17 (76%)
 Frame = +3

Query: 579 GTMPKEFYVNAIERVLA 629
           GT+PK  YV AIE+ ++
Sbjct: 155 GTLPKAVYVRAIEKSIS 171



>sp|Q9ZP20|THIM_ORYSA Thioredoxin M-type, chloroplast precursor
           (TRX-M).>gb:OSA5841_1692753 Oryza sativa mRNA for
           thioredoxin M.
          Length = 172

 Score =  111 bits (278), Expect = 1e-23
 Identities = 47/90 (52%), Positives = 66/90 (73%)
 Frame = +2

Query: 311 KAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADS 490
           +  V   K+WD M+L S+ PVLVEF+A WCGPCRM+  V+DE+A +Y G++KC  +N D 
Sbjct: 66  EVVVADEKNWDSMVLGSEAPVLVEFWAPWCGPCRMIAPVIDELAKEYVGKIKCCKVNTDD 125

Query: 491 DVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
              IA +Y I+++P V++FKNGEK+ SVIG
Sbjct: 126 SPNIATNYGIRSIPTVLMFKNGEKKESVIG 155



>gb:PSU35831_1702500 Pisum sativum thioredoxin m gene, nuclear gene
           encoding chloroplast protein, complete cds.
          Length = 172

 Score =  109 bits (273), Expect = 6e-23
 Identities = 43/87 (49%), Positives = 65/87 (74%)
 Frame = +2

Query: 320 VVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQ 499
           VV   SWD++++ S+ PVLV+F+A WCGPCRM+  ++DE+A +Y+G++KC+ LN D    
Sbjct: 71  VVNDSSWDELVIGSETPVLVDFWAPWCGPCRMIAPIIDELAKEYAGKIKCYKLNTDESPN 130

Query: 500 IAEDYDIKAVPVVMLFKNGEKRGSVIG 580
            A  Y I+++P V+ FKNGE++ SVIG
Sbjct: 131 TATKYGIRSIPTVLFFKNGERKDSVIG 157



>sp|P48384|THIM_PEA Thioredoxin M-type, chloroplast precursor
           (TRX-M).>pir|S38909|S38909 thioredoxin m precursor -
           garden pea>gb:PSTHREM_1702423 P.sativum mRNA for
           thioredoxin M.
          Length = 172

 Score =  109 bits (273), Expect = 6e-23
 Identities = 43/87 (49%), Positives = 65/87 (74%)
 Frame = +2

Query: 320 VVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQ 499
           VV   SWD++++ S+ PVLV+F+A WCGPCRM+  ++DE+A +Y+G++KC+ LN D    
Sbjct: 71  VVNDSSWDELVIGSETPVLVDFWAPWCGPCRMIAPIIDELAKEYAGKIKCYKLNTDESPN 130

Query: 500 IAEDYDIKAVPVVMLFKNGEKRGSVIG 580
            A  Y I+++P V+ FKNGE++ SVIG
Sbjct: 131 TATKYGIRSIPTVLFFKNGERKDSVIG 157



>gb:PSA316577_1701973 Pisum sativum chloroplast mRNA for putative
           cloroplast thioredoxin m2 (trxm2 gene).
          Length = 180

 Score =  108 bits (271), Expect = 1e-22
 Identities = 47/101 (46%), Positives = 70/101 (69%), Gaps = 3/101 (2%)
 Frame = +2

Query: 287 RVVCH-RDA--KAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSG 457
           RV+C  RD   + A +T  +W  +++ SD PVLVEF+A WCGPCRM+H ++DE+A +Y G
Sbjct: 65  RVLCEARDTAVEVASITDGNWQSLVIESDTPVLVEFWAPWCGPCRMMHPIIDELAKEYVG 124

Query: 458 RLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           + KC+ LN D     A  Y I+++P V+ FK+GEK+ ++IG
Sbjct: 125 KFKCYKLNTDESPSTATRYGIRSIPTVIFFKDGEKKDAIIG 165



>gb:AX155045_1462761 Sequence 91 from Patent WO0138484.
          Length = 190

 Score =  107 bits (266), Expect = 4e-22
 Identities = 44/89 (49%), Positives = 65/89 (73%)
 Frame = +2

Query: 314 AAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSD 493
           A VV   +W +++L S +PVLV+F+A WCGPCRM+  ++DE+A  Y+G+++C  LN D  
Sbjct: 85  AGVVNDATWKELVLESQIPVLVDFWAPWCGPCRMIAPLIDELAKQYAGKIRCLKLNTDES 144

Query: 494 VQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
             IA +Y I+++P VMLFK GEK+ +VIG
Sbjct: 145 PGIATEYGIRSIPTVMLFKGGEKKDTVIG 173



>sp|Q9SEU6|THM4_ARATH Thioredoxin M-type 4, chloroplast precursor
           (TRX-M4).>gb:AB022218_1515083 Arabidopsis thaliana
           genomic DNA, chromosome 3, P1 clone:
           MJK13.>gb:AC024081_1539262 Arabidopsis thaliana
           chromosome III P1 MJK13 genomic sequence, complete
           sequence.>gb:AY060538_1564847 Arabidopsis thaliana
           AT3g15360/MJK13_2 mRNA, complete
           cds.>gb:AY088157_1573179 Arabidopsis thaliana clone
           42151 mRNA, complete sequence.>gb:AF375443_1792948
           Arabidopsis thaliana AT3g15360/MJK13_2 mRNA, complete
           cds.
          Length = 193

 Score =  105 bits (261), Expect = 1e-21
 Identities = 47/104 (45%), Positives = 68/104 (65%), Gaps = 6/104 (5%)
 Frame = +2

Query: 287 RVVCH-RDAKAAVV-----TGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATD 448
           R+ C  +D  AA V     +   W   +L SDVPVLVEF+A WCGPCRM+H ++D++A D
Sbjct: 73  RIACEAQDTTAAAVEVPNLSDSEWQTKVLESDVPVLVEFWAPWCGPCRMIHPIVDQLAKD 132

Query: 449 YSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           ++G+ K + +N D     A  Y I++VP V++FK GEK+ S+IG
Sbjct: 133 FAGKFKFYKINTDESPNTANRYGIRSVPTVIIFKGGEKKDSIIG 176



>sp|Q9ZP21|THIM_WHEAT Thioredoxin M-type, chloroplast precursor
           (TRX-M).>gb:TAE5840_1724509 Triticum aestivum mRNA for
           thioredoxin M.>gb:AJ870964_1815098 Triticum turgidum
           subsp. durum mRNA for thioredoxin M precursor (trxm
           gene).
          Length = 175

 Score =  105 bits (261), Expect = 1e-21
 Identities = 45/87 (51%), Positives = 63/87 (72%)
 Frame = +2

Query: 320 VVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQ 499
           V   K+WD M++  + PVLVEF+A WCGPCRM+  V+DE+A DY G++KC  +N D    
Sbjct: 72  VADEKNWDNMVIACESPVLVEFWAPWCGPCRMIAPVIDELAKDYVGKIKCCKVNTDDCPN 131

Query: 500 IAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           IA  Y I+++P V++FK+GEK+ SVIG
Sbjct: 132 IASTYGIRSIPTVLMFKDGEKKESVIG 158



>gb:AP004768_1844711 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0010C01.
          Length = 173

 Score =  103 bits (257), Expect = 4e-21
 Identities = 40/86 (46%), Positives = 65/86 (75%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  +W  +++ S++PVLVEF+ASWCGPC+M+  V+ +++ +Y G+L C+ LN D +  I
Sbjct: 71  VTKSTWQSLVVESELPVLVEFWASWCGPCKMIDPVIGKLSKEYEGKLNCYKLNTDENPDI 130

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
           A  + I+++P +M+FKNGEK+ +VIG
Sbjct: 131 ATQFGIRSIPTMMIFKNGEKKDAVIG 156



>sp|Q41864|THIM_MAIZE Thioredoxin M-type, chloroplast precursor
           (TRX-M).>pir|T03957|T03957 thioredoxin M -
           maize>gb:MZETHIOM_1688049 Zea mays thioredoxin M mRNA,
           complete cds.
          Length = 167

 Score =  103 bits (257), Expect = 4e-21
 Identities = 42/90 (46%), Positives = 63/90 (70%)
 Frame = +2

Query: 311 KAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADS 490
           +  V   K+WD +++  + PVLVEF+A WCGPCRM+  V+DE+A DY+G++ C  +N D 
Sbjct: 60  EVVVADEKNWDGLVMACETPVLVEFWAPWCGPCRMIAPVIDELAKDYAGKITCCKVNTDD 119

Query: 491 DVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
              +A  Y I+++P V++FK GEK+ SVIG
Sbjct: 120 SPNVASTYGIRSIPTVLIFKGGEKKESVIG 149



>gb:AF095752_1767784 Arabidopsis thaliana thioredoxin m4 mRNA,
           complete cds.
          Length = 193

 Score =  103 bits (256), Expect = 5e-21
 Identities = 46/104 (44%), Positives = 67/104 (64%), Gaps = 6/104 (5%)
 Frame = +2

Query: 287 RVVCH-RDAKAAVV-----TGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATD 448
           R+ C  +D  AA V     +   W   +L SDVPVLVEF+A WCGPCRM+H ++D++A D
Sbjct: 73  RIACEAQDTTAAAVEVPNLSDSEWQTKVLESDVPVLVEFWAPWCGPCRMIHPIVDQLAKD 132

Query: 449 YSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           ++G+ K + +N D        Y I++VP V++FK GEK+ S+IG
Sbjct: 133 FAGKFKFYKINTDESPNTPNRYGIRSVPTVIIFKGGEKKDSIIG 176



>gb:OSJN00177_1696251 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0074L08, complete
           sequence.>gb:OSJN00183_1696335 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0081C01, complete
           sequence.
          Length = 180

 Score =  102 bits (254), Expect = 9e-21
 Identities = 38/86 (44%), Positives = 65/86 (75%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  +W  +++ S++PVLV ++A+WCGPC+M+  V+ +++ +Y G+LKC+ LN D +  I
Sbjct: 78  VTKSTWQSLVMESELPVLVGYWATWCGPCKMIDPVVGKLSKEYEGKLKCYKLNTDENPDI 137

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
           A  Y ++++P +M+FKNGEK+ +VIG
Sbjct: 138 ASQYGVRSIPTMMIFKNGEKKDAVIG 163



>gb:BX572092_796687 Prochlorococcus marinus MED4 complete genome;
           segment 3/5.
          Length = 107

 Score =  102 bits (253), Expect = 1e-20
 Identities = 43/91 (47%), Positives = 66/91 (72%)
 Frame = +2

Query: 308 AKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNAD 487
           + A  VT  S+DK +L S++PVLV+F+A WCGPCRMV  V++EI+ D+ G++K F LN D
Sbjct: 2   SSAPAVTDSSFDKEVLQSNLPVLVDFWAPWCGPCRMVAPVVEEISKDFEGKIKVFKLNTD 61

Query: 488 SDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
            +  +A  Y I+++P +M+FK G+K  +V+G
Sbjct: 62  ENPNVASQYGIRSIPTLMIFKGGQKVDTVVG 92



>gb:BX569691_775626 Synechococcus sp. WH8102 complete genome;
           segment 3/7.
          Length = 107

 Score =  101 bits (252), Expect = 2e-20
 Identities = 43/91 (47%), Positives = 67/91 (73%)
 Frame = +2

Query: 308 AKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNAD 487
           + AA VT  S+++ +L SDVPVLV+F+A WCGPCRMV  +++EIA ++ G++K F LN D
Sbjct: 2   SSAAAVTDASFEQDVLQSDVPVLVDFWAPWCGPCRMVAPIVEEIAKEFDGQIKVFKLNTD 61

Query: 488 SDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
            +  +A  Y I+++P +M+FK G+K  +V+G
Sbjct: 62  ENPNVASQYGIRSIPTLMVFKGGQKVDTVVG 92



>gb:BX572098_798469 Prochlorococcus marinus MIT9313 complete genome;
           segment 4/7.
          Length = 107

 Score =  101 bits (251), Expect = 2e-20
 Identities = 43/91 (47%), Positives = 66/91 (72%)
 Frame = +2

Query: 308 AKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNAD 487
           + AA VT  S+++ +L SDVPVLV+F+A WCGPCRMV  ++DEIA ++  ++K F LN D
Sbjct: 2   SNAAAVTDASFEQDVLQSDVPVLVDFWAPWCGPCRMVAPIVDEIAKEFESKIKVFKLNTD 61

Query: 488 SDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
            +  +A  Y I+++P +M+FK G+K  +V+G
Sbjct: 62  ENPNVASQYGIRSIPTLMVFKGGQKVDTVVG 92



>gb:AE017164_395595 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 4 of 6 of the complete
           genome.>gb:AE017126_1031264 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 107

 Score =  101 bits (251), Expect = 2e-20
 Identities = 42/91 (46%), Positives = 66/91 (72%)
 Frame = +2

Query: 308 AKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNAD 487
           + AA VT  S+++ +L SD+PVLV+F+A WCGPCRMV  ++DEI+ D+ G++K   LN D
Sbjct: 2   SSAAAVTDSSFEQEVLQSDLPVLVDFWAPWCGPCRMVSPIVDEISKDFEGKIKVCKLNTD 61

Query: 488 SDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
            +  +A  Y I+++P +M+FK G+K  +V+G
Sbjct: 62  ENPNVASQYGIRSIPTLMIFKGGQKVDTVVG 92



>gb:SOTHM4_1715914 Spinach mRNA for thioredoxin m (clone
           p6SocTRM-4).
          Length = 181

 Score =  100 bits (249), Expect = 3e-20
 Identities = 50/113 (44%), Positives = 73/113 (64%), Gaps = 8/113 (7%)
 Frame = +2

Query: 266 SKSPFHLR---VVCHRDAKAAV-----VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVH 421
           S SP   R   VVC   A  AV     V   SW + +L S+VPV+V+F+A WCGPC+++ 
Sbjct: 54  SSSPRQFRYSSVVCK--ASEAVKEVQDVNDSSWKEFVLESEVPVMVDFWAPWCGPCKLIA 111

Query: 422 RVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
            V+DE+A +YSG++  + LN D    IA  Y+I+++P V+ FKNGE++ S+IG
Sbjct: 112 PVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIG 164



>pir|I39624|TXAI thioredoxin 1 - Anabaena sp.>pir|AD1813|AD1813
           thioredoxin [imported] - Nostoc sp. (strain PCC
           7120)>gb:ANATRXA_553385 Anabaena sp. trxA gene encoding
           thioredoxin, complete cds.>gb:BA000019_681044 Nostoc sp.
           PCC 7120 DNA, complete genome.
          Length = 107

 Score =  100 bits (249), Expect = 3e-20
 Identities = 46/98 (46%), Positives = 67/98 (68%)
 Frame = +2

Query: 314 AAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSD 493
           AA VT  ++ + +L+SDVPVLV+F+A WCGPCRMV  V+DEIA  Y G++K   +N D +
Sbjct: 4   AAQVTDSTFKQEVLDSDVPVLVDFWAPWCGPCRMVAPVVDEIAQQYEGKIKVVKVNTDEN 63

Query: 494 VQIAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
            Q+A  Y I+++P +M+FK G+K   V+G   +  L Q
Sbjct: 64  PQVASQYGIRSIPTLMIFKGGQKVDMVVGAVPKTTLSQ 101



>sp|P07591|THIM_SPIOL Thioredoxin M-type, chloroplast precursor
           (TRX-M).>pir|S20496|TXSPM thioredoxin m precursor -
           spinach>gb:SOTHM1_1715913 Spinach mRNA for thioredoxin m
           clone p6SocTRM-1.
          Length = 181

 Score =  100 bits (249), Expect = 3e-20
 Identities = 50/113 (44%), Positives = 73/113 (64%), Gaps = 8/113 (7%)
 Frame = +2

Query: 266 SKSPFHLR---VVCHRDAKAAV-----VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVH 421
           S SP   R   VVC   A  AV     V   SW + +L S+VPV+V+F+A WCGPC+++ 
Sbjct: 54  SSSPRQFRYSSVVCK--ASEAVKEVQDVNDSSWKEFVLESEVPVMVDFWAPWCGPCKLIA 111

Query: 422 RVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
            V+DE+A +YSG++  + LN D    IA  Y+I+++P V+ FKNGE++ S+IG
Sbjct: 112 PVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIG 164



>sp|P06544|THI1_ANASP Thioredoxin 1 (TRX-1) (Thioredoxin M).
          Length = 106

 Score =  100 bits (249), Expect = 3e-20
 Identities = 46/98 (46%), Positives = 67/98 (68%)
 Frame = +2

Query: 314 AAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSD 493
           AA VT  ++ + +L+SDVPVLV+F+A WCGPCRMV  V+DEIA  Y G++K   +N D +
Sbjct: 3   AAQVTDSTFKQEVLDSDVPVLVDFWAPWCGPCRMVAPVVDEIAQQYEGKIKVVKVNTDEN 62

Query: 494 VQIAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
            Q+A  Y I+++P +M+FK G+K   V+G   +  L Q
Sbjct: 63  PQVASQYGIRSIPTLMIFKGGQKVDMVVGAVPKTTLSQ 100



>gb:BA000039_726595 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 107

 Score =  100 bits (248), Expect = 4e-20
 Identities = 42/91 (46%), Positives = 67/91 (73%)
 Frame = +2

Query: 308 AKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNAD 487
           + A  VT  ++++ +LNSD+PVLV+F+A WCGPCRMV  V+DEIA +Y GR+K   +N D
Sbjct: 2   SSALSVTDATFEEEVLNSDIPVLVDFWAPWCGPCRMVAPVVDEIANEYQGRVKVVKVNTD 61

Query: 488 SDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
            + ++A D+ I+++P +M+FK G+K   ++G
Sbjct: 62  ENSKVATDFGIRSIPTLMIFKGGQKVDILVG 92



>gb:CRTRXM_1673586 C.reinhardtii mRNA for thioredoxin-m.
          Length = 128

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 46/111 (41%), Positives = 68/111 (61%), Gaps = 4/111 (3%)
 Frame = +2

Query: 260 RQSKSPFHLRVVCHRD----AKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRV 427
           R S  P   R    R     A+A  V   ++  ++L S VPVLV+F+A WCGPCR++  V
Sbjct: 2   RSSARPAFARAAPRRSVVVRAEAGAVNDDTFKNVVLESSVPVLVDFWAPWCGPCRIIAPV 61

Query: 428 MDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           +DEIA +Y  +LKC  LN D    +A +Y I+++P +M+FK G+K  ++IG
Sbjct: 62  VDEIAGEYKDKLKCVKLNTDESPNVASEYGIRSIPTIMVFKGGKKCETIIG 112



>sp|P23400|THIM_CHLRE Thioredoxin M-type, chloroplast precursor
           (TRX-M) (Thioredoxin CH2).>pir|S57774|S57774 thioredoxin
           m precursor, chloroplast - Chlamydomonas
           reinhardtii>gb:CRTRXM1_1673587 C.reinhardtii Trx m gene.
          Length = 140

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 46/111 (41%), Positives = 68/111 (61%), Gaps = 4/111 (3%)
 Frame = +2

Query: 260 RQSKSPFHLRVVCHRD----AKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRV 427
           R S  P   R    R     A+A  V   ++  ++L S VPVLV+F+A WCGPCR++  V
Sbjct: 14  RSSARPAFARAAPRRSVVVRAEAGAVNDDTFKNVVLESSVPVLVDFWAPWCGPCRIIAPV 73

Query: 428 MDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           +DEIA +Y  +LKC  LN D    +A +Y I+++P +M+FK G+K  ++IG
Sbjct: 74  VDEIAGEYKDKLKCVKLNTDESPNVASEYGIRSIPTIMVFKGGKKCETIIG 124



>gb:CRTRX_1673583 C.reinhardtii Trx mRNA for thioredoxin Ch2.
          Length = 106

 Score = 95.9 bits (237), Expect = 8e-19
 Identities = 40/90 (44%), Positives = 62/90 (68%)
 Frame = +2

Query: 311 KAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADS 490
           +A  V   ++  ++L S VPVLV+F+A WCGPCR++  V+DEIA +Y  +LKC  LN D 
Sbjct: 1   EAGAVNDDTFKNVVLESSVPVLVDFWAPWCGPCRIIAPVVDEIAGEYKDKLKCVKLNTDE 60

Query: 491 DVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
              +A +Y I+++P +M+FK G+K  ++IG
Sbjct: 61  SPNVASEYGIRSIPTIMVFKGGKKCETIIG 90



>gb:BA000045_740955 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 110

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 46/90 (51%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = +2

Query: 314 AAVVTGKSWDKM-ILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADS 490
           AAV  G S  K  +L+S++PVLV+F+A WCGPCRMV  V+DEIA  YSG+LK   +N D 
Sbjct: 3   AAVPVGDSNFKTEVLDSELPVLVDFWAPWCGPCRMVAPVVDEIAQQYSGKLKVVKVNTDE 62

Query: 491 DVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           + Q+A  Y I+++P +M+FK+G K   V+G
Sbjct: 63  NPQVASQYGIRSIPTLMVFKSGSKVDMVVG 92



>gb:AE013085_288885 Thermoanaerobacter tengcongensis MB4, section
           112 of 244 of the complete genome.>gb:AE008691_1110950
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 223

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 37/87 (42%), Positives = 64/87 (73%)
 Frame = +2

Query: 320 VVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQ 499
           V+T K+W++ ++NSDVPVL++F+A WC PCR+V  +++E+A +Y G++K   +N D + +
Sbjct: 5   VITSKNWEEEVVNSDVPVLIDFWAEWCMPCRLVAPIIEELAKEYEGKIKVGKVNVDEEDE 64

Query: 500 IAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           +A  + I ++P + LFKNG+  G +IG
Sbjct: 65  LAMKFRIMSIPTIGLFKNGKMVGKLIG 91



 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 35/86 (40%), Positives = 60/86 (69%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           +T  +W++ ++NSDVPVL++F+A WC PCR+V  +++E+A +Y GRLK   +N D + ++
Sbjct: 121 ITYDNWEEEVVNSDVPVLIDFWAEWCAPCRLVAPIVEELAHEYKGRLKVGKVNVDEEQEL 180

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
           A  + I ++P + LFK G+    +IG
Sbjct: 181 AMKFRIMSIPTIGLFKKGKMVDKIIG 206



>sp|O48737|THM1_ARATH Thioredoxin M-type 1, chloroplast precursor
           (TRX-M1).>pir|T00893|T00893 thioredoxin F21B7.7 -
           Arabidopsis thaliana>gb:AE005172_889387 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC002560_1530877 Genomic sequence for
           Arabidopsis thaliana BAC F21B7 from chromosome I,
           complete sequence.>gb:BT004295_1637371 Arabidopsis
           thaliana clone RAFL15-09-H06 (R20768) putative
           thioredoxin-m (At1g03675) mRNA, complete
           cds.>gb:BT005525_1638465 Arabidopsis thaliana clone
           U20768 putative thioredoxin-m (At1g03675) mRNA, complete
           cds.>gb:AF095749_1767781 Arabidopsis thaliana
           thioredoxin m1 mRNA, complete cds.
          Length = 179

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 38/100 (38%), Positives = 63/100 (63%), Gaps = 3/100 (3%)
 Frame = +2

Query: 290 VVCHRDAKAA---VVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGR 460
           V+C     A    VV   +WD ++L +D PV V+F+A WCGPC+M+  +++E+A  Y+G+
Sbjct: 65  VICEAQDTATGIPVVNDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDPIVNELAQKYAGQ 124

Query: 461 LKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
            K + LN D        Y ++++P +M+F NGEK+ ++IG
Sbjct: 125 FKFYKLNTDESPATPGQYGVRSIPTIMIFVNGEKKDTIIG 164



>pir|A32956|A32956 thioredoxin m - Synechococcus
           sp.>gb:ANITRXM_553609 A.nidulans thioredoxin m (trxM)
           gene, complete cds.>gb:AP008231_581959 Synechococcus
           elongatus PCC 6301 DNA, complete
           genome.>gb:AY157498_593503 Synechococcus sp. PCC 7942
           cosmid 4G8, complete sequence.
          Length = 107

