BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig981
         (638 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY087765_1572792 Arabidopsis thaliana clone 38286 mRNA, compl...   159   3e-38   
sp|Q38825|IAA7_ARATH|IAA7_ARATH Auxin-responsive protein IAA7 (Indoleacetic...   159   3e-38   Arabidopsis thaliana [mouse-ear cress]
pir|H71407|H71407 auxin-induced protein - Arabidopsis thaliana        156   3e-37   Arabidopsis thaliana [mouse-ear cress]
pir|C85159|C85159 IAA7 like protein [imported] - Arabidopsis tha...   156   3e-37   Arabidopsis thaliana [mouse-ear cress]
sp|Q38832|IAAE_ARATH|IAAE_ARATH Auxin-responsive protein IAA14 (Indoleaceti...   156   3e-37   Arabidopsis thaliana [mouse-ear cress]
gb:PTR306829_1702723 Populus tremula x Populus tremuloides mRNA ...   150   2e-35   
gb:AF373100_1792696 Populus tremula x Populus tremuloides auxin-...   147   1e-34   
gb:AY087284_1572317 Arabidopsis thaliana clone 33613 mRNA, compl...   145   4e-34   
sp|P93830|IAAH_ARATH|IAAH_ARATH Auxin-responsive protein IAA17 (Indoleaceti...   145   4e-34   Arabidopsis thaliana [mouse-ear cress]
gb:AF040632_1763404 Arabidopsis thaliana IAA17/AXR3-1 protein (A...   142   6e-33   
gb:PTR306830_1702724 Populus tremula x Populus tremuloides mRNA ...   141   1e-32   
gb:AJ843999_1814691 Plantago major mRNA for auxin resistance pro...   134   1e-30   
sp|O24407|IAAG_ARATH|IAAG_ARATH Auxin-responsive protein IAA16 (Indoleaceti...   133   3e-30   Arabidopsis thaliana [mouse-ear cress]
gb:AB029148_1518138 Cucumis sativus mRNA expressed in cucumber h...   129   3e-29   
gb:AF123508_1769923 Nicotiana tabacum Nt-iaa28 deduced protein m...   128   9e-29   
sp|P13089|AX28_SOYBN|AX28_SOYBN Auxin-induced protein AUX28.>pir|A28993|A28...   127   1e-28   Glycine max [soybeans]
gb:ATU18416_1556802 Arabidopsis thaliana IAA14 (IAA14) gene, par...   127   2e-28   
pir|S58501|S58501 auxin-induced protein IAA14 - Arabidopsis thal...   125   6e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AY129669_1581148 Mirabilis jalapa auxin-responsive protein IA...   120   3e-26   
gb:TAE575098_1724464 Triticum aestivum partial mRNA for IAA1 pro...   116   4e-25   
gb:AC096855_1736355 Oryza sativa chromosome 3 BAC OJ1365_D05 gen...   114   2e-24   
gb:OSA563599_1692714 Oryza sativa (indica cultivar-group) iaa1 g...   114   2e-24   
gb:OSA251791_1692420 Oryza sativa partial mRNA for putative IAA1...   113   2e-24   
gb:AF123509_1769924 Nicotiana tabacum Nt-iaa4.1 deduced protein ...   110   3e-23   
gb:AF026531_1762202 Pisum sativum putative IAA-related protein g...   108   6e-23   
gb:AY289603_1594944 Pinus taeda auxin-induced protein 4 (IAA4) m...    96   4e-19   
gb:AF022018_1761755 Lycopersicon esculentum auxin-regulated IAA7...    93   3e-18   
pir|T05499|T05499 auxin-induced protein IAA7 - tomato (fragment)       93   3e-18   Solanum lycopersicum
gb:AY289604_1594945 Pinus taeda auxin-induced protein 5 (IAA5) m...    93   4e-18   
gb:AC145379_1744348 Oryza sativa chromosome 3 BAC OSJNBa0010N03 ...    92   7e-18   
gb:AY289600_1594941 Pinus taeda auxin-induced protein 1 (IAA1) m...    92   1e-17   
sp|Q38826|IAA8_ARATH|IAA8_ARATH Auxin-responsive protein IAA8 (Indoleacetic...    91   2e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AY289601_1594942 Pinus taeda auxin-induced protein 2 (IAA2) m...    89   5e-17   
gb:PTR306825_1702719 Populus tremula x Populus tremuloides mRNA ...    89   6e-17   
gb:AF016633_1761508 Glycine max GH1 protein (GH1) mRNA, partial ...    89   8e-17   
pir|T05726|T05726 GH1 protein - soybean (fragment)                     89   8e-17   Glycine max [soybeans]
gb:AB026822_1517413 Cucumis sativus CsIAA2 mRNA for Aux/IAA prot...    88   1e-16   
gb:PPI315675_1701380 Pinus pinaster mRNA for putative auxin indu...    87   2e-16   
gb:AY098938_1576502 Solanum tuberosum Aux/IAA protein mRNA, comp...    87   2e-16   
gb:AY087089_1572125 Arabidopsis thaliana clone 31563 mRNA, compl...    87   3e-16   
gb:AB010075_1510979 Arabidopsis thaliana genomic DNA, chromosome...    87   3e-16   
sp|Q38827|IAA9_ARATH|IAA9_ARATH Auxin-responsive protein IAA9 (Indoleacetic...    87   3e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AY289602_1594943 Pinus taeda auxin-induced protein 3 (IAA3) m...    86   4e-16   
gb:AY781902_1628331 Saccharum hybrid cultivar isolate c57 auxin-...    85   9e-16   
sp|P32294|AX2B_PHAAU|AX2B_PHAAU Auxin-induced protein 22B (Indole-3-acetic ...    85   9e-16   Vigna radiata var. radiata [golden gram]
gb:AP003374_1828707 Oryza sativa (japonica cultivar-group) genom...    85   1e-15   
gb:AF022020_1761757 Lycopersicon esculentum auxin-regulated IAA9...    85   1e-15   
pir|T05708|T05708 auxin-induced protein IAA9 - tomato (fragment)       85   1e-15   Solanum lycopersicum
sp|O24542|AX2D_PHAAU|AX2D_PHAAU Auxin-induced protein 22D (Indole-3-acetic ...    84   2e-15   Vigna radiata var. radiata [golden gram]
gb:NTA417876_1691404 Nicotiana tabacum mRNA for IAA9 protein.          83   3e-15   
gb:GHI458442_1680050 Gossypium hirsutum mRNA for IAA16 protein.        83   3e-15   
gb:AY082522_1569184 Vitis vinifera Aux/IAA protein mRNA, complet...    83   3e-15   
gb:AY090553_1574159 Zinnia elegans auxin-regulated protein (IAA8...    83   4e-15   
sp|Q9ZSY8|IAAR_ARATH|IAAR_ARATH Auxin-responsive protein IAA27 (Indoleaceti...    83   4e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AF026532_1762203 Pisum sativum putative IAA-related protein g...    82   8e-15   
gb:AC145396_1744454 Oryza sativa (japonica cultivar-group) chrom...    82   1e-14   
gb:AY062215_1565008 Antirrhinum majus auxin-induced AUX/IAA1 mRN...    82   1e-14   
gb:AF022021_1761758 Lycopersicon esculentum auxin-regulated IAA1...    81   2e-14   
pir|T05709|T05709 auxin-induced protein IAA10 - tomato (fragment)      81   2e-14   Solanum lycopersicum
gb:AY337616_1600425 Gossypium barbadense Gbiaa-Re (iaa-re) mRNA,...    80   2e-14   
pir|S12243|S12243 auxin-induced protein AUX2-11 - Arabidopsis th...    80   3e-14   Arabidopsis thaliana [mouse-ear cress]
sp|P33077|IAA4_ARATH|IAA4_ARATH Auxin-responsive protein IAA4 (Indoleacetic...    80   3e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AF027157_1762245 Arabidopsis thaliana auxin-responsive protei...    80   4e-14   
gb:AP004784_1845015 Oryza sativa (japonica cultivar-group) genom...    79   5e-14   
gb:PTR306831_1702725 Populus tremula x Populus tremuloides mRNA ...    79   8e-14   
gb:AB026823_1517414 Cucumis sativus CsIAA3 mRNA for Aux/IAA prot...    78   1e-13   
gb:AY847064_1630742 Avena sativa Aux/IAA3 mRNA, partial cds.           77   2e-13   
sp|Q38822|IAA3_ARATH|IAA3_ARATH Auxin-responsive protein IAA3 (Indoleacetic...    77   2e-13   Arabidopsis thaliana [mouse-ear cress]
sp|P49678|IAA2_ARATH|IAA2_ARATH Auxin-responsive protein IAA2 (Indoleacetic...    77   2e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AF169830_1774231 Glycine max auxin-induced protein ali50 mRNA...    77   3e-13   
gb:AY847062_1630740 Avena sativa Aux/IAA1 mRNA, partial cds.           77   3e-13   
gb:AC144735_1744126 Oryza sativa (japonica cultivar-group) chrom...    76   4e-13   
gb:AF123507_1769922 Nicotiana tabacum Nt-iaa4.5 deduced protein ...    76   5e-13   
gb:AF123506_1769921 Nicotiana tabacum Nt-iaa4.3 deduced protein ...    76   5e-13   
gb:AC145379_1744347 Oryza sativa chromosome 3 BAC OSJNBa0010N03 ...    76   5e-13   
gb:AP001550_1821298 Oryza sativa (japonica cultivar-group) genom...    74   2e-12   
gb:PSIAA45D_1702189 P.sativum PS-IAA4/5 gene.                          73   5e-12   
sp|P49679|IAA4_PEA|IAA4_PEA Auxin-induced protein IAA4.>pir|S39075|S39075...    73   5e-12   Pisum sativum [garden pea]
sp|O24543|AX2E_PHAAU|AX2E_PHAAU Auxin-induced protein 22E (Indole-3-acetic ...    73   5e-12   Vigna radiata var. radiata [golden gram]
gb:AF123504_1769919 Nicotiana tabacum Nt-iaa2.3 deduced protein ...    72   8e-12   
gb:AP002524_1822385 Oryza sativa (japonica cultivar-group) genom...    71   2e-11   
gb:ATHIAA1A_1553240 Arabidopsis thaliana auxin-responsive protei...    71   2e-11   
sp|P49677|IAA1_ARATH|IAA1_ARATH Auxin-responsive protein IAA1 (Indoleacetic...    71   2e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AP003835_1833996 Oryza sativa (japonica cultivar-group) genom...    70   4e-11   
gb:AC144738_1744170 Oryza sativa (japonica cultivar-group) chrom...    69   5e-11   
gb:AC093713_1736106 Oryza sativa chromosome 3 BAC OSJNBa0094F01 ...    69   9e-11   
sp|Q9C966|IAAF_ARATH|IAAF_ARATH Auxin-responsive protein IAA15 (Indoleaceti...    68   1e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AP004236_1839117 Oryza sativa (japonica cultivar-group) genom...    67   2e-10   
sp|Q38824|IAA6_ARATH|IAA6_ARATH Auxin-responsive protein IAA6 (Indoleacetic...    67   3e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AY085353_1570424 Arabidopsis thaliana clone 147711 mRNA, comp...    66   6e-10   
pir|S58493|S58493 auxin-induced protein IAA6 - Arabidopsis thali...    66   6e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AY681124_1622096 Citrus limon auxin-induced protein 22D mRNA,...    64   2e-09   
gb:AB061223_1521995 Physcomitrella patens PpIAA1b mRNA for IAA/A...    64   2e-09   
gb:AB061222_1521994 Physcomitrella patens PpIAA1a mRNA for IAA/A...    64   2e-09   
gb:AF123505_1769920 Nicotiana tabacum Nt-iaa2.5 deduced protein ...    61   1e-08   
gb:AF022015_1761752 Lycopersicon esculentum auxin-regulated IAA4...    61   1e-08   
pir|T05364|T05364 auxin-induced protein IAA4 - tomato (fragment)       61   1e-08   Solanum lycopersicum
gb:AF022019_1761756 Lycopersicon esculentum auxin-regulated IAA8...    60   3e-08   
pir|T05706|T05706 auxin-induced protein IAA8 - tomato (fragment)       60   3e-08   Solanum lycopersicum
sp|O24409|IAAJ_ARATH|IAAJ_ARATH Auxin-responsive protein IAA19 (Indoleaceti...    60   4e-08   Arabidopsis thaliana [mouse-ear cress]
sp|P13088|AX22_SOYBN|AX22_SOYBN Auxin-induced protein AUX22.>pir|B28993|B28...    60   4e-08   Glycine max [soybeans]
gb:AC144740_1744194 Oryza sativa (japonica cultivar-group) chrom...    59   7e-08   
gb:AP003768_1833262 Oryza sativa (japonica cultivar-group) genom...    59   9e-08   
gb:AY088753_1573766 Arabidopsis thaliana clone 94231 mRNA, compl...    59   9e-08   
gb:ATU49075_1557046 Arabidopsis thaliana early auxin-induced (IA...    58   1e-07   
gb:ATU18407_1556793 Arabidopsis thaliana IAA5 (IAA5) gene, parti...    58   2e-07   
pir|G86289|G86289 auxin-induced protein AUX2-27 [imported] - Ara...    58   2e-07   Arabidopsis thaliana [mouse-ear cress]
pir|S58492|S58492 auxin-induced protein IAA5 - Arabidopsis thaliana    58   2e-07   Arabidopsis thaliana [mouse-ear cress]
sp|P33078|IAA5_ARATH|IAA5_ARATH Auxin-responsive protein IAA5 (Indoleacetic...    58   2e-07   Arabidopsis thaliana [mouse-ear cress]
pir|S12244|S12244 auxin-induced protein AUX2-27 - Arabidopsis th...    56   5e-07   Arabidopsis thaliana [mouse-ear cress]
gb:PSIAA6R_1702191 P.sativum mRNA for auxin-induced protein (clo...    56   6e-07   
sp|P49680|IAA6_PEA|IAA6_PEA Auxin-induced protein IAA6.>pir|S39078|S39078...    56   6e-07   Pisum sativum [garden pea]
gb:AP005394_1851031 Oryza sativa (japonica cultivar-group) genom...    55   8e-07   
sp|P32293|AX2A_PHAAU|AX2A_PHAAU Auxin-induced protein 22A (Indole-3-acetic ...    55   1e-06   Vigna radiata var. radiata [golden gram]
pir|T05400|T05400 hypothetical protein F10M6.80 - Arabidopsis th...    54   2e-06   Arabidopsis thaliana [mouse-ear cress]
sp|O24541|AX2C_PHAAU|AX2C_PHAAU Auxin-induced protein 22C (Indole-3-acetic ...    54   2e-06   Vigna radiata var. radiata [golden gram]
gb:AY137961_1582213 Mirabilis jalapa clone SM-36 Aux/IAA1 mRNA, ...    52   7e-06   
gb:AB026821_1517412 Cucumis sativus CsIAA1 mRNA for Aux/IAA prot...    52   7e-06   
gb:AP004732_1843950 Oryza sativa (japonica cultivar-group) genom...    52   8e-06   
gb:AF022017_1761754 Lycopersicon esculentum auxin-regulated IAA6...    52   8e-06   
pir|T05368|T05368 auxin-induced protein IAA6 - tomato (fragment)       52   8e-06   Solanum lycopersicum
gb:AF022014_1761751 Lycopersicon esculentum auxin-regulated IAA3...    51   2e-05   
gb:AY099670_1576695 Arabidopsis thaliana early auxin-inducible p...    51   2e-05   
pir|T04352|T04352 auxin-induced protein IAA3 - tomato (fragment)       51   2e-05   Solanum lycopersicum
sp|Q38829|IAAB_ARATH|IAAB_ARATH Auxin-responsive protein IAA11 (Indoleaceti...    51   2e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AY137962_1582214 Mirabilis jalapa clone RS-31 Aux/IAA2 mRNA, ...    50   2e-05   
pir|S58499|S58499 auxin regulated protein (IAA13) [imported] - A...    50   2e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AF088281_1767266 Arabidopsis thaliana phytochrome-associated ...    50   4e-05   
gb:AY087745_1572773 Arabidopsis thaliana clone 38146 mRNA, compl...    50   4e-05   
sp|Q8LAL2|IAAQ_ARATH|IAAQ_ARATH Auxin-responsive protein IAA26 (Indoleaceti...    50   4e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AY088042_1573066 Arabidopsis thaliana clone 40608 mRNA, compl...    49   7e-05   
sp|Q38830|IAAC_ARATH|IAAC_ARATH Auxin-responsive protein IAA12 (Indoleaceti...    49   7e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AF022012_1761749 Lycopersicon esculentum auxin-regulated IAA1...    48   1e-04   
pir|T04345|T04345 auxin-induced protein IAA1 - tomato (fragment)       48   1e-04   Solanum lycopersicum
gb:AP002743_1822682 Oryza sativa (japonica cultivar-group) genom...    48   2e-04   
gb:AF022013_1761750 Lycopersicon esculentum auxin-regulated IAA2...    47   2e-04   
gb:T1N24_1723668 Arabidopsis thaliana BAC T1N24.                       47   2e-04   
gb:PTR306828_1702722 Populus tremula x Populus tremuloides mRNA ...    47   2e-04   
pir|S58502|S58502 probable IAA15 pseudogene - Arabidopsis thaliana     47   2e-04   Arabidopsis thaliana [mouse-ear cress]
pir|T04350|T04350 auxin-induced protein IAA2 - tomato (fragment)       47   2e-04   Solanum lycopersicum
sp|Q9XFM0|IAAS_ARATH|IAAS_ARATH Auxin-responsive protein IAA28 (Indoleaceti...    47   2e-04   Arabidopsis thaliana [mouse-ear cress]
sp|Q38831|IAAD_ARATH|IAAD_ARATH Auxin-responsive protein IAA13 (Indoleaceti...    47   2e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AY254569_1593096 Gossypium barbadense auxin responsive protei...    47   3e-04   
gb:AX365265_1466305 Sequence 1 from Patent WO0206499.                  46   5e-04   
gb:AY054137_1562959 Arabidopsis thaliana AT4g32280/F10M6_80 mRNA...    46   6e-04   
sp|Q93WC4|IAAT_ARATH|IAAT_ARATH Auxin-responsive protein IAA29 (Indoleaceti...    46   6e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AP005681_1855911 Oryza sativa (japonica cultivar-group) genom...    45   8e-04   
gb:AP004028_1836595 Oryza sativa (japonica cultivar-group) genom...    44   0.002   
gb:AY847063_1630741 Avena sativa Aux/IAA2 mRNA, partial cds.           44   0.002   
gb:AP004028_1836596 Oryza sativa (japonica cultivar-group) genom...    44   0.002   
gb:AY088406_1573425 Arabidopsis thaliana clone 6493 mRNA, comple...    43   0.004   
gb:ATU49074_1557045 Arabidopsis thaliana early auxin-induced (IA...    43   0.004   
pir|T52144|T52144 auxin-induced protein IAA18 [imported] - Arabi...    43   0.004   Arabidopsis thaliana [mouse-ear cress]
sp|O24408|IAAI_ARATH|IAAI_ARATH Auxin-responsive protein IAA18 (Indoleaceti...    43   0.005   Arabidopsis thaliana [mouse-ear cress]
gb:AP005197_1849288 Oryza sativa (japonica cultivar-group) genom...    42   0.007   
gb:AC069158_1540668 Genomic Sequence for Oryza sativa, Nipponbar...    41   0.015   
gb:AF022022_1761759 Lycopersicon esculentum auxin-regulated IAA1...    41   0.020   
pir|T05712|T05712 auxin-induced protein IAA11 - tomato (fragment)      41   0.020   Solanum lycopersicum
gb:BT000543_1634821 Arabidopsis thaliana putative auxin-induced ...    40   0.033   
sp|Q8H174|IAAV_ARATH|IAAV_ARATH Auxin-responsive protein IAA31 (Indoleaceti...    40   0.033   Arabidopsis thaliana [mouse-ear cress]
sp|Q38828|IAAA_ARATH|IAAA_ARATH Auxin-responsive protein IAA10 (Indoleaceti...    39   0.057   Arabidopsis thaliana [mouse-ear cress]
gb:PTR306827_1702721 Populus tremula x Populus tremuloides mRNA ...    37   0.28    
gb:AB023482_1515593 Oryza sativa (japonica cultivar-group) genom...    37   0.37    
gb:AK128535_1917255 Homo sapiens cDNA FLJ46693 fis, clone TRACH3...    35   1.4     
gb:PTR306826_1702720 Populus tremula x Populus tremuloides mRNA ...    35   1.4     
gb:AF022016_1761753 Lycopersicon esculentum auxin-regulated IAA5...    33   3.1     
pir|T36479|T36479 probable binding protein dependent transport p...    33   3.1     Streptomyces coelicolor
pir|T05366|T05366 auxin-induced protein IAA5 - tomato (fragment)       33   3.1     Solanum lycopersicum
pir|F64603|F64603 hypothetical protein HP0670 - Helicobacter pyl...    32   7.0     Helicobacter pylori


