BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig1030
         (615 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP000969_1820685 Oryza sativa (japonica cultivar-group) genom...   134   1e-30   
gb:AY080611_1568355 Arabidopsis thaliana unknown protein (At2g41...   114   1e-24   
pir|T04894|T04894 hypothetical protein F18F4.200 - Arabidopsis t...   109   4e-23   Arabidopsis thaliana [mouse-ear cress]
gb:AY046029_1561521 Arabidopsis thaliana unknown protein (At4g36...   108   9e-23   
pir|B85435|B85435 hypothetical protein AT4g36850 [imported] - Ar...   108   9e-23   Arabidopsis thaliana [mouse-ear cress]
gb:CR382136_1669349 Debaryomyces hansenii chromosome D of strain...    69   6e-11   
gb:NCB1D14_1689562 Neurospora crassa genomic DNA, BAC contig B1D14.    62   7e-09   
gb:AE017342_1754993 Cryptococcus neoformans var. neoformans JEC2...    62   1e-08   
gb:CR382132_1665147 Yarrowia lipolytica chromosome F of strain C...    62   1e-08   
gb:CR382134_1667454 Debaryomyces hansenii chromosome B of strain...    60   2e-08   
sp|P38279|YBZ7_YEAST|YBZ7_YEAST Hypothetical 33.5 kDa protein in MRPS9-YSW1...    59   5e-08   Saccharomyces cerevisiae [brewer's yeast]
gb:CR380958_1653364 Candida glabrata strain CBS138 chromosome L ...    59   6e-08   
gb:AE016819_1749440 Ashbya gossypii (= Eremothecium gossypii) AT...    59   8e-08   
gb:CR382123_1655627 Kluyveromyces lactis strain NRRL Y-1140 chro...    57   2e-07   
gb:CR382125_1658193 Kluyveromyces lactis strain NRRL Y-1140 chro...    56   4e-07   
pir|S57377|S57377 probable membrane protein YOL092w - yeast (Sac...    55   7e-07   Saccharomyces cerevisiae [brewer's yeast]
gb:AE017343_1755582 Cryptococcus neoformans var. neoformans JEC2...    54   2e-06   
pir|S61149|S61149 probable membrane protein YDR352w - yeast (Sac...    54   3e-06   Saccharomyces cerevisiae [brewer's yeast]
gb:AK130171_1917553 Homo sapiens cDNA FLJ26661 fis, clone MPG019...    53   3e-06   
gb:AC024781_1204555 Caenorhabditis elegans cosmid Y43H11AL, comp...    53   3e-06   
gb:CR380955_1651846 Candida glabrata strain CBS138 chromosome I ...    50   2e-05   
gb:CR382134_1667605 Debaryomyces hansenii chromosome B of strain...    50   4e-05   
pir|T02114|T02114 hypothetical protein At2g41050 [imported] - Ar...    49   7e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AK130175_1917555 Homo sapiens cDNA FLJ26665 fis, clone MPG02687.    49   9e-05   
gb:AK081661_1173333 Mus musculus 16 days embryo head cDNA, RIKEN...    49   9e-05   
gb:BX649605_1643311 Aspergillus fumigatus BAC pilot project supe...    48   1e-04   
gb:AX405764_1467692 Sequence 179 from Patent WO0222660.>gb:AK000...    48   1e-04   
gb:AE016816_1746586 Ashbya gossypii (= Eremothecium gossypii) AT...    47   2e-04   
gb:CR380947_1649092 Candida glabrata strain CBS138 chromosome A ...    47   2e-04   
gb:BC025609_2095104 Mus musculus PQ loop repeat containing 2, mR...    47   3e-04   
gb:BC019216_2092857 Mus musculus PQ loop repeat containing 2, mR...    47   3e-04   
gb:CR382135_1668134 Debaryomyces hansenii chromosome C of strain...    46   4e-04   
sp|Q10482|STM1_SCHPO|STM1_SCHPO Seven transmembrane protein 1.>pir|T11590|T...    44   0.002   Schizosaccharomyces pombe
gb:CR382132_1665569 Yarrowia lipolytica chromosome F of strain C...    44   0.002   
gb:CR382130_1662386 Yarrowia lipolytica chromosome D of strain C...    44   0.003   
sp|Q10227|YD03_SCHPO|YD03_SCHPO Hypothetical protein C2E12.03c in chromosom...    43   0.004   Schizosaccharomyces pombe
gb:AE017342_1754919 Cryptococcus neoformans var. neoformans JEC2...    42   0.006   
gb:AJ720314_2502501 Gallus gallus mRNA for hypothetical protein,...    41   0.014   
sp|Q03687|YMP0_YEAST|YMP0_YEAST Hypothetical 46.9 kDa protein in PLB1-HXT2 ...    40   0.023   Saccharomyces cerevisiae [brewer's yeast]
gb:BC088186_2110385 Rattus norvegicus cDNA clone MGC:108854 IMAG...    39   0.068   
gb:BC074639_2558134 Xenopus tropicalis MGC69309 protein, mRNA (c...    36   0.44    
gb:CR382124_1656968 Kluyveromyces lactis strain NRRL Y-1140 chro...    35   0.75    
gb:BC043686_2098951 Mus musculus PQ loop repeat containing 1, mR...    35   1.3     
gb:AK026031_1910485 Homo sapiens cDNA: FLJ22378 fis, clone HRC07...    35   1.3     
gb:CQ834734_1454033 Sequence 605 from Patent WO2004058805.>gb:BC...    35   1.3     
gb:AK018759_1159740 Mus musculus adult male liver cDNA, RIKEN fu...    35   1.3     
gb:AK009256_1155030 Mus musculus adult male tongue cDNA, RIKEN f...    35   1.3     
gb:CR382128_1660517 Yarrowia lipolytica chromosome B of strain C...    33   2.9     
gb:AJ627422_527955 Uncultured crenarchaeote genomic fragment 54d9.     33   2.9     
gb:BC044024_2548430 Xenopus laevis similar to myeloid ecotropic ...    33   3.7     
gb:AE017342_1754890 Cryptococcus neoformans var. neoformans JEC2...    33   3.7     
gb:AE015940_320517 Clostridium tetani E88, section 5 of 10 of th...    33   4.9     
gb:AE014297_1140912 Drosophila melanogaster chromosome 3R, compl...    32   6.4     
pir|G84451|G84451 probable cold-regulated protein [imported] - A...    32   6.4     Arabidopsis thaliana [mouse-ear cress]
sp|Q9VCR7|CTNS_DROME|CTNS_DROME Cystinosin homolog.>gb:AE014297_1140911 Dro...    32   6.4     Drosophila melanogaster


>gb:AP000969_1820685 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0011D01.
          Length = 420