 Score = 93.6 bits (231), Expect = 4e-18
 Identities = 40/89 (44%), Positives = 63/89 (70%)
 Frame = +2

Query: 314 AAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSD 493
           AA VT  ++ + +L S +PVLV+F+A WCGPCRMV  V+DEIA  YS ++K   +N D +
Sbjct: 4   AAAVTDATFKQEVLESSIPVLVDFWAPWCGPCRMVAPVVDEIAQQYSDQVKVVKVNTDEN 63

Query: 494 VQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
             +A  Y I+++P +M+FK+G++  +V+G
Sbjct: 64  PSVASQYGIRSIPTLMIFKDGQRVDTVVG 92



>sp|P12243|THI1_SYNP7 Thioredoxin 1 (TRX-1) (Thioredoxin M).
          Length = 106

 Score = 93.6 bits (231), Expect = 4e-18
 Identities = 40/89 (44%), Positives = 63/89 (70%)
 Frame = +2

Query: 314 AAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSD 493
           AA VT  ++ + +L S +PVLV+F+A WCGPCRMV  V+DEIA  YS ++K   +N D +
Sbjct: 3   AAAVTDATFKQEVLESSIPVLVDFWAPWCGPCRMVAPVVDEIAQQYSDQVKVVKVNTDEN 62

Query: 494 VQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
             +A  Y I+++P +M+FK+G++  +V+G
Sbjct: 63  PSVASQYGIRSIPTLMIFKDGQRVDTVVG 91



>sp|P51225|THIO_PORPU Thioredoxin.>pir|S73146|S73146 thioredoxin A -
           red alga (Porphyra purpurea)
           chloroplast>gb:PPU38804_1701541 Porphyra purpurea
           chloroplast, complete genome.
          Length = 107

 Score = 93.2 bits (230), Expect = 5e-18
 Identities = 40/86 (46%), Positives = 62/86 (72%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  S+ + ++N+D+PVLV+F+A WCGPCRMV  V+D IA +Y   +K   +N D +  I
Sbjct: 6   VTDASFKQEVINNDLPVLVDFWAPWCGPCRMVSPVVDAIAEEYESSIKVVKINTDDNPTI 65

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
           A +Y I+++P +M+FK+GE+  +VIG
Sbjct: 66  AAEYGIRSIPTLMIFKSGERVDTVIG 91



>sp|P50254|THIO_PORYE Thioredoxin.>pir|S46521|S46521 thioredoxin -
           Porphyra yezoensis chloroplast>gb:CHPYTRXA_1647324
           P.yezoensis chloroplast trxA gene.
          Length = 107

 Score = 92.4 bits (228), Expect = 9e-18
 Identities = 40/86 (46%), Positives = 62/86 (72%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  S+ + ++N+++PVLV+F+A WCGPCRMV  V+DEIA +Y   +K   +N D +  I
Sbjct: 6   VTDASFKQEVINNNLPVLVDFWAPWCGPCRMVSPVVDEIAEEYESSIKVVKINTDDNPTI 65

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
           A +Y I+++P +M+FK GE+  +VIG
Sbjct: 66  AAEYGIRSIPTLMIFKAGERVDTVIG 91



>sp|Q9XGS0|THIM_BRANA Thioredoxin M-type, chloroplast precursor
           (TRX-M).>pir|T09495|T09495 thioredoxin m - rape
           chloroplast>gb:BNU76831_1633715 Brassica napus
           thioredoxin-m mRNA, complete cds; nuclear gene for
           chloroplast product.>gb:AF160870_1773383 Brassica napus
           thioredoxin-m precursor, mRNA, complete cds; nuclear
           gene for chloroplast product.
          Length = 177

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 35/100 (35%), Positives = 64/100 (64%), Gaps = 3/100 (3%)
 Frame = +2

Query: 290 VVCHRDAKAA---VVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGR 460
           ++C     A    +V   +W+ ++L +D PV+V+F+A WCGPC+M+  +++E+A  Y+G+
Sbjct: 62  IICEAQDTATGIPMVNDSTWESLVLKADEPVVVDFWAPWCGPCKMIDPIVNELAQQYTGK 121

Query: 461 LKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           +K F LN D        Y ++++P +M+F  GEK+ ++IG
Sbjct: 122 IKFFKLNTDDSPATPGKYGVRSIPTIMIFVKGEKKDTIIG 161



>pir|AD2039|AD2039 thioredoxin [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_682855 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 110

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 39/86 (45%), Positives = 62/86 (72%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  ++ + +L+S+VPVLV+F+A WCGPCRMV  V+DE+A++Y G +K   LN D +  +
Sbjct: 7   VTEATFKQEVLDSNVPVLVDFWAPWCGPCRMVAPVVDEVASEYEGLVKVVKLNTDQNPTV 66

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
           A  Y I+++P +M+FK G +  +V+G
Sbjct: 67  ASHYGIRSIPTLMVFKGGRQVNTVVG 92



>gb:AP006840_569593 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 112

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 38/91 (41%), Positives = 59/91 (64%)
 Frame = +2

Query: 311 KAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADS 490
           K   ++  +W   +  S +PVLV+F+A WCGPCRM+  V++EIA DY GR+K   LN D 
Sbjct: 5   KVVTLSASNWAAEVEQSSLPVLVDFWAVWCGPCRMIAPVVEEIAADYEGRMKVGKLNVDE 64

Query: 491 DVQIAEDYDIKAVPVVMLFKNGEKRGSVIGY 583
           +  +A  Y + ++P ++LFKNGE    ++G+
Sbjct: 65  NNDLAARYGVMSIPTLILFKNGEPVERIVGF 95



>sp|Q92JR5|THIO_RICCN Thioredoxin (TRX).>pir|B97700|B97700
           thioredoxin [imported] - Rickettsia conorii (strain
           Malish 7)>gb:AE008569_238366 Rickettsia conorii str.
           Malish 7, section 1 of 114 of the complete
           genome.>gb:AE006914_1120484 Rickettsia conorii str.
           Malish 7, complete genome.
          Length = 105

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 38/93 (40%), Positives = 62/93 (66%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           V   S+ K +L SD+PVLV+F+A WCGPC+M+  ++DEI+ +  G++K   +N D +   
Sbjct: 5   VMDSSFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISKELQGKVKVLKMNIDENPNT 64

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVL 601
             +Y I+++P +MLFKNGE++ + IG   +  L
Sbjct: 65  PSEYGIRSIPTIMLFKNGEQKDTKIGLQQKNSL 97



>gb:AE013598_298003 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 113

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 41/99 (41%), Positives = 63/99 (63%)
 Frame = +2

Query: 311 KAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADS 490
           K   V    +D  +L S  PVLV+F+A WCGPC+M+  V+D++A  Y GRLK   +N D 
Sbjct: 4   KVQHVGDADFDTAVLQSGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGRLKVAKVNVDQ 63

Query: 491 DVQIAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           +  +A  Y ++++P+++LFKNGE + + IG   +G L Q
Sbjct: 64  NRALAIKYHVRSIPMLLLFKNGEVQATQIGAVGKGQLTQ 102



>sp|P50338|THIO_GRIPA Thioredoxin.>pir|S46522|S46522 thioredoxin A -
           Griffithsia pacifica chloroplast>gb:CHCPTRXA_1646593
           G.pacifica chloroplast trxA gene.
          Length = 109

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 40/86 (46%), Positives = 59/86 (68%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           V   S+ + ++NS  PVLV+F+A WCGPCRM+   +DEIA DY  +LK   +N D +  I
Sbjct: 6   VIDTSFHEEVINSRQPVLVDFWAPWCGPCRMIASTIDEIAHDYKDKLKVVKVNTDQNPTI 65

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
           A +Y I+++P VM+F NG+K  +V+G
Sbjct: 66  ATEYGIRSIPTVMIFINGKKVDTVVG 91



>gb:AY084496_1569585 Arabidopsis thaliana clone 10950 mRNA, complete
           sequence.
          Length = 186

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 38/112 (33%), Positives = 67/112 (59%), Gaps = 3/112 (2%)
 Frame = +2

Query: 254 RPRQSKSPFHLRVVCHRDAKAA---VVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHR 424
           +PR S+      VVC          VV   +WD ++L +  PV+V+F+A WCGPC+M+  
Sbjct: 61  QPRVSR--LRRAVVCEAQETTTDIQVVNDSTWDSLVLKATGPVVVDFWAPWCGPCKMIDP 118

Query: 425 VMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           +++++A  Y+G++K + LN D        Y ++++P +M+F  GEK+ ++IG
Sbjct: 119 LVNDLAQHYTGKIKFYKLNTDESXNTPGQYGVRSIPTIMIFVGGEKKDTIIG 170



>pir|S46958|S46958 thioredoxin A - Synechocystis sp. (strain PCC
           6803)>gb:SSPTRXA_190986 Synechocystis sp. trxA
           gene.>gb:BA000022_690012 Synechocystis sp. PCC 6803 DNA,
           complete genome.
          Length = 107

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 38/86 (44%), Positives = 60/86 (69%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           V+  S+ + +L+S++PVLV+F+A WCGPCRMV  V+DEI+  Y G++K   LN D +   
Sbjct: 7   VSDASFKEDVLDSELPVLVDFWAPWCGPCRMVAPVVDEISQQYEGKVKVVKLNTDENPNT 66

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
           A  Y I+++P +M+FK G++   V+G
Sbjct: 67  ASQYGIRSIPTLMIFKGGQRVDMVVG 92



>sp|P52231|THIO_SYNY3 Thioredoxin (TRX).
          Length = 106

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 38/86 (44%), Positives = 60/86 (69%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           V+  S+ + +L+S++PVLV+F+A WCGPCRMV  V+DEI+  Y G++K   LN D +   
Sbjct: 6   VSDASFKEDVLDSELPVLVDFWAPWCGPCRMVAPVVDEISQQYEGKVKVVKLNTDENPNT 65

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
           A  Y I+++P +M+FK G++   V+G
Sbjct: 66  ASQYGIRSIPTLMIFKGGQRVDMVVG 91



>pir|C81090|C81090 thioredoxin NMB1366 [imported] - Neisseria
           meningitidis  (strain MC58 serogroup
           B)>gb:AE002485_46785 Neisseria meningitidis serogroup B
           strain MC58 section 127 of 206 of the complete
           genome.>gb:AE002098_896898 Neisseria meningitidis
           serogroup B strain MC58 complete genome.
          Length = 110

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 35/89 (39%), Positives = 62/89 (69%)
 Frame = +2

Query: 335 SWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDY 514
           +++K +LN+D+PVL++F+A WCGPC+M+  ++D+IA ++ GRLK   +N D +      +
Sbjct: 13  AFEKDVLNADIPVLLDFWAPWCGPCKMIAPILDDIAAEFEGRLKVVKINIDDNEATPSRF 72

Query: 515 DIKAVPVVMLFKNGEKRGSVIGYHAQGVL 601
            ++ +P +M+FKNGE   + +G  A+G L
Sbjct: 73  GVRGIPTLMVFKNGEVVATKVGALAKGQL 101



>sp|Q9SEU8|THM2_ARATH Thioredoxin M-type 2, chloroplast precursor
           (TRX-M2).>pir|F85044|F85044 probable M-type thioredoxin
           [imported] - Arabidopsis thaliana>gb:AC005142_1532193
           Arabidopsis thaliana BAC T5L23 from chromosome IV, near
           19 cM, complete sequence.>gb:ATCHRIV9_1547832
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 9.>gb:AY046001_1561495 Arabidopsis thaliana putative
           M-type thioredoxin (At4g03520) mRNA, complete
           cds.>gb:AY079362_1568252 Arabidopsis thaliana putative
           M-type thioredoxin (At4g03520) mRNA, complete
           cds.>gb:AF071527_1765786 Arabidopsis thaliana BAC F9H3,
           from chromosome IV near 18.8 cM, complete sequence.
          Length = 186

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 38/112 (33%), Positives = 67/112 (59%), Gaps = 3/112 (2%)
 Frame = +2

Query: 254 RPRQSKSPFHLRVVCHRDAKAA---VVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHR 424
           +PR S+      VVC          VV   +WD ++L +  PV+V+F+A WCGPC+M+  
Sbjct: 61  QPRVSR--LRRAVVCEAQETTTDIQVVNDSTWDSLVLKATGPVVVDFWAPWCGPCKMIDP 118

Query: 425 VMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           +++++A  Y+G++K + LN D        Y ++++P +M+F  GEK+ ++IG
Sbjct: 119 LVNDLAQHYTGKIKFYKLNTDESPNTPGQYGVRSIPTIMIFVGGEKKDTIIG 170



>gb:CS008403_1455704 Sequence 29 from Patent WO2005007189.
          Length = 283

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 42/110 (38%), Positives = 66/110 (60%)
 Frame = +2

Query: 278 FHLRVVCHRDAKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSG 457
           F L V      K   +T  S+D  +L +D  +LV+F+A WCGPC+M+  ++DEIA +Y G
Sbjct: 2   FLLAVFYGGSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQG 61

Query: 458 RLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           +L    LN D +   A  Y I+ +P ++LFKNGE   + +G  ++G L++
Sbjct: 62  KLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKE 111



>gb:CS008401_1455703 Sequence 27 from Patent WO2005007189.
          Length = 283

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 42/110 (38%), Positives = 66/110 (60%)
 Frame = +2

Query: 278 FHLRVVCHRDAKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSG 457
           F L V      K   +T  S+D  +L +D  +LV+F+A WCGPC+M+  ++DEIA +Y G
Sbjct: 2   FLLAVFYGGSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQG 61

Query: 458 RLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           +L    LN D +   A  Y I+ +P ++LFKNGE   + +G  ++G L++
Sbjct: 62  KLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKE 111



>gb:CVPTRXFUS_2151987 Fusion cloning vector pTRXFUS, complete
           sequence.
          Length = 134

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 38/95 (40%), Positives = 62/95 (65%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           +T  S+D  +L +D  +LV+F+A WCGPC+M+  ++DEIA +Y G+L    LN D +   
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGT 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           A  Y I+ +P ++LFKNGE   + +G  ++G L++
Sbjct: 68  APKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKE 102



>gb:AY148193_2143938 Synthetic construct thioredoxin/transketolase
           fusion protein gene, complete cds.
          Length = 804

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 38/95 (40%), Positives = 62/95 (65%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           +T  S+D  +L +D  +LV+F+A WCGPC+M+  ++DEIA +Y G+L    LN D +   
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGT 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           A  Y I+ +P ++LFKNGE   + +G  ++G L++
Sbjct: 68  APKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKE 102



>gb:CS008407_1455706 Sequence 33 from Patent WO2005007189.
          Length = 283

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 38/95 (40%), Positives = 62/95 (65%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           +T  S+D  +L +D  +LV+F+A WCGPC+M+  ++DEIA +Y G+L    LN D +   
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGT 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           A  Y I+ +P ++LFKNGE   + +G  ++G L++
Sbjct: 68  APKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKE 102



>gb:CS008405_1455705 Sequence 31 from Patent WO2005007189.
          Length = 283

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 38/95 (40%), Positives = 62/95 (65%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           +T  S+D  +L +D  +LV+F+A WCGPC+M+  ++DEIA +Y G+L    LN D +   
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGT 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           A  Y I+ +P ++LFKNGE   + +G  ++G L++
Sbjct: 68  APKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKE 102



>gb:CS008399_1455702 Sequence 25 from Patent WO2005007189.
          Length = 274

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 38/95 (40%), Positives = 62/95 (65%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           +T  S+D  +L +D  +LV+F+A WCGPC+M+  ++DEIA +Y G+L    LN D +   
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGT 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           A  Y I+ +P ++LFKNGE   + +G  ++G L++
Sbjct: 68  APKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKE 102



>gb:CS008397_1455701 Sequence 23 from Patent WO2005007189.
          Length = 274

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 38/95 (40%), Positives = 62/95 (65%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           +T  S+D  +L +D  +LV+F+A WCGPC+M+  ++DEIA +Y G+L    LN D +   
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGT 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           A  Y I+ +P ++LFKNGE   + +G  ++G L++
Sbjct: 68  APKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKE 102



>gb:AE016769_328671 Escherichia coli CFT073 section 15 of 18 of the
           complete genome.>gb:AE014075_959255 Escherichia coli
           CFT073 complete genome.
          Length = 144

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 38/95 (40%), Positives = 62/95 (65%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           +T  S+D  +L +D  +LV+F+A WCGPC+M+  ++DEIA +Y G+L    LN D +   
Sbjct: 43  LTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGT 102

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           A  Y I+ +P ++LFKNGE   + +G  ++G L++
Sbjct: 103 APKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKE 137



>gb:AE012498_283002 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 406 of 460 of the complete
           genome.>gb:AE008922_916284 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 113

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 40/99 (40%), Positives = 63/99 (63%)
 Frame = +2

Query: 311 KAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADS 490
           K   V    +D  +L S  PVLV+F+A WCGPC+M+  V+D++A  Y G+LK   +N D 
Sbjct: 4   KVQHVGDADFDTAVLQSGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGKLKVAKVNVDQ 63

Query: 491 DVQIAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           +  +A  Y ++++P+++LFK+GE + S IG   +G L Q
Sbjct: 64  NRALAIKYHVRSIPMLLLFKDGEVQASQIGAVGKGQLTQ 102



>pir|D71707|D71707 thioredoxin (trxA) RP002 - Rickettsia
           prowazekii>gb:RPXX01_166809 Rickettsia prowazekii strain
           Madrid E, complete genome; segment 1/4.
          Length = 130

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 36/93 (38%), Positives = 62/93 (66%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  S+   +L SD+PV+V+F+A WCGPC+M+  ++DEI+ +   ++K   +N D + + 
Sbjct: 30  VTDSSFKNEVLESDLPVMVDFWAEWCGPCKMLIPIIDEISKELQDKVKVLKMNIDENPKT 89

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVL 601
             +Y I+++P +MLFKNGE++ + IG   +  L
Sbjct: 90  PSEYGIRSIPTIMLFKNGEQKDTKIGLQQKNSL 122



>pir|B91218|B91218 thioredoxin 1 [imported] - Escherichia coli
           (strain O157:H7, substrain RIMD
           0509952)>pir|C86064|C86064 thioredoxin 1 [imported] -
           Escherichia coli (strain O157:H7, substrain
           EDL933)>gb:AE005174_68974 Escherichia coli O157:H7
           EDL933, complete genome.>gb:AE005674_73438 Shigella
           flexneri 2a str. 301, complete genome.>gb:ECORHOB_130100
           E.coli (clone pBHK10) thioredoxin (trxA) and termination
           factor (rho) genes, complete cds.>gb:ECOUW85_131335 E.
           coli genomic sequence of the region from 84.5 to 86.5
           minutes.>gb:U00096_202770 Escherichia coli K-12 MG1655
           complete genome.>gb:AE016991_373353 Shigella flexneri 2a
           str. 2457T section 14 of 16 of the complete
           genome.>gb:BA000007_662726 Escherichia coli O157:H7 DNA,
           complete genome.>gb:AE014073_998103 Shigella flexneri 2a
           str. 2457T complete genome.
          Length = 127

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 38/95 (40%), Positives = 62/95 (65%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           +T  S+D  +L +D  +LV+F+A WCGPC+M+  ++DEIA +Y G+L    LN D +   
Sbjct: 26  LTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGT 85

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           A  Y I+ +P ++LFKNGE   + +G  ++G L++
Sbjct: 86  APKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKE 120



>pir|S35497|S35497 thioredoxin - Salmonella
           typhimurium>pir|A91519|TXEC thioredoxin [validated] -
           Escherichia coli (strain K-12)>pir|AF0922|AF0922
           thioredoxin [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)>gb:CP000026_78422
           Salmonella enterica subsp. enterica serovar Paratypi A
           str. ATCC 9150.>gb:ECORHOA_130099 E.coli K12 trxA gene
           encoding thioredoxin, complete cds.>gb:ECOTRX_130450
           E.coli thioredoxin gene, complete cds.>gb:ECOTRXA_130451
           E.coli (clone pRH4) trxA gene encoding thioredoxin,
           complete cds and rho gene, encoding rho protein, 5'
           end.>gb:NGTRXAGNA_152674 S.typhimurium trxA gene and rho
           factor gene.>gb:STYSTMD1_194982 Salmonella typhimurium
           fragment STMD1.>gb:STYTRXA_195101 S.typhimurium genes
           for thioredoxin and rho protein.>gb:AE008882_245538
           Salmonella typhimurium LT2, section 186 of 220 of the
           complete genome.>gb:AE016845_347361 Salmonella enterica
           subsp. enterica serovar Typhi Ty2, section 12 of 16 of
           the complete genome.>gb:AL627279_543694 Salmonella
           enterica serovar Typhi (Salmonella typhi) strain CT18,
           complete chromosome; segment 15/20.>gb:AE014613_984693
           Salmonella enterica subsp. enterica serovar Typhi Ty2,
           complete genome.>gb:AE006468_1002620 Salmonella
           typhimurium LT2, complete genome.>gb:CQ796303_1453233
           Sequence 79 from Patent
           WO2004027092.>gb:AF044308_2141033 Cloning vector
           pBIOTRX-BirA, complete sequence.
          Length = 109

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 38/95 (40%), Positives = 62/95 (65%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           +T  S+D  +L +D  +LV+F+A WCGPC+M+  ++DEIA +Y G+L    LN D +   
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGT 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           A  Y I+ +P ++LFKNGE   + +G  ++G L++
Sbjct: 68  APKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKE 102



>sp|Q9ZEE0|THIO_RICPR Thioredoxin (TRX).
          Length = 105

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 36/93 (38%), Positives = 62/93 (66%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  S+   +L SD+PV+V+F+A WCGPC+M+  ++DEI+ +   ++K   +N D + + 
Sbjct: 5   VTDSSFKNEVLESDLPVMVDFWAEWCGPCKMLIPIIDEISKELQDKVKVLKMNIDENPKT 64

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVL 601
             +Y I+++P +MLFKNGE++ + IG   +  L
Sbjct: 65  PSEYGIRSIPTIMLFKNGEQKDTKIGLQQKNSL 97



>sp|P00274|THIO_ECOLI Thioredoxin 1 (TRX1) (TRX).
          Length = 108

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 38/95 (40%), Positives = 62/95 (65%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           +T  S+D  +L +D  +LV+F+A WCGPC+M+  ++DEIA +Y G+L    LN D +   
Sbjct: 7   LTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGT 66

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           A  Y I+ +P ++LFKNGE   + +G  ++G L++
Sbjct: 67  APKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKE 101



>sp|P37395|THIO_CYACA Thioredoxin.>pir|S31915|S31915 thioredoxin -
           red alga (Cyanidium caldarium)>gb:CHCCTRXRB_1646542
           Cyanidium caldarium chloroplast trX, rbcL and rbcX genes
           for thioredoxin, rubisco large subunit, and rubisco
           small subunit.>gb:AF022186_1761897 Cyanidium caldarium
           strain RK1 chloroplast, complete genome.
          Length = 107

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 38/86 (44%), Positives = 63/86 (73%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  S++K ++NS+  VLV+F+A WCGPCRM+  V+DE+A +Y  ++K   +N D +  I
Sbjct: 7   VTDFSFEKEVVNSEKLVLVDFWAPWCGPCRMISPVIDELAQEYVEQVKIVKINTDENPSI 66

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
           + +Y I+++P +MLFK+G++  +VIG
Sbjct: 67  SAEYGIRSIPTLMLFKDGKRVDTVIG 92



>gb:AY657681_2146691 Synthetic construct Peudomonas aeruginosa clone
           FLH032695.01F PA5240 gene, partial cds.
          Length = 109

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 41/108 (37%), Positives = 65/108 (60%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  S+++ +L +D PVLV+++A WCGPC+M+  V+DE+A DY G+LK   LN D +   
Sbjct: 8   VTDASFEQDVLKADGPVLVDYWAEWCGPCKMIAPVLDEVARDYQGKLKVCKLNIDENQDT 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQCHREGFSLLDGNI 646
              Y ++ +P +MLFK+G    + +G  ++  L        + LD NI
Sbjct: 68  PPKYGVRGIPTLMLFKDGNVEATKVGALSKSQLA-------AFLDANI 108