>gb:AY087765_1572792 Arabidopsis thaliana clone 38286 mRNA, complete
           sequence.
          Length = 238

 Score =  159 bits (403), Expect = 3e-38
 Identities = 98/183 (53%), Positives = 109/183 (59%), Gaps = 9/183 (4%)
 Frame = +3

Query: 117 TDLCLGLPGGNN--ESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXXX 290
           T+LCLGLPGG    ES     +  KR FSETVDL LNL  Q N                 
Sbjct: 6   TELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNL--QSNKEGSVDLKNVSAVPK-- 61

Query: 291 HHEPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNT-----EGSEEKXXXXXXXXXAAN 455
             +  LKDP  PP KAQVVGWPPV+NYRK M  +  T     E S EK          A 
Sbjct: 62  -EKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSSGAEEASSEKAGNFGGGAAGAG 120

Query: 456 LVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFT--TIGNNGMIDFMNERKLMDLL 629
           LVKV MDGAPYLRKVDLK+Y SYQ+L DALA MF+SFT    G  GMIDFMNE KLM+LL
Sbjct: 121 LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLL 180

Query: 630 HTS 638
           ++S
Sbjct: 181 NSS 183



>sp|Q38825|IAA7_ARATH Auxin-responsive protein IAA7 (Indoleacetic
           acid-induced protein 7) (Auxin resistant
           2).>pir|S58494|S58494 auxin-induced protein IAA7 -
           Arabidopsis thaliana>gb:AB026655_1517323 Arabidopsis
           thaliana genomic DNA, chromosome 3, P1 clone:
           MXC7.>gb:ATU18409_1556795 Arabidopsis thaliana IAA7
           (IAA7) gene, complete cds.>gb:AY054651_1563305
           Arabidopsis thaliana auxin-responsive protein IAA7
           (At3g23050; MXC7.8) mRNA, complete
           cds.>gb:AY072461_1567278 Arabidopsis thaliana
           auxin-responsive protein IAA7 (At3g23050; MXC7.8) mRNA,
           complete cds.>gb:AF332395_1787208 Arabidopsis thaliana
           clone C00014 (o) indoleacetic acid-inducible protein
           IAA7 (At3g23050) mRNA, complete cds.
          Length = 243

 Score =  159 bits (403), Expect = 3e-38
 Identities = 98/183 (53%), Positives = 109/183 (59%), Gaps = 9/183 (4%)
 Frame = +3

Query: 117 TDLCLGLPGGNN--ESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXXX 290
           T+LCLGLPGG    ES     +  KR FSETVDL LNL  Q N                 
Sbjct: 11  TELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNL--QSNKEGSVDLKNVSAVPK-- 66

Query: 291 HHEPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNT-----EGSEEKXXXXXXXXXAAN 455
             +  LKDP  PP KAQVVGWPPV+NYRK M  +  T     E S EK          A 
Sbjct: 67  -EKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSSGAEEASSEKAGNFGGGAAGAG 125

Query: 456 LVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFT--TIGNNGMIDFMNERKLMDLL 629
           LVKV MDGAPYLRKVDLK+Y SYQ+L DALA MF+SFT    G  GMIDFMNE KLM+LL
Sbjct: 126 LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLL 185

Query: 630 HTS 638
           ++S
Sbjct: 186 NSS 188



>pir|H71407|H71407 auxin-induced protein - Arabidopsis thaliana
          Length = 225

 Score =  156 bits (394), Expect = 3e-37
 Identities = 94/179 (52%), Positives = 109/179 (60%), Gaps = 4/179 (2%)
 Frame = +3

Query: 114 ETDLCLGLPGGNN--ESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXX 287
           ET+LCLGLPGG    ES     +  KR FSETVDLKLNL  Q N                
Sbjct: 5   ETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNL--QSNKQGHVDLNTNGAPK-- 60

Query: 288 XHHEPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKV 467
              +  LKDP  PP KAQVVGWPPV+NYRK +     +  +EE              VKV
Sbjct: 61  --EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGEAEEAMSSGGGTVA---FVKV 115

Query: 468 CMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFT--TIGNNGMIDFMNERKLMDLLHTS 638
            MDGAPYLRKVDLK+YTSY++L DALA MF+SFT  + G  GMIDFMNE K+MDLL++S
Sbjct: 116 SMDGAPYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSS 174



>pir|C85159|C85159 IAA7 like protein [imported] - Arabidopsis
           thaliana>gb:ATCHRIV39_1545219 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 39.>gb:ATFCA1_1551505
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 1.
          Length = 234

 Score =  156 bits (394), Expect = 3e-37
 Identities = 94/179 (52%), Positives = 109/179 (60%), Gaps = 4/179 (2%)
 Frame = +3

Query: 114 ETDLCLGLPGGNN--ESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXX 287
           ET+LCLGLPGG    ES     +  KR FSETVDLKLNL  Q N                
Sbjct: 5   ETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNL--QSNKQGHVDLNTNGAPK-- 60

Query: 288 XHHEPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKV 467
              +  LKDP  PP KAQVVGWPPV+NYRK +     +  +EE              VKV
Sbjct: 61  --EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGEAEEAMSSGGGTVA---FVKV 115

Query: 468 CMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFT--TIGNNGMIDFMNERKLMDLLHTS 638
            MDGAPYLRKVDLK+YTSY++L DALA MF+SFT  + G  GMIDFMNE K+MDLL++S
Sbjct: 116 SMDGAPYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSS 174



>sp|Q38832|IAAE_ARATH Auxin-responsive protein IAA14 (Indoleacetic
           acid-induced protein 14) (SOLITARY-ROOT
           protein).>gb:AF334718_1787458 Arabidopsis thaliana IAA14
           (At4g14550) mRNA, complete cds.
          Length = 228

 Score =  156 bits (394), Expect = 3e-37
 Identities = 94/179 (52%), Positives = 109/179 (60%), Gaps = 4/179 (2%)
 Frame = +3

Query: 114 ETDLCLGLPGGNN--ESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXX 287
           ET+LCLGLPGG    ES     +  KR FSETVDLKLNL  Q N                
Sbjct: 5   ETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNL--QSNKQGHVDLNTNGAPK-- 60

Query: 288 XHHEPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKV 467
              +  LKDP  PP KAQVVGWPPV+NYRK +     +  +EE              VKV
Sbjct: 61  --EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGEAEEAMSSGGGTVA---FVKV 115

Query: 468 CMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFT--TIGNNGMIDFMNERKLMDLLHTS 638
            MDGAPYLRKVDLK+YTSY++L DALA MF+SFT  + G  GMIDFMNE K+MDLL++S
Sbjct: 116 SMDGAPYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSS 174



>gb:PTR306829_1702723 Populus tremula x Populus tremuloides mRNA for
           aux/IAA protein (IAA6 gene).
          Length = 277

 Score =  150 bits (379), Expect = 2e-35
 Identities = 95/205 (46%), Positives = 111/205 (54%), Gaps = 31/205 (15%)
 Frame = +3