 Score =  134 bits (337), Expect = 1e-30
 Identities = 60/113 (53%), Positives = 77/113 (68%)
 Frame = +2

Query: 221 CSQWALEYMDYCLCSSKDEXXXXXXXXXXXXXXXXEVPQIMTNFREKSTEGLSCWFLLTW 400
           C++WA  Y+ YCLCS++D                 EVPQI+TN++ KSTEGLS  FL+TW
Sbjct: 20  CAKWAQTYLKYCLCSTRDGMALTLGLLSVISWGVAEVPQIITNYKHKSTEGLSLAFLMTW 79

Query: 401 IIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLAGQALYYSHIYPRLKSNR 559
           I+GD  N+ GC LEP TLPTQ YMA+ +T+TT  L GQ +YYSHIY RLK+ +
Sbjct: 80  IVGDFFNLIGCFLEPETLPTQFYMALLYTITTVILTGQTVYYSHIYHRLKAKK 132



>gb:AY080611_1568355 Arabidopsis thaliana unknown protein
           (At2g41050) mRNA, complete cds.>gb:AY133749_1581569
           Arabidopsis thaliana clone U19895 unknown protein
           (At2g41050) mRNA, complete cds.
          Length = 376

 Score =  114 bits (286), Expect = 1e-24
 Identities = 52/78 (66%), Positives = 64/78 (82%)
 Frame = +2

Query: 326 EVPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGL 505
           E+PQIMTN+ EKSTEGLS  FL TW+IGD+ N+ GCL+EPATLPTQ YMA+ +T+TT  L
Sbjct: 27  EIPQIMTNYSEKSTEGLSITFLTTWMIGDIFNLLGCLMEPATLPTQFYMALLYTVTTSVL 86

Query: 506 AGQALYYSHIYPRLKSNR 559
             Q++YY HIYPRLK+ R
Sbjct: 87  YVQSIYYGHIYPRLKNRR 104



>pir|T04894|T04894 hypothetical protein F18F4.200 - Arabidopsis
           thaliana>gb:ATCHRIV52_1545848 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 52.>gb:ATF18F4_1549153
           Arabidopsis thaliana DNA chromosome 4, BAC clone F18F4
           (ESSA project).
          Length = 288

 Score =  109 bits (272), Expect = 4e-23
 Identities = 48/83 (57%), Positives = 63/83 (75%)
 Frame = +2

Query: 326 EVPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGL 505
           E+PQIMTN+ +KS EG+S  FL TW++GD+ N+ GCL+EPA+LP Q Y AV +TL T  L
Sbjct: 22  EIPQIMTNYNQKSIEGVSITFLTTWMLGDIFNVVGCLMEPASLPVQFYTAVLYTLATLVL 81

Query: 506 AGQALYYSHIYPRLKSNRRWHEV 574
             Q++YY HIYPRL  NRR H++
Sbjct: 82  YVQSIYYGHIYPRLMKNRRNHQM 104



>gb:AY046029_1561521 Arabidopsis thaliana unknown protein
           (At4g36850) mRNA, complete cds.
          Length = 392

 Score =  108 bits (269), Expect = 9e-23
 Identities = 49/118 (41%), Positives = 70/118 (59%)
 Frame = +2

Query: 206 EQLQKCSQWALEYMDYCLCSSKDEXXXXXXXXXXXXXXXXEVPQIMTNFREKSTEGLSCW 385
           ++ + C +W   Y D CLC+  D+                E+PQ++TNFR KS+ G+S  
Sbjct: 9   KEKKTCVRWVEIYFDDCLCNLNDDVSFALGIASLLCWGVAEIPQVITNFRTKSSNGVSLS 68

Query: 386 FLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLAGQALYYSHIYPRLKSNR 559
           FLL W+ GD+ N+ GCLLEPATLPTQ Y A+ +T++T  L  Q +YY +IY   +  R
Sbjct: 69  FLLAWVAGDIFNLVGCLLEPATLPTQFYTALLYTVSTVVLVIQTIYYDYIYKLCRHRR 126



>pir|B85435|B85435 hypothetical protein AT4g36850 [imported] -
           Arabidopsis thaliana>gb:ATAP22_1544012 Arabidopsis
           thaliana DNA chromosome 4, ESSA I AP2 contig fragment
           No. 2.>gb:ATCHRIV86_1547640 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 86.
          Length = 374

 Score =  108 bits (269), Expect = 9e-23
 Identities = 49/118 (41%), Positives = 70/118 (59%)
 Frame = +2

Query: 206 EQLQKCSQWALEYMDYCLCSSKDEXXXXXXXXXXXXXXXXEVPQIMTNFREKSTEGLSCW 385
           ++ + C +W   Y D CLC+  D+                E+PQ++TNFR KS+ G+S  
Sbjct: 9   KEKKTCVRWVEIYFDDCLCNLNDDVSFALGIASLLCWGVAEIPQVITNFRTKSSNGVSLS 68

Query: 386 FLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLAGQALYYSHIYPRLKSNR 559
           FLL W+ GD+ N+ GCLLEPATLPTQ Y A+ +T++T  L  Q +YY +IY   +  R
Sbjct: 69  FLLAWVAGDIFNLVGCLLEPATLPTQFYTALLYTVSTVVLVIQTIYYDYIYKLCRHRR 126



>gb:CR382136_1669349 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 352

 Score = 68.9 bits (167), Expect = 6e-11
 Identities = 32/77 (41%), Positives = 43/77 (55%)
 Frame = +2

Query: 326 EVPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGL 505
           ++PQI  N+R KS EG+S  FLL W +GD  +   CLL    L  Q Y+++FF      L
Sbjct: 26  QLPQIYCNYRNKSAEGISPLFLLLWFMGDFLSFTSCLLNDVVLKFQVYLSLFFLCNDVTL 85

Query: 506 AGQALYYSHIYPRLKSN 556
             Q  YY+ +YPR   N
Sbjct: 86  CYQYYYYNSVYPRKYGN 102



>gb:NCB1D14_1689562 Neurospora crassa genomic DNA, BAC contig B1D14.
          Length = 337

 Score = 62.0 bits (149), Expect = 7e-09
 Identities = 29/80 (36%), Positives = 47/80 (58%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLA 508
           +PQ++TN++ KS +GLS  FL+ W++GD+ N+ G L   +  PT   +A++F      L 
Sbjct: 31  LPQLITNYKAKSADGLSMNFLIIWLLGDIANLLGALW-TSLAPTAVALALYFCFADLVLI 89