>gb:AF095750_1767782 Arabidopsis thaliana thioredoxin m2 mRNA,
           complete cds.
          Length = 186

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 38/112 (33%), Positives = 67/112 (59%), Gaps = 3/112 (2%)
 Frame = +2

Query: 254 RPRQSKSPFHLRVVCHRDAKAA---VVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHR 424
           +PR S+      VVC          VV   +WD ++L +  PV+V+F+A WCGPC+M+  
Sbjct: 61  QPRVSR--LRRAVVCEAQETTTDIQVVNDSTWDFLVLKATGPVVVDFWAPWCGPCKMIDP 118

Query: 425 VMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           +++++A  Y+G++K + LN D        Y ++++P +M+F  GEK+ ++IG
Sbjct: 119 LVNDLAQHYTGKIKFYKLNTDESPNTPGQYGVRSIPTIMIFVGGEKKDTIIG 170



>gb:BX897700_828272 Bartonella quintana str. Toulouse, complete
           genome.
          Length = 107

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 32/96 (33%), Positives = 68/96 (70%)
 Frame = +2

Query: 335 SWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDY 514
           +++  +L S VPV+V+F+A WCGPC+M+  ++DEI+T+  G++K   +N D + ++A  Y
Sbjct: 10  NFENEVLASSVPVVVDFWAEWCGPCKMIAPILDEISTEMQGQIKIAKVNIDENPELATQY 69

Query: 515 DIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQCHREG 622
            ++++P +++FKNG+   +++G  ++G + +  ++G
Sbjct: 70  GVRSIPTLLMFKNGKASSNMVGAASKGRVSEWIKDG 105



>sp|Q9X2T1|THIO_PSEAE Thioredoxin (TRX).>pir|G82991|G82991
           thioredoxin PA5240 [imported] - Pseudomonas aeruginosa
           (strain PAO1)>gb:AE004936_59472 Pseudomonas aeruginosa
           PAO1, section 497 of 529 of the complete
           genome.>gb:AF053463_473636 Pseudomonas aeruginosa
           thioredoxin (trx) and exopolyphosphatase (ppx) genes,
           complete cds.>gb:AE004091_973572 Pseudomonas aeruginosa
           PAO1, complete genome.
          Length = 108

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 41/108 (37%), Positives = 65/108 (60%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  S+++ +L +D PVLV+++A WCGPC+M+  V+DE+A DY G+LK   LN D +   
Sbjct: 8   VTDASFEQDVLKADGPVLVDYWAEWCGPCKMIAPVLDEVARDYQGKLKVCKLNIDENQDT 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQCHREGFSLLDGNI 646
              Y ++ +P +MLFK+G    + +G  ++  L        + LD NI
Sbjct: 68  PPKYGVRGIPTLMLFKDGNVEATKVGALSKSQLA-------AFLDANI 108



>gb:AE017340_458116 Idiomarina loihiensis L2TR, complete genome.
          Length = 108

 Score = 87.0 bits (214), Expect = 4e-16
 Identities = 37/82 (45%), Positives = 58/82 (70%)
 Frame = +2

Query: 335 SWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDY 514
           S+D  ++NSD PVLV+F+A WCGPC+MV  ++D+IA++Y+ +L    LN D + Q    Y
Sbjct: 12  SFDADVINSDKPVLVDFWAEWCGPCKMVAPILDDIASEYADKLVIGKLNVDHNEQTPPKY 71

Query: 515 DIKAVPVVMLFKNGEKRGSVIG 580
           +I+ +P ++LFK GE  G+ +G
Sbjct: 72  NIRGIPTLLLFKGGEVVGTKVG 93



>gb:BX321859_773362 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 4/10.
          Length = 108

 Score = 86.7 bits (213), Expect = 5e-16
 Identities = 37/86 (43%), Positives = 56/86 (65%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  S++  +L   VPVLV+++A WCGPCRM+  ++DEIA++Y  RLK   LN D +   
Sbjct: 8   VTDASFESEVLQCPVPVLVDYWAEWCGPCRMIAPLLDEIASEYGDRLKIAKLNIDENQST 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
            + Y I+ +P +M+FKNG    + +G
Sbjct: 68  PQKYGIRGIPTLMIFKNGNIEATKVG 93



>pir|G70464|G70464 thioredoxin - Aquifex aeolicus>gb:AE000763_27102
           Aquifex aeolicus VF5 section 95 of 109 of the complete
           genome.>gb:AE000657_977633 Aquifex aeolicus VF5 complete
           genome.
          Length = 139

 Score = 86.7 bits (213), Expect = 5e-16
 Identities = 44/126 (34%), Positives = 70/126 (55%)
 Frame = +2

Query: 332 KSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAED 511
           ++W++ +L SD PVLV+F+A WCGPCR++  +++EIA +   ++K   LN D +  IA  
Sbjct: 11  QNWEQEVLQSDKPVLVDFWAPWCGPCRIIAPIIEEIAEELGDKVKVGKLNTDENPNIAMR 70

Query: 512 YDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQCHREGFSLLDGNIMNGWLIINYALSFLS 691
           Y I+A+P ++LFKNGE   + IG   +  L +     F+       N W +    +  L 
Sbjct: 71  YGIRAIPTIILFKNGEVVDTRIGVQPKERLNKWFLSTFN-------NLWRLRPVLIPLLK 123

Query: 692 SHCNVF 709
            H   F
Sbjct: 124 PHVTSF 129



>gb:AE016915_356545 Chromobacterium violaceum ATCC 12472 section 6
           of 16 of the complete genome.>gb:AE016825_1041699
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 108

 Score = 86.3 bits (212), Expect = 7e-16
 Identities = 35/86 (40%), Positives = 58/86 (67%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  S++  +L +D PVLV+++A WCGPC+M+  ++DE+A +Y G+LK   LN D + Q 
Sbjct: 8   VTDDSFENEVLKADRPVLVDYWAEWCGPCKMIAPILDEVAKEYDGKLKIAKLNIDQNEQT 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
              + I+ +P +MLFK+G+   + +G
Sbjct: 68  PPKFGIRGIPTLMLFKDGQVAATKVG 93



>gb:AE017197_401997 Rickettsia typhi str. Wilmington complete
           genome.
          Length = 105

 Score = 85.9 bits (211), Expect = 9e-16
 Identities = 34/86 (39%), Positives = 60/86 (69%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  S+   +L SD+PV+V+F+A WCGPC+M+  ++DEI+ +   ++K   +N D + + 
Sbjct: 5   VTDISFKNEVLESDLPVIVDFWAEWCGPCKMLIPIIDEISKELQDKVKVLKMNIDENPKT 64

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
             +Y ++++P +MLFKNGE++ + IG
Sbjct: 65  PSEYGVRSIPTIMLFKNGEQKDTKIG 90



>gb:AE017156_393164 Haemophilus ducreyi strain 35000HP section 6 of
           6 of the complete genome.>gb:AE017143_1027426
           Haemophilus ducreyi strain 35000HP complete genome.
          Length = 105

 Score = 85.9 bits (211), Expect = 9e-16
 Identities = 35/79 (44%), Positives = 58/79 (73%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  ++++ +L SD+PVL++F+A WCGPCR +   +DE+A +++GR K   +N D + QI
Sbjct: 5   VTDATFEQEVLKSDLPVLLDFWAPWCGPCRTIAPWLDELAQEFAGRAKVAKVNVDENQQI 64

Query: 503 AEDYDIKAVPVVMLFKNGE 559
           A  + I+++P ++LFKNGE
Sbjct: 65  AAQFGIRSIPTLLLFKNGE 83



>pir|S33357|S33357 thioredoxin - Streptomyces aureofaciens
           (fragment)
          Length = 106

 Score = 85.9 bits (211), Expect = 9e-16
 Identities = 36/86 (41%), Positives = 56/86 (65%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  ++   +L SD PVLV F   WCGPC+MV  V+DEIA +Y G++K   +N D + Q+
Sbjct: 6   VTNATFKSDVLESDKPVLVHFEGPWCGPCKMVAPVLDEIANEYEGKVKVAKVNTDENPQL 65

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
           A  Y ++++P  ++FK GE   +++G
Sbjct: 66  ASQYGVRSIPTRLMFKGGEVAANMVG 91



>sp|P33791|THIO_STRAU Thioredoxin (TRX) (Fragment).>gb:SATRX_171951
           S.aureofaciens TRX gene for thioredoxin.
          Length = 106

 Score = 85.9 bits (211), Expect = 9e-16
 Identities = 36/86 (41%), Positives = 56/86 (65%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  ++   +L SD PVLV F   WCGPC+MV  V+DEIA +Y G++K   +N D + Q+
Sbjct: 6   VTNATFKSDVLESDKPVLVHFEGPWCGPCKMVAPVLDEIANEYEGKVKVAKVNTDENPQL 65

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
           A  Y ++++P  ++FK GE   +++G
Sbjct: 66  ASQYGVRSIPTRLMFKGGEVAANMVG 91



>gb:AE012032_278743 Xanthomonas axonopodis pv. citri str. 306,
           section 410 of 469 of the complete
           genome.>gb:AE008923_920518 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 113

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 38/99 (38%), Positives = 63/99 (63%)
 Frame = +2

Query: 311 KAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADS 490
           K   V    +D  +L +  PVLV+F+A WCGPC+M+  V+D++A  Y GRLK   +N D 
Sbjct: 4   KVQHVGDADFDTAVLQAGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGRLKVAKVNVDQ 63

Query: 491 DVQIAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           +  +A  Y ++++P+++LFK+G+ + + IG   +G L Q
Sbjct: 64  NRALAIKYHVRSIPMLLLFKDGQVQATQIGAVGKGQLTQ 102



>gb:BX571874_789519 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 16/17.
          Length = 108

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 37/91 (40%), Positives = 62/91 (68%)
 Frame = +2

Query: 335 SWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDY 514
           S+D  +LN+  PVLV+F+A+WCGPC+M+  ++DEIA +YSG+L    LN D +   A  Y
Sbjct: 12  SFDTDVLNAAGPVLVDFWAAWCGPCKMIAPILDEIAPEYSGKLTITKLNIDDNPATAPKY 71

Query: 515 DIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
            I+ +P ++LFK+G+   + +G  ++  L++
Sbjct: 72  GIRGIPTLLLFKDGQVAATKVGALSKTQLKE 102



>gb:AE004969_60408 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 110

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 34/89 (38%), Positives = 61/89 (68%)
 Frame = +2

Query: 335 SWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDY 514
           ++++ +L SD+PVL++F+A WCGPC+M+  ++D+IA ++ GRLK   +N D +      +
Sbjct: 13  AFEQDVLKSDLPVLLDFWAPWCGPCKMIAPILDDIAAEFEGRLKVVKINIDDNEATPSRF 72

Query: 515 DIKAVPVVMLFKNGEKRGSVIGYHAQGVL 601
            ++ +P +M+FKNGE   + +G  A+G L
Sbjct: 73  GVRGIPTLMVFKNGEVVATKVGALAKGQL 101



>gb:CP000027_79664 Dehalococcoides ethenogenes 195, complete
           genome.>gb:CP000027_79698 Dehalococcoides ethenogenes
           195, complete genome.
          Length = 107

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 37/95 (38%), Positives = 59/95 (62%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           +T +S+   +L SD PVLV+F+A WCGPCRMV  ++D+++T Y G+ K   LN D +   
Sbjct: 5   ITDQSFAAEVLKSDKPVLVDFWAPWCGPCRMVAPIIDKLSTKYEGKFKFCKLNVDENKTT 64

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           A  Y + ++P ++ FK+G+    V+G   +  L Q
Sbjct: 65  AAQYRVMSIPTLLFFKSGQVADMVVGAVPESALSQ 99



>gb:AE015489_314828 Shewanella oneidensis MR-1 section 38 of 457 of
           the complete genome.>gb:AE014299_950425 Shewanella
           oneidensis MR-1 complete genome.
          Length = 108

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 34/99 (34%), Positives = 64/99 (64%)
 Frame = +2

Query: 311 KAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADS 490
           K   ++  S++  +L +D+PVLV+F+A WCGPC+M+  ++D++A +Y+GR+    LN D 
Sbjct: 4   KIIYLSDDSFENDVLKADLPVLVDFWAEWCGPCKMIAPILDDVAEEYAGRVTIAKLNVDQ 63

Query: 491 DVQIAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           +      Y ++ +P ++LFKNGE   + +G  ++  L++
Sbjct: 64  NNVSPAKYGVRGIPTLLLFKNGELAATKVGALSKTQLKE 102



>gb:ECOTRXA1_130453 Escherichia coli thioredoxin (trxA) gene,
           complete cds.
          Length = 110

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 38/96 (39%), Positives = 62/96 (64%), Gaps = 1/96 (1%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           +T  S+D  +L +D  +LV+F+A WCGPC+M+  ++DEIA +Y G+L    LN D +   
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGT 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSV-IGYHAQGVLRQ 607
           A  Y I+ +P ++LFKNGE   +  +G  ++G L++
Sbjct: 68  APKYGIRGIPTLLLFKNGEVASATKVGALSKGQLKE 103



>pir|E81850|E81850 thioredoxin I NMA1578 [imported] - Neisseria
           meningitidis  (strain Z2491 serogroup
           A)>gb:NMA5Z2491_154461 Neisseria meningitidis serogroup
           A strain Z2491 complete genome; segment 5/7.
          Length = 110

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 33/89 (37%), Positives = 61/89 (68%)
 Frame = +2

Query: 335 SWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDY 514
           ++++ +L SD+PVL++F+A WCGPC+M+  ++D+IA ++ GRLK   +N D +      +
Sbjct: 13  AFEQDVLKSDLPVLLDFWAPWCGPCKMIAPILDDIAAEFEGRLKVVKINIDDNEATPSRF 72

Query: 515 DIKAVPVVMLFKNGEKRGSVIGYHAQGVL 601
            ++ +P +M+FKNG+   + +G  A+G L
Sbjct: 73  GVRGIPTLMVFKNGDVVATKVGALAKGQL 101



>sp|Q7M1B9|THIO_CHLAU Thioredoxin (TRX).
          Length = 109

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 35/100 (35%), Positives = 63/100 (63%)
 Frame = +2

Query: 308 AKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNAD 487
           AK   V    + + +L S  PV+V+F+A WCGPCR++  ++D++A +Y+GRL    +N D
Sbjct: 1   AKPIEVHDSDFAEKVLQSKTPVVVDFWAPWCGPCRVIAPILDKLAGEYAGRLTIAKVNTD 60

Query: 488 SDVQIAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
            +VQ A    +K +P +++FK+G + G ++G   + + R+
Sbjct: 61  DNVQYASQLGLKGLPTLVIFKDGREVGRLVGARPEAMYRE 100



>gb:BX640446_815876 Bordetella bronchiseptica strain RB50, complete
           genome; segment 10/16.
          Length = 141

 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 33/86 (38%), Positives = 59/86 (68%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           V+  S++  +L S  PVLV+++A+WCGPC+M+  +++E+A++Y+GRL    LN D +   
Sbjct: 41  VSDASFEADVLKSGQPVLVDYWAAWCGPCKMIAPILEEVASEYAGRLTVAKLNVDENQDT 100

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
           A  Y ++ +P +MLFK+G+   + +G
Sbjct: 101 AAKYGVRGIPTLMLFKDGQAAATKVG 126



>gb:AE017315_440088 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 7 of 12 of the complete
           genome.>gb:AE017285_1073249 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 107

 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 36/89 (40%), Positives = 57/89 (64%)
 Frame = +2

Query: 314 AAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSD 493
           AA +T  +++  +L S +PVL++F+A WCGPCR +  V+DE+A +Y G++    +N D +
Sbjct: 2   AAQITDATFEASVLKSAIPVLIDFWAPWCGPCRAMGPVIDELAAEYEGKVLIVKMNVDDN 61

Query: 494 VQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
                 Y I+A+P ++LFKNGE    V G
Sbjct: 62  PATPSKYGIRAIPTLILFKNGEVVEQVTG 90



>gb:BX842652_825305 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 7/11.
          Length = 108

 Score = 83.2 bits (204), Expect = 6e-15
 Identities = 34/93 (36%), Positives = 57/93 (61%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  S+D  +LNS  PVLV+F+A WCGPCR +   ++E+A +   ++K   +N D +  +
Sbjct: 8   VTDTSFDAEVLNSSTPVLVDFWAEWCGPCRALAPKLEEVAQELGAKVKIVKVNVDENPSV 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVL 601
              Y I+ +P ++LFK G + G ++G H +  +
Sbjct: 68  PGKYGIRGIPAMLLFKGGSEVGQLVGNHPKDAI 100



>gb:BX640414_805687 Bordetella pertussis strain Tohama I, complete
           genome; segment 4/12.>gb:BX640428_810131 Bordetella
           parapertussis strain 12822, complete genome; segment
           6/14.
          Length = 141

 Score = 83.2 bits (204), Expect = 6e-15
 Identities = 33/86 (38%), Positives = 58/86 (67%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           V+  S++  +L S  PVLV+++A+WCGPC+M+  +++E+A +Y+GRL    LN D +   
Sbjct: 41  VSDASFEADVLKSGQPVLVDYWAAWCGPCKMIAPILEEVAAEYAGRLTVAKLNVDENQDT 100

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
           A  Y ++ +P +MLFK+G+   + +G
Sbjct: 101 AAKYGVRGIPTLMLFKDGQAAATKVG 126



>pir|A55124|A55124 thioredoxin - Chloroflexus aurantiacus
          Length = 109

 Score = 83.2 bits (204), Expect = 6e-15
 Identities = 35/100 (35%), Positives = 62/100 (62%)
 Frame = +2

Query: 308 AKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNAD 487
           AK   V    + + +L S  PV+V+F+A WCGPCR++  ++D++A +Y+GRL    +N D
Sbjct: 1   AKPIEVHDSDFAEKVLQSKTPVVVDFWAPWCGPCRVIAPILDKLAGEYAGRLTIAKVNTD 60

Query: 488 SDVQIAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
            +VQ A    +K +P  ++FK+G + G ++G   + + R+
Sbjct: 61  DNVQYASQLGLKGLPTXVIFKDGREVGRLVGARPEAMYRE 100



>sp|Q9CM49|THIO_PASMU Thioredoxin (TRX).>gb:AE006138_215882
           Pasteurella multocida subsp. multocida str. Pm70 section
           105 of 204 of the complete genome.>gb:AE004439_1118612
           Pasteurella multocida subsp. multocida str. Pm70,
           complete genome.
          Length = 106

 Score = 83.2 bits (204), Expect = 6e-15
 Identities = 32/77 (41%), Positives = 55/77 (71%)
 Frame = +2

Query: 350 ILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAV 529
           ++NSDVPVL++F+A WCGPCRM+  ++DEIA ++SG++K   +N D +        ++++
Sbjct: 15  VVNSDVPVLLDFWAPWCGPCRMISPILDEIAAEFSGKVKVVKINIDENQATPAQLGVRSI 74

Query: 530 PVVMLFKNGEKRGSVIG 580
           P ++LFKNG+   + +G
Sbjct: 75  PTLVLFKNGKAVATQVG 91



>gb:AE016875_354581 Pseudomonas syringae pv. tomato str. DC3000
           section 20 of 21 of the complete
           genome.>gb:AE016853_1039756 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 109

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 40/108 (37%), Positives = 64/108 (59%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  S++  +L +D  VLV+++A WCGPC+M+  V+DEIAT Y+G+L    LN D + + 
Sbjct: 9   VTDASFEADVLKADGAVLVDYWAEWCGPCKMIAPVLDEIATTYAGKLTIAKLNIDENQET 68

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQCHREGFSLLDGNI 646
              + ++ +P +MLFKNG    + +G  ++  L        + LD NI
Sbjct: 69  PAKHGVRGIPTLMLFKNGNVEATKVGALSKSQLA-------AFLDANI 109



>gb:OSJN00083_1694574 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0064G10, complete sequence.
          Length = 180

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 41/116 (35%), Positives = 68/116 (58%)
 Frame = +2

Query: 215 ASIGSSFLLNRNVRPRQSKSPFHLRVVCHRDAKAAVVTGKSWDKMILNSDVPVLVEFYAS 394
           AS+GS  ++     P   +     RV C   A    +    ++  +L SD+PVLV+F A 
Sbjct: 38  ASVGSFRVVGPAAAPPGGRRIASARVRC--GAAVRFIGQSEFEAEVLQSDLPVLVDFVAD 95

Query: 395 WCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEK 562
           WCGPCR++  V+D  A +Y GRLK   ++ D++ Q+ E+Y +  +P ++LFK+G++
Sbjct: 96  WCGPCRLIAPVVDWAAEEYEGRLKIVKIDHDANPQLIEEYKVYGLPSLILFKDGKE 151



>gb:BX950851_842946 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 108

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 35/95 (36%), Positives = 60/95 (63%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           +T  S+   +L ++   LV+F+A WCGPC+M+  ++DEIA ++ G+L    LN D +   
Sbjct: 8   LTDDSFGTKVLQAEGATLVDFWAEWCGPCKMIAPILDEIAEEFEGKLTVTKLNIDENPAT 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           A  Y I+ +P ++LFKNGE   + +G  ++G L++
Sbjct: 68  APKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKE 102



>gb:AE016966_369261 Coxiella burnetii strain RSA 493, section 7 of 7
           of the complete genome.>gb:AE016828_1009997 Coxiella
           burnetii strain RSA 493, complete genome.
          Length = 112

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 31/76 (40%), Positives = 55/76 (72%)
 Frame = +2

Query: 332 KSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAED 511
           ++++  +L +D+PVLV+F+A WC PC+M+  V++EIA +Y+GR+K F LN D + Q    
Sbjct: 11  ENFETEVLQADMPVLVDFWAEWCQPCKMISPVVEEIAKEYAGRVKVFKLNVDENAQTPTK 70

Query: 512 YDIKAVPVVMLFKNGE 559
           Y ++ +P +++F+ GE
Sbjct: 71  YGVRGIPSLLIFREGE 86



>gb:AE012561_285426 Xylella fastidiosa Temecula1, section 9 of 9 of
           the complete genome.>gb:AE009442_962002 Xylella
           fastidiosa Temecula1, complete genome.
          Length = 113

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 35/95 (36%), Positives = 64/95 (67%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           ++  ++D M+L SD PVLV+F+A WCGPC+++  ++D++A  Y GRLK   ++ D +  +
Sbjct: 8   ISDANFDAMVLLSDQPVLVDFWAKWCGPCKIISTLLDDLAQSYEGRLKIAKVDIDENRAL 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           A  Y + ++P+++LFK+G+ + +  G   +G L Q
Sbjct: 68  AIKYHVCSIPMLLLFKDGQVQITQTGAVGKGRLTQ 102



>gb:CR555306_108087 Azoarcus sp. EbN1 complete genome.
          Length = 108

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 31/86 (36%), Positives = 56/86 (65%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  +++  +L S  PVLV+++A WCGPC+M+  ++D++A +Y+G+LK   LN D + + 
Sbjct: 8   VTDGNFEAEVLQSQTPVLVDYWAEWCGPCKMIAPILDDVAKEYAGKLKVAKLNIDENQET 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
              + ++ +P +MLFK G    + +G
Sbjct: 68  PAKFGVRGIPTLMLFKGGNVEATKVG 93



>gb:AJ749949_531902 Francisella tularensis subsp. tularensis
           complete genome.
          Length = 107

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 29/91 (31%), Positives = 60/91 (65%)
 Frame = +2

Query: 308 AKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNAD 487
           +K   ++   ++  ++NSD+PVL++F+A WCGPC+M+  ++D++   Y  ++K   +N D
Sbjct: 2   SKCIDISDSQFESEVVNSDIPVLLDFWAPWCGPCKMLAPILDQVTEHYGDKIKVCKINID 61

Query: 488 SDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
            + + A  + ++ VP +M+FK+GE + + +G
Sbjct: 62  DNEETAMKFGVRGVPTLMVFKDGENKETKVG 92



>sp|P43785|THIO_HAEIN Thioredoxin (TRX).>pir|E64047|E64047
           thioredoxin - Haemophilus influenzae (strain Rd
           KW20)>gb:U32693_203775 Haemophilus influenzae Rd KW20
           section 8 of 163 of the complete
           genome.>gb:L42023_1096324 Haemophilus influenzae Rd KW20
           complete genome.
          Length = 107