Query: 117 TDLCLGLPGG---NNESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXX 287
           T+LCLGLPG     NE     K T KR F+ETVDLKLNL  +                  
Sbjct: 19  TELCLGLPGAVGVKNEVETPNKATGKRGFAETVDLKLNLQAKEGVMDLNENINNIASEDK 78

Query: 288 XH-HEPILKDPIMPPPKAQVVGWPPVKNYRKK-MAQKSNTE------------------- 404
            H     +KDP  PP KAQVVGWPPV++YRK  +AQK+ +E                   
Sbjct: 79  NHLPSATIKDPAKPPAKAQVVGWPPVRSYRKNVLAQKNASEEGFGAQVEGWPPVRSYRKN 138

Query: 405 -----GSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFT 569
                 + E+         +A  VKVCMDGAPYLRKVDLK+Y SYQ L DALA MF+S T
Sbjct: 139 VLVQKNASEEGEKASTGGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSDALAKMFSSLT 198

Query: 570 --TIGNNGMIDFMNERKLMDLLHTS 638
               G  GMIDFMNE KLMDLL++S
Sbjct: 199 MGNYGAQGMIDFMNESKLMDLLNSS 223



>gb:AF373100_1792696 Populus tremula x Populus tremuloides
           auxin-regulated protein (IAA1) mRNA, complete cds.
          Length = 249

 Score =  147 bits (371), Expect = 1e-34
 Identities = 89/186 (47%), Positives = 107/186 (57%), Gaps = 5/186 (2%)
 Frame = +3

Query: 96  TMLIHGETDLCLGLPGG--NNESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXX 269
           +M+   ET+L LGLPGG  N   +E  K   KR FSETVDLKLNL  +            
Sbjct: 14  SMMNFEETELRLGLPGGVSNGNDSEAAKSNGKRGFSETVDLKLNLSTKETGKDGSDQEKV 73

Query: 270 XXXXXXXHHEPILKDPIMPPPKAQVVGWPPVKNYRKK-MAQKSNTEGSEEKXXXXXXXXX 446
                     P   DP  PP KAQVVGWPP++++RK  MA + N+    EK         
Sbjct: 74  VMKEKTVAPRP--NDPAKPPSKAQVVGWPPIRSFRKNVMAVQKNSNDEGEKASSSGATGA 131

Query: 447 AANLVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFT--TIGNNGMIDFMNERKLM 620
           A   VKV MDGAPYLRKVDLK+Y SY+ L DAL  MF+SFT    G+ G  DFMNE KL+
Sbjct: 132 A--FVKVSMDGAPYLRKVDLKLYKSYRELSDALGKMFSSFTIGNCGSQGTKDFMNESKLI 189

Query: 621 DLLHTS 638
           DLL++S
Sbjct: 190 DLLNSS 195



>gb:AY087284_1572317 Arabidopsis thaliana clone 33613 mRNA, complete
           sequence.
          Length = 228

 Score =  145 bits (367), Expect = 4e-34
 Identities = 88/178 (49%), Positives = 104/178 (58%), Gaps = 4/178 (2%)
 Frame = +3

Query: 114 ETDLCLGLPGGNNESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXXXH 293
           ET+LCLGLPGG+  +        KR FSETVDLKLNL  +P                   
Sbjct: 10  ETELCLGLPGGDTVAPVT---GNKRGFSETVDLKLNLNNEP-ANKEGSTTHDVVTFDSKE 65

Query: 294 HEPILKDPIMPPPKAQVVGWPPVKNYRKK-MAQKSNTEGSEEKXXXXXXXXXAANLVKVC 470
                KDP  PP KAQVVGWPPV++YRK  M     + G  E          AA  VKV 
Sbjct: 66  KSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSGGPE----------AAAFVKVS 115

Query: 471 MDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTT---IGNNGMIDFMNERKLMDLLHT 635
           MDGAPYLRK+DL++Y SY  L +AL+NMF+SFT     G  GMIDFMNERKLMDL+++
Sbjct: 116 MDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNS 173



>sp|P93830|IAAH_ARATH Auxin-responsive protein IAA17 (Indoleacetic
           acid-induced protein 17) (Auxin response
           3).>pir|H86173|H86173 hypothetical protein [imported] -
           Arabidopsis thaliana>gb:AE005172_889442 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:ATU49073_1557044 Arabidopsis thaliana early
           auxin-induced (IAA17) mRNA, complete
           cds.>gb:AY070094_1566734 Arabidopsis thaliana
           auxin-induced protein IAA17/AXR3-1 (At1g04250) mRNA,
           complete cds.>gb:AY117183_1579224 Arabidopsis thaliana
           auxin-induced protein IAA17/AXR3-1 (At1g04250) mRNA,
           complete cds.>gb:F19P19_1677737 Sequence of BAC F19P19
           from Arabidopsis thaliana chromosome 1, complete
           sequence.>gb:AF040631_1763403 Arabidopsis thaliana
           IAA17/AXR3 protein (AXR3) gene, complete
           cds.>gb:AF336916_1787608 Arabidopsis thaliana
           auxin-induced protein, IAA17/AXR3-1 (At1g04250) mRNA,
           complete cds.
          Length = 229

 Score =  145 bits (367), Expect = 4e-34
 Identities = 88/178 (49%), Positives = 104/178 (58%), Gaps = 4/178 (2%)
 Frame = +3

Query: 114 ETDLCLGLPGGNNESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXXXH 293
           ET+LCLGLPGG+  +        KR FSETVDLKLNL  +P                   
Sbjct: 11  ETELCLGLPGGDTVAPVT---GNKRGFSETVDLKLNLNNEP-ANKEGSTTHDVVTFDSKE 66

Query: 294 HEPILKDPIMPPPKAQVVGWPPVKNYRKK-MAQKSNTEGSEEKXXXXXXXXXAANLVKVC 470
                KDP  PP KAQVVGWPPV++YRK  M     + G  E          AA  VKV 
Sbjct: 67  KSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSGGPE----------AAAFVKVS 116

Query: 471 MDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTT---IGNNGMIDFMNERKLMDLLHT 635
           MDGAPYLRK+DL++Y SY  L +AL+NMF+SFT     G  GMIDFMNERKLMDL+++
Sbjct: 117 MDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNS 174



>gb:AF040632_1763404 Arabidopsis thaliana IAA17/AXR3-1 protein
           (AXR3) gene, complete cds.
          Length = 229

 Score =  142 bits (357), Expect = 6e-33
 Identities = 87/178 (48%), Positives = 103/178 (57%), Gaps = 4/178 (2%)
 Frame = +3

Query: 114 ETDLCLGLPGGNNESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXXXH 293
           ET+LCLGLPGG+  +        KR FSETVDLKLNL  +P                   
Sbjct: 11  ETELCLGLPGGDTVAPVT---GNKRGFSETVDLKLNLNNEP-ANKEGSTTHDVVTFDSKE 66

Query: 294 HEPILKDPIMPPPKAQVVGWPPVKNYRKK-MAQKSNTEGSEEKXXXXXXXXXAANLVKVC 470
                KDP  PP KAQVVGWP V++YRK  M     + G  E          AA  VKV 
Sbjct: 67  KSACPKDPAKPPAKAQVVGWPLVRSYRKNVMVSCQKSSGGPE----------AAAFVKVS 116

Query: 471 MDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTT---IGNNGMIDFMNERKLMDLLHT 635
           MDGAPYLRK+DL++Y SY  L +AL+NMF+SFT     G  GMIDFMNERKLMDL+++
Sbjct: 117 MDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNS 174



>gb:PTR306830_1702724 Populus tremula x Populus tremuloides mRNA for
           aux/IAA protein (IAA7 gene).
          Length = 229

 Score =  141 bits (355), Expect = 1e-32
 Identities = 88/193 (45%), Positives = 108/193 (55%), Gaps = 9/193 (4%)
 Frame = +3

Query: 81  EIKMATMLIHGETDLCLGLPGGNNESAECLKITRKREFSETVDLKLNLP-----IQPNXX 245
           E++  T +   ET+L LGLPG      E  +  RKR FSETVDLKLNL      I PN  
Sbjct: 2   EVEKGTKMRFEETELRLGLPGNGGGGTEGGEFARKRGFSETVDLKLNLSSKEGGIDPNHE 61

Query: 246 XXXXXXXXXXXXXXXHHEPILKDPIMPPPKAQVVGWPPVKNYRKKM--AQKSNTEGSEEK 419
                              +  DP  PP KAQVVGWPPV+++RK M   QKS+T+    +
Sbjct: 62  KTRREKNL-----------LATDPAKPPAKAQVVGWPPVRSFRKNMLAVQKSSTD----Q 106

Query: 420 XXXXXXXXXAANLVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFT--TIGNNGMI 593
                     A  VKV MDGAPYLRKVDL +Y +Y  L DAL  MF+SFT    G++GM 
Sbjct: 107 ESTNKVPGGNATFVKVSMDGAPYLRKVDLNMYKTYHELSDALGKMFSSFTIGNCGSHGMK 166

Query: 594 DFMNERKLMDLLH 632
           DF+NE KL+DLL+
Sbjct: 167 DFLNESKLIDLLN 179



>gb:AJ843999_1814691 Plantago major mRNA for auxin resistance
           protein (axr2 gene).
          Length = 227

 Score =  134 bits (337), Expect = 1e-30
 Identities = 87/194 (44%), Positives = 107/194 (55%), Gaps = 9/194 (4%)
 Frame = +3

Query: 84  IKMATMLIHGETDLCLGLPGGNNESAECLKITR-----KREFSETVDLKLNLPIQ--PNX 242
           ++  T +   ET+L LGLPGG   + E  K T      KR + +TVDLKLNL  +  PN 
Sbjct: 2   VESCTKMNFEETELRLGLPGGAAAAGE--KTTNNNNYGKRGYEQTVDLKLNLSSKDLPNQ 59

Query: 243 XXXXXXXXXXXXXXXXHHEPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKX 422
                                   P+ PP KAQVVGWPPV+N+RK +     TE +EE  
Sbjct: 60  TDLAENKKND-------------QPVKPPAKAQVVGWPPVRNFRKNVMAVQKTEKAEESG 106

Query: 423 XXXXXXXXAANLVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFT--TIGNNGMID 596
                   +A  VKV MDGAPYLRKVDLK+Y +Y+ L DAL  MF+SFT       GM+D
Sbjct: 107 G-------SAAFVKVSMDGAPYLRKVDLKMYKTYEELSDALGKMFSSFTMSKCDAQGMMD 159

Query: 597 FMNERKLMDLLHTS 638
           FMNE KLMDLL+ S
Sbjct: 160 FMNESKLMDLLNGS 173



>sp|O24407|IAAG_ARATH Auxin-responsive protein IAA16 (Indoleacetic
           acid-induced protein 16).>gb:ATAC011437_1543285
           Arabidopsis thaliana chromosome III BAC F7O18 genomic
           sequence, complete sequence.>gb:ATU49072_1557043
           Arabidopsis thaliana early auxin-induced (IAA16) mRNA,
           complete cds.>gb:AY087195_1572229 Arabidopsis thaliana
           clone 32727 mRNA, complete sequence.>gb:BT000857_1635112
           Arabidopsis thaliana At3g04730/F7O18_22 mRNA, complete
           cds.>gb:AF332400_1787213 Arabidopsis thaliana clone
           C00021 (e) auxin-induced protein IAA16 (At3g04730) mRNA,
           complete cds.>gb:AF375420_1792925 Arabidopsis thaliana
           AT3g04730/F7O18_22 mRNA, complete cds.
          Length = 236

 Score =  133 bits (334), Expect = 3e-30
 Identities = 84/187 (44%), Positives = 106/187 (56%), Gaps = 13/187 (6%)
 Frame = +3

Query: 117 TDLCLGLPGGNNESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXXXHH 296
           T+L LGLPGGN+      K   KR FSETVDLKLNL                        
Sbjct: 7   TELRLGLPGGNHGGEMAGKNNGKRGFSETVDLKLNL-----------SSTAMDSVSKVDL 55

Query: 297 EPILKDPIMPPPKAQVVGWPPVKNYRKKM--AQKSNT----EGSEEKXXXXXXXXXAANL 458
           E + +  + PP KAQVVGWPPV+++RK +   QK  T    EG+++          A+  
Sbjct: 56  ENMKEKVVKPPAKAQVVGWPPVRSFRKNVMSGQKPTTGDATEGNDKTSGSSGATSSASAC 115

Query: 459 -----VKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFT--TIGNNGMIDFMNERKL 617
                VKV MDGAPYLRK+DLK+Y +YQ+L +AL+ MF+SFT    G  GM DFMNE KL
Sbjct: 116 ATVAYVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKL 175

Query: 618 MDLLHTS 638
           +DLL+ S
Sbjct: 176 IDLLNGS 182



>gb:AB029148_1518138 Cucumis sativus mRNA expressed in cucumber
           hypocotyls, complete cds.
          Length = 230

 Score =  129 bits (325), Expect = 3e-29
 Identities = 88/188 (46%), Positives = 100/188 (53%), Gaps = 13/188 (6%)
 Frame = +3

Query: 114 ETDLCLGLPGGNN-ESAECLKIT-RKREFSETV--------DLKLNLPIQPNXXXXXXXX 263
           ET+L LGLPG NN  S+E  ++  RKR F+ETV        DLKLNL  +          
Sbjct: 10  ETELRLGLPGNNNIGSSELGEVAARKRGFAETVSSETISKVDLKLNLSSKETVGVGDDDL 69

Query: 264 XXXXXXXXXHHEPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXX 443
                        +  DP  PP KAQVVGWPPV+++RK                      
Sbjct: 70  VADSNPSNKDKAVLTADPAKPPAKAQVVGWPPVRSFRKN--------------------- 108

Query: 444 XAANLVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNG---MIDFMNERK 614
                VKV MDGAPYLRKVDLK+Y SY+ L DALA MF SFTTIGN G   M DFMNE K
Sbjct: 109 NMLAFVKVSMDGAPYLRKVDLKMYKSYKQLSDALAAMFGSFTTIGNCGSQEMKDFMNESK 168

Query: 615 LMDLLHTS 638
           LMDLL  S
Sbjct: 169 LMDLLSGS 176



>gb:AF123508_1769923 Nicotiana tabacum Nt-iaa28 deduced protein
           mRNA, complete cds.
          Length = 240