Query: 509 GQALYYSHIYPRLKSNRRWH 568
           GQ  YY+ +  R +S    H
Sbjct: 90  GQCSYYNAVNARRRSRIERH 109



 Score = 34.3 bits (77), Expect = 1.7
 Identities = 15/29 (51%), Positives = 21/29 (72%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDL 415
           +PQI+ N+REKS EGL+  F L  + G+L
Sbjct: 254 IPQIIKNYREKSCEGLALLFFLLSLTGNL 282



>gb:AE017342_1754993 Cryptococcus neoformans var. neoformans JEC21
           chromosome 2, complete sequence.
          Length = 648

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 28/67 (41%), Positives = 42/67 (62%)
 Frame = +2

Query: 326 EVPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGL 505
           ++PQ++ N   +S EGL+  FL+ W+ GD+ N+ GCLL    LP QT++A +F +    L
Sbjct: 33  QLPQVLKNLSLQSCEGLALPFLVNWLFGDITNLIGCLLTD-QLPFQTFLAAYFCIIDVTL 91

Query: 506 AGQALYY 526
            GQ  YY
Sbjct: 92  LGQYFYY 98



 Score = 33.9 bits (76), Expect = 2.2
 Identities = 16/40 (40%), Positives = 22/40 (55%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPA 448
           +PQI  NF+ KS EGLS    L    G++  +F  L  P+
Sbjct: 478 MPQIWKNFQRKSVEGLSILLFLFAFCGNVTYVFSILFNPS 517



>gb:CR382132_1665147 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 278

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 28/67 (41%), Positives = 44/67 (65%)
 Frame = +2

Query: 332 PQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLAG 511
           PQI  NF+ +S+EGLS  F++ W+IGD+ N+ G +L+   +PT   +A+++TL    L  
Sbjct: 38  PQIYENFKRQSSEGLSLSFVVIWLIGDIFNVLGAILQ-KIIPTMIILAIYYTLADILLLL 96

Query: 512 QALYYSH 532
           Q L Y+H
Sbjct: 97  QCLVYTH 103



 Score = 33.1 bits (74), Expect = 3.7
 Identities = 16/38 (42%), Positives = 23/38 (60%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLE 442
           VPQI+ N+  KS EG+S  F L   +G+L  +   LL+
Sbjct: 205 VPQIVLNYERKSCEGISFMFFLFACLGNLTAVASILLK 242



>gb:CR382134_1667454 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 320

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 28/65 (43%), Positives = 41/65 (63%)
 Frame = +2

Query: 332 PQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLAG 511
           PQI  NFR KS++GLS  F++ W+ GD+ N+ G +L+   LPT   +A+++TL    L  
Sbjct: 32  PQIYENFRRKSSDGLSLLFIILWLAGDVFNVLGSILQ-GVLPTMIILAIYYTLADVVLLW 90

Query: 512 QALYY 526
           Q L Y
Sbjct: 91  QCLVY 95



 Score = 32.7 bits (73), Expect = 4.9
 Identities = 14/36 (38%), Positives = 22/36 (61%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCL 436
           +PQI+ N++ KS EG+S  F L   +G+L  +   L
Sbjct: 222 IPQILLNYKRKSCEGISFMFFLFACLGNLTYVISIL 257



>sp|P38279|YBZ7_YEAST Hypothetical 33.5 kDa protein in MRPS9-YSW1
           intergenic region.>pir|S46018|S46018 probable membrane
           protein YBR147w - yeast (Saccharomyces
           cerevisiae)>gb:SCYBR147W_1711383 S.cerevisiae chromosome
           II reading frame ORF YBR147w.
          Length = 296

 Score = 59.3 bits (142), Expect = 5e-08
 Identities = 27/66 (40%), Positives = 42/66 (63%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLA 508
           VPQI  NFR +S EGLS  F++ W++GD+ N+ G +++   LPT   +A ++TL    L 
Sbjct: 30  VPQIYENFRRQSAEGLSLLFIVLWLLGDIFNVMGAMMQ-NLLPTMIILAAYYTLADLILL 88

Query: 509 GQALYY 526
            Q ++Y
Sbjct: 89  IQCMWY 94



>gb:CR380958_1653364 Candida glabrata strain CBS138 chromosome L
           complete sequence.
          Length = 329

 Score = 58.9 bits (141), Expect = 6e-08
 Identities = 27/66 (40%), Positives = 43/66 (65%)
 Frame = +2

Query: 332 PQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLAG 511
           PQI  NFR KS++GLS  F++ W+IGD+ NI G +++   LPT   +A ++T+    L  
Sbjct: 31  PQIYENFRRKSSDGLSLMFIILWLIGDIFNIVGAIMQ-NLLPTMIILAAYYTVADIILWF 89

Query: 512 QALYYS 529
           Q ++Y+
Sbjct: 90  QCIWYN 95



 Score = 32.0 bits (71), Expect = 8.3
 Identities = 15/36 (41%), Positives = 22/36 (61%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCL 436
           +PQI+ NF+ KS EG+S  F L   +G++  I   L
Sbjct: 252 IPQILLNFKRKSCEGVSLLFFLFACLGNINFILSVL 287



>gb:AE016819_1749440 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 315

 Score = 58.5 bits (140), Expect = 8e-08
 Identities = 28/66 (42%), Positives = 41/66 (62%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLA 508
           VPQI  NFR KS EGLS  F++ W+ GD+ N+ G +L+   LPT   +A ++T+    L 
Sbjct: 28  VPQIYENFRRKSAEGLSLLFVVLWLAGDIFNLLGAILQ-HLLPTMIVLAAYYTVADIVLW 86

Query: 509 GQALYY 526
            Q ++Y
Sbjct: 87  FQCVFY 92



 Score = 34.7 bits (78), Expect = 1.3
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 6/93 (6%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGD---LCNIFGCLLEPATLPTQTYM---AVFFTL 490
           VPQI+ NF+ KS EG+S  F L   +G+   + ++    L+P  L         ++   L
Sbjct: 222 VPQILLNFKRKSCEGISFLFFLFACLGNTTFIISVLSISLQPRYLLVNASWLLGSIGTLL 281

Query: 491 TTFGLAGQALYYSHIYPRLKSNRRWHEVSEDGA 589
               + GQ   Y     +  + R  H+  ED A
Sbjct: 282 MDLLIFGQFFIYGGANEKEAATRITHDTFEDAA 314



>gb:CR382123_1655627 Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 306

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 29/71 (40%), Positives = 40/71 (56%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLA 508
           VPQI  NF  KS EGLS  F++ W+ GD+ N+ G +L+   LPT   +A ++T     L 
Sbjct: 30  VPQIYENFYRKSAEGLSLMFVVLWLAGDIFNLLGAMLQ-HLLPTMIILAAYYTAADIILL 88

Query: 509 GQALYYSHIYP 541
            Q L+Y    P
Sbjct: 89  IQCLFYGQDGP 99



>gb:CR382125_1658193 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 319

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 26/71 (36%), Positives = 43/71 (60%)
 Frame = +2