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 27/86 (31%), Positives = 59/86 (68%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           +    ++ +++NSD+P+L++F+A WCGPC+M+  V+DE+A +++G++K   +N D +   
Sbjct: 7   INDADFESVVVNSDIPILLDFWAPWCGPCKMIAPVLDELAPEFAGKVKIVKMNVDDNQAT 66

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
              + ++++P ++L KNG+   + +G
Sbjct: 67  PAQFGVRSIPTLLLIKNGQVVATQVG 92



>gb:AY673996_1621513 Gracilaria tenuistipitata var. liui
           chloroplast, complete genome.
          Length = 113

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 34/86 (39%), Positives = 58/86 (67%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           V   S+++ ++ S  PVLV+F+A WCGPCRMV  V+++IA +Y  +LK   LN D +   
Sbjct: 6   VMDASFNEEVIKSSYPVLVDFWAPWCGPCRMVAPVVNQIAHEYKDKLKVVTLNTDKNPST 65

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
           A +Y I+++P +++F  G++  +V+G
Sbjct: 66  AAEYGIRSIPTLIIFIEGQRVHTVVG 91



>gb:CP000009_862647 Gluconobacter oxydans 621H, complete genome.
          Length = 108

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 33/91 (36%), Positives = 58/91 (63%)
 Frame = +2

Query: 308 AKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNAD 487
           A    V+  S++  +L S+ PVLV+F+A WCGPC+M+   ++EI  +Y GRLK   +N D
Sbjct: 3   ANTVAVSDSSFEADVLKSEGPVLVDFWAEWCGPCKMIAPALEEIGAEYQGRLKVAKVNID 62

Query: 488 SDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           S+ +    Y ++++P +++FK+G+     +G
Sbjct: 63  SNPEAPTKYGVRSIPTLIVFKDGKPVAQQMG 93



>gb:AL646063_546116 Ralstonia solanacearum GMI1000 chromosome,
           complete sequence; segment 7/19.
          Length = 108

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 32/86 (37%), Positives = 55/86 (63%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           V+  S++  +L SD PVLV+F+A WCGPC+M+  ++DE++ DY  +++   LN D +  +
Sbjct: 8   VSDASFEADVLKSDKPVLVDFWAEWCGPCKMIAPILDEVSKDYGDKVQIAKLNVDENAGV 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
              + I+ +P ++LFKNG      +G
Sbjct: 68  PAKFGIRGIPTLILFKNGAVAAQKVG 93



>gb:AE017282_426894 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 109

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 34/86 (39%), Positives = 54/86 (62%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT   ++  +L +  PVLV+++A WCGPC+M+  ++DEIA +Y GRL    LN D +   
Sbjct: 9   VTDAEFEDKVLKAPGPVLVDYWAEWCGPCKMIAPILDEIAGEYEGRLTVAKLNIDDNPAT 68

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
            + Y ++ +P +M+FK GE   S +G
Sbjct: 69  PQRYGVRGIPTLMVFKGGEVVASKVG 94



>pir|AD0471|AD0471 thioredoxin 1 [imported] - Yersinia pestis
           (strain CO92)>gb:AE013636_298691 Yersinia pestis KIM
           section 36 of 415 of the complete
           genome.>gb:AE017139_388922 Yersinia pestis biovar
           Medievalis str. 91001 section 13 of 16 of the complete
           genome.>gb:AJ414159_525625 Yersinia pestis strain CO92
           complete genome; segment 19/20.>gb:BX936398_834811
           Yersinia pseudotuberculosis IP32953 genome, complete
           sequence.>gb:AE009952_928874 Yersinia pestis KIM
           complete genome.>gb:AE017042_1145488 Yersinia pestis
           biovar Medievalis str. 91001 complete genome.
          Length = 108

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 39/104 (37%), Positives = 63/104 (60%)
 Frame = +2

Query: 335 SWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDY 514
           S+D  +L +   VLV+F+A WCGPC+M+  ++DEIA +Y GRL    LN D +   A  Y
Sbjct: 12  SFDTDVLKASGLVLVDFWAEWCGPCKMIAPILDEIAEEYEGRLTIAKLNIDDNQGTAPKY 71

Query: 515 DIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQCHREGFSLLDGNI 646
            I+ +P ++LF++GE   + +G  ++G L+       + LD N+
Sbjct: 72  GIRGIPTLLLFRDGEVVATKVGALSKGQLK-------AFLDANL 108



>sp|P00275|THI1_CORNE Thioredoxin C-1.>pir|A00281|TXFK thioredoxin -
           coryneform bacterium ATCC11425
          Length = 105

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 30/86 (34%), Positives = 59/86 (68%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           V   ++   +L S  PV+V+F+A WCGPC+M+   +DEIAT+ +G++K   +N D + ++
Sbjct: 5   VDNSNFQSDVLQSSEPVVVDFWAEWCGPCKMIAPALDEIATEMAGQVKIAKVNIDENPEL 64

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
           A  + ++++P +++FK+GE   +++G
Sbjct: 65  AAQFGVRSIPTLLMFKDGELAANMVG 90



>gb:BX897699_826662 Bartonella henselae strain Houston-1, complete
           genome.
          Length = 107

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 30/100 (30%), Positives = 65/100 (65%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           V   +++  +L S  PV+V+F+A WCGPC+M+  ++DEI+ +   ++K   +N D + ++
Sbjct: 6   VDKSNFESEVLTSSTPVVVDFWAEWCGPCKMIAPILDEISMEMQNQVKIAKVNIDENPEL 65

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQCHREG 622
           A  Y ++++P +++FK+G    +++G  ++G + +  +EG
Sbjct: 66  ATQYGVRSIPTLLMFKDGNIASNMVGAASKGRVSEWIKEG 105



>gb:SME591782_184051 Sinorhizobium meliloti 1021 complete
           chromosome; segment 1/12.
          Length = 107

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 32/82 (39%), Positives = 56/82 (68%)
 Frame = +2

Query: 335 SWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDY 514
           ++ K +LNS  PV+V+F+A WCGPC+M+   ++EIAT+ +G++K   LN D + ++A  Y
Sbjct: 10  NFQKEVLNSAEPVVVDFWAEWCGPCKMIAPSLEEIATELAGKVKVVKLNIDENPELAAQY 69

Query: 515 DIKAVPVVMLFKNGEKRGSVIG 580
            ++++P + +FK GE     +G
Sbjct: 70  GVRSIPTLAMFKGGEVADIKVG 91



>pir|F82526|F82526 thioredoxin XF2698 [imported] - Xylella
           fastidiosa (strain 9a5c)>gb:AE004075_50324 Xylella
           fastidiosa 9a5c, section 221 of 229 of the complete
           genome.>gb:AE003849_1117534 Xylella fastidiosa 9a5c,
           complete genome.
          Length = 113

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 35/95 (36%), Positives = 64/95 (67%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           V+  ++D ++L SD PVLV+F+A WC PC+++  ++D++A  Y GRLK   ++ D +  +
Sbjct: 8   VSDANFDAVVLLSDQPVLVDFWAKWCSPCKIISTLLDDLAQSYKGRLKIAKVDIDENRAL 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           A  Y + ++P+++LFK+G+ + + IG   +G L Q
Sbjct: 68  AIKYHVCSIPMLLLFKDGQVQITQIGAVGKGRLTQ 102



>gb:AE016827_343255 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 107

 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 31/85 (36%), Positives = 58/85 (68%)
 Frame = +2

Query: 326 TGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIA 505
           T  S++  +L SDVPVLV+ +A WCGPCRMV  ++D++A + +G++K   +N D +    
Sbjct: 8   TDASFEADVLRSDVPVLVDLWAPWCGPCRMVAPILDDLAAELAGKVKIVKINIDENQGTP 67

Query: 506 EDYDIKAVPVVMLFKNGEKRGSVIG 580
             + ++++P +++FK+G+  G+ +G
Sbjct: 68  AQFGVRSIPTLLMFKDGQLVGTQVG 92



>gb:AP006618_562064 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 110

 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 37/99 (37%), Positives = 60/99 (60%)
 Frame = +2

Query: 305 DAKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNA 484
           + K   VT  S+   +L S+ PVLV+F+A WCGPC+MV  V++EIA  ++ +L    L+ 
Sbjct: 4   NGKTVTVTDASFADDVLMSEKPVLVDFWADWCGPCKMVAPVLEEIAGTHADKLTVAKLDV 63

Query: 485 DSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVL 601
           D++   A DY I ++P +MLF+ G+    ++G   +  L
Sbjct: 64  DANPATARDYQILSLPTMMLFRGGKPVKQIVGAKGKAAL 102



>gb:AE016822_341357 Leifsonia xyli subsp. xyli str. CTCB07, complete
           genome.
          Length = 108

 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 35/86 (40%), Positives = 58/86 (67%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  S+++ +LNS+  VLV+F+A WCGPCR V  ++D+IA ++S +++   LN D + Q 
Sbjct: 7   VTDVSFEQDVLNSEKTVLVDFWAEWCGPCRAVGPILDQIAAEHSEKIEIVKLNVDENPQT 66

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
           A  Y I ++P + +++ GE   +VIG
Sbjct: 67  AAKYQITSIPAMKVYQGGEVVKTVIG 92



>gb:CR378674_96789 Photobacterium profundum SS9; segment 12/12.
          Length = 112

 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 33/99 (33%), Positives = 61/99 (61%)
 Frame = +2

Query: 311 KAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADS 490
           K   +T  ++D  ++N+  PVLV+F+A WCGPC+M+  ++DEIA +Y G++    LN D 
Sbjct: 8   KIVQLTDATFDSDVVNAAGPVLVDFWAEWCGPCKMIAPILDEIANEYEGKVTIGKLNIDQ 67

Query: 491 DVQIAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           +      + I+ +P ++LFK+G    + +G  ++  L++
Sbjct: 68  NAATPPKFGIRGIPTLLLFKDGSVAATKVGALSKTQLKE 106



>gb:AB032759_5171 Actinobacillus actinomycetemcomitans trxA gene for
           thioredoxin, complete cds.
          Length = 107

 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 28/77 (36%), Positives = 56/77 (72%)
 Frame = +2

Query: 350 ILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAV 529
           +LNS+VPVL++F+A+WCGPC+M+  ++D++A ++ G++K   +N D +      + +++V
Sbjct: 16  VLNSEVPVLLDFWATWCGPCKMIAPILDDLAVEFDGKVKIVKINIDDNQATPAQFGVRSV 75

Query: 530 PVVMLFKNGEKRGSVIG 580
           P ++LFK+G+   + +G
Sbjct: 76  PTLLLFKDGKPVATQVG 92



>gb:AP006840_567436 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 114

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 33/95 (34%), Positives = 60/95 (63%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           +T  +++  +L S++PVLV+F+A WCGPCRM+  V++E A D   R+K   LN D + + 
Sbjct: 8   ITDATFEAEVLQSELPVLVDFWAPWCGPCRMIGPVLEEYARDNGHRIKIAKLNVDEEQEW 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           A  + + ++P ++LF  G+  G ++G+  +  + Q
Sbjct: 68  AGRFGVMSIPTMILFHKGKPVGQLVGFRPKHEMYQ 102



>gb:D63676_1674716 Cyanidium caldarium trnK, trpA, trnT, rps4, trxM,
           rbcL, rbcS, cfxQ, trnC, trnL and ilvH genes, complete
           cds.
          Length = 101

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 36/82 (43%), Positives = 55/82 (67%)
 Frame = +2

Query: 335 SWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDY 514
           S+D  +L S   VLV+F+A WCGPCRM+  ++DEIA +    +K   LN D +  +A +Y
Sbjct: 7   SFDTEVLQSHQLVLVDFWAPWCGPCRMIAPILDEIAQELD--IKVVKLNTDENPNLATEY 64

Query: 515 DIKAVPVVMLFKNGEKRGSVIG 580
            I+++P +MLFK G++  +VIG
Sbjct: 65  GIRSIPTLMLFKKGQRLDTVIG 86



>gb:BA000037_724008 Vibrio vulnificus YJ016 DNA, chromosome I,
           complete sequence.
          Length = 112

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 33/99 (33%), Positives = 61/99 (61%)
 Frame = +2

Query: 311 KAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADS 490
           K   ++ + ++  ++N+  PVLV+F+A WCGPC+M+  ++DEIA +Y G+L    LN D 
Sbjct: 8   KILQLSDEGFENDVINAAGPVLVDFWAEWCGPCKMIAPILDEIAEEYEGKLTIGKLNIDH 67

Query: 491 DVQIAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           +      + I+ +P ++LFKNG    + +G  ++  L++
Sbjct: 68  NAGTPPKFGIRGIPTLLLFKNGSVAATKVGALSKTQLKE 106



>gb:AE016800_335688 Vibrio vulnificus CMCP6 chromosome I section 4
           of 11 of the complete sequence.>gb:AE016795_1045412
           Vibrio vulnificus CMCP6 chromosome I complete sequence.
          Length = 108

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 33/99 (33%), Positives = 61/99 (61%)
 Frame = +2

Query: 311 KAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADS 490
           K   ++ + ++  ++N+  PVLV+F+A WCGPC+M+  ++DEIA +Y G+L    LN D 
Sbjct: 4   KILQLSDEGFENDVINAAGPVLVDFWAEWCGPCKMIAPILDEIAEEYEGKLTIGKLNIDH 63

Query: 491 DVQIAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           +      + I+ +P ++LFKNG    + +G  ++  L++
Sbjct: 64  NAGTPPKFGIRGIPTLLLFKNGSVAATKVGALSKTQLKE 102



>gb:CP000031_87860 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 106

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 29/79 (36%), Positives = 55/79 (69%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  ++D  + NSD+PV+V+F+A WCGPC+ +   ++E+AT+Y+G++K   ++ DS+   
Sbjct: 6   VTDATFDAEVKNSDIPVVVDFWAEWCGPCKQIGPALEELATEYAGKVKIAKVDVDSNPNA 65

Query: 503 AEDYDIKAVPVVMLFKNGE 559
           A    ++ +P + +FK+G+
Sbjct: 66  AAAMGVRGIPALFIFKDGQ 84



>gb:BX571965_791286 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.>gb:CP000010_865637
           Burkholderia mallei ATCC 23344 chromosome 1, complete
           sequence.
          Length = 108

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 29/86 (33%), Positives = 55/86 (63%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           ++  S+++ ++ SD PVL++F+A WCGPC+M+  ++DE+A DY  +L+   +N D +   
Sbjct: 8   ISDASFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKINVDENQAT 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
              + ++ +P ++LFKNG      +G
Sbjct: 68  PAKFGVRGIPTLILFKNGAVAAQKVG 93



>gb:AF279106_495020 Uncultured marine gamma proteobacterium
           EBAC31A08 BAC sequence.
          Length = 108

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 33/83 (39%), Positives = 57/83 (68%)
 Frame = +2

Query: 332 KSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAED 511
           +S++  +LNS+ PVLV+F+A WCGPC+ +   ++ +A + S  LK   ++ DS+ +IA  
Sbjct: 11  ESFNSDVLNSEKPVLVDFWAEWCGPCKQLAPTVETVAAEKSETLKVCKMDVDSNREIAAK 70

Query: 512 YDIKAVPVVMLFKNGEKRGSVIG 580
           Y I+++P +++FKNGE  G  +G
Sbjct: 71  YGIRSIPSLIIFKNGEPAGVEVG 93



>gb:CP000020_870233 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 108

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 33/99 (33%), Positives = 61/99 (61%)
 Frame = +2

Query: 311 KAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADS 490
           K   +T   +++ ++N+  PVLV+F+A WCGPC+M+  ++DEIA +Y G+L    LN D 
Sbjct: 4   KILQLTDGGFEESVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLNIDQ 63

Query: 491 DVQIAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           +      + I+ +P ++LFK+G    + +G  ++  L++
Sbjct: 64  NAGTPPKFGIRGIPTLLLFKDGGVAATKVGALSKTQLKE 102



>gb:AE016793_334594 Pseudomonas putida KT2440 section 20 of 21 of
           the complete genome.>gb:AE015451_949671 Pseudomonas
           putida KT2440 complete genome.
          Length = 109

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 32/86 (37%), Positives = 55/86 (63%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  S++  +L ++  VLV+++A WCGPC+M+  V+D+IA+ Y G+L    LN D + + 
Sbjct: 9   VTDASFEADVLKAEGAVLVDYWAEWCGPCKMIAPVLDDIASTYEGKLTVAKLNIDENQET 68

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
              + ++ +P +MLFKNG    + +G
Sbjct: 69  PAKHGVRGIPTLMLFKNGNVEATKVG 94



>gb:BA000031_708461 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 108

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 33/99 (33%), Positives = 60/99 (60%)
 Frame = +2

Query: 311 KAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADS 490
           K   +T   ++  ++N+  PVLV+F+A WCGPC+M+  ++DEIA +Y G+L    LN D 
Sbjct: 4   KILQLTDDGFENDVINAAGPVLVDFWAEWCGPCKMIAPILDEIAEEYEGKLTIGKLNIDH 63

Query: 491 DVQIAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           +      + I+ +P ++LFK+G    + +G  ++  L++
Sbjct: 64  NAGTPPKFGIRGIPTLLLFKDGNVAATKVGALSKTQLKE 102



>sp|P09857|THIO_CHRVI Thioredoxin (TRX).>pir|A26622|A26622
           thioredoxin - Chromatium vinosum
          Length = 107

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 34/86 (39%), Positives = 52/86 (60%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  S+++ +  S  PVLV+++A WCGPC+M   V DEIA +Y+GR+K    N D +   
Sbjct: 7   VTDDSFEEEVXKSPDPVLVDYWADWCGPCKMXAPVXDEIADEYAGRVKXAKXNXDENPNT 66

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
              Y  + +P +MLF+ GE   + +G
Sbjct: 67  PPRYGXRGIPTLMLFRGGEVEATKVG 92



>pir|G75612|G75612 thioredoxin 1 - Deinococcus radiodurans (strain
           R1)>gb:AE001862_40097 Deinococcus radiodurans R1 section
           1 of 2 of the complete chromosome 2.>gb:AE001825_885419
           Deinococcus radiodurans R1 complete chromosome 2.
          Length = 142

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 29/84 (34%), Positives = 58/84 (69%)
 Frame = +2

Query: 353 LNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVP 532
           L + VPVLV+F+A WCGPCR++  V++++A D  G+++   +N D + + A  ++++++P
Sbjct: 49  LQTSVPVLVDFWAPWCGPCRVMGPVLEDLARDLPGKVRVVKVNVDENPRTAARFEVRSIP 108

Query: 533 VVMLFKNGEKRGSVIGYHAQGVLR 604
            +++FK+GE+   ++G   +  LR
Sbjct: 109 TLLMFKDGEEVDQMVGVTQKAALR 132



>pir|A35135|A35135 thioredoxin - Rhodobacter
           sphaeroides>gb:RCATRXA_162590 R.sphaeroides Y
           thioredoxin (trxA) gene, complete cds.
          Length = 106

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 30/86 (34%), Positives = 55/86 (63%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  ++D  +  SDVPV+V+F+A WCGPCR +   ++E++ +Y+G++K   +N D + + 
Sbjct: 6   VTDATFDTEVRKSDVPVVVDFWAEWCGPCRQIGPALEELSKEYAGKVKIVKVNVDENPES 65

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
                ++ +P + LFKNG+   + +G
Sbjct: 66  PAMLGVRGIPALFLFKNGQVVSNKVG 91



>sp|P96132|THIO_THIRO Thioredoxin (TRX)
           (Fragment).>gb:TRU75512_198247 Thiocapsa roseopersicina
           thioredoxin (trxA) gene, partial cds.
          Length = 91

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 34/79 (43%), Positives = 51/79 (64%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  S++  +L S  PVLV+++A WCGPC+M+  V+DEIA +Y+GR+K   LN D +   
Sbjct: 8   VTDDSFEDEVLKSLEPVLVDYWADWCGPCKMIAPVLDEIAGEYAGRIKVAKLNIDENPNT 67

Query: 503 AEDYDIKAVPVVMLFKNGE 559
              Y I+ +P +ML +  E
Sbjct: 68  PRRYGIRGIPTLMLSRQSE 86



>sp|P52233|THIO_THIFE Thioredoxin (TRX).>gb:TFU20361_197592
           Thiobacillus ferrooxidans thioredoxin (trxA) gene,
           complete cds and rho transcription terminator (rho)
           gene, partial cds.
          Length = 108

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 32/86 (37%), Positives = 54/86 (62%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           V+  S++  +L S  PVLV+F+A WCGPC+M+  +++EIA +Y+ RL+    N D +   
Sbjct: 8   VSDDSFETDVLKSSKPVLVDFWAEWCGPCKMIAPILEEIADEYADRLRVAKFNIDENPNT 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
              Y I+ +P ++LFK G+   + +G
Sbjct: 68  PPQYAIRGIPTLLLFKAGKLEATKVG 93



>sp|P08058|THIO_RHOSH Thioredoxin (TRX).
          Length = 105

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 30/86 (34%), Positives = 55/86 (63%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  ++D  +  SDVPV+V+F+A WCGPCR +   ++E++ +Y+G++K   +N D + + 
Sbjct: 5   VTDATFDTEVRKSDVPVVVDFWAEWCGPCRQIGPALEELSKEYAGKVKIVKVNVDENPES 64

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
                ++ +P + LFKNG+   + +G
Sbjct: 65  PAMLGVRGIPALFLFKNGQVVSNKVG 90



>gb:BX572593_799688 Rhodopseudomonas palustris CGA009 complete
           genome; segment 1/16.
          Length = 106

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 34/95 (35%), Positives = 54/95 (56%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           V+   ++  +LN+  PV+V+F+A WCGPCRM+   +DEIA     ++K   LN D     
Sbjct: 6   VSDADFENEVLNAQGPVVVDFWAEWCGPCRMIAPALDEIAGAMGDKVKIVKLNVDESPVT 65

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           A  Y + ++P +M+FK GE     +G   +  L+Q
Sbjct: 66  ASKYGVMSIPTLMIFKGGEMASRQVGAAPKAKLQQ 100



>gb:AE008692_240835 Zymomonas mobilis subsp. mobilis ZM4, complete
           genome.
          Length = 106

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 31/79 (39%), Positives = 53/79 (67%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  S++  +L S VPV+V+F+A WCGPCR +   + EIA++  G++    +  D++++ 
Sbjct: 6   VTDASFEADVLKSPVPVVVDFWAEWCGPCRQIAPALGEIASELEGKMTLAKVEVDNNIET 65

Query: 503 AEDYDIKAVPVVMLFKNGE 559
           A  + I+ +P ++LFKNGE
Sbjct: 66  ASRFGIRNIPTLLLFKNGE 84



>pir|AH3504|AH3504 thioredoxin C-1 [imported] - Brucella melitensis
           (strain 16M)>gb:AE009635_253940 Brucella melitensis 16M
           chromosome I, section 192 of 195 of the complete
           sequence.>gb:AE014291_309509 Brucella suis 1330
           chromosome I, complete sequence.>gb:AE008917_979852
           Brucella melitensis 16M chromosome I, complete sequence.
          Length = 107

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 28/86 (32%), Positives = 57/86 (66%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           V   ++   +L S  PV+V+F+A WCGPC+ +   +DEIA + +G++K   +N D + ++
Sbjct: 6   VDNSNFQSDVLQSSEPVVVDFWAEWCGPCKTIAPALDEIAAEMAGQVKIAKVNIDENPEL 65

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
           A  + ++++P +++FK+GE   +++G
Sbjct: 66  AAQFGVRSIPTLLMFKDGELAANMVG 91



>pir|B70851|B70851 probable trxC protein - Mycobacterium
           tuberculosis (strain H37RV)>gb:AE000516_24169
           Mycobacterium tuberculosis CDC1551, complete
           genome.>gb:MTTRTRXGN_151333 M.tuberculosis TR and Trx
           genes.>gb:BX248347_761300 Mycobacterium bovis subsp.
           bovis AF2122/97 complete genome; segment
           14/14.>gb:BX842584_822027 Mycobacterium tuberculosis
           H37Rv complete genome; segment 13/13.
          Length = 116