 Score =  128 bits (321), Expect = 9e-29
 Identities = 84/181 (46%), Positives = 99/181 (54%), Gaps = 6/181 (3%)
 Frame = +3

Query: 114 ETDLCLGLPGG--NNESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXX 287
           ET+L LGL      NE     K   KR FSETVDLKLNL  + +                
Sbjct: 19  ETELRLGLRSAINGNEGEMTSKNNGKRVFSETVDLKLNLSSKDSTVDNQVDNIKEKKNIA 78

Query: 288 XHHEPILKDPIMPPPKAQVVGWPPVKNYRKKM--AQKSNTEGSEEKXXXXXXXXXAANLV 461
                   DP  PP KAQVVGWPPV+++RK +   QK++T   E            A  V
Sbjct: 79  P------TDPAKPPAKAQVVGWPPVRSFRKNVLTVQKNSTGNGESSGG-------GAAFV 125

Query: 462 KVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFT--TIGNNGMIDFMNERKLMDLLHT 635
           KV +DGAPYLRKVDLK+Y SYQ L DAL  MF+SFT    G +G  DFMNE KL+DLL+ 
Sbjct: 126 KVSVDGAPYLRKVDLKMYKSYQQLSDALGKMFSSFTIGNCGTHGFKDFMNESKLIDLLNG 185

Query: 636 S 638
           S
Sbjct: 186 S 186



>sp|P13089|AX28_SOYBN Auxin-induced protein AUX28.>pir|A28993|A28993
           auxin-induced protein aux28 -
           soybean>gb:SOYAUX28_1715967 Soybean auxin-regulated
           protein (Aux28) mRNA, complete cds.
          Length = 243

 Score =  127 bits (320), Expect = 1e-28
 Identities = 91/193 (47%), Positives = 105/193 (54%), Gaps = 18/193 (9%)
 Frame = +3

Query: 114 ETDLCLGLPGGNNESAECLKITRKREFSET-----------VDLKLNLPIQPNXXXXXXX 260
           ET+L LGLPG N  + E L   RKR FSET           VDL LNL  +         
Sbjct: 5   ETELRLGLPG-NGGTEEVL--IRKRGFSETETGHEDESATTVDLMLNLSSKEAATTAAAA 61

Query: 261 XXXXXXXXXXHHEPIL--KDPIMPPPKAQVVGWPPVKNYRKKM--AQKSNTEGSEEKXXX 428
                       E  L   DP  PP K QVVGWPPV+++RK M   QKS  E SE+    
Sbjct: 62  ADPTDKHKTLPKEKTLLPADPAKPPAKTQVVGWPPVRSFRKNMLAVQKSVGEESEKNSSP 121

Query: 429 XXXXXXAANLVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGN---NGMIDF 599
                  A+ VKV MDGAPYLRKVDLK+Y SY+ L D+L  MF+SF T GN    GM DF
Sbjct: 122 N------ASFVKVSMDGAPYLRKVDLKMYKSYRELSDSLGKMFSSF-TFGNCESQGMKDF 174

Query: 600 MNERKLMDLLHTS 638
           MNE KL DLL++S
Sbjct: 175 MNESKLNDLLNSS 187



>gb:ATU18416_1556802 Arabidopsis thaliana IAA14 (IAA14) gene,
           partial cds.
          Length = 164

 Score =  127 bits (318), Expect = 2e-28
 Identities = 67/113 (59%), Positives = 79/113 (69%), Gaps = 2/113 (1%)
 Frame = +3

Query: 306 LKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAP 485
           LKDP  PP KAQVVGWPPV+NYRK +     +  +EE              VKV MDGAP
Sbjct: 1   LKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGEAEEAMSSGGGTVA---FVKVSMDGAP 57

Query: 486 YLRKVDLKIYTSYQNLYDALANMFTSFT--TIGNNGMIDFMNERKLMDLLHTS 638
           YLRKVDLK+YTSY++L DALA MF+SFT  + G  GMIDFMNE K+MDLL++S
Sbjct: 58  YLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSS 110



>pir|S58501|S58501 auxin-induced protein IAA14 - Arabidopsis
           thaliana  (fragment)
          Length = 164

 Score =  125 bits (314), Expect = 6e-28
 Identities = 66/112 (58%), Positives = 78/112 (69%), Gaps = 2/112 (1%)
 Frame = +3

Query: 306 LKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAP 485
           LKDP  PP KAQVVGWPPV+NYRK +     +  +EE              VKV MDGAP
Sbjct: 1   LKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGEAEEAMSSGGGTVA---FVKVSMDGAP 57

Query: 486 YLRKVDLKIYTSYQNLYDALANMFTSFT--TIGNNGMIDFMNERKLMDLLHT 635
           YLRKVDLK+YTSY++L DALA MF+SFT  + G  GMIDFMNE K+MDLL++
Sbjct: 58  YLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNS 109



>gb:AY129669_1581148 Mirabilis jalapa auxin-responsive protein IAA1
           mRNA, partial cds.
          Length = 194

 Score =  120 bits (300), Expect = 3e-26
 Identities = 64/111 (57%), Positives = 74/111 (66%), Gaps = 2/111 (1%)
 Frame = +3

Query: 312 DPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYL 491
           D   PP KAQVVGWPPV++YRK M     + G+ E             LVKV MDGAPYL
Sbjct: 32  DLAKPPAKAQVVGWPPVRSYRKNMLAVQKSTGAPESESEKPAAN--GGLVKVSMDGAPYL 89

Query: 492 RKVDLKIYTSYQNLYDALANMFTSFT--TIGNNGMIDFMNERKLMDLLHTS 638
           RKVDLK+Y SYQ+L DAL  MF+SFT    G+ GMIDFMNE KLMDL++ S
Sbjct: 90  RKVDLKLYKSYQDLSDALGKMFSSFTLGNYGSQGMIDFMNESKLMDLINGS 140



>gb:TAE575098_1724464 Triticum aestivum partial mRNA for IAA1
           protein.
          Length = 233

 Score =  116 bits (290), Expect = 4e-25
 Identities = 70/173 (40%), Positives = 94/173 (54%), Gaps = 10/173 (5%)
 Frame = +3

Query: 117 TDLCLGLPGGNNESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXXXHH 296
           T+L LGLPGG  E+A+      KR + +T+DLKL LP                       
Sbjct: 10  TELRLGLPGGGAEAAKA----GKRGYEDTIDLKLTLPTGGMQEDSAGKPEPAADKAKRPA 65

Query: 297 EPILKDPIMPP-PKAQVVGWPPVKNYRK--------KMAQKSNTEGSEEKXXXXXXXXXA 449
           E    DP  PP PKAQ VGWPPV++YR+        K+ ++  TE  ++           
Sbjct: 66  EAAAADPEKPPAPKAQAVGWPPVRSYRRNAMTVQSVKIKKEEETE-KQQPAAAAAAGANG 124

Query: 450 ANLVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNG-MIDFMN 605
           +N VKV MDGAPYLRKVDLK+Y +Y++L  AL  MF++FT  GN G M++ +N
Sbjct: 125 SNFVKVSMDGAPYLRKVDLKMYNTYKDLSIALQKMFSTFTATGNEGKMVEAVN 177



>gb:AC096855_1736355 Oryza sativa chromosome 3 BAC OJ1365_D05
           genomic sequence, complete sequence.
          Length = 224

 Score =  114 bits (284), Expect = 2e-24
 Identities = 74/183 (40%), Positives = 91/183 (49%), Gaps = 10/183 (5%)
 Frame = +3

Query: 117 TDLCLGLPGGNNESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXXXHH 296
           T+L LGLPGG   +AE      KR F ET+DLKL LP                       
Sbjct: 10  TELRLGLPGGGGGAAEAAAKAAKRGFEETIDLKLKLPTAGMEEAAAGKAEAPAAEKAKRP 69

Query: 297 -EPILKDPIMPP-PKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAAN----- 455
            E    D   PP PKAQ VGWPPV+++R+ +    + +  +E+         AAN     
Sbjct: 70  AEAAAADAEKPPAPKAQAVGWPPVRSFRRNIMTVQSVKSKKEEEADKQQQQPAANASGSN 129

Query: 456 ---LVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNGMIDFMNERKLMDL 626
               VKV MDGAPYLRKVDLK+Y SY++L  AL  MF +FT  GNN     MNE    D 
Sbjct: 130 SSAFVKVSMDGAPYLRKVDLKMYNSYKDLSLALQKMFGTFTATGNN-----MNEVNGSDA 184

Query: 627 LHT 635
           + T
Sbjct: 185 VTT 187



>gb:OSA563599_1692714 Oryza sativa (indica cultivar-group) iaa1 gene
           for Aux/IAA protein, exons 1-6.>gb:AC096855_1736354
           Oryza sativa chromosome 3 BAC OJ1365_D05 genomic
           sequence, complete sequence.
          Length = 236

 Score =  114 bits (284), Expect = 2e-24
 Identities = 74/183 (40%), Positives = 91/183 (49%), Gaps = 10/183 (5%)
 Frame = +3

Query: 117 TDLCLGLPGGNNESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXXXHH 296
           T+L LGLPGG   +AE      KR F ET+DLKL LP                       
Sbjct: 10  TELRLGLPGGGGGAAEAAAKAAKRGFEETIDLKLKLPTAGMEEAAAGKAEAPAAEKAKRP 69

Query: 297 -EPILKDPIMPP-PKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAAN----- 455
            E    D   PP PKAQ VGWPPV+++R+ +    + +  +E+         AAN     
Sbjct: 70  AEAAAADAEKPPAPKAQAVGWPPVRSFRRNIMTVQSVKSKKEEEADKQQQQPAANASGSN 129

Query: 456 ---LVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNGMIDFMNERKLMDL 626
               VKV MDGAPYLRKVDLK+Y SY++L  AL  MF +FT  GNN     MNE    D 
Sbjct: 130 SSAFVKVSMDGAPYLRKVDLKMYNSYKDLSLALQKMFGTFTATGNN-----MNEVNGSDA 184

Query: 627 LHT 635
           + T
Sbjct: 185 VTT 187



>gb:OSA251791_1692420 Oryza sativa partial mRNA for putative IAA1
           protein (iaa1 gene).
          Length = 236

 Score =  113 bits (283), Expect = 2e-24
 Identities = 69/166 (41%), Positives = 85/166 (51%), Gaps = 10/166 (6%)
 Frame = +3

Query: 117 TDLCLGLPGGNNESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXXXHH 296
           T+L LGLPGG   +AE      KR F ET+DLKL LP                       
Sbjct: 10  TELRLGLPGGGGGAAEAAAKAAKRGFEETIDLKLKLPTAGMEEAAAGKAEAPAAEKAKRP 69

Query: 297 -EPILKDPIMPP-PKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAAN----- 455
            E    D   PP PKAQ VGWPPV+++R+ +    + +  +E+         AAN     
Sbjct: 70  AEAAAADAEKPPAPKAQAVGWPPVRSFRRNIMTVQSVKSKKEEEADKQQQQPAANASGSN 129

Query: 456 ---LVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNN 584
               VKV MDGAPYLRKVDLK+Y SY++L  AL  MF +FT  GNN
Sbjct: 130 SSAFVKVSMDGAPYLRKVDLKMYNSYKDLSLALQKMFGTFTATGNN 175



>gb:AF123509_1769924 Nicotiana tabacum Nt-iaa4.1 deduced protein
           mRNA, complete cds.
          Length = 220

 Score =  110 bits (274), Expect = 3e-23
 Identities = 61/109 (55%), Positives = 72/109 (66%), Gaps = 4/109 (3%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKM--AQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRK 497
           P PKAQVVGWPPV+++RK +   QK +T   E            A  VKV +DGAPYLRK
Sbjct: 65  PAPKAQVVGWPPVRSFRKNVLTVQKKSTGNGESSSG-------GAAFVKVSVDGAPYLRK 117

Query: 498 VDLKIYTSYQNLYDALANMFTSFT--TIGNNGMIDFMNERKLMDLLHTS 638
           VDLK+Y SYQ L DAL  MF+SFT    GN+G  DFMNE KL+DLL+ S
Sbjct: 118 VDLKMYKSYQQLSDALGKMFSSFTIGNCGNHGFKDFMNESKLIDLLNGS 166



>gb:AF026531_1762202 Pisum sativum putative IAA-related protein
           gene, partial cds.
          Length = 167

 Score =  108 bits (271), Expect = 6e-23
 Identities = 75/172 (43%), Positives = 89/172 (51%), Gaps = 17/172 (9%)
 Frame = +3

Query: 174 ITRKREFSET------------VDLKLNLPIQPNXXXXXXXXXXXXXXXXXHHEPILKDP 317
           +  KR FSET            VDLKLNL  +                       +    
Sbjct: 2   VVSKRGFSETESESESESEITTVDLKLNLSPKEGAADPQLKPKEKSLL-------VSDSG 54

Query: 318 IMPPPKAQVVGWPPVKNYRKKM-AQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLR 494
             PP KAQVVGWPPV+++RK M A + +  GSEE          A + VKV MDGAPYLR
Sbjct: 55  TKPPAKAQVVGWPPVRSFRKNMFAGQKSIGGSEETTKKSSDGSNAISFVKVSMDGAPYLR 114

Query: 495 KVDLKIYTSYQNLYDALANMFTSFTTIGN---NGMIDFMNE-RKLMDLLHTS 638
           K+DLK+Y SY  L DALA MF S T  GN    G+ DFM E  K+MDLL+TS
Sbjct: 115 KIDLKMYKSYPELSDALAKMFNSITN-GNCESQGIKDFMKESNKMMDLLNTS 165



>gb:AY289603_1594944 Pinus taeda auxin-induced protein 4 (IAA4)
           mRNA, complete cds.
          Length = 231

 Score = 96.3 bits (238), Expect = 4e-19
 Identities = 67/199 (33%), Positives = 99/199 (49%), Gaps = 1/199 (0%)
 Frame = +3