Query: 326 EVPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGL 505
           ++PQ++  +R+KS EGLS  FLL W+ GD+ ++ G +L    LP Q  +AV++      +
Sbjct: 31  QIPQLIETYRDKSVEGLSPGFLLCWLFGDITSLIGAVL-THQLPFQILLAVYYLSNDMLI 89

Query: 506 AGQALYYSHIY 538
            GQ  YY  ++
Sbjct: 90  CGQYYYYGILH 100



>pir|S57377|S57377 probable membrane protein YOL092w - yeast
           (Saccharomyces cerevisiae)>gb:SCCHXVORF_1707262
           S.cerevisiae DNA for ORF's from chromosome
           XV.>gb:SCYOL092W_1714141 S.cerevisiae chromosome XV
           reading frame ORF YOL092w.
          Length = 308

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 26/68 (38%), Positives = 42/68 (61%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLA 508
           VPQI  NF  KS++GLS  F++ W+ GD+ N+ G +++   L T   +A ++T+    L 
Sbjct: 30  VPQIYENFYRKSSDGLSLLFVVLWLAGDVFNLMGAVMQ-HLLSTMIILAAYYTVADIILL 88

Query: 509 GQALYYSH 532
           GQ L+Y +
Sbjct: 89  GQCLWYDN 96



 Score = 33.5 bits (75), Expect = 2.9
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLL 439
           +PQI+ NF+ KS EG+S  F L   +G+   IF  ++
Sbjct: 228 IPQILLNFKRKSCEGISFLFFLFACLGNTTFIFSVIV 264



>gb:AE017343_1755582 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 256

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 26/65 (40%), Positives = 41/65 (63%)
 Frame = +2

Query: 332 PQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLAG 511
           PQ+  N++ KS EGLS  F++ W++GD+ N+FG ++    LPT   +AV++T+    L  
Sbjct: 12  PQMWENYQLKSGEGLSVPFIILWLLGDITNLFGGMM-AHLLPTVIILAVYYTICDLVLLF 70

Query: 512 QALYY 526
           Q  YY
Sbjct: 71  QVYYY 75



>pir|S61149|S61149 probable membrane protein YDR352w - yeast
           (Saccharomyces cerevisiae)>gb:YSCD9476_1728669
           Saccharomyces cerevisiae chromosome IV cosmid 9476.
          Length = 317

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 26/69 (37%), Positives = 41/69 (59%)
 Frame = +2

Query: 332 PQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLAG 511
           PQI+  +R+KS +GLS +FLL W+ GD+ ++ G  L    L  Q  +A++F L    + G
Sbjct: 29  PQIIETYRDKSVDGLSPYFLLAWLCGDITSLIGAKL-TGQLLFQILLAIYFLLNDSFVCG 87

Query: 512 QALYYSHIY 538
           Q  YY  ++
Sbjct: 88  QYYYYGVLH 96



>gb:AK130171_1917553 Homo sapiens cDNA FLJ26661 fis, clone
           MPG01974.>gb:HS657E11_1999219 Human DNA sequence from
           clone RP4-657E11 on chromosome 1p35.1-36.23 Contains the
           5' end of a novel gene, the C1orf33 gene for chromosome
           1 open reading frame 33, four novel genes, the AKR7A3
           gene for aldo-keto reductase family 7, member A3
           (aflatoxin aldehyde reductase), the AKR7A2 gene for
           aldo-keto reductase family 7, member A2 (aflatoxin
           aldehyde reductase), the 3' end of the CAPZB gene for
           capping protein (actin filament) muscle Z-line, beta and
           two CpG islands, complete sequence.
          Length = 291

 Score = 53.1 bits (126), Expect = 3e-06
 Identities = 31/101 (30%), Positives = 42/101 (41%), Gaps = 1/101 (0%)
 Frame = +2

Query: 227 QWALEYMDYCLCSSKDEXXXXXXXXXXXXXXXXEVPQIMTNFREKSTE-GLSCWFLLTWI 403
           QW  + +  C     DE                  PQ +  ++  + +  LS WFLL WI
Sbjct: 20  QWIWDVLGECAQDGWDEASVGLGLISILCFAASTFPQFIKAYKTGNMDQALSLWFLLGWI 79

Query: 404 IGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLAGQALYY 526
            GD CN+ G  L    LP QTY AV++ L    +     YY
Sbjct: 80  GGDSCNLIGSFLAD-QLPLQTYTAVYYVLADLVMLTLYFYY 119



>gb:AC024781_1204555 Caenorhabditis elegans cosmid Y43H11AL,
           complete sequence.
          Length = 311

 Score = 53.1 bits (126), Expect = 3e-06
 Identities = 27/71 (38%), Positives = 38/71 (53%)
 Frame = +2

Query: 332 PQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLAG 511
           PQ+  N++ K  EGLS  FL  W++GD CN+ G +L     P Q  + V++ +    L  
Sbjct: 59  PQLWQNYKTKKCEGLSLAFLFFWLVGDTCNMLGAILTNQQ-PIQKIIGVYYIIQDLVLWT 117

Query: 512 QALYYSHIYPR 544
           Q  YY  IY R
Sbjct: 118 QYGYYLKIYNR 128



>gb:CR380955_1651846 Candida glabrata strain CBS138 chromosome I
           complete sequence.
          Length = 309

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 25/68 (36%), Positives = 39/68 (57%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLA 508
           VPQI  NF  KS +GLS  F++ W+ GD+ N+ G +++   L T   +A ++T     L 
Sbjct: 31  VPQIYENFYRKSADGLSLLFVVLWLAGDVFNLVGAMMQHLLL-TMVILAAYYTAADVILL 89

Query: 509 GQALYYSH 532
            Q L+Y +
Sbjct: 90  IQCLWYDN 97



 Score = 32.0 bits (71), Expect = 8.3
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCL 436
           VPQI+ NF+ KS EG+S  F L   +G+   I   L
Sbjct: 222 VPQILLNFKRKSCEGISFLFFLFACLGNTTFIISVL 257



>gb:CR382134_1667605 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 311

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 23/72 (31%), Positives = 41/72 (56%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLA 508
           +PQ++  +R KS +G+S  F+  W +GD+ N+ G L     LP   ++AV+F +    + 
Sbjct: 43  MPQLIEQWRLKSADGVSIGFISIWFLGDVFNLIGALW-AGLLPEVIFLAVWFCIADAMMI 101

Query: 509 GQALYYSHIYPR 544
               YY+ +YP+
Sbjct: 102 LSYFYYTRMYPK 113



>pir|T02114|T02114 hypothetical protein At2g41050 [imported] -
           Arabidopsis thaliana>gb:AC004261_1531633 Arabidopsis
           thaliana chromosome 2 clone T3K9 map CIC11C08, complete
           sequence.
          Length = 219