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 34/93 (36%), Positives = 62/93 (66%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  S+   +L+S+ PVLV+F+A+WCGPC+MV  V++EIAT+ +  L    L+ D++ + 
Sbjct: 12  VTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDTNPET 71

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVL 601
           A ++ + ++P ++LFK+G+    ++G   +  L
Sbjct: 72  ARNFQVVSIPTLILFKDGQPVKRIVGAKGKAAL 104



>sp|P52229|THIO_MYCTU Thioredoxin (TRX) (MPT46).
          Length = 115

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 34/93 (36%), Positives = 62/93 (66%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  S+   +L+S+ PVLV+F+A+WCGPC+MV  V++EIAT+ +  L    L+ D++ + 
Sbjct: 11  VTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDTNPET 70

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVL 601
           A ++ + ++P ++LFK+G+    ++G   +  L
Sbjct: 71  ARNFQVVSIPTLILFKDGQPVKRIVGAKGKAAL 103



>gb:CP000020_871085 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 144

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 30/86 (34%), Positives = 56/86 (65%)
 Frame = +2

Query: 350 ILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAV 529
           +LNSD  V+++F+A WC PC     V +++A + +G+++C  +N +++ QIA  Y I+++
Sbjct: 51  LLNSDKAVVIDFWAPWCNPCVGFSPVFEDVAAERNGQIRCIKVNTEAEQQIAAQYQIRSI 110

Query: 530 PVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           P +M+FKNG++   + G   +G   Q
Sbjct: 111 PTIMVFKNGQRVDMINGALPKGQFDQ 136



>gb:BX294154_771691 Pirellula sp. strain 1 complete genome; segment
           22/24.
          Length = 108

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 34/90 (37%), Positives = 58/90 (64%)
 Frame = +2

Query: 335 SWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDY 514
           ++D  +L SD PVLV+F+A WCGPCR +  ++DE+A++  G +K   +N D +   A+ +
Sbjct: 13  NFDSEVLKSDSPVLVDFWAPWCGPCRQIAPMIDELASENPG-VKIGKVNIDDNPGAAQKF 71

Query: 515 DIKAVPVVMLFKNGEKRGSVIGYHAQGVLR 604
            I ++P ++LFKNGE   + +G   +  L+
Sbjct: 72  GINSIPTLLLFKNGEIADTFVGVRPKAALQ 101



>gb:BA000012_669879 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 107

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 28/77 (36%), Positives = 53/77 (68%)
 Frame = +2

Query: 350 ILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAV 529
           +LN++VPV+V+F+A WCGPC+ +   +++IAT+   ++K   LN D + ++A  + ++++
Sbjct: 16  VLNANVPVVVDFWAEWCGPCKQIAPSLEDIATELGAKIKIAKLNIDENPELAAQFGVRSI 75

Query: 530 PVVMLFKNGEKRGSVIG 580
           P +M+FK GE     +G
Sbjct: 76  PTLMIFKGGEVADMKVG 92



>sp|O22022|THIO_CYAME Thioredoxin.>gb:AB002583_1508730
           Cyanidioschyzon merolae chloroplast DNA, complete
           genome, strain:10D.>gb:D63675_1674707 Cyanidioschyzon
           merolae trnK, trpA, trnT, rps4, trxM, rbcL, rbcS, cfxQ,
           trnC, trnL and ilvH genes, complete cds.
          Length = 102

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 34/89 (38%), Positives = 60/89 (67%)
 Frame = +2

Query: 335 SWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDY 514
           +++  +L S+  VLV+F+A WCGPCRM+  +++EIA +++  LK   +N D +  +A  Y
Sbjct: 8   TFENEVLQSEKLVLVDFWAPWCGPCRMIGPILEEIAKEFN--LKVVQVNTDENPNLATFY 65

Query: 515 DIKAVPVVMLFKNGEKRGSVIGYHAQGVL 601
            I+++P +MLFK G++  +VIG   + +L
Sbjct: 66  GIRSIPTLMLFKKGQRVDTVIGAVPKSIL 94



>gb:BA000040_729011 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 106

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 33/95 (34%), Positives = 55/95 (57%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           V+   ++  +L ++ PV+V+F+A WCGPCRM+   +DEIA     ++K   LN D   + 
Sbjct: 6   VSDTDFEAEVLKANGPVVVDFWAEWCGPCRMIAPALDEIAGAMGDKVKIVKLNVDESPKT 65

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           A  Y + ++P +M+FK GE     +G   +  L+Q
Sbjct: 66  ASKYGVMSIPTLMIFKGGEMASRQVGAAPKAKLQQ 100



>gb:BA000030_705129 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 151

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 32/94 (34%), Positives = 59/94 (62%)
 Frame = +2

Query: 359 SDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVV 538
           +DVPV+V+ +A+WCGPCRMV   ++++ATD +GR+K   ++ D + +++  ++++AVP +
Sbjct: 58  ADVPVVVDLWATWCGPCRMVSPALEKVATDLAGRIKLVKVDIDKNPRLSRRFEVQAVPTL 117

Query: 539 MLFKNGEKRGSVIGYHAQGVLRQCHREGFSLLDG 640
           ++   GE      G     VLRQ   +  +  +G
Sbjct: 118 LVLDQGETVARQAGAAPAPVLRQWVEQSITAREG 151



>gb:CR767821_117118 Ehrlichia ruminantium strain Welgevonden,
           complete genome.>gb:CR925677_118045 Ehrlichia
           ruminantium str. Gardel, complete
           genome.>gb:CR925678_119004 Ehrlichia ruminantium str.
           Welgevonden, complete genome.
          Length = 107

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 28/73 (38%), Positives = 51/73 (69%)
 Frame = +2

Query: 362 DVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVM 541
           D+ +LV+F+A WCGPC+ +   ++++A  Y+ ++K + L+ D++  +A  Y + AVP ++
Sbjct: 20  DILILVDFWAPWCGPCKSLEPQLEKLANQYADKIKIYKLSIDNNQDVAIQYGVSAVPTIL 79

Query: 542 LFKNGEKRGSVIG 580
           +FKNG+K   VIG
Sbjct: 80  MFKNGKKLAQVIG 92



>pir|D97279|D97279 thioredoxin [imported] - Clostridium
           acetobutylicum>gb:AE007805_230384 Clostridium
           acetobutylicum ATCC 824 section 293 of 356 of the
           complete genome.>gb:AE001437_1093339 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 105

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 31/82 (37%), Positives = 54/82 (65%)
 Frame = +2

Query: 338 WDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYD 517
           +D+ I  S  PV+V+F+A WCGPC+M+  ++DE++ D  G+ K   +N D +  IA  + 
Sbjct: 10  FDEEIKTSGEPVIVDFWAPWCGPCKMLGPIIDELSEDLDGKAKFTKVNVDENPGIASKFG 69

Query: 518 IKAVPVVMLFKNGEKRGSVIGY 583
           I ++P VM+FK+G    +++G+
Sbjct: 70  IASIPTVMIFKDGNPVETLVGF 91



>pir|T42061|T42061 thioredoxin - Streptomyces
           coelicolor>gb:SCO007313_173239 Streptomyces coelicolor
           sigT, trxB and trxA genes, and ORF1 and
           ORF2.>gb:SCTRXAGEN_181632 S.coelicolor trxA
           gene.>gb:AF187159_486522 Streptomyces coelicolor TrxB
           (trxB) gene, partial cds; and TrxA (trxA), Orf205, ParB
           (parB), ParA (parA), GidB (gidB), Jag (jag), Orf431,
           Orf124, RNase P protein (rnpB), ribosomal protein rpmH
           (rpmH), DnaA (dnaA), and DnaN (dnaN) genes, complete
           cds.
          Length = 110

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 30/93 (32%), Positives = 59/93 (63%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  S+++ +L +D PVLV+F+A+WCGPCR +   ++ IA +Y  +++   LN D +   
Sbjct: 8   VTDDSFEQDVLKNDKPVLVDFWAAWCGPCRQIAPSLEAIAAEYGDKIEIVKLNIDENPGT 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVL 601
           A  Y + ++P + +++ GE   +++G +A+  +
Sbjct: 68  AAKYGVMSIPTLNVYQGGEVAKTIVGANAKAAI 100



>pir|H69517|H69517 thioredoxin (trx-4) homolog - Archaeoglobus
           fulgidus>gb:AE000956_29771 Archaeoglobus fulgidus DSM
           4304 section 151 of 172 of the complete
           genome.>gb:AE000782_976021 Archaeoglobus fulgidus DSM
           4304 complete genome.
          Length = 105

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 29/85 (34%), Positives = 55/85 (64%)
 Frame = +2

Query: 350 ILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAV 529
           ++ SD  V+V+FYA WC PCR +  ++++++ +Y+G ++ + LN D +  +A +Y I ++
Sbjct: 12  VIQSDKLVVVDFYADWCMPCRYISPILEKLSKEYNGEVEFYKLNVDENQDVAFEYGIASI 71

Query: 530 PVVMLFKNGEKRGSVIGYHAQGVLR 604
           P V+ F+NG+  G  IG   +  +R
Sbjct: 72  PTVLFFRNGKVVGGFIGAMPESAVR 96



>sp|P46843|TRXB_MYCLE Bifunctional thioredoxin reductase/thioredoxin
           [Includes: Thioredoxin reductase (EC 1.8.1.9) (TRXR);
           Thioredoxin].>pir|S77662|S77662 thioredoxin-disulfide
           reductase (EC 1.8.1.9) / thioredoxin - Mycobacterium
           leprae>gb:MLEPRTN10_146053 Mycobacterium leprae strain
           TN complete genome; segment 10/10.>gb:MLTRTRXHP_148798
           M.leprae TR/Trx hybrid protein.>gb:MSGDNAB_150415
           Mycobacterium leprae cosmid L222 DNA sequence, 27 CDS
           features.
          Length = 458

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 32/93 (34%), Positives = 62/93 (66%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  S+   +L+S+ PVLV+F+A+WCGPC+MV  V++EIA++   +L    L+ D++ ++
Sbjct: 354 VTDASFFADVLSSNKPVLVDFWATWCGPCKMVAPVLEEIASEQRNQLTVAKLDVDTNPEM 413

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVL 601
           A ++ + ++P ++LF+ G+    ++G   +  L
Sbjct: 414 AREFQVVSIPTMILFQGGQPVKRIVGAKGKAAL 446



>sp|P33636|THI2_ECOLI Thioredoxin 2 (EC 1.8.1.8) (Protein-disulfide
           reductase) (Disulfide reductase)
           (Trx2).>pir|H91059|H91059 probable thioredoxin-like
           protein [imported] - Escherichia coli (strain O157:H7,
           substrain RIMD 0509952)>pir|G85904|G85904 probable
           thioredoxin-like protein trxC [imported] - Escherichia
           coli (strain O157:H7, substrain
           EDL933)>pir|E65036|E65036 robable thioredoxin-like
           protein trxC [similarity] - Escherichia coli (strain
           K-12)>gb:AE005174_67698 Escherichia coli O157:H7 EDL933,
           complete genome.>gb:AE005674_72226 Shigella flexneri 2a
           str. 301, complete genome.>gb:ECU85942_134914
           Escherichia coli thioredoxin 2 gene, complete
           cds.>gb:U00096_201621 Escherichia coli K-12 MG1655
           complete genome.>gb:AE016764_327100 Escherichia coli
           CFT073 section 10 of 18 of the complete
           genome.>gb:AE016987_372412 Shigella flexneri 2a str.
           2457T section 10 of 16 of the complete
           genome.>gb:BA000007_661460 Escherichia coli O157:H7 DNA,
           complete genome.>gb:AE014075_957684 Escherichia coli
           CFT073 complete genome.>gb:AE014073_997162 Shigella
           flexneri 2a str. 2457T complete genome.
          Length = 139

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 28/85 (32%), Positives = 59/85 (69%)
 Frame = +2

Query: 305 DAKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNA 484
           D +    TG++ DK+ L  D+PV+++F+A WCGPCR    + +++A + SG+++   +N 
Sbjct: 34  DGEVINATGETLDKL-LKDDLPVVIDFWAPWCGPCRNFAPIFEDVAQERSGKVRFVKVNT 92

Query: 485 DSDVQIAEDYDIKAVPVVMLFKNGE 559
           +++ +++  + I+++P +M+FKNG+
Sbjct: 93  EAERELSSRFGIRSIPTIMIFKNGQ 117



>gb:AE017180_401568 Geobacter sulfurreducens PCA, complete genome.
          Length = 109

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 32/90 (35%), Positives = 54/90 (60%)
 Frame = +2

Query: 311 KAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADS 490
           K    +  ++D  +L S VPVLV+F+A+WC PC+ +  V+D IA ++ G++K   +N D 
Sbjct: 5   KVLTFSDDTFDSEVLKSPVPVLVDFWATWCAPCKAIAPVIDAIADEFDGKVKVGKVNVDD 64

Query: 491 DVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           +      Y ++ +P V+LFK G+    V+G
Sbjct: 65  NPGTPGKYGVRGIPTVILFKEGKVVDQVVG 94



>pir|AH2101|AH2101 thioredoxin [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_683356 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 108

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 28/77 (36%), Positives = 55/77 (71%)
 Frame = +2

Query: 350 ILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAV 529
           +L+ D  V+V+F A+WCGPCR+V  +MD++A +Y GR+K   ++ D++  + + + ++++
Sbjct: 17  VLSEDKVVVVDFTATWCGPCRLVSPLMDQLADEYKGRVKVVKVDVDNNKPLFKRFGLRSI 76

Query: 530 PVVMLFKNGEKRGSVIG 580
           P V++FK+GE    ++G
Sbjct: 77  PAVLIFKDGELTEKIVG 93



>gb:BA000030_702193 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 110

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 30/86 (34%), Positives = 56/86 (65%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  S+++ +L SD PVLV+F+A+WCGPCR +   ++ IA++Y  +++   LN D +   
Sbjct: 8   VTDDSFEQDVLKSDKPVLVDFWAAWCGPCRQIAPSLEAIASEYGDKIEIVKLNIDENPGT 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
           A  Y + ++P + +++ GE   +++G
Sbjct: 68  AAKYGVMSIPTLNVYQGGEVAKTIVG 93



>gb:AE017242_415045 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 16 of 16 of the complete
           genome.>gb:AF418548_509576 Mycobacterium avium subsp.
           paratuberculosis thioredoxin reductase (trxB),
           thioredoxin (trxA), and N-acetylmuramoyl-l-alanine
           amidase (cwlM) genes, complete cds; and ParA (parA)
           gene, partial cds.>gb:AE016958_1058449 Mycobacterium
           avium subsp. paratuberculosis str. k10, complete genome.
          Length = 117

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 32/93 (34%), Positives = 61/93 (65%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           V+  S+   +L S+ PVLV+F+A+WCGPC+MV  V++EIA++    L    L+ D++ + 
Sbjct: 13  VSDASFSTDVLASNKPVLVDFWATWCGPCKMVAPVLEEIASERGDHLTVAKLDVDANPET 72

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVL 601
           A+++ + ++P ++LFK+G+    ++G   +  L
Sbjct: 73  AQNFQVVSIPTLILFKDGQPVKRIVGAKGKAAL 105



>gb:AE014296_1134355 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003474_1211654 Drosophila melanogaster
           chromosome 3L, section 8 of 83 of the complete
           sequence.>gb:AY071406_1295490 Drosophila melanogaster
           RE49388 full length cDNA.
          Length = 142

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 33/107 (30%), Positives = 64/107 (59%)
 Frame = +2

Query: 284 LRVVCHRDAKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRL 463
           L V   R     V + + +DK + NS  PV+V+F+A+WC PC+++   ++ I  + +G +
Sbjct: 25  LSVSAPRQEIFKVQSAEDFDKKVKNSQQPVIVDFFATWCNPCKLLTPRIESIVGEQAGSI 84

Query: 464 KCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLR 604
           K   ++ D   ++A DYD+ AVPV+++ +NG++   ++G   +  +R
Sbjct: 85  KLAKVDIDEHSELALDYDVAAVPVLVVLQNGKEVQRMVGLQDEDKIR 131



>gb:AE017172_396428 Porphyromonas gingivalis W83 section 1 of 8 of
           the complete genome.>gb:AE015924_1032039 Porphyromonas
           gingivalis W83 complete genome.
          Length = 104

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 30/98 (30%), Positives = 61/98 (62%)
 Frame = +2

Query: 314 AAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSD 493
           A  +T  ++D ++     P++V+F+A+WCGPCRMV  ++DE+A +Y GR     ++ D++
Sbjct: 2   ALQITDATFDGLVAEGK-PMVVDFWATWCGPCRMVGPIIDELAAEYEGRAIIGKVDVDAN 60

Query: 494 VQIAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
            ++   Y ++ +P ++  KNGE    ++G  ++ V ++
Sbjct: 61  TELPMKYGVRNIPTILFIKNGEVVKKLVGAQSKDVFKK 98



>pir|D82338|D82338 thioredoxin VC0306 [imported] - Vibrio cholerae
           (strain N16961 serogroup O1)>gb:AE004119_50710 Vibrio
           cholerae O1 biovar eltor str. N16961 chromosome I,
           section 27 of 251 of the complete
           chromosome.>gb:AE003852_1051484 Vibrio cholerae O1
           biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 108

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 31/99 (31%), Positives = 60/99 (60%)
 Frame = +2

Query: 311 KAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADS 490
           K   +T   ++  ++ +  PVLV+F+A WCGPC+M+  ++DE+A +Y+G+L    LN D 
Sbjct: 4   KILQLTDDGFENDVIKAAGPVLVDFWAEWCGPCKMIAPILDEVADEYAGKLTIGKLNIDH 63

Query: 491 DVQIAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           +      + I+ +P ++LFK+G    + +G  ++  L++
Sbjct: 64  NAGTPPKFGIRGIPTLLLFKDGSVVATKVGALSKTQLKE 102



>gb:AL935252_550242 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 1/11.
          Length = 110

 Score = 73.6 bits (179), Expect = 4e-12
 Identities = 28/78 (35%), Positives = 52/78 (66%)
 Frame = +2

Query: 374 LVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKN 553
           +V+F+A WCGPC+M   V++ +   Y G++K   L+ D   +IA+ ++I ++P +++FKN
Sbjct: 21  VVDFWADWCGPCKMQEPVLEALDELYDGQVKFASLDVDQHQEIAQQFEIMSIPALVIFKN 80

Query: 554 GEKRGSVIGYHAQGVLRQ 607
           G+    V+G+H Q  L++
Sbjct: 81  GQPAEKVVGFHPQAALKK 98



>pir|G97090|G97090 thioredoxin, trx [imported] - Clostridium
           acetobutylicum>gb:AE007665_228875 Clostridium
           acetobutylicum ATCC 824 section 153 of 356 of the
           complete genome.>gb:AE001437_1091830 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 105

 Score = 73.6 bits (179), Expect = 4e-12
 Identities = 31/95 (32%), Positives = 60/95 (63%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           +  KS+  +I NS   V+V+F+A+WC PC+M+  +++EIA +    L+   +N D + + 
Sbjct: 5   INDKSFVNVISNSKKVVVVDFWATWCEPCKMIAPILEEIAGELKESLEIIKINDDKNREA 64

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
            + Y I  +P +++FKNGE + S+ G++ +  L++
Sbjct: 65  VDKYGISNIPTMLIFKNGELQESLTGFNPKNKLKE 99



>sp|O30974|THIO_MYCSM Thioredoxin (TRX).>gb:AF023161_469984
           Mycobacterium smegmatis thioredoxin reductase (trxB) and
           thioredoxin (trxA) genes, complete cds.
          Length = 112

 Score = 73.6 bits (179), Expect = 4e-12
 Identities = 35/101 (34%), Positives = 58/101 (57%), Gaps = 2/101 (1%)
 Frame = +2

Query: 305 DAKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNA 484
           D+    VT  S+   +L S  PVLV+F+A+WCGPC+MV  V++EIA +   +L    ++ 
Sbjct: 4   DSATVAVTDDSFSTDVLGSSKPVLVDFWATWCGPCKMVAPVLEEIAAEKGDQLTVAKIDV 63

Query: 485 DSDVQ--IAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVL 601
           D D     A D+ + ++P ++LFK+G     ++G   +  L
Sbjct: 64  DVDANPATARDFQVVSIPTMILFKDGAPVKRIVGAKGKAAL 104



>gb:AE012852_286319 Chlorobium tepidum TLS section 73 of 194 of the
           complete genome.>gb:AE006470_933487 Chlorobium tepidum
           TLS complete genome.
          Length = 109

 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 32/85 (37%), Positives = 53/85 (62%)
 Frame = +2

Query: 326 TGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIA 505
           T +++   ILNSD   LV+F+A+WCGPC M+  V++E+A DY G+     LN D +   A
Sbjct: 9   TDQNFQAEILNSDKVALVDFWAAWCGPCMMLGPVIEELAGDYEGKAIIAKLNVDENPNTA 68

Query: 506 EDYDIKAVPVVMLFKNGEKRGSVIG 580
             Y I+++P +++ K G+    ++G
Sbjct: 69  GQYGIRSIPTMLIIKGGKVVDQMVG 93



>pir|AB0831|AB0831 thioredoxin 2 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain
           CT18)>gb:AE016835_344454 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, section 2 of 16 of the
           complete genome.>gb:AL627276_542962 Salmonella enterica
           serovar Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 12/20.>gb:AE014613_981786 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, complete
           genome.
          Length = 139

 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 27/85 (31%), Positives = 60/85 (70%)
 Frame = +2

Query: 305 DAKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNA 484
           D +    TG++ DK+ L  D+PV+++F+A WCGPCR    + +++A + SG+++   +N 
Sbjct: 34  DGEVINATGETLDKL-LKDDLPVVIDFWAPWCGPCRNFAPIFEDVAEERSGKVRFVKVNT 92

Query: 485 DSDVQIAEDYDIKAVPVVMLFKNGE 559
           +++ +++  + I+++P++M+FK+G+
Sbjct: 93  EAERELSARFGIRSIPMIMIFKHGQ 117



>sp|Q8KE49|THI2_CHLTE Thioredoxin 2 (Trx-2).
          Length = 108

 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 32/85 (37%), Positives = 53/85 (62%)
 Frame = +2

Query: 326 TGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIA 505
           T +++   ILNSD   LV+F+A+WCGPC M+  V++E+A DY G+     LN D +   A
Sbjct: 8   TDQNFQAEILNSDKVALVDFWAAWCGPCMMLGPVIEELAGDYEGKAIIAKLNVDENPNTA 67

Query: 506 EDYDIKAVPVVMLFKNGEKRGSVIG 580
             Y I+++P +++ K G+    ++G
Sbjct: 68  GQYGIRSIPTMLIIKGGKVVDQMVG 92



>gb:AY184796_1587990 Chlamydomonas reinhardtii thioredoxin y (TRXy)
           mRNA, complete cds; nuclear gene for chloroplast
           product.
          Length = 152

 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 40/132 (30%), Positives = 70/132 (53%), Gaps = 12/132 (9%)
 Frame = +2

Query: 248 NVRPRQSKSPFHLRVVCHRDAKAAVVTGK------------SWDKMILNSDVPVLVEFYA 391
           N R  +  +P  +R    R A+ AVV  +            S+D M+  S++P+LV+FYA
Sbjct: 6   NSRSLRGANPSAVRATAARVARLAVVPRRGVATAAQKQQFESFDDMLARSELPLLVDFYA 65

Query: 392 SWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGS 571
           +WCGPC+M+  ++  + T   G+L+   ++ D    IA  + I+A+P + LF  G+    
Sbjct: 66  TWCGPCQMMSPILTAVQTKMKGKLQVVKIDTDKYPGIASQHRIQALPTIALFMKGK---- 121

Query: 572 VIGYHAQGVLRQ 607
            + +  +GVL +
Sbjct: 122 -MVFRFEGVLNE 132



>gb:CP000025_877920 Campylobacter jejuni RM1221, complete genome.
          Length = 104

 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 28/69 (40%), Positives = 47/69 (68%)
 Frame = +2