Query: 45  IEGDQREATSKPEIKMATMLIHGETDLCLGLPGGNNESAECLKITRKREFSETVDLK-LN 221
           + G ++ +T   +    ++ I  ET+L LGLPG    + E  +I  KR FSE ++ +  +
Sbjct: 5   VGGMEKSSTGAQQENKCSLDIFAETELRLGLPGV--AAGERQRICGKRSFSEAMESRNFS 62

Query: 222 LPIQPNXXXXXXXXXXXXXXXXXHHEPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNT 401
           +P +                    ++P    P   PPKAQ+VGWPPVK++RK        
Sbjct: 63  IPQEEAHKFHEPNLGTEKQMVRPANDPPKMGPT--PPKAQIVGWPPVKDFRK-------- 112

Query: 402 EGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGN 581
                          ++  VKV MDGAPYLRKVDLK+Y++Y +L  AL NMF    T+G 
Sbjct: 113 --------VRTIAASSSLYVKVSMDGAPYLRKVDLKMYSTYHDLSSALENMFGCLITMGK 164

Query: 582 NGMIDFMNERKLMDLLHTS 638
            G    + E  LMD+++ S
Sbjct: 165 CGS-SGIKESNLMDVVNGS 182



>gb:AF022018_1761755 Lycopersicon esculentum auxin-regulated IAA7
           (IAA7) mRNA, partial cds.
          Length = 102

 Score = 93.2 bits (230), Expect = 3e-18
 Identities = 52/96 (54%), Positives = 65/96 (67%), Gaps = 3/96 (3%)
 Frame = +3

Query: 360 VKNYRKKM-AQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVDLKIYTSYQNLY 536
           V+++RK M +QK N   +  +          A  VKV MDGAPYLRKVDLK+Y SYQ L 
Sbjct: 1   VRSFRKNMLSQKGNNNNNNNEEISEKDEKTIA-FVKVSMDGAPYLRKVDLKMYKSYQQLS 59

Query: 537 DALANMFTSFT--TIGNNGMIDFMNERKLMDLLHTS 638
            +L NMF+SFT    G+ GMIDFMNERKLMD+L++S
Sbjct: 60  HSLTNMFSSFTMGNYGSQGMIDFMNERKLMDVLNSS 95



>pir|T05499|T05499 auxin-induced protein IAA7 - tomato (fragment)
          Length = 102

 Score = 93.2 bits (230), Expect = 3e-18
 Identities = 52/96 (54%), Positives = 65/96 (67%), Gaps = 3/96 (3%)
 Frame = +3

Query: 360 VKNYRKKM-AQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVDLKIYTSYQNLY 536
           V+++RK M +QK N   +  +          A  VKV MDGAPYLRKVDLK+Y SYQ L 
Sbjct: 1   VRSFRKNMLSQKGNNNNNNNEEISEKDEKTIA-FVKVSMDGAPYLRKVDLKMYKSYQQLS 59

Query: 537 DALANMFTSFT--TIGNNGMIDFMNERKLMDLLHTS 638
            +L NMF+SFT    G+ GMIDFMNERKLMD+L++S
Sbjct: 60  HSLTNMFSSFTMGNYGSQGMIDFMNERKLMDVLNSS 95



>gb:AY289604_1594945 Pinus taeda auxin-induced protein 5 (IAA5)
           mRNA, complete cds.
          Length = 252

 Score = 92.8 bits (229), Expect = 4e-18
 Identities = 67/185 (36%), Positives = 87/185 (47%), Gaps = 14/185 (7%)
 Frame = +3

Query: 114 ETDLCLGLPG-GNNESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXXX 290
           ET+L LGLPG   +ES    K   KR FSE ++ +                         
Sbjct: 32  ETELKLGLPGVAADESRAHQKSCGKRSFSEAMESR-----SYTITDVDITRTGTPEDADK 86

Query: 291 HHEPILKDPIM-------------PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXX 431
            H PI+K+  M             PPPKAQ+VGWPPVK++RK                  
Sbjct: 87  FHGPIVKEKQMALPANDPATTGSRPPPKAQIVGWPPVKDFRK----------------VR 130

Query: 432 XXXXXAANLVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNGMIDFMNER 611
                 +  VKV MDGAPYLRKV+LKIY++Y +L  AL NMF+   T+G +     +NE 
Sbjct: 131 TISTCDSLYVKVSMDGAPYLRKVNLKIYSTYHDLSSALENMFSCLLTMGKS-RSHGLNES 189

Query: 612 KLMDL 626
            LMD+
Sbjct: 190 SLMDM 194



>gb:AC145379_1744348 Oryza sativa chromosome 3 BAC OSJNBa0010N03
           genomic sequence, complete sequence.>gb:AC145780_1744490
           Oryza sativa chromosome 3 BAC OSJNBb0069P02 genomic
           sequence, complete sequence.
          Length = 233

 Score = 92.0 bits (227), Expect = 7e-18
 Identities = 75/192 (39%), Positives = 92/192 (47%), Gaps = 22/192 (11%)
 Frame = +3

Query: 114 ETDLCLGLPGGNNESAECLKITRKREFSETVDLKLNL-PIQP-----NXXXXXXXXXXXX 275
           ET+L LGLPG    +A   + + KR F+ET+DLKL L P  P                  
Sbjct: 8   ETELRLGLPGAGELAA---RSSGKRGFAETIDLKLKLQPAAPAAVSGEEGAQEDKEDADA 64

Query: 276 XXXXXHHEPILK-------------DPIMP-PPKAQVVGWPPVKNYRKK-MAQKSNTEGS 410
                  +  +K             DP  P  PKAQVVGWPPV+++RK  +A+K      
Sbjct: 65  AAAAADEKMSMKRSASQSSVVTAEPDPDKPRAPKAQVVGWPPVRSFRKNVLAEKCK---- 120

Query: 411 EEKXXXXXXXXXAANLVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNGM 590
                       AA LVKV MDGAPYLRK+D+ +Y SY  L  A  NMFTSF TIG  G 
Sbjct: 121 ------------AAALVKVSMDGAPYLRKIDVAMYKSYPELSMAFQNMFTSF-TIGKCGS 167

Query: 591 IDFMNE-RKLMD 623
              + E  KL D
Sbjct: 168 HQQLKESNKLRD 179



>gb:AY289600_1594941 Pinus taeda auxin-induced protein 1 (IAA1)
           mRNA, complete cds.
          Length = 218

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 65/176 (36%), Positives = 88/176 (50%), Gaps = 1/176 (0%)
 Frame = +3

Query: 114 ETDLCLGLPGGNNESAECLKITRKREFSETVDL-KLNLPIQPNXXXXXXXXXXXXXXXXX 290
           ET+L LGLPG    + E  +I  KR FSE  +  K ++P +                   
Sbjct: 27  ETELKLGLPGV--ATGERQRICGKRSFSEARESRKFSIPHEEAHKFHEPNLGTEKQMVRP 84

Query: 291 HHEPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVC 470
            ++P    P  PP KAQ+VGWPPVK++RK                       ++  VKV 
Sbjct: 85  ANDPPKMGP-PPPRKAQIVGWPPVKDFRK----------------VRTIAASSSLYVKVS 127

Query: 471 MDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNGMIDFMNERKLMDLLHTS 638
           MDGAPYLRKVDLK+Y++Y +L  AL NMF    T+G +G    +NE  L D+ + S
Sbjct: 128 MDGAPYLRKVDLKMYSTYHDLSSALENMFGCLITMGKSGS-HALNESNLFDVRNGS 182



>sp|Q38826|IAA8_ARATH Auxin-responsive protein IAA8 (Indoleacetic
           acid-induced protein 8).>pir|S58495|S58495 auxin-induced
           protein IAA8 - Arabidopsis thaliana>gb:AC006340_1534071
           Arabidopsis thaliana chromosome 2 clone T9I22 map
           CIC06C07, complete sequence.>gb:ATU18410_1556796
           Arabidopsis thaliana IAA8 (IAA8) gene complete
           cds.>gb:AY059905_1564749 Arabidopsis thaliana
           auxin-regulated protein (IAA8) (At2g22670; T9I22.11)
           mRNA, complete cds.>gb:AY070399_1566798 Arabidopsis
           thaliana auxin-regulated protein IAA8 (At2g22670) mRNA,
           complete cds.>gb:AY087635_1572665 Arabidopsis thaliana
           clone 37274 mRNA, complete sequence.>gb:AY096452_1575996
           Arabidopsis thaliana auxin-regulated protein IAA8
           (At2g22670) mRNA, complete cds.>gb:AY114671_1578713
           Arabidopsis thaliana auxin-regulated protein IAA8
           (At2g22670) mRNA, complete cds.>gb:AF334714_1787454
           Arabidopsis thaliana auxin-regulated protein IAA8
           (At2g22670) mRNA, complete cds.
          Length = 321

 Score = 90.5 bits (223), Expect = 2e-17
 Identities = 53/110 (48%), Positives = 66/110 (60%), Gaps = 5/110 (4%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVD 503
           P  KAQVVGWPP+++YRK     S ++ ++E              VKV MDGAPYLRKVD
Sbjct: 160 PAAKAQVVGWPPIRSYRKNTMASSTSKNTDE---VDGKPGLGVLFVKVSMDGAPYLRKVD 216

Query: 504 LKIYTSYQNLYDALANMFTSFTTIGNNGM-----IDFMNERKLMDLLHTS 638
           L+ YTSYQ L  AL  MF+ F T+G  G+      + M+E KL DLLH S
Sbjct: 217 LRTYTSYQQLSSALEKMFSCF-TLGQCGLHGAQGRERMSEIKLKDLLHGS 265



>gb:AY289601_1594942 Pinus taeda auxin-induced protein 2 (IAA2)
           mRNA, complete cds.
          Length = 302

 Score = 89.4 bits (220), Expect = 5e-17
 Identities = 56/113 (49%), Positives = 69/113 (61%), Gaps = 4/113 (3%)
 Frame = +3

Query: 312 DPIMPP-PKAQVVGWPPVKNYRKKMA---QKSNTEGSEEKXXXXXXXXXAANLVKVCMDG 479
           DP M P PKAQVVGWPP++++RK       K N EGS             A  VKV MDG
Sbjct: 148 DPAMAPAPKAQVVGWPPIRSFRKNTLAANSKPNDEGSSSN----------ALYVKVSMDG 197

Query: 480 APYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNGMIDFMNERKLMDLLHTS 638
           APYLRKVDLK+Y++Y  L  AL  MF+ F T+G  G    ++E KL+DLL+ S
Sbjct: 198 APYLRKVDLKMYSTYHELSSALEKMFSCF-TMGQCGS-PGLSESKLIDLLNGS 248



>gb:PTR306825_1702719 Populus tremula x Populus tremuloides mRNA for
           aux/IAA protein (IAA2 gene).
          Length = 365

 Score = 89.0 bits (219), Expect = 6e-17
 Identities = 54/112 (48%), Positives = 66/112 (58%), Gaps = 7/112 (6%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKM--AQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRK 497
           P PKAQVVGWPP+K++RK        NTE  + K          A  +KV MDGAPYLRK
Sbjct: 207 PAPKAQVVGWPPIKSFRKNSLATTSKNTEEVDGKAGP------GALFIKVSMDGAPYLRK 260

Query: 498 VDLKIYTSYQNLYDALANMFTSFTTIGNNGM-----IDFMNERKLMDLLHTS 638
           VDL+ Y++YQ L  AL  MF+ F TIG  G       + ++E KL DLLH S
Sbjct: 261 VDLRNYSAYQELSSALEKMFSCF-TIGQYGSHGAPGREMLSESKLKDLLHGS 311



>gb:AF016633_1761508 Glycine max GH1 protein (GH1) mRNA, partial
           cds.
          Length = 339

 Score = 88.6 bits (218), Expect = 8e-17
 Identities = 50/110 (45%), Positives = 64/110 (58%), Gaps = 5/110 (4%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVD 503
           P  KAQVVGWPP++++RK     +  + ++E           A  VKV MDGAPYLRKVD
Sbjct: 179 PASKAQVVGWPPIRSFRKNSMATTTNKNNDE---VDGKPGVGALFVKVSMDGAPYLRKVD 235

Query: 504 LKIYTSYQNLYDALANMFTSFTTIGNNGM-----IDFMNERKLMDLLHTS 638
           L+ YT+YQ L  AL  MF S  T+G  G       + ++E KL DLLH S
Sbjct: 236 LRSYTTYQELSSALEKMFLSCFTLGQCGSHGAPGREMLSESKLRDLLHGS 285



>pir|T05726|T05726 GH1 protein - soybean (fragment)
          Length = 339

 Score = 88.6 bits (218), Expect = 8e-17
 Identities = 50/110 (45%), Positives = 64/110 (58%), Gaps = 5/110 (4%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVD 503
           P  KAQVVGWPP++++RK     +  + ++E           A  VKV MDGAPYLRKVD
Sbjct: 179 PASKAQVVGWPPIRSFRKNSMATTTNKNNDE---VDGKPGVGALFVKVSMDGAPYLRKVD 235

Query: 504 LKIYTSYQNLYDALANMFTSFTTIGNNGM-----IDFMNERKLMDLLHTS 638
           L+ YT+YQ L  AL  MF S  T+G  G       + ++E KL DLLH S
Sbjct: 236 LRSYTTYQELSSALEKMFLSCFTLGQCGSHGAPGREMLSESKLRDLLHGS 285



>gb:AB026822_1517413 Cucumis sativus CsIAA2 mRNA for Aux/IAA
           protein, complete cds.
          Length = 355

 Score = 88.2 bits (217), Expect = 1e-16
 Identities = 52/121 (42%), Positives = 68/121 (56%), Gaps = 5/121 (4%)
 Frame = +3

Query: 291 HHEPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVC 470
           H+E    +   P  KAQVVGWPP++++RK     ++    E            A  +KV 
Sbjct: 186 HNETANNNTSTPVSKAQVVGWPPIRSFRKNTLATTSKNNDE----VDGKAMAGALFIKVS 241