 Score = 48.9 bits (115), Expect = 7e-05
 Identities = 23/41 (56%), Positives = 28/41 (68%)
 Frame = +2

Query: 326 EVPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPA 448
           E+PQIMTN+ EKSTEGLS  FL TW+IG   ++      PA
Sbjct: 27  EIPQIMTNYSEKSTEGLSITFLTTWMIGSARSLSSSHTPPA 67



>gb:AK130175_1917555 Homo sapiens cDNA FLJ26665 fis, clone MPG02687.
          Length = 291

 Score = 48.5 bits (114), Expect = 9e-05
 Identities = 30/101 (29%), Positives = 41/101 (40%), Gaps = 1/101 (0%)
 Frame = +2

Query: 227 QWALEYMDYCLCSSKDEXXXXXXXXXXXXXXXXEVPQIMTNFREKSTE-GLSCWFLLTWI 403
           QW  + +        DE                  PQ +  ++  + +  LS WFLL WI
Sbjct: 20  QWIWDVLGERAQDGWDEASVGLGLISILCFAASTFPQFIKAYKTGNMDQALSLWFLLGWI 79

Query: 404 IGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLAGQALYY 526
            GD CN+ G  L    LP QTY AV++ L    +     YY
Sbjct: 80  GGDSCNLIGSFLAD-QLPLQTYTAVYYVLADLVMLTLYFYY 119



>gb:AK081661_1173333 Mus musculus 16 days embryo head cDNA, RIKEN
           full-length enriched library, clone:C130062C02
           product:hypothetical protein, full insert sequence.
          Length = 293

 Score = 48.5 bits (114), Expect = 9e-05
 Identities = 33/110 (30%), Positives = 45/110 (40%), Gaps = 1/110 (0%)
 Frame = +2

Query: 227 QWALEYMDYCLCSSKDEXXXXXXXXXXXXXXXXEVPQIMTNFREKSTE-GLSCWFLLTWI 403
           QW  +    C     DE                  PQ +   +  + +  LS WFLL WI
Sbjct: 20  QWIWDVFGECAQDGWDEASVGLGLVSILCFAASTFPQYIKACKTGNMDQALSLWFLLGWI 79

Query: 404 IGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLAGQALYYSHIYPRLKS 553
            GD CN+ G  L    LP QTY AV++ L    L    LY+ + + +  S
Sbjct: 80  GGDSCNLIGSFLAD-QLPLQTYTAVYYVLA--DLMMLTLYFHYKFKKRPS 126



>gb:BX649605_1643311 Aspergillus fumigatus BAC pilot project
           supercontig; segment 1/3.
          Length = 431

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 24/69 (34%), Positives = 38/69 (55%)
 Frame = +2

Query: 326 EVPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGL 505
           ++PQI  N++ +ST GLS +FL+ W +GD  N+ G L        Q  +A ++ L    L
Sbjct: 59  QLPQIYKNYQLQSTSGLSLFFLVEWCLGDTGNLVGALF-TRQAAWQVIIAAYYVLVDVTL 117

Query: 506 AGQALYYSH 532
             Q  +Y+H
Sbjct: 118 VFQFFWYTH 126



>gb:AX405764_1467692 Sequence 179 from Patent
           WO0222660.>gb:AK000327_1907835 Homo sapiens cDNA
           FLJ20320 fis, clone HEP08923.>gb:BC015324_1975041 Homo
           sapiens PQ loop repeat containing 2, mRNA (cDNA clone
           MGC:21152 IMAGE:4426038), complete cds.
          Length = 226

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 24/53 (45%), Positives = 29/53 (54%)
 Frame = +2

Query: 368 EGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLAGQALYY 526
           + LS WFLL WI GD CN+ G  L    LP QTY AV++ L    +     YY
Sbjct: 3   QALSLWFLLGWIGGDSCNLIGSFLAD-QLPLQTYTAVYYVLADLVMLTLYFYY 54



>gb:AE016816_1746586 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome III, complete sequence.
          Length = 273

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 25/66 (37%), Positives = 36/66 (54%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLA 508
           +PQ++  ++EKS +GLS   LL WI GD+  + G +L    LP Q   A ++  T   L 
Sbjct: 32  IPQVVETYKEKSVDGLSPLCLLCWISGDITTLVGAIL-THQLPFQIIQAFYYFSTDLILC 90

Query: 509 GQALYY 526
            Q  YY
Sbjct: 91  YQYYYY 96



>gb:CR380947_1649092 Candida glabrata strain CBS138 chromosome A
           complete sequence.
          Length = 316

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 22/69 (31%), Positives = 39/69 (56%)
 Frame = +2

Query: 332 PQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLAG 511
           PQI+  +++K+ EGLS  FL+ W+ GD+ ++ G L+    L  Q  +A++F      +  
Sbjct: 29  PQIIETYKDKTVEGLSPLFLMCWLSGDITSLIGALM-TGQLKFQIALAIYFLFNDLFVCC 87

Query: 512 QALYYSHIY 538
           Q  YY  ++
Sbjct: 88  QYYYYGVLH 96



 Score = 35.8 bits (81), Expect = 0.58
 Identities = 23/91 (25%), Positives = 41/91 (45%), Gaps = 6/91 (6%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLT--TFG 502
           +PQ++ N++ KST+GLS +   T ++G++            L T+  MA  F      FG
Sbjct: 212 IPQLIKNYQRKSTDGLSPFLFATTLLGNITYNISIFTSCNFLDTEDKMAFIFNELPFIFG 271

Query: 503 LAG----QALYYSHIYPRLKSNRRWHEVSED 583
            AG      +Y+   Y     + +  E+  +
Sbjct: 272 SAGTVAFDLIYFYQYYVLYSRDNKLRELERE 302



>gb:BC025609_2095104 Mus musculus PQ loop repeat containing 2, mRNA
           (cDNA clone MGC:38094 IMAGE:5309871), complete cds.
          Length = 228

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 26/62 (41%), Positives = 34/62 (54%)
 Frame = +2

Query: 368 EGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLAGQALYYSHIYPRL 547
           + LS WFLL WI GD CN+ G  L    LP QTY AV++ L    L    LY+ + + + 
Sbjct: 3   QALSLWFLLGWIGGDSCNLIGSFLAD-QLPLQTYTAVYYVLA--DLMMLTLYFHYKFKKR 59

Query: 548 KS 553
            S
Sbjct: 60  PS 61



>gb:BC019216_2092857 Mus musculus PQ loop repeat containing 2, mRNA
           (cDNA clone MGC:29170 IMAGE:5065163), complete cds.
          Length = 285