Query: 374 LVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKN 553
           LV+F+A WCGPCRM+  V+DE+A D+ G+ K   +N D    +A ++ ++++P ++ FKN
Sbjct: 21  LVDFWAPWCGPCRMLAPVIDELANDFDGKAKICKVNTDEQGDLAAEFGVRSIPTLIFFKN 80

Query: 554 GEKRGSVIG 580
           GE    ++G
Sbjct: 81  GEVVDQLVG 89



>gb:AY619685_637090 Uncultured gamma proteobacterium eBACHOT4E07
           clone eBACHOT4E07, complete sequence.
          Length = 108

 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 26/77 (33%), Positives = 56/77 (72%)
 Frame = +2

Query: 350 ILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAV 529
           ++N++ PVLV+F+A WCGPC+ +  ++++ + ++  ++K   ++ D++ + A +Y I+++
Sbjct: 17  VINTEGPVLVDFWAEWCGPCKQLAPLVEDASEEFKDKIKVCKMDVDANRETAAEYGIRSI 76

Query: 530 PVVMLFKNGEKRGSVIG 580
           P +M+F+NGE  G+ IG
Sbjct: 77  PTLMIFENGELVGTEIG 93



>gb:CP000026_75175 Salmonella enterica subsp. enterica serovar
           Paratypi A str. ATCC 9150.>gb:AE008820_244315 Salmonella
           typhimurium LT2, section 124 of 220 of the complete
           genome.>gb:AE006468_1001397 Salmonella typhimurium LT2,
           complete genome.
          Length = 139

 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 27/85 (31%), Positives = 59/85 (69%)
 Frame = +2

Query: 305 DAKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNA 484
           D +    TG++ DK+ L  D+PV+++F+A WCGPCR    + +++A + SG+++   +N 
Sbjct: 34  DGEVINATGETLDKL-LKDDLPVVIDFWAPWCGPCRNFAPIFEDVAEERSGKVRFVKVNT 92

Query: 485 DSDVQIAEDYDIKAVPVVMLFKNGE 559
           +++ +++  + I+++P +M+FK+G+
Sbjct: 93  EAERELSARFGIRSIPTIMIFKHGQ 117



>pir|F97361|F97361 thioredoxin c-1 [imported] - Agrobacterium
           tumefaciens  (strain C58, Cereon)>gb:AE007945_231787
           Agrobacterium tumefaciens str. C58 circular chromosome,
           section 3 of 254 of the complete
           sequence.>gb:AE007869_1081456 Agrobacterium tumefaciens
           str. C58 circular chromosome, complete sequence.
          Length = 133

 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 29/92 (31%), Positives = 56/92 (60%)
 Frame = +2

Query: 305 DAKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNA 484
           D     V   ++   +L S  PV+V+F+A WCGPC+M+   ++EI+++ +G++K   LN 
Sbjct: 27  DMATVKVDAANFQSEVLESAEPVVVDFWAEWCGPCKMIAPSLEEISSELAGKVKVAKLNI 86

Query: 485 DSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           D + ++A  + ++++P + +FK GE     +G
Sbjct: 87  DENPELAAQFGVRSIPTLAIFKGGEVADIKVG 118



>sp|P52230|THIO_STRCO Thioredoxin (TRX).>pir|T36576|T36576
           thioredoxin - Streptomyces
           coelicolor>gb:SCO939118_177561 Streptomyces coelicolor
           A3(2) complete genome; segment
           15/29.>gb:SCTRXABGN_181631 Streptomyces coelicolor trxA
           and trxB gene cluster.
          Length = 110

 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 29/86 (33%), Positives = 55/86 (63%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  S+++ +L +D PVLV+F+A+WCGPCR +   ++ IA +Y  +++   LN D +   
Sbjct: 8   VTDDSFEQDVLKNDKPVLVDFWAAWCGPCRQIAPSLEAIAAEYGDKIEIVKLNIDENPGT 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
           A  Y + ++P + +++ GE   +++G
Sbjct: 68  AAKYGVMSIPTLNVYQGGEVAKTIVG 93



>gb:BX571658_777849 Wolinella succinogenes, complete genome; segment
           2/7.
          Length = 106

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 29/78 (37%), Positives = 51/78 (65%)
 Frame = +2

Query: 374 LVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKN 553
           LV+F+A WCGPCRMV  V++E+A D+ G+     +N D + ++A  Y I+++P ++ FK+
Sbjct: 22  LVDFWAPWCGPCRMVAPVIEELAADFEGKANVCKVNTDEEQELAVKYGIRSIPTILFFKD 81

Query: 554 GEKRGSVIGYHAQGVLRQ 607
           GE    +IG  ++   ++
Sbjct: 82  GEIVDQMIGASSKQAFKE 99



>gb:AY552545_627809 Uncultured marine gamma proteobacterium
           EBAC20E09 clone EBAC20E09, complete sequence.
          Length = 108

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 28/77 (36%), Positives = 52/77 (67%)
 Frame = +2

Query: 350 ILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAV 529
           ++NSD PVLV+F+A WCGPC+ +  +++  A ++   +    ++ D++ + A +Y I+++
Sbjct: 17  VINSDKPVLVDFWAEWCGPCKQLAPLVEAAAEEFKNDITVCKMDVDANRETAAEYGIRSI 76

Query: 530 PVVMLFKNGEKRGSVIG 580
           P +M+F NGE  G+ IG
Sbjct: 77  PTLMIFTNGESVGTEIG 93



>gb:CR628336_113120 Legionella pneumophila str. Paris complete
           genome.>gb:CR628337_116072 Legionella pneumophila str.
           Lens complete genome.>gb:AE017354_461267 Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1,
           complete genome.
          Length = 108

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 30/86 (34%), Positives = 54/86 (62%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT  S+++ ++NS  PVLV+F+A WCGPCR +  +++E+A  +S  +    +N D + Q 
Sbjct: 8   VTDASFEQDVINSSKPVLVDFWAEWCGPCRALTPILEEVAATHSKDMTFAKINIDENPQA 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
              + + ++P ++LFKNG+     +G
Sbjct: 68  PAKFGVMSIPTLILFKNGQVEAVKMG 93



>gb:AP008226_578938 Thermus thermophilus HB8 genomic DNA, complete
           genome.
          Length = 140

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 30/78 (38%), Positives = 51/78 (65%)
 Frame = +2

Query: 374 LVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKN 553
           LV+F+A WCGPCR+V  +++E+A D++GRLK   +N D    +A  Y +++VP ++LF+ 
Sbjct: 54  LVDFFAPWCGPCRLVSPILEELARDHAGRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRR 113

Query: 554 GEKRGSVIGYHAQGVLRQ 607
           G    + +G   + VL +
Sbjct: 114 GAPVATWVGASPRRVLEE 131



>pir|AG2579|AG2579 thioredoxin C-1 trxA [imported] - Agrobacterium
           tumefaciens  (strain C58, Dupont)>gb:AE008976_247080
           Agrobacterium tumefaciens str. C58 circular chromosome,
           section 2 of 256 of the complete
           sequence.>gb:AE008688_1084923 Agrobacterium tumefaciens
           str. C58 circular chromosome, complete sequence.
          Length = 106

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 28/86 (32%), Positives = 55/86 (63%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           V   ++   +L S  PV+V+F+A WCGPC+M+   ++EI+++ +G++K   LN D + ++
Sbjct: 6   VDAANFQSEVLESAEPVVVDFWAEWCGPCKMIAPSLEEISSELAGKVKVAKLNIDENPEL 65

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
           A  + ++++P + +FK GE     +G
Sbjct: 66  AAQFGVRSIPTLAIFKGGEVADIKVG 91



>gb:AJ749949_531433 Francisella tularensis subsp. tularensis
           complete genome.
          Length = 108

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 30/91 (32%), Positives = 60/91 (65%)
 Frame = +2

Query: 335 SWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDY 514
           ++DK+I N++  VLV+FYA WCGPC+ +  ++D+++ DY+ +     +N D +  +A  +
Sbjct: 13  NFDKLIDNTNKAVLVDFYADWCGPCKTLAPILDQLSKDYT-KAVIVKVNVDENQNLAARF 71

Query: 515 DIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
            I+++P +++FKN ++  +++G H    L Q
Sbjct: 72  AIRSIPTLIVFKNRKQLETLMGVHTASQLEQ 102



>gb:AE016935_361597 Bacteroides thetaiotaomicron VPI-5482, section
           10 of 21 of the complete genome.>gb:AE015928_988085
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 104

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 32/85 (37%), Positives = 53/85 (62%)
 Frame = +2

Query: 344 KMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIK 523
           K IL    PV+V+F+A WCGPC+MV  +++E+A ++ G++     + D +  +A +Y I+
Sbjct: 11  KEILAEGKPVVVDFWAPWCGPCKMVAPIIEELAAEFEGQVIIGKCDVDDNSDVAAEYGIR 70

Query: 524 AVPVVMLFKNGEKRGSVIGYHAQGV 598
            +P V+ FKNGE     +G  A+ V
Sbjct: 71  NIPTVLFFKNGEIVDKQVGAVAKPV 95



>pir|C81432|C81432 thioredoxin Cj0147c [imported] - Campylobacter
           jejuni  (strain NCTC 11168)>gb:CJ11168X1_846570
           Campylobacter jejuni subsp. jejuni NCTC 11168 complete
           genome; segment 1/6.
          Length = 104

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 27/69 (39%), Positives = 47/69 (68%)
 Frame = +2

Query: 374 LVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKN 553
           LV+F+A WCGPCRM+  V+DE++ D+ G+ K   +N D    +A ++ ++++P ++ FKN
Sbjct: 21  LVDFWAPWCGPCRMLAPVIDELSNDFDGKAKICKVNTDEQGDLAAEFGVRSIPTLIFFKN 80

Query: 554 GEKRGSVIG 580
           GE    ++G
Sbjct: 81  GEVVDQLVG 89



>pir|AG2042|AG2042 thioredoxin [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_682882 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 105

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 27/75 (36%), Positives = 50/75 (66%)
 Frame = +2

Query: 335 SWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDY 514
           S+++M+  SD+PVLV+FYA WCGPC+M+  ++ ++      R++   ++ +   ++A  Y
Sbjct: 9   SFEEMLSGSDLPVLVDFYADWCGPCQMMGTILQQVNNQLKDRIRIVKIDTEKYTELATQY 68

Query: 515 DIKAVPVVMLFKNGE 559
            I A+P ++LFK G+
Sbjct: 69  QIAALPTLVLFKQGK 83



>sp|Q8CPL5|THIO_STAEP Thioredoxin (TRX).>gb:CP000029_81339
           Staphylococcus epidermidis RP62A, complete
           genome.>gb:AE016746_322488 Staphylococcus epidermidis
           ATCC 12228, section 3 of 9 of the complete
           genome.>gb:AE015929_1147157 Staphylococcus epidermidis
           ATCC 12228, complete genome.
          Length = 104

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 27/70 (38%), Positives = 48/70 (68%)
 Frame = +2

Query: 374 LVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKN 553
           LV+F+A+WCGPC+M+  V++E+A DY G+     L+ D +   A  Y++ ++P +++FK+
Sbjct: 21  LVDFWATWCGPCKMIAPVLEELAGDYDGKADILKLDVDENPSTAAKYEVMSIPTLIVFKD 80

Query: 554 GEKRGSVIGY 583
           GE    V+G+
Sbjct: 81  GEPVDKVVGF 90



>gb:BX248361_763622 Corynebacterium diphtheriae gravis NCTC13129,
           complete genome; segment 8/8.
          Length = 107

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 28/91 (30%), Positives = 57/91 (62%)
 Frame = +2

Query: 308 AKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNAD 487
           + A  +T  ++  ++++SD PVLV+F+A WCGPC+ +  ++DEIA +    +    ++ D
Sbjct: 2   SNAIALTQDTFKSIVIDSDKPVLVDFWAQWCGPCKKLGPIIDEIAEELGDEVLVAKVDVD 61

Query: 488 SDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           ++  +   + I ++P V++FK+G+K    +G
Sbjct: 62  AERNLGAMFQIMSIPTVLIFKDGQKVSEFVG 92



>gb:AE015945_321575 Clostridium tetani E88, section 10 of 10 of the
           complete genome.>gb:AE015927_964364 Clostridium tetani
           E88, complete genome.
          Length = 105

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 28/85 (32%), Positives = 57/85 (67%)
 Frame = +2

Query: 350 ILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAV 529
           +LNSD   +V+F+A WCGPCRM+  V++E++ + S ++K   +N D +   A +Y + ++
Sbjct: 14  VLNSDKVTVVDFWAPWCGPCRMLGPVIEELSQEMSEQVKFVKVNVDENPMSATEYKVASI 73

Query: 530 PVVMLFKNGEKRGSVIGYHAQGVLR 604
           P V +FK+G+ + +++G+  +  ++
Sbjct: 74  PTVAVFKDGKIQETLVGFRPKQAMQ 98



>gb:AE012374_281850 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 282 of 460 of the complete
           genome.>gb:AE008922_915132 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 285

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 33/97 (34%), Positives = 59/97 (60%), Gaps = 2/97 (2%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDV--PVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDV 496
           VT  +++  +L   +  PVLV+F+A+WCGPC+ +  +++++A DY+G  +   ++ D + 
Sbjct: 10  VTTDTFETEVLQKSLTTPVLVDFWATWCGPCKSLTPILEKLAADYNGAFELAKVDVDKEQ 69

Query: 497 QIAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           QIA  + I++VP V L K GE      G   +G +R+
Sbjct: 70  QIAAAFQIRSVPTVFLVKGGELVDGFPGAMPEGQIRE 106



>pir|B96796|B96796 thioredoxin-like protein, 49720-48645 [imported]
           - Arabidopsis thaliana>gb:AE005173_895207 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010718_1537048 Arabidopsis thaliana
           chromosome 1 BAC F28O16 genomic sequence, complete
           sequence.
          Length = 151

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 37/121 (30%), Positives = 68/121 (56%), Gaps = 7/121 (5%)
 Frame = +2

Query: 218 SIGSSFLLNRNVRPRQSKSPFHLRVVCH-------RDAKAAVVTGKSWDKMILNSDVPVL 376
           S+ SS + + N +     S F  R +         R  +A   T  S++ +++NSD PVL
Sbjct: 5   SLSSSTVPSLNSKESSGVSAFASRSISAVKFQFPVRRIEAKKQTFDSFEDLLVNSDKPVL 64

Query: 377 VEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNG 556
           V++YA+WCGPC+ +  +++E++     +++   ++ +    IA  Y I+A+P  +LFK+G
Sbjct: 65  VDYYATWCGPCQFMVPILNEVSETLKDKIQVVKIDTEKYPSIANKYKIEALPTFILFKDG 124

Query: 557 E 559
           E
Sbjct: 125 E 125



>sp|Q9ZEH4|THIO_STAAM Thioredoxin (TRX).>pir|E89885|E89885
           thioredoxin [imported] - Staphylococcus aureus (strain
           N315)>gb:CP000046_91297 Staphylococcus aureus subsp.
           aureus COL, complete genome.>gb:SATRXA_171953
           Staphylococcus aureus trxA and uvrC genes and partial
           mutS2 and sdhC genes.>gb:BA000017_676837 Staphylococcus
           aureus subsp. aureus Mu50 DNA, complete
           genome.>gb:BA000018_679423 Staphylococcus aureus subsp.
           aureus N315 genomic DNA, complete
           genome.>gb:BA000033_711320 Staphylococcus aureus subsp.
           aureus MW2 DNA, complete genome,
           strain:MW2.>gb:BX571856_780565 Staphylococcus aureus
           subsp. aureus strain MRSA252, complete
           genome.>gb:BX571857_783298 Staphylococcus aureus strain
           MSSA476, complete genome.
          Length = 104

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 26/70 (37%), Positives = 48/70 (68%)
 Frame = +2

Query: 374 LVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKN 553
           LV+F+A+WCGPC+M+  V++E+A DY G+     L+ D +   A  Y++ ++P +++FK+
Sbjct: 21  LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKD 80

Query: 554 GEKRGSVIGY 583
           G+    V+G+
Sbjct: 81  GQPVDKVVGF 90



>gb:BT010677_1640623 Arabidopsis thaliana At1g76760 mRNA, complete
           cds.>gb:BT010965_1640911 Arabidopsis thaliana At1g76760
           mRNA, complete cds.
          Length = 172

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 30/86 (34%), Positives = 56/86 (65%)
 Frame = +2

Query: 302 RDAKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLN 481
           R  +A   T  S++ +++NSD PVLV++YA+WCGPC+ +  +++E++     +++   ++
Sbjct: 61  RRIEAKKQTFDSFEDLLVNSDKPVLVDYYATWCGPCQFMVPILNEVSETLKDKIQVVKID 120

Query: 482 ADSDVQIAEDYDIKAVPVVMLFKNGE 559
            +    IA  Y I+A+P  +LFK+GE
Sbjct: 121 TEKYPSIANKYKIEALPTFILFKDGE 146



>gb:BX927157_834634 Corynebacterium glutamicum ATCC 13032, IS
           fingerprint type 4-5, complete genome; segment 10/10.
          Length = 107

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 28/91 (30%), Positives = 56/91 (61%)
 Frame = +2

Query: 308 AKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNAD 487
           +    VT +++   +++SD PV+V+F+A WCGPC+ +  +++EIA +Y  +     ++ D
Sbjct: 2   SNVVAVTEQTFKSTVIDSDKPVIVDFWAEWCGPCKKLSPIIEEIAGEYGDKAVVASVDVD 61

Query: 488 SDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           ++  +   + I ++P V++FKNG K    +G
Sbjct: 62  AERTLGAMFQIMSIPSVLIFKNGAKVEEFVG 92



>gb:BA000036_720818 Corynebacterium glutamicum ATCC 13032 DNA,
           complete genome.>gb:AX763726_1474413 Sequence 33 from
           Patent WO03040180.
          Length = 124

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 28/91 (30%), Positives = 56/91 (61%)
 Frame = +2

Query: 308 AKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNAD 487
           +    VT +++   +++SD PV+V+F+A WCGPC+ +  +++EIA +Y  +     ++ D
Sbjct: 19  SNVVAVTEQTFKSTVIDSDKPVIVDFWAEWCGPCKKLSPIIEEIAGEYGDKAVVASVDVD 78

Query: 488 SDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           ++  +   + I ++P V++FKNG K    +G
Sbjct: 79  AERTLGAMFQIMSIPSVLIFKNGAKVEEFVG 109



>gb:BA000035_717711 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 107

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 28/86 (32%), Positives = 55/86 (63%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT +++   ++ SD PVLV+F+A WCGPC+ +  +++EIA +Y  ++    ++ D++  +
Sbjct: 7   VTEQTFKSTVVESDKPVLVDFWAEWCGPCKKLSPIIEEIAGEYGDKIVVASVDVDAERTL 66

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
              + I ++P V++FK G+K    +G
Sbjct: 67  GAMFQIMSIPSVLIFKGGQKVDEFVG 92



>gb:CORTC2_850604 Corynebacterium nephridii thioredoxin C-2 gene.
          Length = 123

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 27/85 (31%), Positives = 56/85 (65%)
 Frame = +2

Query: 326 TGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIA 505
           T +++   +L+++ PVLV+F+A WC PC+ +  V++E++ +Y+G++K   ++  S    A
Sbjct: 24  TDENFQADVLDAETPVLVDFWAGWCAPCKAIAPVLEELSNEYAGKVKIVKVDVTSCEDTA 83

Query: 506 EDYDIKAVPVVMLFKNGEKRGSVIG 580
             Y+I+ +P +++FK+GE     +G
Sbjct: 84  VKYNIRNIPALLMFKDGEVVAQQVG 108



>gb:BAP426489_747034 Buchnera aphidicola (Pemphigus spyrothecae) rep
           gene (partial), leuA gene, leuB gene, leuC gene, leuD
           gene, trxA gene and rho gene (partial).
          Length = 110

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 32/92 (34%), Positives = 55/92 (59%)
 Frame = +2

Query: 305 DAKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNA 484
           + K   V  ++++K IL     +LV+F+A WC PC+++  +++EIA +Y  +L    +N 
Sbjct: 3   NTKIINVNEENFEKNILQEKNFILVDFWAEWCNPCKILAPILEEIANEYQDKLIVAKINI 62

Query: 485 DSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           D +  IA  Y I+ +P ++LFKNG    + IG
Sbjct: 63  DENPNIAPKYSIRGIPALLLFKNGTLLKTKIG 94



>gb:AY552334_627679 Rhizobium etli nucelotidyl transferase, AddB
           (addB), AddA (addA), TrxA (trxA), FolC (folC), AccD
           (accD), TrpA (trpA), and TrpB (trpB) genes, complete
           cds.
          Length = 106

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 27/77 (35%), Positives = 50/77 (64%)
 Frame = +2

Query: 350 ILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAV 529
           +L S  PV+V+F+A WCGPC+M+   ++EI+ +  G++K   LN D + ++A  + ++++
Sbjct: 15  VLESAEPVVVDFWAEWCGPCKMIAPSLEEISVEMEGKVKVAKLNIDENPELAAQFGVRSI 74

Query: 530 PVVMLFKNGEKRGSVIG 580
           P + +FK GE     +G
Sbjct: 75  PTLAIFKGGEVADISVG 91



>gb:AE017305_437019 Thermus thermophilus HB27 section 5 of 7 of the
           complete genome.>gb:AP008226_579204 Thermus thermophilus
           HB8 genomic DNA, complete genome.>gb:AE017221_1078997
           Thermus thermophilus HB27 complete genome.
          Length = 110

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 34/91 (37%), Positives = 57/91 (62%)
 Frame = +2

Query: 308 AKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNAD 487
           AK   VT +++D+  L     VLV+F+A WC PCRM+  +++EIA +Y G+L    L+ D
Sbjct: 2   AKPIEVTDQNFDET-LGQHPLVLVDFWAEWCAPCRMIAPILEEIAKEYEGKLLVAKLDVD 60

Query: 488 SDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
            + + A  Y + ++P V+LFK+G+    ++G
Sbjct: 61  ENPKTAMRYRVMSIPTVILFKDGQPVEVLVG 91



>gb:AE017304_436751 Thermus thermophilus HB27 section 4 of 7 of the
           complete genome.>gb:AE017221_1078729 Thermus
           thermophilus HB27 complete genome.
          Length = 140

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 29/78 (37%), Positives = 51/78 (65%)
 Frame = +2

Query: 374 LVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKN 553
           LV+F+A WCGPCR+V  +++E+A +++GRLK   +N D    +A  Y +++VP ++LF+ 
Sbjct: 54  LVDFFAPWCGPCRLVSPILEELAREHAGRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRR 113

Query: 554 GEKRGSVIGYHAQGVLRQ 607
           G    + +G   + VL +
Sbjct: 114 GAPVATWVGASPKRVLEE 131



>pir|A28215|A28215 thioredoxin - Rhodospirillum rubrum
          Length = 104

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 29/86 (33%), Positives = 52/86 (60%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           V+  S+++ +L +D PV V+F+A WCGPCR     ++E+AT    ++    +N D + Q 
Sbjct: 4   VSDASFEEDVLKADGPVXVDFWAEWCGPCRQXAPALEELATALGDKVTVAKINIDENPQT 63

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
              Y ++ +P +M+FK+G+   + IG
Sbjct: 64  PSKYGVRGIPTLMIFKDGQVAATKIG 89



>pir|S02802|S02802 thioredoxin C-2 - coryneform
           bacterium>gb:CNTHIOREX_850548 C.nephridii gene for
           thioredoxin C-2 (EC 1.6.4.5).
          Length = 108

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 27/85 (31%), Positives = 56/85 (65%)
 Frame = +2

Query: 326 TGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIA 505
           T +++   +L+++ PVLV+F+A WC PC+ +  V++E++ +Y+G++K   ++  S    A
Sbjct: 9   TDENFQADVLDAETPVLVDFWAGWCAPCKAIAPVLEELSNEYAGKVKIVKVDVTSCEDTA 68

Query: 506 EDYDIKAVPVVMLFKNGEKRGSVIG 580
             Y+I+ +P +++FK+GE     +G
Sbjct: 69  VKYNIRNIPALLMFKDGEVVAQQVG 93



>sp|P07887|THI2_CORNE Thioredoxin C-2.
          Length = 107

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 27/85 (31%), Positives = 56/85 (65%)
 Frame = +2