Query: 471 MDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNGM-----IDFMNERKLMDLLHT 635
           MDGAPYLRKVDL+ Y++YQ L  AL  MF+ F TIG  G      ++ M+E KL DLLH 
Sbjct: 242 MDGAPYLRKVDLRNYSAYQELSSALEKMFSCF-TIGQYGAHGALGMEKMSESKLKDLLHG 300

Query: 636 S 638
           S
Sbjct: 301 S 301



>gb:PPI315675_1701380 Pinus pinaster mRNA for putative auxin induced
           transcription factor Aux/Iaa (iaa88 gene).
          Length = 302

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 55/113 (48%), Positives = 68/113 (60%), Gaps = 4/113 (3%)
 Frame = +3

Query: 312 DPIMPP-PKAQVVGWPPVKNYRKKMA---QKSNTEGSEEKXXXXXXXXXAANLVKVCMDG 479
           DP M P PKAQVVGWPP++++RK       K N EGS             A  VKV MDG
Sbjct: 148 DPAMAPAPKAQVVGWPPIRSFRKNTLAANSKPNDEGSSSN----------ALYVKVSMDG 197

Query: 480 APYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNGMIDFMNERKLMDLLHTS 638
           APYLRKVDLK+Y++Y  L  AL  MF+ F  +G  G    ++E KL+DLL+ S
Sbjct: 198 APYLRKVDLKMYSTYHELSSALEKMFSCF-NMGQCG-APGLSESKLIDLLNGS 248



>gb:AY098938_1576502 Solanum tuberosum Aux/IAA protein mRNA,
           complete cds.
          Length = 349

 Score = 87.0 bits (214), Expect = 2e-16
 Identities = 50/110 (45%), Positives = 63/110 (57%), Gaps = 5/110 (4%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVD 503
           P  KAQVVGWPP++++RK     ++    E            A  +KV MDGAPYLRKVD
Sbjct: 191 PATKAQVVGWPPIRSFRKNTLASASKNNEE----VDGKAGSPALFIKVSMDGAPYLRKVD 246

Query: 504 LKIYTSYQNLYDALANMFTSFTTIGNNGM-----IDFMNERKLMDLLHTS 638
           L+ Y++YQ L  AL  MF+ F TIG  G       D ++E KL DLLH S
Sbjct: 247 LRTYSAYQELSSALETMFSCF-TIGQYGSHGAPGKDMLSESKLKDLLHGS 295



>gb:AY087089_1572125 Arabidopsis thaliana clone 31563 mRNA, complete
           sequence.
          Length = 338

 Score = 86.7 bits (213), Expect = 3e-16
 Identities = 51/107 (47%), Positives = 62/107 (57%), Gaps = 4/107 (3%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVD 503
           P  KAQ+VGWPPV++YRK     +     E            A  VKV MDGAPYLRKVD
Sbjct: 178 PAAKAQIVGWPPVRSYRKNTLATTCKNSDE----VDGRPGSGALFVKVSMDGAPYLRKVD 233

Query: 504 LKIYTSYQNLYDALANMFTSFT--TIGNNGMI--DFMNERKLMDLLH 632
           L+ YT+Y  L  AL  MFT+FT    G+NG    D ++E KL DLL+
Sbjct: 234 LRSYTNYGELSSALEKMFTTFTLGQCGSNGAAGKDMLSETKLKDLLN 280



>gb:AB010075_1510979 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MPA24.
          Length = 333

 Score = 86.7 bits (213), Expect = 3e-16
 Identities = 51/107 (47%), Positives = 62/107 (57%), Gaps = 4/107 (3%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVD 503
           P  KAQ+VGWPPV++YRK     +     E            A  VKV MDGAPYLRKVD
Sbjct: 178 PAAKAQIVGWPPVRSYRKNTLATTCKNSDE----VDGRPGSGALFVKVSMDGAPYLRKVD 233

Query: 504 LKIYTSYQNLYDALANMFTSFT--TIGNNGMI--DFMNERKLMDLLH 632
           L+ YT+Y  L  AL  MFT+FT    G+NG    D ++E KL DLL+
Sbjct: 234 LRSYTNYGELSSALEKMFTTFTLGQCGSNGAAGKDMLSETKLKDLLN 280



>sp|Q38827|IAA9_ARATH Auxin-responsive protein IAA9 (Indoleacetic
           acid-induced protein 9).>pir|T05902|T05902 auxin-induced
           protein IAA9 - Arabidopsis thaliana>gb:ATF6H11_1550864
           Arabidopsis thaliana DNA chromosome 5, BAC clone F6H11
           (ESSAII project).>gb:ATU18411_1556797 Arabidopsis
           thaliana IAA9 (IAA9) gene, complete
           cds.>gb:AF334715_1787455 Arabidopsis thaliana clone
           C00016 (e) auxin-induced protein IAA9 (At5g65670) mRNA,
           complete cds.
          Length = 338

 Score = 86.7 bits (213), Expect = 3e-16
 Identities = 51/107 (47%), Positives = 62/107 (57%), Gaps = 4/107 (3%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVD 503
           P  KAQ+VGWPPV++YRK     +     E            A  VKV MDGAPYLRKVD
Sbjct: 178 PAAKAQIVGWPPVRSYRKNTLATTCKNSDE----VDGRPGSGALFVKVSMDGAPYLRKVD 233

Query: 504 LKIYTSYQNLYDALANMFTSFT--TIGNNGMI--DFMNERKLMDLLH 632
           L+ YT+Y  L  AL  MFT+FT    G+NG    D ++E KL DLL+
Sbjct: 234 LRSYTNYGELSSALEKMFTTFTLGQCGSNGAAGKDMLSETKLKDLLN 280



>gb:AY289602_1594943 Pinus taeda auxin-induced protein 3 (IAA3)
           mRNA, complete cds.
          Length = 252

 Score = 86.3 bits (212), Expect = 4e-16
 Identities = 70/218 (32%), Positives = 101/218 (46%), Gaps = 13/218 (5%)
 Frame = +3

Query: 12  LSVVIEKE*NPIEGDQREATSKPEIKMATMLIHGETDLCLGLPGGNNESAECLKITRKRE 191
           +++V+EK     + ++R++           L   ET+L LGLPG    + +  +I  KR 
Sbjct: 8   MAMVLEKSGGNAQHEKRDS-----------LDFAETELKLGLPGVAAGARQ--RICGKRS 54

Query: 192 FSETVDLKLNLPIQPNXXXXXXXXXXXXXXXXXHHEPILKDPIM-------------PPP 332
           FSE ++ + N  I                       PI+K+  M             PP 
Sbjct: 55  FSEAMESR-NYTIPDEDITNTSTHEDLDKFKG----PIVKEKQMALSANDPPRMGPPPPS 109

Query: 333 KAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVDLKI 512
           KAQVVGWPPV+++RK     ++                 +  VKV MDGAPYLRKVDLK+
Sbjct: 110 KAQVVGWPPVRDFRKVRTVAASN----------------SLYVKVSMDGAPYLRKVDLKL 153

Query: 513 YTSYQNLYDALANMFTSFTTIGNNGMIDFMNERKLMDL 626
           Y++Y  L  AL  MF+    +G  G +  +NE  LMDL
Sbjct: 154 YSTYHELTSALEKMFSCLIIMGKCGSL-ALNESNLMDL 190



>gb:AY781902_1628331 Saccharum hybrid cultivar isolate c57
           auxin-induced protein mRNA, partial cds.
          Length = 188

 Score = 85.1 bits (209), Expect = 9e-16
 Identities = 57/127 (44%), Positives = 72/127 (56%), Gaps = 15/127 (11%)
 Frame = +3

Query: 303 ILKDPIMPP--PKAQVVGWPPVKNYRKKMAQKSNTEGS--------EEKXXXXXXXXXAA 452
           I  DP   P  PKAQVVGWPPV+++RK +    + +G+                     A
Sbjct: 10  IQADPAEKPRAPKAQVVGWPPVRSFRKNIMSVQSDKGAGGSKDADKSSPPPAAAAAVGGA 69

Query: 453 NLVKVCMDGAPYLRKVDL---KIYTSYQNLYDALANMFTSFTTIGNNGM--IDFMNERKL 617
             VKV +DGAPYLRKVDL   K+Y SYQ L  AL  MF+S  TIG+ G   ++ MNE KL
Sbjct: 70  AFVKVSLDGAPYLRKVDLKMYKMYKSYQELSKALEKMFSS--TIGSCGSQGMNGMNESKL 127

Query: 618 MDLLHTS 638
           +DLL+ S
Sbjct: 128 VDLLNGS 134



>sp|P32294|AX2B_PHAAU Auxin-induced protein 22B (Indole-3-acetic
           acid induced protein ARG4).>pir|T10941|T10941
           auxin-induced protein Aux22 - mung
           bean>gb:VIRAUX22B_1727241 Vigna radiata auxin-regulated
           mRNA.
          Length = 196

 Score = 85.1 bits (209), Expect = 9e-16
 Identities = 53/152 (34%), Positives = 70/152 (46%), Gaps = 5/152 (3%)
 Frame = +3

Query: 117 TDLCLGLPG-----GNNESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXX 281
           T+L LGLPG      NN     +    KR+  ET    +++                   
Sbjct: 16  TELRLGLPGTEEKEDNNLRTHAVLRNNKRQVRETSQDSVSI------------------S 57

Query: 282 XXXHHEPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLV 461
              HH+  ++    PPPKA++VGWPP+++YRK   Q+   +G                 V
Sbjct: 58  KASHHQQHVETVSAPPPKAKIVGWPPIRSYRKNSVQEGEGDGI---------------FV 102

Query: 462 KVCMDGAPYLRKVDLKIYTSYQNLYDALANMF 557
           KV MDGAPYLRKVDLK+Y  Y  L  AL  MF
Sbjct: 103 KVSMDGAPYLRKVDLKVYGGYPELLKALETMF 134



>gb:AP003374_1828707 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OJ1117_G01.
          Length = 271

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 48/98 (48%), Positives = 59/98 (60%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVD 503
           P  KAQVVGWPPV+NYRK     S ++G  E              VKV MDGAPYLRKVD
Sbjct: 112 PAAKAQVVGWPPVRNYRKNTLAASASKGKGEDKGTAEGGPL---YVKVSMDGAPYLRKVD 168

Query: 504 LKIYTSYQNLYDALANMFTSFTTIGNNGMIDFMNERKL 617
           LK+Y+SY++L  AL  MF+ F T G +G+    N  +L
Sbjct: 169 LKMYSSYEDLSMALEKMFSCFIT-GQSGLRKSSNRDRL 205



>gb:AF022020_1761757 Lycopersicon esculentum auxin-regulated IAA9
           (IAA9) mRNA, partial cds.
          Length = 99

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 50/96 (52%), Positives = 60/96 (62%), Gaps = 3/96 (3%)
 Frame = +3

Query: 360 VKNYRKK-MAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVDLKIYTSYQNLY 536
           V+++RK  M  + NT G+ E           A  VKV +DGAPYLRKVDLK+Y SYQ L 
Sbjct: 1   VRSFRKNVMTVQKNTTGAGE----ISGTGTGAAFVKVSVDGAPYLRKVDLKMYKSYQQLS 56

Query: 537 DALANMFTSFT--TIGNNGMIDFMNERKLMDLLHTS 638
           DAL  MF+SFT    G  G  DFMNE KL+DLL+ S
Sbjct: 57  DALGKMFSSFTIGNCGTQGXXDFMNESKLIDLLNGS 92



>pir|T05708|T05708 auxin-induced protein IAA9 - tomato (fragment)
          Length = 99

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 50/96 (52%), Positives = 60/96 (62%), Gaps = 3/96 (3%)
 Frame = +3

Query: 360 VKNYRKK-MAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVDLKIYTSYQNLY 536
           V+++RK  M  + NT G+ E           A  VKV +DGAPYLRKVDLK+Y SYQ L 
Sbjct: 1   VRSFRKNVMTVQKNTTGAGE----ISGTGTGAAFVKVSVDGAPYLRKVDLKMYKSYQQLS 56

Query: 537 DALANMFTSFT--TIGNNGMIDFMNERKLMDLLHTS 638
           DAL  MF+SFT    G  G  DFMNE KL+DLL+ S
Sbjct: 57  DALGKMFSSFTIGNCGTQGXXDFMNESKLIDLLNGS 92



>sp|O24542|AX2D_PHAAU Auxin-induced protein 22D (Indole-3-acetic
           acid induced protein ARG13).>pir|T10884|T10884
           auxin-induced protein Aux22d - mung
           bean>gb:AB004932_1509224 Vigna radiata mRNA for Aux22d,
           complete cds.
          Length = 193

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 53/147 (36%), Positives = 67/147 (45%)
 Frame = +3

Query: 117 TDLCLGLPGGNNESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXXXHH 296
           T+L LGLPG +         + KR   E  D +                           
Sbjct: 17  TELRLGLPGSDEPEKRATARSNKRSSPEASDEE---------------------SISNGS 55

Query: 297 EPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMD 476
           +   +D ++PP KAQVVGWPP+++YRK   Q+   E SE               VKV M 
Sbjct: 56  DVTKEDNVVPPAKAQVVGWPPIRSYRKNNVQQKKEEESEGNGMY----------VKVSMA 105

Query: 477 GAPYLRKVDLKIYTSYQNLYDALANMF 557
           GAPYLRK+DLK+Y SY  L  AL NMF
Sbjct: 106 GAPYLRKIDLKVYKSYPELLKALENMF 132



>gb:NTA417876_1691404 Nicotiana tabacum mRNA for IAA9 protein.
          Length = 346

 Score = 83.2 bits (204), Expect = 3e-15
 Identities = 50/110 (45%), Positives = 66/110 (60%), Gaps = 5/110 (4%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVD 503
           P  KAQVVGWPP+++++K     ++T  + EK          A  +KV MDGAPYLRKVD
Sbjct: 188 PATKAQVVGWPPIRSFKKNTL--ASTSKNNEKVDGKAGS--PALFIKVSMDGAPYLRKVD 243