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 26/62 (41%), Positives = 34/62 (54%)
 Frame = +2

Query: 368 EGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLAGQALYYSHIYPRL 547
           + LS WFLL WI GD CN+ G  L    LP QTY AV++ L    L    LY+ + + + 
Sbjct: 3   QALSLWFLLGWIGGDSCNLIGSFLAD-QLPLQTYTAVYYVLA--DLMMLTLYFHYKFKKR 59

Query: 548 KS 553
            S
Sbjct: 60  PS 61



>gb:CR382135_1668134 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 583

 Score = 46.2 bits (108), Expect = 4e-04
 Identities = 23/74 (31%), Positives = 38/74 (51%)
 Frame = +2

Query: 326 EVPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGL 505
           ++PQ++ N   +S +GLS   ++ WI GD+ N    +L     P Q  +  +       L
Sbjct: 61  QIPQLIENHMNRSVQGLSLLLVIFWISGDISNFVASVLNGT--PFQVCIGAYHCCIGSVL 118

Query: 506 AGQALYYSHIYPRL 547
             Q  YY+++YPRL
Sbjct: 119 GMQYWYYTNVYPRL 132



 Score = 32.0 bits (71), Expect = 8.3
 Identities = 14/28 (50%), Positives = 21/28 (75%)
 Frame = +2

Query: 332 PQIMTNFREKSTEGLSCWFLLTWIIGDL 415
           PQI+ N++ KST GLS + +L  +IG+L
Sbjct: 267 PQIIQNYKAKSTNGLSLYTILLAMIGNL 294



>sp|Q10482|STM1_SCHPO Seven transmembrane protein
           1.>pir|T11590|T11590 hypothetical protein SPAC17C9.10 -
           fission yeast  (Schizosaccharomyces
           pombe)>gb:L49134_1683842 Schizosaccharomyces pombe seven
           transmembrane protein (stm1) mRNA, complete
           cds.>gb:SPAC17C9_1716733 S.pombe chromosome I cosmid
           c17C9.
          Length = 271

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 23/91 (25%), Positives = 47/91 (51%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLA 508
           +PQ++ N++ +S E +S  FL+ W+IGD  N+ G +    +  T   ++ ++ ++   L 
Sbjct: 34  IPQLLENYKNQSGESISDLFLIIWLIGDFFNVLGSIYGNVS-STVLVLSFYYIVSDSTLL 92

Query: 509 GQALYYSHIYPRLKSNRRWHEVSEDGAYEKG 601
            Q  YY     R  ++R    + +  + E+G
Sbjct: 93  MQIYYYRWKAARRIASREHEPLLQSRSLEEG 123



 Score = 35.0 bits (79), Expect = 0.98
 Identities = 17/41 (41%), Positives = 25/41 (60%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPAT 451
           +PQI+ N + KSTEGLS  F +   +G+    F  L+ PA+
Sbjct: 194 IPQIIKNHKAKSTEGLSIIFFVLASVGNTSYAFSILVFPAS 234



>gb:CR382132_1665569 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 268

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 20/71 (28%), Positives = 39/71 (54%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLA 508
           +PQ++  +R +S EG++  F+L W++GD+ N+ G L          ++AV+F      + 
Sbjct: 25  LPQLIEQWRLQSAEGIAIGFILVWLVGDITNLAGALW-AGLRSNVVFLAVWFCFADGLII 83

Query: 509 GQALYYSHIYP 541
              +YY++  P
Sbjct: 84  ASYVYYTYYKP 94



 Score = 32.0 bits (71), Expect = 8.3
 Identities = 14/29 (48%), Positives = 20/29 (68%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDL 415
           +PQI+ N R KS EGLS  F +  ++G+L
Sbjct: 184 IPQIIRNTRRKSVEGLSLLFFIFSLLGNL 212



>gb:CR382130_1662386 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 324

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 30/83 (36%), Positives = 39/83 (46%), Gaps = 1/83 (1%)
 Frame = +2

Query: 335 QIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLAGQ 514
           Q   NFR K  +G S  FLL WI GD   ++G LL    LP Q ++A ++      L  Q
Sbjct: 28  QCYANFRNKRVDGFSFGFLLCWIGGDTFALWGALL-THQLPFQIFLATYYCGIDAILLSQ 86

Query: 515 ALYYSHI-YPRLKSNRRWHEVSE 580
             YY  + Y   K      EV+E
Sbjct: 87  YFYYETLGYGAHKMESTGPEVTE 109



>sp|Q10227|YD03_SCHPO Hypothetical protein C2E12.03c in chromosome
           I.>pir|T38532|T38532 hypothetical protein SPAC2E12.03c -
           fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC2E12_1717583 S.pombe chromosome I cosmid
           c2E12.
          Length = 283

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 2/77 (2%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDL-CNIFGCLLE-PATLPTQTYMAVFFTLTTFG 502
           +PQI+ N+R KSTEGL   F+L+W++  +  +++  + E    L  Q  +      TTF 
Sbjct: 35  IPQIIKNYRAKSTEGLDTLFILSWVVASIPLSVYNQVQELNIALKVQPELFQALAFTTF- 93

Query: 503 LAGQALYYSHIYPRLKS 553
              Q LYY   +P  K+
Sbjct: 94  --FQCLYYGSKWPLRKA 108



>gb:AE017342_1754919 Cryptococcus neoformans var. neoformans JEC21
           chromosome 2, complete sequence.
          Length = 244

 Score = 42.4 bits (98), Expect = 0.006
 Identities = 22/70 (31%), Positives = 37/70 (52%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLA 508
           +PQ++ ++REKST+GLS   +  W +G + +    + +  ++P Q    VF  L T    
Sbjct: 24  IPQVIKSYREKSTKGLSASLMFIWALGTVIHGAYIVAQNFSIPLQVQPQVFAALATVSWC 83

Query: 509 GQALYYSHIY 538
            Q L+Y   Y
Sbjct: 84  -QCLHYDRGY 92



>gb:AJ720314_2502501 Gallus gallus mRNA for hypothetical protein,
           clone 14o18.
          Length = 303

 Score = 41.2 bits (95), Expect = 0.014
 Identities = 27/102 (26%), Positives = 40/102 (39%), Gaps = 1/102 (0%)
 Frame = +2

Query: 224 SQWALEYMDYCLCSSKDEXXXXXXXXXXXXXXXXEVPQIMTNFREKSTE-GLSCWFLLTW 400
           ++W L  +  C    +D                  +PQ     +    +  LS +FLL W
Sbjct: 21  ARWVLRLLGECARDGRDVGSALLGLLSIGCFAAAALPQFYQACKTGIMDRALSIYFLLGW 80