Query: 326 TGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIA 505
           T +++   +L+++ PVLV+F+A WC PC+ +  V++E++ +Y+G++K   ++  S    A
Sbjct: 8   TDENFQADVLDAETPVLVDFWAGWCAPCKAIAPVLEELSNEYAGKVKIVKVDVTSCEDTA 67

Query: 506 EDYDIKAVPVVMLFKNGEKRGSVIG 580
             Y+I+ +P +++FK+GE     +G
Sbjct: 68  VKYNIRNIPALLMFKDGEVVAQQVG 92



>gb:AY184799_1587993 Chlamydomonas reinhardtii thioredoxin x (TRXx)
           mRNA, complete cds; nuclear gene for chloroplast
           product.
          Length = 145

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 40/118 (33%), Positives = 67/118 (56%), Gaps = 9/118 (7%)
 Frame = +2

Query: 236 LLNRNVRPRQSKSPFH-LRVVCHRDAKAAVVTG------KSWDKMILNSDV--PVLVEFY 388
           L  R   P   ++ F  +R VC R A+A+ VT        S+D  +L +    PVLV+F+
Sbjct: 3   LSTRTAVPCSGRTAFGAVRPVC-RPARASTVTRVANVTEASFDDEVLKASAGQPVLVDFW 61

Query: 389 ASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEK 562
           ASWCGPC++V  +MD    +Y G+LK   +  D++ ++   Y +  +P +++FK G++
Sbjct: 62  ASWCGPCKLVAPLMDWAEKEYGGKLKVVKIEHDANPKLIAQYKVYGLPTLIVFKEGQE 119



>gb:AX951400_1484096 Sequence 57 from Patent
           EP1367064.>gb:AX959976_1484360 Sequence 57 from Patent
           WO03099778.
          Length = 135

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 38/121 (31%), Positives = 62/121 (51%), Gaps = 26/121 (21%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWC-------------------------GPCRMVHRV 427
           +T  S+D  +L +D  +LV+F+A WC                         GPC+M+  +
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCICGYNLATLVMLGPSERVFCPLCEPGPCKMIAPI 67

Query: 428 MDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSV-IGYHAQGVLR 604
           +DEIA +Y G+L    LN D +   A  Y I+ +P ++LFKNGE   +  +G  ++G L+
Sbjct: 68  LDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVASATKVGALSKGQLK 127

Query: 605 Q 607
           +
Sbjct: 128 E 128



>gb:AX951386_1484089 Sequence 43 from Patent
           EP1367064.>gb:AX959962_1484353 Sequence 43 from Patent
           WO03099778.
          Length = 135

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 38/121 (31%), Positives = 62/121 (51%), Gaps = 26/121 (21%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGP-------------------------CRMVHRV 427
           +T  S+D  +L +D  +LV+F+A WCGP                         C+M+  +
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCGPICGYNLATLVMLGPSERVFCPLCEPCKMIAPI 67

Query: 428 MDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSV-IGYHAQGVLR 604
           +DEIA +Y G+L    LN D +   A  Y I+ +P ++LFKNGE   +  +G  ++G L+
Sbjct: 68  LDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVASATKVGALSKGQLK 127

Query: 605 Q 607
           +
Sbjct: 128 E 128



>gb:AP006841_571237 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 104

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 29/79 (36%), Positives = 49/79 (62%)
 Frame = +2

Query: 344 KMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIK 523
           K IL    PV+++F+A WCGPC+MV  ++DE+A +Y G++     + D +  +  ++ I+
Sbjct: 11  KEILAEGSPVVIDFWAPWCGPCKMVGPIIDELAKEYEGKVIMGKCDVDENSDLPAEFGIR 70

Query: 524 AVPVVMLFKNGEKRGSVIG 580
            +P V+ FKNGE     +G
Sbjct: 71  NIPTVLFFKNGELVDKQVG 89



>gb:AE008921_246387 Uncultured proteobacterium clone EBAC000-60D04
           complete sequence.
          Length = 106

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 27/93 (29%), Positives = 57/93 (61%)
 Frame = +2

Query: 326 TGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIA 505
           T  ++D ++ +SD+PV+V+F+A WCGPC+ +   ++E++ +  G++K   ++ DS+   A
Sbjct: 7   TDATFDSIVKDSDLPVVVDFWAEWCGPCKQIGPSLEELSVEMEGKIKVVKVDVDSNPSAA 66

Query: 506 EDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLR 604
               ++ +P + LFK+G+   +  G   +  L+
Sbjct: 67  AALGVRGIPALFLFKDGQVISNKTGAAPKAALK 99



>pir|B55124|B55124 thioredoxin - Chlorobium limicola f.sp.
           thiosulfatophilum
          Length = 108

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 31/85 (36%), Positives = 51/85 (60%)
 Frame = +2

Query: 326 TGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIA 505
           T K++   IL+SD  V V+F+ASWCGPC M   V++++A DY G+      N D +  IA
Sbjct: 8   TDKNFQTEILDSDKAVXVDFWASWCGPCMMXGPVIEQLADDYEGKAIIAKXNVDENPNIA 67

Query: 506 EDYDIKAVPVVMLFKNGEKRGSVIG 580
             Y  +++P +++ K G+    ++G
Sbjct: 68  GQYGXRSIPTMLIXKGGKVVDQMVG 92



>gb:CR382139_1672186 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 103

 Score = 69.7 bits (169), Expect = 6e-11
 Identities = 34/97 (35%), Positives = 61/97 (62%)
 Frame = +2

Query: 317 AVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDV 496
           A +T K      L+ D  V+V+F+A+WCGPC+M+  ++D+ + +Y+ + K   ++ D   
Sbjct: 3   AAITSKQEFTDALSHDGLVVVDFFATWCGPCKMIAPLLDKFSAEYN-QAKFIKVDVDEFG 61

Query: 497 QIAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           +IA++Y++ ++P V+ FK GE    VIG +  G L+Q
Sbjct: 62  EIAQEYEVSSMPTVIFFKGGEVVNKVIGAN-PGALKQ 97



>gb:AX951398_1484095 Sequence 55 from Patent
           EP1367064.>gb:AX959974_1484359 Sequence 55 from Patent
           WO03099778.
          Length = 136

 Score = 69.7 bits (169), Expect = 6e-11
 Identities = 38/122 (31%), Positives = 62/122 (50%), Gaps = 27/122 (22%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWC--------------------------GPCRMVHR 424
           +T  S+D  +L +D  +LV+F+A WC                          GPC+M+  
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCICGYNLATLVMLGPSERVFCPLCEPCGPCKMIAP 67

Query: 425 VMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSV-IGYHAQGVL 601
           ++DEIA +Y G+L    LN D +   A  Y I+ +P ++LFKNGE   +  +G  ++G L
Sbjct: 68  ILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVASATKVGALSKGQL 127

Query: 602 RQ 607
           ++
Sbjct: 128 KE 129



>gb:AX951384_1484088 Sequence 41 from Patent
           EP1367064.>gb:AX959960_1484352 Sequence 41 from Patent
           WO03099778.
          Length = 136

 Score = 69.7 bits (169), Expect = 6e-11
 Identities = 38/122 (31%), Positives = 62/122 (50%), Gaps = 27/122 (22%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGP--------------------------CRMVHR 424
           +T  S+D  +L +D  +LV+F+A WCGP                          C+M+  
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCGPICGYNLATLVMLGPSERVFCPLCEPCCKMIAP 67

Query: 425 VMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSV-IGYHAQGVL 601
           ++DEIA +Y G+L    LN D +   A  Y I+ +P ++LFKNGE   +  +G  ++G L
Sbjct: 68  ILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVASATKVGALSKGQL 127

Query: 602 RQ 607
           ++
Sbjct: 128 KE 129



>gb:AX461034_1469006 Sequence 24 from Patent WO0222823.
          Length = 111

 Score = 69.7 bits (169), Expect = 6e-11
 Identities = 29/92 (31%), Positives = 56/92 (60%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           +T  S  +  ++SD  V+V+FYA+WCGPC+M+  ++++ AT +      + ++ D+  ++
Sbjct: 9   ITXXSXPESAVSSDKLVVVDFYATWCGPCKMIAPMIEKFATQFQ-EASFYKVDVDAAAEV 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGV 598
           A  Y I ++P ++ FKNG+    V+G   Q +
Sbjct: 68  AHKYQITSMPTILXFKNGQAVDXVVGADVQSI 99



>gb:AE013599_1132872 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003794_1224818 Drosophila melanogaster
           chromosome 2R, section 56 of 74 of the complete
           sequence.>gb:AY070811_1294896 Drosophila melanogaster
           AT22380 full insert cDNA.
          Length = 145

 Score = 69.7 bits (169), Expect = 6e-11
 Identities = 29/96 (30%), Positives = 60/96 (62%)
 Frame = +2

Query: 320 VVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQ 499
           V T K +++ ++NSD PV+V+F+ASWC PC+ +   ++ + ++  GR++   ++ D   +
Sbjct: 34  VETRKDFEQRVINSDRPVVVDFHASWCCPCKALAPRLENVVSEQEGRVRLARVDIDEHGE 93

Query: 500 IAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           +A DY++ +VP +++  NG+    ++G      LR+
Sbjct: 94  LALDYNVGSVPSLVVISNGKVVNRMVGLQTSEYLRK 129



>gb:BX572594_799989 Rhodopseudomonas palustris CGA009 complete
           genome; segment 2/16.
          Length = 145

 Score = 69.7 bits (169), Expect = 6e-11
 Identities = 31/88 (35%), Positives = 52/88 (59%)
 Frame = +2

Query: 317 AVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDV 496
           A V+ + +DK +  S VPVLV+ +A WCGPCR +    ++ A +    ++   LN+D++ 
Sbjct: 41  ADVSAELFDKQVSRSSVPVLVDVWAPWCGPCRAMAPAYEQAARELEPNVRLIKLNSDNEQ 100

Query: 497 QIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           Q+A    I+ +P ++LF NG +R    G
Sbjct: 101 QVAGRLGIQGIPTMILFDNGRERARTSG 128



>sp|P80579|THIO_ALIAC Thioredoxin (TRX).
          Length = 105

 Score = 69.7 bits (169), Expect = 6e-11
 Identities = 29/77 (37%), Positives = 48/77 (62%)
 Frame = +2

Query: 353 LNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVP 532
           +  D PVLV+F+A+WCGPCRM+  V++E A  ++ ++    LN D + +    + I ++P
Sbjct: 14  IQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIP 73

Query: 533 VVMLFKNGEKRGSVIGY 583
            ++LFK G     +IGY
Sbjct: 74  TLILFKGGRPVKQLIGY 90



>gb:AX951372_1484082 Sequence 29 from Patent
           EP1367064.>gb:AX959948_1484346 Sequence 29 from Patent
           WO03099778.
          Length = 137

 Score = 69.3 bits (168), Expect = 8e-11
 Identities = 38/123 (30%), Positives = 62/123 (50%), Gaps = 28/123 (22%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGP---------------------------CRMVH 421
           +T  S+D  +L +D  +LV+F+A WCGP                           C+M+ 
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCGPICGYNLATLVMLGPSERVFCPLCEPGPCKMIA 67

Query: 422 RVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSV-IGYHAQGV 598
            ++DEIA +Y G+L    LN D +   A  Y I+ +P ++LFKNGE   +  +G  ++G 
Sbjct: 68  PILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVASATKVGALSKGQ 127

Query: 599 LRQ 607
           L++
Sbjct: 128 LKE 130



>gb:AE017144_389808 Helicobacter hepaticus ATCC 51449 section 1 of 6
           of the complete genome.>gb:AE017125_1024070 Helicobacter
           hepaticus ATCC 51449 complete genome.
          Length = 105

 Score = 69.3 bits (168), Expect = 8e-11
 Identities = 32/100 (32%), Positives = 59/100 (59%)
 Frame = +2

Query: 308 AKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNAD 487
           AK   +T  ++D   L+     LV+F+A WC PC+M+  V+D++A +Y G+ K   +N D
Sbjct: 2   AKYKELTNDNFDTEALSG--VALVDFWAPWCNPCKMLSPVIDKLADEYEGKAKICKVNVD 59

Query: 488 SDVQIAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
              ++++ + I+ +P ++  K+GE +  V G   + V+RQ
Sbjct: 60  EQGELSKRFGIRNIPTILFMKDGEIKDQVTGAMPEQVIRQ 99



>gb:AX951396_1484094 Sequence 53 from Patent
           EP1367064.>gb:AX959972_1484358 Sequence 53 from Patent
           WO03099778.
          Length = 138

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 38/124 (30%), Positives = 62/124 (50%), Gaps = 29/124 (23%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWC----------------------------GPCRMV 418
           +T  S+D  +L +D  +LV+F+A WC                            GPC+M+
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCICGYNLATLVMLGPSERVFCPLCEPCSSGPCKMI 67

Query: 419 HRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSV-IGYHAQG 595
             ++DEIA +Y G+L    LN D +   A  Y I+ +P ++LFKNGE   +  +G  ++G
Sbjct: 68  APILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVASATKVGALSKG 127

Query: 596 VLRQ 607
            L++
Sbjct: 128 QLKE 131



>gb:AX951382_1484087 Sequence 39 from Patent
           EP1367064.>gb:AX959958_1484351 Sequence 39 from Patent
           WO03099778.
          Length = 138

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 38/124 (30%), Positives = 62/124 (50%), Gaps = 29/124 (23%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGP----------------------------CRMV 418
           +T  S+D  +L +D  +LV+F+A WCGP                            C+M+
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCGPICGYNLATLVMLGPSERVFCPLCEPCSSCKMI 67

Query: 419 HRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSV-IGYHAQG 595
             ++DEIA +Y G+L    LN D +   A  Y I+ +P ++LFKNGE   +  +G  ++G
Sbjct: 68  APILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVASATKVGALSKG 127

Query: 596 VLRQ 607
            L++
Sbjct: 128 QLKE 131



>gb:AX951370_1484081 Sequence 27 from Patent
           EP1367064.>gb:AX959946_1484345 Sequence 27 from Patent
           WO03099778.
          Length = 138

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 38/124 (30%), Positives = 62/124 (50%), Gaps = 29/124 (23%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGP----------------------------CRMV 418
           +T  S+D  +L +D  +LV+F+A WCGP                            C+M+
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCGPICGYNLATLVMLGPSERVFCPLCEPCGPCKMI 67

Query: 419 HRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSV-IGYHAQG 595
             ++DEIA +Y G+L    LN D +   A  Y I+ +P ++LFKNGE   +  +G  ++G
Sbjct: 68  APILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVASATKVGALSKG 127

Query: 596 VLRQ 607
            L++
Sbjct: 128 QLKE 131



>sp|Q95108|THI2_BOVIN Thioredoxin, mitochondrial precursor
           (MT-TRX).>gb:D87741_1439238 Bovine mRNA for
           mitochondrial thioredoxin, complete cds.
          Length = 166

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 31/110 (28%), Positives = 60/110 (54%)
 Frame = +2

Query: 251 VRPRQSKSPFHLRVVCHRDAKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVM 430
           V P Q++S +  RV         +  G  +   ++NS+ PV+V+F+A WCGPC+++   +
Sbjct: 44  VTPSQARSIYTTRVC---STTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRL 100

Query: 431 DEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           +++     G++    ++ D    +A +Y++ AVP V+  KNG+     +G
Sbjct: 101 EKVVAKQHGKVVMAKVDIDDHTDLALEYEVSAVPTVLAMKNGDVVDKFVG 150



>gb:BA000043_739262 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 105

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 28/78 (35%), Positives = 48/78 (61%)
 Frame = +2

Query: 374 LVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKN 553
           LV+F+A WCGPCRM+  V++E+  +   ++K   +N D + + A  + + ++P +++FKN
Sbjct: 21  LVDFWAPWCGPCRMIAPVLEELDREMGDKVKIVKVNVDENQETASKFGVMSIPTLLVFKN 80

Query: 554 GEKRGSVIGYHAQGVLRQ 607
           GE     IGY  +  L Q
Sbjct: 81  GELVDKAIGYQPKEALVQ 98



>gb:BA000016_673779 Clostridium perfringens str. 13 DNA, complete
           genome.
          Length = 105

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 30/91 (32%), Positives = 60/91 (65%), Gaps = 1/91 (1%)
 Frame = +2

Query: 338 WDKMILNSD-VPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDY 514
           ++K ++N + V V+V+F+A+WCGPC+M+  V+DE+  D    +K   ++ D +   A +Y
Sbjct: 10  FEKEVINEEGVVVVVDFFATWCGPCKMLAPVLDEV-QDEMKNVKIVKIDIDENSDKASEY 68

Query: 515 DIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
            +K +P + +FKNGE+  + +G+  + +L++
Sbjct: 69  GVKNIPTIKIFKNGEEITTNVGFVPKNLLKE 99



>gb:AP006841_573199 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 161

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 24/69 (34%), Positives = 47/69 (68%)
 Frame = +2

Query: 332 KSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAED 511
           K W  +    D P +V+FYA WCGPC+MV  +++E++ +Y+G++  + +N D + ++A D
Sbjct: 64  KEWKYL---GDKPAIVDFYADWCGPCKMVAPILEELSKEYAGKIYIYKVNVDKEPELARD 120

Query: 512 YDIKAVPVV 538
           + I+++P +
Sbjct: 121 FGIQSIPTI 129



>gb:AE016926_359587 Bacteroides thetaiotaomicron VPI-5482, section 1
           of 21 of the complete genome.>gb:AE015928_986075
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 99

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 31/90 (34%), Positives = 52/90 (57%), Gaps = 4/90 (4%)
 Frame = +2

Query: 350 ILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAV 529
           ++ S +PVLV+F+A WCGPC+ +  V++E+ T    + +   ++ D    +A  Y I+AV
Sbjct: 7   LIQSPIPVLVDFFAEWCGPCKAMKPVLEELKTMVGDKARIVKIDVDQHEDLATKYRIQAV 66

Query: 530 PVVMLFKNGE----KRGSVIGYHAQGVLRQ 607
           P  +LFKNGE      G +     +G++ Q
Sbjct: 67  PTFILFKNGEAVWRHSGVIHSSELKGIIEQ 96



>sp|P56430|THIO_HELPY Thioredoxin (TRX).>pir|H64622|H64622
           thioredoxin - Helicobacter pylori>gb:AE000594_24992
           Helicobacter pylori 26695 section 72 of 134 of the
           complete genome.>gb:AE001507_35754 Helicobacter pylori,
           strain J99 section 68 of 132 of the complete
           genome.>gb:AE000511_880431 Helicobacter pylori 26695
           complete genome.>gb:AE001439_884524 Helicobacter pylori,
           strain J99 complete genome.
          Length = 106

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 26/78 (33%), Positives = 51/78 (65%)
 Frame = +2

Query: 374 LVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKN 553
           LV+F+A WCGPC+M+  V+DE+A++Y G+ K   +N D   +++  + I+++P ++  K+
Sbjct: 22  LVDFWAPWCGPCKMLSPVIDELASEYEGKAKICKVNTDEQEELSAKFGIRSIPTLLFTKD 81

Query: 554 GEKRGSVIGYHAQGVLRQ 607
           GE    ++G   +  L++
Sbjct: 82  GEVVHQLVGVQTKVALKE 99



>sp|P59527|THIO_BUCBP Thioredoxin (TRX).>gb:AE014017_302922 Buchnera
           aphidicola str. Bp (Baizongia pistaciae), section 2 of 2
           of the complete genome.>gb:AE016826_981523 Buchnera
           aphidicola str. Bp (Baizongia pistaciae), complete
           genome.
          Length = 109

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 30/86 (34%), Positives = 52/86 (60%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           +T   + + IL S   VLV+F+A WC PC+++  ++++IA +Y  +L    +N D +   
Sbjct: 8   LTDGIFKQYILESKKAVLVDFWAEWCNPCKILAPILEDIAKEYEHKLIVTKINIDKNPNT 67

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
           A  Y I+ +P ++LFKN E  G+ +G
Sbjct: 68  APKYSIRGIPALLLFKNSELVGTKVG 93



>sp|Q8KEA4|THI1_CHLTE Thioredoxin 1 (Trx-1).>gb:AE012847_286264
           Chlorobium tepidum TLS section 68 of 194 of the complete
           genome.>gb:AE006470_933432 Chlorobium tepidum TLS
           complete genome.
          Length = 101

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 29/89 (32%), Positives = 51/89 (57%)
 Frame = +2

Query: 341 DKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDI 520
           D +I  S++PV ++F+A WCGPC+MV   + ++A+++ GRL    +N D     A  + +
Sbjct: 6   DDLIRTSELPVFIDFWADWCGPCKMVAPSVKQLASEFKGRLIVVKVNVDQQPDAAARFQV 65

Query: 521 KAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           + +P +MLF  G+ +    G      +RQ
Sbjct: 66  QGIPALMLFVGGQLKWRTAGAIPYQQMRQ 94



>gb:AP003263_1826662 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0483G10.
          Length = 123

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 27/78 (34%), Positives = 51/78 (65%)
 Frame = +2

Query: 326 TGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIA 505
           T  S+D+++  S+ PVLV+FYA+WCGPC+ +  ++ E++     +++   ++ +    IA
Sbjct: 20  TFSSFDELLEKSEKPVLVDFYATWCGPCQYMVPILQEVSEKLGDKIQVVKIDTEKYTSIA 79

Query: 506 EDYDIKAVPVVMLFKNGE 559
             Y I+A+P  ++FKNG+
Sbjct: 80  NRYQIEALPTFIIFKNGK 97



>gb:AY128276_1580578 Arabidopsis thaliana At1g43560/T10P12_4 mRNA,
           complete cds.>gb:BT014871_1641861 Arabidopsis thaliana
           At1g43560 gene, complete cds.
          Length = 167

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 28/78 (35%), Positives = 51/78 (65%)
 Frame = +2

Query: 326 TGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIA 505
           T  S+D ++ NSD PVLV+FYA+WCGPC+++  +++E++      +    ++ +    +A
Sbjct: 64  TFNSFDDLLQNSDKPVLVDFYATWCGPCQLMVPILNEVSETLKDIIAVVKIDTEKYPSLA 123

Query: 506 EDYDIKAVPVVMLFKNGE 559
             Y I+A+P  +LFK+G+
Sbjct: 124 NKYQIEALPTFILFKDGK 141



>gb:AX951394_1484093 Sequence 51 from Patent
           EP1367064.>gb:AX959970_1484357 Sequence 51 from Patent
           WO03099778.
          Length = 140

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 38/126 (30%), Positives = 62/126 (49%), Gaps = 31/126 (24%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWC------------------------------GPCR 412
           +T  S+D  +L +D  +LV+F+A WC                              GPC+
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCICGYNLATLVMLGPSERVFCPLCEPCSSDIGPCK 67

Query: 413 MVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSV-IGYHA 589
           M+  ++DEIA +Y G+L    LN D +   A  Y I+ +P ++LFKNGE   +  +G  +
Sbjct: 68  MIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVASATKVGALS 127

Query: 590 QGVLRQ 607
           +G L++
Sbjct: 128 KGQLKE 133



>gb:AX951380_1484086 Sequence 37 from Patent
           EP1367064.>gb:AX959956_1484350 Sequence 37 from Patent
           WO03099778.
          Length = 140

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 38/126 (30%), Positives = 62/126 (49%), Gaps = 31/126 (24%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGP------------------------------CR 412
           +T  S+D  +L +D  +LV+F+A WCGP                              C+
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCGPICGYNLATLVMLGPSERVFCPLCEPCSSDICK 67

Query: 413 MVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSV-IGYHA 589
           M+  ++DEIA +Y G+L    LN D +   A  Y I+ +P ++LFKNGE   +  +G  +
Sbjct: 68  MIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVASATKVGALS 127

Query: 590 QGVLRQ 607
           +G L++
Sbjct: 128 KGQLKE 133



>gb:AX951368_1484080 Sequence 25 from Patent
           EP1367064.>gb:AX959944_1484344 Sequence 25 from Patent
           WO03099778.
          Length = 140