Query: 504 LKIYTSYQNLYDALANMFTSFTTIGNNGM-----IDFMNERKLMDLLHTS 638
           LK Y++YQ L  AL  MF+ F TIG  G       + ++E +L DLLH S
Sbjct: 244 LKNYSAYQELSSALEKMFSCF-TIGQYGSHGAPGKEMLSESQLKDLLHGS 292



>gb:GHI458442_1680050 Gossypium hirsutum mRNA for IAA16 protein.
          Length = 208

 Score = 83.2 bits (204), Expect = 3e-15
 Identities = 62/168 (36%), Positives = 84/168 (50%), Gaps = 1/168 (0%)
 Frame = +3

Query: 117 TDLCLGLPGGNNESAEC-LKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXXXH 293
           T+L LGLPG    +++   K+  KR FSETVDLKL    Q                    
Sbjct: 22  TELTLGLPGEPRVTSDGGAKLGSKRGFSETVDLKLGDNNQEVKLGHSL------------ 69

Query: 294 HEPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCM 473
            +   K P+    K QVVGWPPV+ + K+  +KS                     VKV +
Sbjct: 70  -QEAAKSPV---SKTQVVGWPPVRGFAKR-GKKS------------------CKYVKVAV 106

Query: 474 DGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNGMIDFMNERKL 617
           DGAPYLRKVDL+IY SYQ L  +L +MF+ FT      + +++NE+K+
Sbjct: 107 DGAPYLRKVDLEIYNSYQQLLTSLEDMFSCFT------IRNYLNEKKI 148



>gb:AY082522_1569184 Vitis vinifera Aux/IAA protein mRNA, complete
           cds.
          Length = 359

 Score = 83.2 bits (204), Expect = 3e-15
 Identities = 52/111 (46%), Positives = 64/111 (57%), Gaps = 6/111 (5%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANL-VKVCMDGAPYLRKV 500
           P  KAQVVGWPP++++RK      NT  +  K            L VKV MDGAPYLRKV
Sbjct: 202 PATKAQVVGWPPIRSFRK------NTLATTSKNTEVDGKAGPGALFVKVSMDGAPYLRKV 255

Query: 501 DLKIYTSYQNLYDALANMFTSFTTIGNNGM-----IDFMNERKLMDLLHTS 638
           DL+ Y++YQ L  AL  MF+ F TIG  G       + ++E KL DLLH S
Sbjct: 256 DLRNYSAYQELSSALEKMFSCF-TIGQYGSHGAPGREMLSESKLKDLLHGS 305



>gb:AY090553_1574159 Zinnia elegans auxin-regulated protein (IAA8)
           mRNA, complete cds.
          Length = 351

 Score = 82.8 bits (203), Expect = 4e-15
 Identities = 50/110 (45%), Positives = 64/110 (58%), Gaps = 5/110 (4%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVD 503
           P  KAQVVGWPPV+++RK +   ++    E            A  VKV MDGAPYLRKVD
Sbjct: 193 PAAKAQVVGWPPVRSFRKNILATNSKTNDE----VDGKPGPGALFVKVSMDGAPYLRKVD 248

Query: 504 LKIYTSYQNLYDALANMFTSFTTIGNNGM-----IDFMNERKLMDLLHTS 638
           L+ Y++YQ L  A+  MF+ F TIG  G       + ++E KL DLLH S
Sbjct: 249 LRSYSTYQQLSSAIEKMFSCF-TIGQCGSQGAPGRESLSESKLRDLLHGS 297



>sp|Q9ZSY8|IAAR_ARATH Auxin-responsive protein IAA27 (Indoleacetic
           acid-induced protein 27) (Auxin-induced protein 27)
           (Phytochrome-associated protein 2).>pir|T08963|T08963
           phytochrome-associated protein PAP2 - Arabidopsis
           thaliana>gb:ATCHRIV70_1546829 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           70.>gb:ATF19B15_1549281 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F19B15 (ESSA
           project).>gb:ATH458326_1552606 Arabidopsis thaliana mRNA
           for putative auxin-induced protein 27 (iaa27
           gene).>gb:AY053404_1562917 Arabidopsis thaliana
           AT4g29080/F19B15_110 mRNA, complete
           cds.>gb:AY133516_1581339 Arabidopsis thaliana
           At4g29080/F19B15_110 mRNA, complete
           cds.>gb:AF087936_1767257 Arabidopsis thaliana
           phytochrome-associated protein 2 (PAP2) mRNA, complete
           cds.>gb:AF332402_1787215 Arabidopsis thaliana clone
           C00024 (f) putative phytochrome-associated protein 2
           (At4g29080) mRNA, complete cds.
          Length = 305

 Score = 82.8 bits (203), Expect = 4e-15
 Identities = 49/114 (42%), Positives = 62/114 (54%), Gaps = 9/114 (7%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKK-----MAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPY 488
           P  KAQVVGWPP++++RK       +QK       E+             VKV M+GAPY
Sbjct: 138 PASKAQVVGWPPIRSFRKNSMASSQSQKPGNNSETEEAEAKSGPEQPCLYVKVSMEGAPY 197

Query: 489 LRKVDLKIYTSYQNLYDALANMFTSFT--TIGNNGMI--DFMNERKLMDLLHTS 638
           LRK+DLK Y SY  L  AL  MF+ FT    G++G    D +NE +L DLL  S
Sbjct: 198 LRKIDLKTYKSYLELSSALEKMFSCFTIGQFGSHGGCGRDGLNESRLTDLLRGS 251



>gb:AF026532_1762203 Pisum sativum putative IAA-related protein
           gene, partial cds.
          Length = 101

 Score = 82.0 bits (201), Expect = 8e-15
 Identities = 51/108 (47%), Positives = 62/108 (57%), Gaps = 7/108 (6%)
 Frame = +3

Query: 336 AQVVGWPPVKNYRKKM--AQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVDLK 509
           AQVVGWPP++++RK        NTE ++ K          A  VKV MDGAPYLRKVDLK
Sbjct: 1   AQVVGWPPIRSFRKNSLTTASKNTEEADGKLGLG-----GAVFVKVSMDGAPYLRKVDLK 55

Query: 510 IYTSYQNLYDALANMFTSFT-----TIGNNGMIDFMNERKLMDLLHTS 638
            YT+Y  L  +L  MF+ FT     + GN      +NE KL DLLH S
Sbjct: 56  NYTAYSELSSSLEKMFSCFTIGQCESHGN----QMLNETKLRDLLHGS 99



>gb:AC145396_1744454 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0042F15, complete
           sequence.>gb:AC145477_1744489 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone B1402B06, complete
           sequence.
          Length = 257

 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 44/92 (47%), Positives = 55/92 (59%)
 Frame = +3

Query: 315 PIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLR 494
           P  P  KAQVVGWPP+++YRK     +  + S+E              VKV MDGAPYLR
Sbjct: 108 PQAPAAKAQVVGWPPIRSYRKNTMATNQLKSSKEDAEAKQGQGFL--YVKVSMDGAPYLR 165

Query: 495 KVDLKIYTSYQNLYDALANMFTSFTTIGNNGM 590
           KVDLK Y +Y++L  AL  MF  FTT G +G+
Sbjct: 166 KVDLKTYKNYKDLSTALEKMFIGFTT-GKDGL 196



>gb:AY062215_1565008 Antirrhinum majus auxin-induced AUX/IAA1 mRNA,
           partial cds.
          Length = 172

 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 41/83 (49%), Positives = 53/83 (63%)
 Frame = +3

Query: 309 KDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPY 488
           ++ I P PKAQVVGWPPV+++RK + + S ++GS                VKV MDGAPY
Sbjct: 46  EESIAPAPKAQVVGWPPVRSFRKNVMKASESDGS-------------GMFVKVSMDGAPY 92

Query: 489 LRKVDLKIYTSYQNLYDALANMF 557
           LRK+DLK Y +Y +L  AL NMF
Sbjct: 93  LRKIDLKFYNNYFDLLKALENMF 115



>gb:AF022021_1761758 Lycopersicon esculentum auxin-regulated IAA10
           (IAA10) mRNA, partial cds.
          Length = 87

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 41/61 (67%), Positives = 48/61 (78%)
 Frame = +3

Query: 456 LVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNGMIDFMNERKLMDLLHT 635
           LVKV MDGAPYLRKVDL +Y SYQ L+DAL  MF SFT +   GM DFM+E +LMDLL++
Sbjct: 22  LVKVSMDGAPYLRKVDLNMYKSYQELFDALTKMFNSFTIV--QGMKDFMHEGRLMDLLNS 79

Query: 636 S 638
           S
Sbjct: 80  S 80



>pir|T05709|T05709 auxin-induced protein IAA10 - tomato (fragment)
          Length = 87

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 41/61 (67%), Positives = 48/61 (78%)
 Frame = +3

Query: 456 LVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNGMIDFMNERKLMDLLHT 635
           LVKV MDGAPYLRKVDL +Y SYQ L+DAL  MF SFT +   GM DFM+E +LMDLL++
Sbjct: 22  LVKVSMDGAPYLRKVDLNMYKSYQELFDALTKMFNSFTIV--QGMKDFMHEGRLMDLLNS 79

Query: 636 S 638
           S
Sbjct: 80  S 80



>gb:AY337616_1600425 Gossypium barbadense Gbiaa-Re (iaa-re) mRNA,
           complete cds.
          Length = 190

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 39/78 (50%), Positives = 46/78 (58%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVD 503
           PPPKAQ+VGWPP+++YRK   Q    E                  VKV MDGAPYLRK+D
Sbjct: 62  PPPKAQIVGWPPIRSYRKNNIQTKKNESE-----------GGGIYVKVSMDGAPYLRKID 110

Query: 504 LKIYTSYQNLYDALANMF 557
           LKIY+ Y  L  A+ NMF
Sbjct: 111 LKIYSGYPELLQAIENMF 128



>pir|S12243|S12243 auxin-induced protein AUX2-11 - Arabidopsis
           thaliana
          Length = 186

 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 56/149 (37%), Positives = 69/149 (46%), Gaps = 2/149 (1%)
 Frame = +3

Query: 117 TDLCLGLPGGNNESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXXXHH 296
           T+L LGLPG   E+  C K + KR   E  + ++                          
Sbjct: 16  TELRLGLPG-TEETVSCGK-SNKRVLPEATEKEI-------------------------- 47

Query: 297 EPILKDPIMPPPKAQVVGWPPVKNYRKKMAQ--KSNTEGSEEKXXXXXXXXXAANLVKVC 470
           E   K     PPKAQ+VGWPPV++YRK   Q  KS +EG               N VKV 
Sbjct: 48  ESTGKTETASPPKAQIVGWPPVRSYRKNNVQTKKSESEGQ-------------GNYVKVS 94

Query: 471 MDGAPYLRKVDLKIYTSYQNLYDALANMF 557
           MDGAPYLRK+DL +Y  Y  L  +L NMF
Sbjct: 95  MDGAPYLRKIDLTMYKQYPELMKSLENMF 123



>sp|P33077|IAA4_ARATH Auxin-responsive protein IAA4 (Indoleacetic
           acid-induced protein 4) (Auxin-induced protein
           AUX2-11).>gb:AB026651_1517262 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1
           clone:MQD19.>gb:ATAUX211_1544124 A.thaliana
           auxin-inducible gene Aux2-11.>gb:ATHIAA4A_1553242
           Arabidopsis thaliana auxin-responsive protein (IAA4)
           mRNA, 5' partial cds.>gb:BT005853_1638775 Arabidopsis
           thaliana At5g43700 gene, complete cds.
          Length = 186

 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 56/149 (37%), Positives = 69/149 (46%), Gaps = 2/149 (1%)
 Frame = +3

Query: 117 TDLCLGLPGGNNESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXXXHH 296
           T+L LGLPG   E+  C K + KR   E  + ++                          
Sbjct: 16  TELRLGLPG-TEETVSCGK-SNKRVLPEATEKEI-------------------------- 47

Query: 297 EPILKDPIMPPPKAQVVGWPPVKNYRKKMAQ--KSNTEGSEEKXXXXXXXXXAANLVKVC 470
           E   K     PPKAQ+VGWPPV++YRK   Q  KS +EG               N VKV 
Sbjct: 48  ESTGKTETASPPKAQIVGWPPVRSYRKNNVQTKKSESEGQ-------------GNYVKVS 94

Query: 471 MDGAPYLRKVDLKIYTSYQNLYDALANMF 557
           MDGAPYLRK+DL +Y  Y  L  +L NMF
Sbjct: 95  MDGAPYLRKIDLTMYKQYPELMKSLENMF 123



>gb:AF027157_1762245 Arabidopsis thaliana auxin-responsive protein
           IAA2 gene, complete cds.
          Length = 174

 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 53/153 (34%), Positives = 66/153 (43%), Gaps = 5/153 (3%)
 Frame = +3

Query: 114 ETDLCLGLPGGNNESAE-----CLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXX 278
           +T+LCLGLPG   +  E     C+KI  KR F ET D                       
Sbjct: 13  DTELCLGLPGRTEKIKEEQEVSCVKINNKRLFEETRD----------------------- 49

Query: 279 XXXXHHEPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANL 458
                     ++   PP K Q+VGWPPV++ RK                       + + 
Sbjct: 50  ----------EEESTPPTKTQIVGWPPVRSSRKN--------------------NNSVSY 79

Query: 459 VKVCMDGAPYLRKVDLKIYTSYQNLYDALANMF 557
           VKV MDGAPYLRK+DLK Y +Y  L  AL NMF
Sbjct: 80  VKVSMDGAPYLRKIDLKTYKNYPELLKALENMF 112



>gb:AP004784_1845015 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0012F14.
          Length = 266

 Score = 79.3 bits (194), Expect = 5e-14
 Identities = 47/107 (43%), Positives = 62/107 (57%), Gaps = 6/107 (5%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKK-MAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKV 500
           P  KAQVVGWPP+++YRK  MA        ++              VKV MDGAPYLRKV
Sbjct: 103 PAAKAQVVGWPPIRSYRKNTMAMSQPALKGKDDGEAKQAPASGCLYVKVSMDGAPYLRKV 162