Query: 401 IIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLAGQALYY 526
           + GDL N+ G  L    LP Q Y AV++ L    +     YY
Sbjct: 81  LGGDLLNLIGSFL-ANQLPLQVYTAVYYVLADLVMLSLYGYY 121



>sp|Q03687|YMP0_YEAST Hypothetical 46.9 kDa protein in PLB1-HXT2
           intergenic region.>pir|S53040|S53040 probable membrane
           protein YMR010w - yeast (Saccharomyces
           cerevisiae)>gb:AY558117_1614344 Saccharomyces cerevisiae
           clone FLH110903.01X YMR010W gene, complete
           cds.>gb:SC8270_1705557 S.cerevisiae chromosome XIII
           cosmid 8270.
          Length = 405

 Score = 40.4 bits (93), Expect = 0.023
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 1/75 (1%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLT-TFGL 505
           +PQI   ++ KS +G     L++W+ GD   I   +     +     +   F ++  F +
Sbjct: 269 LPQIAILYKLKSVQGFKLILLVSWLCGDTLKITYLIFGAKNISALFVIFALFQMSLDFYI 328

Query: 506 AGQALYYSHIYPRLK 550
            GQ +YY + YP+L+
Sbjct: 329 GGQYIYYRYYYPKLR 343



>gb:BC088186_2110385 Rattus norvegicus cDNA clone MGC:108854
           IMAGE:7369419, complete cds.
          Length = 247

 Score = 38.9 bits (89), Expect = 0.068
 Identities = 25/83 (30%), Positives = 39/83 (46%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLA 508
           VPQ+  N+R +STEG+S   +L W  GD       LL  A L   +   +   +    + 
Sbjct: 163 VPQLYRNYRHRSTEGMSLKMVLMWTSGDTFKTAYFLLNGAPLQF-SVCGLLQVMVDLAIL 221

Query: 509 GQALYYSHIYPRLKSNRRWHEVS 577
           GQA  ++H +P+  +    H  S
Sbjct: 222 GQAYAFAH-HPQKPAPHAVHPAS 243



>gb:BC074639_2558134 Xenopus tropicalis MGC69309 protein, mRNA (cDNA
           clone MGC:69309 IMAGE:5308672), complete cds.
          Length = 229

 Score = 36.2 bits (82), Expect = 0.44
 Identities = 15/30 (50%), Positives = 21/30 (70%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLC 418
           +PQI+TNFR KS EGL+    L  ++ +LC
Sbjct: 132 IPQIVTNFRRKSVEGLALGMFLLMMVENLC 161



>gb:CR382124_1656968 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 360

 Score = 35.4 bits (80), Expect = 0.75
 Identities = 20/83 (24%), Positives = 39/83 (46%), Gaps = 1/83 (1%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLT-TFGL 505
           +PQI   ++ KS +G     L++W+ GD+  I   +   + +         F ++    +
Sbjct: 257 LPQISIFYKLKSVQGFKLIILVSWLCGDILKISYLVFGASNISVIFLCFGLFQMSLDIYI 316

Query: 506 AGQALYYSHIYPRLKSNRRWHEV 574
           A Q +YY + YP L+ +    E+
Sbjct: 317 ACQYIYYKYYYPSLRHDEENPEI 339



>gb:BC043686_2098951 Mus musculus PQ loop repeat containing 1, mRNA
           (cDNA clone MGC:49294 IMAGE:5135928), complete cds.
          Length = 271

 Score = 34.7 bits (78), Expect = 1.3
 Identities = 24/83 (28%), Positives = 38/83 (45%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLA 508
           VPQ+  N+  +STEG+S   +L W  GD       LL  A L   +   +   +    + 
Sbjct: 187 VPQLYRNYCHRSTEGMSLKMVLMWTSGDTFKTAYFLLNGAPLQF-SVCGLLQVMVDLVIL 245

Query: 509 GQALYYSHIYPRLKSNRRWHEVS 577
           GQA  ++H +P+  +    H  S
Sbjct: 246 GQAYAFAH-HPQKPAAHAVHPAS 267



>gb:AK026031_1910485 Homo sapiens cDNA: FLJ22378 fis, clone
           HRC07430.
          Length = 170

 Score = 34.7 bits (78), Expect = 1.3
 Identities = 22/67 (32%), Positives = 32/67 (47%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLA 508
           VPQ+  N R +STEG+S   +L W  GD       LL+ A L   +   +   L    + 
Sbjct: 86  VPQLYRNHRHQSTEGMSIKMVLMWTSGDAFKTAYFLLKGAPLQF-SVCGLLQVLVDLAIL 144

Query: 509 GQALYYS 529
           GQA  ++
Sbjct: 145 GQAYAFA 151



>gb:CQ834734_1454033 Sequence 605 from Patent
           WO2004058805.>gb:BC030140_1979728 Homo sapiens PQ loop
           repeat containing 1, mRNA (cDNA clone MGC:20614
           IMAGE:4761671), complete cds.
          Length = 271

 Score = 34.7 bits (78), Expect = 1.3
 Identities = 22/67 (32%), Positives = 32/67 (47%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLA 508
           VPQ+  N R +STEG+S   +L W  GD       LL+ A L   +   +   L    + 
Sbjct: 187 VPQLYRNHRHQSTEGMSIKMVLMWTSGDAFKTAYFLLKGAPLQF-SVCGLLQVLVDLAIL 245

Query: 509 GQALYYS 529
           GQA  ++
Sbjct: 246 GQAYAFA 252



>gb:AK018759_1159740 Mus musculus adult male liver cDNA, RIKEN
           full-length enriched library, clone:1300006G03
           product:weakly similar to SD10385P [Drosophila
           melanogaster], full insert sequence.
          Length = 271

 Score = 34.7 bits (78), Expect = 1.3
 Identities = 24/83 (28%), Positives = 38/83 (45%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLA 508
           VPQ+  N+  +STEG+S   +L W  GD       LL  A L   +   +   +    + 
Sbjct: 187 VPQLYRNYCHRSTEGMSLKMVLMWTSGDTFKTAYFLLNGAPLQF-SVCGLLQVMVDLVIL 245

Query: 509 GQALYYSHIYPRLKSNRRWHEVS 577
           GQA  ++H +P+  +    H  S
Sbjct: 246 GQAYAFAH-HPQKPAAHAVHPAS 267



>gb:AK009256_1155030 Mus musculus adult male tongue cDNA, RIKEN
           full-length enriched library, clone:2310009N05
           product:weakly similar to SD10385P [Drosophila
           melanogaster], full insert sequence.>gb:BC008231_2090672
           Mus musculus PQ loop repeat containing 1, mRNA (cDNA
           clone MGC:6795 IMAGE:2647794), complete
           cds.>gb:BC029179_2096506 Mus musculus PQ loop repeat
           containing 1, mRNA (cDNA clone MGC:36695 IMAGE:3487991),
           complete cds.
          Length = 253