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 38/126 (30%), Positives = 62/126 (49%), Gaps = 31/126 (24%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGP------------------------------CR 412
           +T  S+D  +L +D  +LV+F+A WCGP                              C+
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCGPICGYNLATLVMLGPSERVFCPLCEPCSSGPCK 67

Query: 413 MVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSV-IGYHA 589
           M+  ++DEIA +Y G+L    LN D +   A  Y I+ +P ++LFKNGE   +  +G  +
Sbjct: 68  MIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVASATKVGALS 127

Query: 590 QGVLRQ 607
           +G L++
Sbjct: 128 KGQLKE 133



>gb:BA000030_700694 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 104

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 30/86 (34%), Positives = 51/86 (59%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           VT   ++  ++ +D+PVLVEF A WC PCR +  V+  +A +   RLK   L+ D++ + 
Sbjct: 4   VTDADFEAEVIGADLPVLVEFTADWCPPCRQMGPVLSSLAFEEGDRLKVVQLDVDTNPET 63

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
              Y + ++P  M+F+ GE   S++G
Sbjct: 64  TNAYKVLSMPTFMVFRGGEPVKSMVG 89



>gb:CR522870_99655 Desulfotalea psychrophila LSv54 chromosome.
          Length = 108

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 26/77 (33%), Positives = 49/77 (63%)
 Frame = +2

Query: 350 ILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAV 529
           +++S  P LV+F+A WCGPC+ +  V++++A ++ G++    +N D +      Y I+A+
Sbjct: 17  LISSGQPTLVDFWAPWCGPCKAIGPVIEDLANEFDGKVTIAKMNVDDNPNTPGKYGIRAI 76

Query: 530 PVVMLFKNGEKRGSVIG 580
           P ++LFK+GE    + G
Sbjct: 77  PTIILFKDGEAIDQLTG 93



>pir|A96499|A96499 hypothetical protein T10P12.4 [imported] -
           Arabidopsis thaliana>gb:AE005173_892549 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC007203_1535552 Arabidopsis thaliana
           chromosome I BAC T10P12 genomic sequence, complete
           sequence.
          Length = 242

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 28/78 (35%), Positives = 51/78 (65%)
 Frame = +2

Query: 326 TGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIA 505
           T  S+D ++ NSD PVLV+FYA+WCGPC+++  +++E++      +    ++ +    +A
Sbjct: 139 TFNSFDDLLQNSDKPVLVDFYATWCGPCQLMVPILNEVSETLKDIIAVVKIDTEKYPSLA 198

Query: 506 EDYDIKAVPVVMLFKNGE 559
             Y I+A+P  +LFK+G+
Sbjct: 199 NKYQIEALPTFILFKDGK 216



>pir|T48127|T48127 hypothetical protein T4C9.10 - Arabidopsis
           thaliana>gb:ATCHRIV33_1544982 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 33.>gb:ATT4C9_1555984
           Arabidopsis thaliana DNA chromosome 4, BAC clone T4C9
           (ESSA project).>gb:AY133708_1581528 Arabidopsis thaliana
           clone C103136 unknown protein (At4g12170) mRNA, complete
           cds.
          Length = 128

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 28/96 (29%), Positives = 57/96 (59%)
 Frame = +2

Query: 305 DAKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNA 484
           D     ++   W+ +++ S VPV+V F A  C  C  +   ++ + ++Y   LK + ++ 
Sbjct: 23  DGLVQSLSASEWNSLVIQSKVPVIVVFIAKDCAECGSLMPELEFLDSEYEYMLKFYTVDT 82

Query: 485 DSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQ 592
           D ++++A+DY I+  P+ ++FK GE++  V+GY+ Q
Sbjct: 83  DEELELAKDYRIEYHPITIVFKGGEEKERVLGYYPQ 118



>sp|Q17424|THI2_CAEEL Probable thioredoxin
           B0024.9.>pir|T18644|T18644 hypothetical protein B0024.9
           - Caenorhabditis elegans>gb:CEB0024_1359670
           Caenorhabditis elegans cosmid B0024, complete sequence.
          Length = 119

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 33/93 (35%), Positives = 52/93 (55%)
 Frame = +2

Query: 284 LRVVCHRDAKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRL 463
           LR   H  +   + + + + + ++ S VPV+V+F+A WCGPC+ +   ++E      G +
Sbjct: 4   LRHFSHGASVFDIDSVEDFTEKVIQSSVPVIVDFHAEWCGPCQALGPRLEEKVNGRQGSV 63

Query: 464 KCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEK 562
               +N D   ++A DY I AVP V  FKNGEK
Sbjct: 64  LLAKINVDHAGELAMDYGISAVPTVFAFKNGEK 96



>sp|P10473|THIO_RHORU Thioredoxin (TRX).
          Length = 104

 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 28/86 (32%), Positives = 51/86 (59%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           V+  S+++ +L +D P  V+F+A WCGPCR     ++E+AT    ++    +N D + Q 
Sbjct: 4   VSDASFEEDVLKADGPNXVDFWAEWCGPCRQXAPALEELATALGDKVTVAKINIDENPQT 63

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIG 580
              Y ++ +P +M+FK+G+   + IG
Sbjct: 64  PSKYGVRGIPTLMIFKDGQVAATKIG 89



>gb:AE016816_1746561 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome III, complete sequence.
          Length = 103

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 27/82 (32%), Positives = 51/82 (62%)
 Frame = +2

Query: 353 LNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVP 532
           + SD  V+V+FYA+WCGPC+M+  ++++ AT +      + ++ D+  ++A  Y I ++P
Sbjct: 15  VGSDKLVVVDFYATWCGPCKMIAPMIEKFATQFQ-EASFYKVDVDAAAEVAHKYQITSMP 73

Query: 533 VVMLFKNGEKRGSVIGYHAQGV 598
            ++ FKNG+    V+G   Q +
Sbjct: 74  TILFFKNGQAVDKVVGADVQSI 95



>gb:AX951392_1484092 Sequence 49 from Patent
           EP1367064.>gb:AX959968_1484356 Sequence 49 from Patent
           WO03099778.
          Length = 142

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 38/128 (29%), Positives = 62/128 (48%), Gaps = 33/128 (25%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWC--------------------------------GP 406
           +T  S+D  +L +D  +LV+F+A WC                                GP
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCICGYNLATLVMLGPSERVFCPLCEPCSSDIYEGP 67

Query: 407 CRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSV-IGY 583
           C+M+  ++DEIA +Y G+L    LN D +   A  Y I+ +P ++LFKNGE   +  +G 
Sbjct: 68  CKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVASATKVGA 127

Query: 584 HAQGVLRQ 607
            ++G L++
Sbjct: 128 LSKGQLKE 135



>gb:AX951378_1484085 Sequence 35 from Patent
           EP1367064.>gb:AX959954_1484349 Sequence 35 from Patent
           WO03099778.
          Length = 142

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 38/128 (29%), Positives = 62/128 (48%), Gaps = 33/128 (25%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGP-------------------------------- 406
           +T  S+D  +L +D  +LV+F+A WCGP                                
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCGPICGYNLATLVMLGPSERVFCPLCEPCSSDIYE 67

Query: 407 CRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSV-IGY 583
           C+M+  ++DEIA +Y G+L    LN D +   A  Y I+ +P ++LFKNGE   +  +G 
Sbjct: 68  CKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVASATKVGA 127

Query: 584 HAQGVLRQ 607
            ++G L++
Sbjct: 128 LSKGQLKE 135



>gb:AX951366_1484079 Sequence 23 from Patent
           EP1367064.>gb:AX959942_1484343 Sequence 23 from Patent
           WO03099778.
          Length = 142

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 38/128 (29%), Positives = 62/128 (48%), Gaps = 33/128 (25%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGP-------------------------------- 406
           +T  S+D  +L +D  +LV+F+A WCGP                                
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCGPICGYNLATLVMLGPSERVFCPLCEPCSSDIGP 67

Query: 407 CRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSV-IGY 583
           C+M+  ++DEIA +Y G+L    LN D +   A  Y I+ +P ++LFKNGE   +  +G 
Sbjct: 68  CKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVASATKVGA 127

Query: 584 HAQGVLRQ 607
            ++G L++
Sbjct: 128 LSKGQLKE 135



>gb:AY826134_1180094 Aedes albopictus clone AL_166 mitochondrial
           thioredoxin 2 mRNA, complete cds; nuclear gene for
           mitochondrial product.
          Length = 148

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 27/91 (29%), Positives = 55/91 (60%)
 Frame = +2

Query: 332 KSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAED 511
           + + + + +S  P++V+F+A+WCGPCRM+   ++ I  +  G++K   ++ D    +A D
Sbjct: 47  QEFQEKVKDSKDPIIVDFFATWCGPCRMLTPRIESIVGEQKGKVKLAKVDIDEHTDLALD 106

Query: 512 YDIKAVPVVMLFKNGEKRGSVIGYHAQGVLR 604
           Y++ +VPV++  +NG+    ++G      LR
Sbjct: 107 YEVASVPVLLAIRNGKVEQRLVGLQDTDKLR 137



>gb:BA000038_724995 Vibrio vulnificus YJ016 DNA, chromosome II,
           complete sequence.
          Length = 144

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 26/71 (36%), Positives = 47/71 (66%)
 Frame = +2

Query: 350 ILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAV 529
           +L SD PV+V+F+A WC PC     V  ++A +  G+++   +N + + Q+A  + I+++
Sbjct: 51  LLQSDQPVVVDFWAPWCNPCVGFAPVFQDVAAERKGKVRFIKINTEIEQQLAAQFQIRSI 110

Query: 530 PVVMLFKNGEK 562
           P VM+FKNG++
Sbjct: 111 PTVMVFKNGQR 121



>gb:AE016809_338099 Vibrio vulnificus CMCP6 chromosome II section 2
           of 6 of the complete sequence.>gb:AE016796_1047823
           Vibrio vulnificus CMCP6 chromosome II complete sequence.
          Length = 131

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 26/71 (36%), Positives = 47/71 (66%)
 Frame = +2

Query: 350 ILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAV 529
           +L SD PV+V+F+A WC PC     V  ++A +  G+++   +N + + Q+A  + I+++
Sbjct: 38  LLQSDQPVVVDFWAPWCNPCVGFAPVFQDVAAERKGKVRFIKINTEIEQQLAAQFQIRSI 97

Query: 530 PVVMLFKNGEK 562
           P VM+FKNG++
Sbjct: 98  PTVMVFKNGQR 108



>pir|AD2300|AD2300 thioredoxin [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_684944 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 128

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 30/94 (31%), Positives = 58/94 (61%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           V+ +++ + +L S VPVLV F A WCG CR++H ++ +  +    ++K   +NAD + ++
Sbjct: 5   VSERTFTQEVLESPVPVLVNFEAPWCGLCRIIHPLLLQFQSQCGEQIKLVGVNADENFKL 64

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLR 604
           +  Y +K++P ++L +NG  R  + G+  +  LR
Sbjct: 65  SNTYRLKSLPTLLLIENGIVRHRLEGFRGRDDLR 98



>sp|P57653|THIO_BUCAI Thioredoxin (TRX).>pir|B84999|B84999
           thioredoxin [imported] - Buchnera sp. (strain
           APS)>gb:BA000003_653936 Buchnera aphidicola str. APS
           (Acyrthosiphon pisum) genomic DNA, complete sequence.
          Length = 108

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 28/90 (31%), Positives = 56/90 (62%)
 Frame = +2

Query: 311 KAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADS 490
           K   +T +++++ +LNS    LV+F+A WC PC+++  +++EI+ +YS ++    LN + 
Sbjct: 3   KIIELTDQNFEEQVLNSKSFFLVDFWAQWCNPCKILAPILEEISKEYSNKVIVGKLNIEE 62

Query: 491 DVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           +   A  Y I+++P ++LF N E   + +G
Sbjct: 63  NPNTAPVYSIRSIPTLLLFNNSEVLATKVG 92



>sp|P97615|THI2_RAT Thioredoxin, mitochondrial precursor (Mt-TRX)
           (Thioredoxin 2).>gb:A89697_1451101 Sequence 2 from
           Patent WO9832863.>gb:BC081760_2108011 Rattus norvegicus
           thioredoxin 2, mRNA (cDNA clone MGC:93312
           IMAGE:7190504), complete cds.>gb:RNU73525_2137691 Rattus
           norvegicus thioredoxin mRNA, nuclear gene encoding
           mitochondrial protein, complete cds.
          Length = 166

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 30/101 (29%), Positives = 55/101 (54%)
 Frame = +2

Query: 278 FHLRVVCHRDAKAAVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSG 457
           FH   VC       V  G  +   ++NS+ PV+V+F+A WCGPC+++   ++++     G
Sbjct: 52  FHTTRVCSTTFN--VQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHG 109

Query: 458 RLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
           ++    ++ D    +A +Y++ AVP V+  KNG+     +G
Sbjct: 110 KVVMAKVDIDDHTDLAIEYEVSAVPTVLAIKNGDVVDKFVG 150



>gb:CR382125_1657949 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 104

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 28/88 (31%), Positives = 55/88 (62%)
 Frame = +2

Query: 317 AVVTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDV 496
           A +T  S  +  L  D  V+V+F+A+WCGPC+M+  ++++ A +Y G+     ++ D   
Sbjct: 3   AQLTSASEFEKALTDDKLVVVDFFATWCGPCKMIAPMLEKFAKEYEGKATFLKVDVDELP 62

Query: 497 QIAEDYDIKAVPVVMLFKNGEKRGSVIG 580
            +A++ D+ A+P ++ FK+G++   V+G
Sbjct: 63  DVAKNNDVSAMPTLVFFKSGKEISRVLG 90



>gb:AX951402_1484097 Sequence 59 from Patent
           EP1367064.>gb:AX959978_1484361 Sequence 59 from Patent
           WO03099778.
          Length = 143

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 38/129 (29%), Positives = 62/129 (48%), Gaps = 34/129 (26%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWC---------------------------------G 403
           +T  S+D  +L +D  +LV+F+A WC                                 G
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCAREGADGAICGYNLATLVMLGPSERVFCPLCEPG 67

Query: 404 PCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSV-IG 580
           PC+M+  ++DEIA +Y G+L    LN D +   A  Y I+ +P ++LFKNGE   +  +G
Sbjct: 68  PCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVASATKVG 127

Query: 581 YHAQGVLRQ 607
             ++G L++
Sbjct: 128 ALSKGQLKE 136



>gb:AX951388_1484090 Sequence 45 from Patent
           EP1367064.>gb:AX959964_1484354 Sequence 45 from Patent
           WO03099778.
          Length = 143

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 38/129 (29%), Positives = 62/129 (48%), Gaps = 34/129 (26%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGP-------------------------------- 406
           +T  S+D  +L +D  +LV+F+A WCGP                                
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCGPAREGADGAICGYNLATLVMLGPSERVFCPLCE 67

Query: 407 -CRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSV-IG 580
            C+M+  ++DEIA +Y G+L    LN D +   A  Y I+ +P ++LFKNGE   +  +G
Sbjct: 68  PCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVASATKVG 127

Query: 581 YHAQGVLRQ 607
             ++G L++
Sbjct: 128 ALSKGQLKE 136



>gb:AE016858_350140 Pseudomonas syringae pv. tomato str. DC3000
           section 3 of 21 of the complete
           genome.>gb:AE016853_1035315 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 290

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 28/96 (29%), Positives = 56/96 (58%), Gaps = 2/96 (2%)
 Frame = +2

Query: 326 TGKSWDKMILNS--DVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQ 499
           T  ++D+ +++   D PVLV+F+A WC PC+++  ++ +I   Y G L    +N D++  
Sbjct: 12  TSANFDQQVIDKSFDQPVLVDFWAEWCAPCKVLMPLLQQITESYQGELLLAKVNCDAEPD 71

Query: 500 IAEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           +   + I+++P V+LFK+G+      G   +  +R+
Sbjct: 72  VVSRFGIRSLPTVVLFKDGQPVDGFAGAQPESEIRK 107



>gb:AE013598_297033 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 326

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 29/80 (36%), Positives = 51/80 (63%)
 Frame = +2

Query: 368 PVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLF 547
           PVLV+F+A+WCGPC+ +  +++++A +Y+G  +   ++ D + QIA  + I++VP V L 
Sbjct: 68  PVLVDFWAAWCGPCKSLTPILEKLAGEYNGAFELGKVDVDKEQQIAAAFQIRSVPTVFLV 127

Query: 548 KNGEKRGSVIGYHAQGVLRQ 607
           K GE      G   +G +R+
Sbjct: 128 KGGEIVDGFPGAMPEGQVRE 147



>gb:AE011919_277699 Xanthomonas axonopodis pv. citri str. 306,
           section 297 of 469 of the complete
           genome.>gb:AE008923_919474 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 286

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 29/80 (36%), Positives = 51/80 (63%)
 Frame = +2

Query: 368 PVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLF 547
           PVLV+F+A+WCGPC+ +  +++++A +Y+G  +   ++ D + QIA  + I++VP V L 
Sbjct: 27  PVLVDFWATWCGPCKSLTPILEKLAGEYNGAFELGKVDVDKEQQIAAAFQIRSVPTVFLV 86

Query: 548 KNGEKRGSVIGYHAQGVLRQ 607
           K GE      G   +G +R+
Sbjct: 87  KGGEIVDGFPGAMPEGQVRE 106



>pir|C69410|C69410 thioredoxin (trx-3) homolog - Archaeoglobus
           fulgidus>gb:AE001015_30615 Archaeoglobus fulgidus DSM
           4304 section 92 of 172 of the complete
           genome.>gb:AE000782_975169 Archaeoglobus fulgidus DSM
           4304 complete genome.
          Length = 134

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 30/95 (31%), Positives = 59/95 (62%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQI 502
           +   ++D+ + N++  V+V+F+A WC PC+M+  V++E+A +Y+G++    LN D +  I
Sbjct: 35  LNSSNFDETLKNNE-NVVVDFWAEWCMPCKMIAPVIEELAKEYAGKVVFGKLNTDENPTI 93

Query: 503 AEDYDIKAVPVVMLFKNGEKRGSVIGYHAQGVLRQ 607
           A  Y I A+P ++ FK G+    ++G   +  L++
Sbjct: 94  AARYGISAIPTLIFFKKGKPVDQLVGAMPKSELKR 128



>pir|B82423|B82423 thioredoxin 2 VCA0752 [imported] - Vibrio
           cholerae (strain N16961 serogroup O1)>gb:AE004403_53880
           Vibrio cholerae O1 biovar eltor str. N16961 chromosome
           II, section 60 of 93 of the complete
           chromosome.>gb:AE003853_1050826 Vibrio cholerae O1
           biovar eltor str. N16961 chromosome II, complete
           chromosome.
          Length = 144

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 24/77 (31%), Positives = 49/77 (63%)
 Frame = +2

Query: 350 ILNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAV 529
           +L SD PV+V+F+A WC PC     +  ++A +  G+++C  ++ ++   +A  + I+++
Sbjct: 51  LLQSDKPVVVDFWAPWCNPCVGFAPIFSDVAAERKGQIRCVKIDTEAQQNLAAHFQIRSI 110

Query: 530 PVVMLFKNGEKRGSVIG 580
           P +M+FKNG++   + G
Sbjct: 111 PTIMVFKNGQRIDMING 127



>pir|B59394|A59394 thioredoxin - Clostridium pasteurianum
          Length = 104

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 28/80 (35%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +2

Query: 371 VLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFK 550
           V+V+F+A+WCGPC+M+  V+DE  ++  G+L    +N D++  +A  ++I ++P V++FK
Sbjct: 19  VVVDFWAAWCGPCKMLGPVIDEDLSEEQGKLDIAKVNVDTNPIVASRFEIASIPTVLVFK 78

Query: 551 NGEKRG-SVIGYHAQGVLRQ 607
           NG+    +++G+  +G L++
Sbjct: 79  NGQVADETLVGFAPKGRLKE 98



>gb:AX951390_1484091 Sequence 47 from Patent
           EP1367064.>gb:AX959966_1484355 Sequence 47 from Patent
           WO03099778.
          Length = 144

 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 38/130 (29%), Positives = 62/130 (47%), Gaps = 35/130 (26%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWC---------------------------------- 400
           +T  S+D  +L +D  +LV+F+A WC                                  
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCICGYNLATLVMLGPSERVFCPLCEPCSSDIYELM 67

Query: 401 GPCRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSV-I 577
           GPC+M+  ++DEIA +Y G+L    LN D +   A  Y I+ +P ++LFKNGE   +  +
Sbjct: 68  GPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVASATKV 127

Query: 578 GYHAQGVLRQ 607
           G  ++G L++
Sbjct: 128 GALSKGQLKE 137



>gb:AX951376_1484084 Sequence 33 from Patent
           EP1367064.>gb:AX959952_1484348 Sequence 33 from Patent
           WO03099778.
          Length = 144

 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 38/130 (29%), Positives = 62/130 (47%), Gaps = 35/130 (26%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGP-------------------------------- 406
           +T  S+D  +L +D  +LV+F+A WCGP                                
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCGPICGYNLATLVMLGPSERVFCPLCEPCSSDIYE 67

Query: 407 --CRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSV-I 577
             C+M+  ++DEIA +Y G+L    LN D +   A  Y I+ +P ++LFKNGE   +  +
Sbjct: 68  LMCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVASATKV 127

Query: 578 GYHAQGVLRQ 607
           G  ++G L++
Sbjct: 128 GALSKGQLKE 137



>gb:AX951364_1484078 Sequence 21 from Patent
           EP1367064.>gb:AX959940_1484342 Sequence 21 from Patent
           WO03099778.
          Length = 144

 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 38/130 (29%), Positives = 62/130 (47%), Gaps = 35/130 (26%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGP-------------------------------- 406
           +T  S+D  +L +D  +LV+F+A WCGP                                
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCGPICGYNLATLVMLGPSERVFCPLCEPCSSDIYE 67

Query: 407 --CRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSV-I 577
             C+M+  ++DEIA +Y G+L    LN D +   A  Y I+ +P ++LFKNGE   +  +
Sbjct: 68  GPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVASATKV 127

Query: 578 GYHAQGVLRQ 607
           G  ++G L++
Sbjct: 128 GALSKGQLKE 137



>gb:AE014296_1136277 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003533_1214403 Drosophila melanogaster
           chromosome 3L, section 52 of 83 of the complete
           sequence.
          Length = 139

 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 30/84 (35%), Positives = 54/84 (64%), Gaps = 3/84 (3%)
 Frame = +2

Query: 311 KAAVVTGKSW-DKMI--LNSDVPVLVEFYASWCGPCRMVHRVMDEIATDYSGRLKCFVLN 481
           K  +V  KS+ DK+I    ++  VLVEF+A+WCGPC M+   ++++A+DY GR+    ++
Sbjct: 7   KVIIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKID 66

Query: 482 ADSDVQIAEDYDIKAVPVVMLFKN 553
            D +  +A  Y++ ++P  ++ KN
Sbjct: 67  VDENEDLAVQYEVNSMPTFLIIKN 90



>gb:AX951374_1484083 Sequence 31 from Patent
           EP1367064.>gb:AX959950_1484347 Sequence 31 from Patent
           WO03099778.
          Length = 145

 Score = 66.2 bits (160), Expect = 7e-10
 Identities = 38/131 (29%), Positives = 62/131 (47%), Gaps = 36/131 (27%)
 Frame = +2

Query: 323 VTGKSWDKMILNSDVPVLVEFYASWCGP-------------------------------- 406
           +T  S+D  +L +D  +LV+F+A WCGP                                
Sbjct: 8   LTDDSFDTDVLKADGAILVDFWAEWCGPAREGADGAICGYNLATLVMLGPSERVFCPLCE 67

Query: 407 ---CRMVHRVMDEIATDYSGRLKCFVLNADSDVQIAEDYDIKAVPVVMLFKNGEKRGSV- 574
              C+M+  ++DEIA +Y G+L    LN D +   A  Y I+ +P ++LFKNGE   +  
Sbjct: 68  PGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVASATK 127

Query: 575 IGYHAQGVLRQ 607
           +G  ++G L++
Sbjct: 128 VGALSKGQLKE 138


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 895,791,700
Number of Sequences: 1806583
Number of extensions: 18986850
Number of successful extensions: 50524
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 48549
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 50222
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 55754781230
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)