 Score = 34.7 bits (78), Expect = 1.3
 Identities = 24/83 (28%), Positives = 38/83 (45%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLA 508
           VPQ+  N+  +STEG+S   +L W  GD       LL  A L   +   +   +    + 
Sbjct: 169 VPQLYRNYCHRSTEGMSLKMVLMWTSGDTFKTAYFLLNGAPLQF-SVCGLLQVMVDLVIL 227

Query: 509 GQALYYSHIYPRLKSNRRWHEVS 577
           GQA  ++H +P+  +    H  S
Sbjct: 228 GQAYAFAH-HPQKPAAHAVHPAS 249



>gb:CR382128_1660517 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 268

 Score = 33.5 bits (75), Expect = 2.9
 Identities = 15/39 (38%), Positives = 24/39 (61%)
 Frame = +2

Query: 326 EVPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLE 442
           ++PQI TNF  KST  LS + ++ ++ G L  +F  + E
Sbjct: 188 KLPQIYTNFANKSTGKLSTFSVVNYLAGSLARVFTTMQE 226



>gb:AJ627422_527955 Uncultured crenarchaeote genomic fragment 54d9.
          Length = 89

 Score = 33.5 bits (75), Expect = 2.9
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 1/60 (1%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIG-DLCNIFGCLLEPATLPTQTYMAVFFTLTTFGL 505
           VPQI  + + K T+ +S W +++ I+G  L  I+G +     + +   + V   L  FGL
Sbjct: 22  VPQISKSLKTKKTDDVSKWLIISLIVGLSLWVIYGIMKGDIVIASANAIGVTLNLILFGL 81



>gb:BC044024_2548430 Xenopus laevis similar to myeloid ecotropic
           viral integration site-related gene 1, mRNA (cDNA clone
           MGC:52546 IMAGE:5571486), complete cds.
          Length = 451

 Score = 33.1 bits (74), Expect = 3.7
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = -3

Query: 385 PTGEPLRGFLPEVSHNLGNLSHRPAQHTQRPQHQRNFILTAAQAVVHV 242
           P G P  G+ P +  +   L H P+ H+  P H  + IL A  +  H+
Sbjct: 383 PMGFPPAGYTPAIPPHSAGLRHGPSLHSYLPGHPHSMILPAGASPHHL 430



>gb:AE017342_1754890 Cryptococcus neoformans var. neoformans JEC21
           chromosome 2, complete sequence.
          Length = 305

 Score = 33.1 bits (74), Expect = 3.7
 Identities = 20/70 (28%), Positives = 32/70 (45%)
 Frame = +2

Query: 329 VPQIMTNFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLA 508
           +PQI+ + REK+T+GLS   +  W +  L      + +  ++P Q     F  L      
Sbjct: 24  LPQIIKSHREKTTKGLSASLMFIWALASLFLGAYIVAQKLSIPLQIQPQAFGVLAAVSWC 83

Query: 509 GQALYYSHIY 538
            Q L+Y   Y
Sbjct: 84  -QCLHYDRGY 92



>gb:AE015940_320517 Clostridium tetani E88, section 5 of 10 of the
           complete genome.>gb:AE015927_963306 Clostridium tetani
           E88, complete genome.
          Length = 247

 Score = 32.7 bits (73), Expect = 4.9
 Identities = 27/87 (31%), Positives = 40/87 (45%)
 Frame = +2

Query: 347 NFREKSTEGLSCWFLLTWIIGDLCNIFGCLLEPATLPTQTYMAVFFTLTTFGLAGQALYY 526
           N++EK  E L   F L ++ G    I+  +L    L    +   F  L T GLA   LY+
Sbjct: 97  NYKEKFKESLG--FYLRYL-GLSIIIYAIILGVTLLSIFAFRVPFIALLTIGLA---LYF 150

Query: 527 SHIYPRLKSNRRWHEVSEDGAYEKGTE 607
             +    KS   +H+ + + A EKG E
Sbjct: 151 EIVLMPCKSYLVYHDTTPEIALEKGKE 177



>gb:AE014297_1140912 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003741_1222905 Drosophila melanogaster
           chromosome 3R, section 79 of 118 of the complete
           sequence.
          Length = 363

 Score = 32.3 bits (72), Expect = 6.4
 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 1/35 (2%)
 Frame = +2

Query: 332 PQIMTNFREKSTEGLSCWFLLTWIIG-DLCNIFGC 433
           PQI +N+R KS EGL+  FL   I+G  L ++F C
Sbjct: 149 PQIWSNYRRKSVEGLNFDFLALNIVGFTLYSMFNC 183



>pir|G84451|G84451 probable cold-regulated protein [imported] -
           Arabidopsis thaliana>gb:AC006836_1534615 Arabidopsis
           thaliana chromosome 2 clone F19B11 map RNSI, complete
           sequence.>gb:AY087757_1572784 Arabidopsis thaliana clone
           38210 mRNA, complete sequence.
          Length = 189

 Score = 32.3 bits (72), Expect = 6.4
 Identities = 16/52 (30%), Positives = 24/52 (46%)
 Frame = -3

Query: 454 KSSWF*KAAKDVA*IPNNPR*QEPTGEPLRGFLPEVSHNLGNLSHRPAQHTQ 299
           K SW   A K     PN+P+  +   E   G++ E    +GN+S +  Q  Q
Sbjct: 44  KKSWVSAAVKGAGNSPNDPKWLDDASEKASGYVKEKGSEVGNVSAQKGQELQ 95



>sp|Q9VCR7|CTNS_DROME Cystinosin homolog.>gb:AE014297_1140911
           Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003741_1222904 Drosophila melanogaster
           chromosome 3R, section 79 of 118 of the complete
           sequence.>gb:AY119096_1300818 Drosophila melanogaster
           LP12305 full insert cDNA.
          Length = 397

 Score = 32.3 bits (72), Expect = 6.4
 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 1/35 (2%)
 Frame = +2

Query: 332 PQIMTNFREKSTEGLSCWFLLTWIIG-DLCNIFGC 433
           PQI +N+R KS EGL+  FL   I+G  L ++F C
Sbjct: 149 PQIWSNYRRKSVEGLNFDFLALNIVGFTLYSMFNC 183


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 609,310,389
Number of Sequences: 1806583
Number of extensions: 11872634
Number of successful extensions: 30476
Number of sequences better than 10.0: 55
Number of HSP's better than 10.0 without gapping: 29585
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30430
length of database: 581,917,975
effective HSP length: 119
effective length of database: 366,934,598
effective search space used: 31189440830
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)