Query: 501 DLKIYTSYQNLYDALANMFTSFT-----TIGNNGMIDFMNERKLMDL 626
           DLK+Y +Y+ L  AL  MF+ FT     + G +G  D +++ +LMDL
Sbjct: 163 DLKMYKNYKELSLALEKMFSCFTVGHGESNGKSGR-DGLSDCRLMDL 208



>gb:PTR306831_1702725 Populus tremula x Populus tremuloides mRNA for
           aux/IAA protein (IAA8 gene).
          Length = 204

 Score = 78.6 bits (192), Expect = 8e-14
 Identities = 54/149 (36%), Positives = 68/149 (45%)
 Frame = +3

Query: 117 TDLCLGLPGGNNESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXXXHH 296
           T+L LGLPG     +E  K T     +++   K +LP   N                   
Sbjct: 12  TELRLGLPGTATRQSE--KQTPNSNLAKSN--KRSLP-DMNEDPAGSSRENSSTVSSNEE 66

Query: 297 EPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMD 476
           +   ++   PP KAQVVGWPP+++YRK   Q    E              A   VKV MD
Sbjct: 67  KSHDQETAPPPIKAQVVGWPPIRSYRKNCLQAKKQEAE-----------AAGLYVKVSMD 115

Query: 477 GAPYLRKVDLKIYTSYQNLYDALANMFTS 563
           GAPYLRK+DLK+Y  Y  L  AL  MF S
Sbjct: 116 GAPYLRKIDLKVYKGYPELLKALEEMFKS 144



>gb:AB026823_1517414 Cucumis sativus CsIAA3 mRNA for Aux/IAA
           protein, complete cds.
          Length = 180

 Score = 77.8 bits (190), Expect = 1e-13
 Identities = 40/78 (51%), Positives = 47/78 (60%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVD 503
           PP KAQVVGWPPV+++RK   Q    E +            A   +KV MDGAP+LRKVD
Sbjct: 57  PPTKAQVVGWPPVRSFRKNSLQAKKKEET-----------AAGMFIKVSMDGAPFLRKVD 105

Query: 504 LKIYTSYQNLYDALANMF 557
           LKIY  Y +L  AL NMF
Sbjct: 106 LKIYQGYPDLLQALENMF 123



>gb:AY847064_1630742 Avena sativa Aux/IAA3 mRNA, partial cds.
          Length = 120

 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 43/103 (41%), Positives = 60/103 (58%), Gaps = 15/103 (14%)
 Frame = +3

Query: 342 VVGWPPVKNYRK--------KMAQKSNTEGSEEKXXXXXXXXXA------ANLVKVCMDG 479
           VVGWPPV++YR+        K+ ++  TE  +           A      +  VKV MDG
Sbjct: 3   VVGWPPVRSYRRNAMTVQSVKIKKEEETEKQQPASAVAAAAAAATAGGNGSAFVKVSMDG 62

Query: 480 APYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNG-MIDFMN 605
           APYLRKVDLK+Y +Y++L  AL  MF++FT  GN G M++ +N
Sbjct: 63  APYLRKVDLKMYNTYKDLSIALQKMFSTFTATGNEGKMVEAVN 105



>sp|Q38822|IAA3_ARATH Auxin-responsive protein IAA3 (Indoleacetic
           acid-induced protein 3) (Short hypocotyl) (Suppressor of
           HY2).>pir|S58491|S58491 auxin-induced protein IAA3 -
           Arabidopsis thaliana>gb:AE005172_889441 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:ATU18406_1556792 Arabidopsis thaliana IAA3
           (IAA3) gene, complete cds.>gb:AY064007_1565948
           Arabidopsis thaliana putative auxin-induced protein IAA3
           (At1g04240) mRNA, complete cds.>gb:F19P19_1677738
           Sequence of BAC F19P19 from Arabidopsis thaliana
           chromosome 1, complete sequence.>gb:AF332393_1787206
           Arabidopsis thaliana clone C00011 (f) auxin-induced
           protein IAA3 (At1g04240) mRNA, complete cds.
          Length = 189

 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 53/153 (34%), Positives = 63/153 (41%), Gaps = 5/153 (3%)
 Frame = +3

Query: 114 ETDLCLGLPGGNN-----ESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXX 278
           ET+L LGLPG +N     E   C     KR  S   + ++    +               
Sbjct: 9   ETELRLGLPGTDNVCEAKERVSCCNNNNKRVLSTDTEKEIESSSR--------------- 53

Query: 279 XXXXHHEPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANL 458
                     K    PP KAQ+VGWPPV++YRK   Q    E   E              
Sbjct: 54  ----------KTETSPPRKAQIVGWPPVRSYRKNNIQSKKNESEHEGQGIY--------- 94

Query: 459 VKVCMDGAPYLRKVDLKIYTSYQNLYDALANMF 557
           VKV MDGAPYLRK+DL  Y  Y  L  AL  MF
Sbjct: 95  VKVSMDGAPYLRKIDLSCYKGYSELLKALEVMF 127



>sp|P49678|IAA2_ARATH Auxin-responsive protein IAA2 (Indoleacetic
           acid-induced protein 2).>gb:AB026655_1517321 Arabidopsis
           thaliana genomic DNA, chromosome 3, P1 clone:
           MXC7.>gb:ATHIAA2A_1553241 Arabidopsis thaliana
           auxin-responsive protein (IAA2) mRNA, 5' partial
           cds.>gb:AF332392_1787205 Arabidopsis thaliana clone
           C00010 (f) auxin-inducible protein IAA2 (At3g23030)
           mRNA, complete cds.
          Length = 174

 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 52/153 (33%), Positives = 65/153 (42%), Gaps = 5/153 (3%)
 Frame = +3

Query: 114 ETDLCLGLPGGNNESAE-----CLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXX 278
           +T+LCLGLPG   +  E     C+K   KR F ET D                       
Sbjct: 13  DTELCLGLPGRTEKIKEEQEVSCVKSNNKRLFEETRD----------------------- 49

Query: 279 XXXXHHEPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANL 458
                     ++   PP K Q+VGWPPV++ RK                       + + 
Sbjct: 50  ----------EEESTPPTKTQIVGWPPVRSSRKN--------------------NNSVSY 79

Query: 459 VKVCMDGAPYLRKVDLKIYTSYQNLYDALANMF 557
           VKV MDGAPYLRK+DLK Y +Y  L  AL NMF
Sbjct: 80  VKVSMDGAPYLRKIDLKTYKNYPELLKALENMF 112



>gb:AF169830_1774231 Glycine max auxin-induced protein ali50 mRNA,
           partial cds.
          Length = 218

 Score = 76.6 bits (187), Expect = 3e-13
 Identities = 48/107 (44%), Positives = 58/107 (54%), Gaps = 6/107 (5%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKM--AQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRK 497
           PP KAQVVGWPPV++YRK M   QK + E   +           A  V+V MDGAPYLRK
Sbjct: 3   PPAKAQVVGWPPVRSYRKNMIAVQKVSNEEVADNTTISTLANSGA-FVQVSMDGAPYLRK 61

Query: 498 VDLKIYTSYQNLYDALAN----MFTSFTTIGNNGMIDFMNERKLMDL 626
           VDL +Y SY  L   L      +   +     N +  FMN+ KLMDL
Sbjct: 62  VDLPMYKSYIRLISCLGQNVQLLHHGYLWGPRNDI--FMNDSKLMDL 106



>gb:AY847062_1630740 Avena sativa Aux/IAA1 mRNA, partial cds.
          Length = 183

 Score = 76.6 bits (187), Expect = 3e-13
 Identities = 45/106 (42%), Positives = 63/106 (59%), Gaps = 6/106 (5%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKK-MAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKV 500
           P  KAQVVGWPP+++YRK  MA   +   S+++             VKV MDGAPYLRKV
Sbjct: 63  PAAKAQVVGWPPIRSYRKNTMATSLSAPRSKDEVEAKQAPVAGCLYVKVSMDGAPYLRKV 122

Query: 501 DLKIYTSYQNLYDALANMFTSFT-----TIGNNGMIDFMNERKLMD 623
           DLK+Y +Y++L   L   F+ FT     + G +G  D +++ +LMD
Sbjct: 123 DLKMYKNYKDLSLELEKKFSCFTVGHGESNGKSGR-DGLSDCRLMD 167



>gb:AC144735_1744126 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0001A14, complete sequence.
          Length = 281

 Score = 76.3 bits (186), Expect = 4e-13
 Identities = 42/80 (52%), Positives = 49/80 (61%)
 Frame = +3

Query: 333 KAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVDLKI 512
           KAQVVGWPPV++YRK     S T+    K             VKV MDGAPYLRKVDLK 
Sbjct: 125 KAQVVGWPPVRSYRKNTLAASATK---TKGEDQGKSEVGCCYVKVSMDGAPYLRKVDLKT 181

Query: 513 YTSYQNLYDALANMFTSFTT 572
           Y+SY++L  AL  MF+ F T
Sbjct: 182 YSSYEDLSLALEKMFSCFIT 201



>gb:AF123507_1769922 Nicotiana tabacum Nt-iaa4.5 deduced protein
           mRNA, complete cds.
          Length = 195

 Score = 75.9 bits (185), Expect = 5e-13
 Identities = 38/78 (48%), Positives = 46/78 (58%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVD 503
           P PKAQVVGWPPV++YRK + Q   +E              +   +KV MDG  YLRK+D
Sbjct: 65  PAPKAQVVGWPPVRSYRKNVLQIKKSESDNS----------SGMYLKVSMDGGTYLRKID 114

Query: 504 LKIYTSYQNLYDALANMF 557
           LK+Y SY  L  AL NMF
Sbjct: 115 LKVYNSYPELLKALQNMF 132



>gb:AF123506_1769921 Nicotiana tabacum Nt-iaa4.3 deduced protein
           mRNA, complete cds.
          Length = 202

 Score = 75.9 bits (185), Expect = 5e-13
 Identities = 38/78 (48%), Positives = 46/78 (58%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVD 503
           P PKAQVVGWPPV++YRK + Q   +E              +   +KV MDG  YLRK+D
Sbjct: 65  PAPKAQVVGWPPVRSYRKNVLQVKKSESDNS----------SGMYLKVSMDGGTYLRKID 114

Query: 504 LKIYTSYQNLYDALANMF 557
           LK+Y SY  L  AL NMF
Sbjct: 115 LKVYKSYPELLKALQNMF 132



>gb:AC145379_1744347 Oryza sativa chromosome 3 BAC OSJNBa0010N03
           genomic sequence, complete sequence.
          Length = 226

 Score = 75.9 bits (185), Expect = 5e-13
 Identities = 43/103 (41%), Positives = 54/103 (52%), Gaps = 21/103 (20%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXX------------------XXXXA 449
           P  KAQVVGWPPV++YRK   Q+ +   S+ K                           A
Sbjct: 65  PVAKAQVVGWPPVRSYRKSCFQQQSAAASKSKAAVSSCNNKDEPITKNAAPAPAASSAAA 124

Query: 450 AN---LVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFT 569
           AN   LVKV MDGAPYLRK+DL++Y  Y+ L +AL  MF  F+
Sbjct: 125 ANGGSLVKVSMDGAPYLRKIDLRMYKGYRELREALEAMFVCFS 167



>gb:AP001550_1821298 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0431F01.>gb:AP001859_1821444 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0485D09.
          Length = 263

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 38/86 (44%), Positives = 50/86 (58%)
 Frame = +3

Query: 315 PIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLR 494
           P  P  KAQVVGWPP+++YRK     +  + ++E              VKV MDGAPYLR
Sbjct: 115 PPQPAAKAQVVGWPPIRSYRKNTMATNQIKSNKEDVDAKQGQGFL--YVKVSMDGAPYLR 172

Query: 495 KVDLKIYTSYQNLYDALANMFTSFTT 572
           KVDLK Y +Y+++   L  MF  F+T
Sbjct: 173 KVDLKTYKNYKDMSLGLEKMFIGFST 198



>gb:PSIAA45D_1702189 P.sativum PS-IAA4/5 gene.
          Length = 187

 Score = 72.8 bits (177), Expect = 5e-12
 Identities = 47/154 (30%), Positives = 67/154 (43%), Gaps = 7/154 (4%)
 Frame = +3

Query: 117 TDLCLGLPGGNNES-------AECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXX 275
           T+L LGLPG   E        +  +K   KR+  +T +  +++    N            
Sbjct: 6   TELRLGLPGITEEEEKKIIHGSSVVKNNNKRQLPQTSEESVSISKVTNDEHIVESSSAA- 64

Query: 276 XXXXXHHEPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAAN 455
                           PP KA++VGWPP+++YRK    +++  G                
Sbjct: 65  ----------------PPAKAKIVGWPPIRSYRKNSLHEADVGGI--------------- 93

Query: 456 LVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMF 557
            VKV MDGAPYLRK+DL++Y  Y  L  AL  MF
Sbjct: 94  FVKVSMDGAPYLRKIDLRVYGGYSELLKALETMF 127



>sp|P49679|IAA4_PEA Auxin-induced protein IAA4.>pir|S39075|S39075
           auxin-induced protein IAA4/5 - garden
           pea>gb:PSPIAA45R_1702348 P.sativum mRNA for pIAA4/5.1.
          Length = 189

 Score = 72.8 bits (177), Expect = 5e-12
 Identities = 47/154 (30%), Positives = 67/154 (43%), Gaps = 7/154 (4%)
 Frame = +3

Query: 117 TDLCLGLPGGNNES-------AECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXX 275
           T+L LGLPG   E        +  +K   KR+  +T +  +++    N            
Sbjct: 6   TELRLGLPGITEEEEKKIIHGSSVVKNNNKRQLPQTSEESVSISKVTNDEHIVESSSAA- 64

Query: 276 XXXXXHHEPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAAN 455
                           PP KA++VGWPP+++YRK    +++  G                
Sbjct: 65  ----------------PPAKAKIVGWPPIRSYRKNSLHEADVGGI--------------- 93

Query: 456 LVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMF 557
            VKV MDGAPYLRK+DL++Y  Y  L  AL  MF
Sbjct: 94  FVKVSMDGAPYLRKIDLRVYGGYSELLKALETMF 127



>sp|O24543|AX2E_PHAAU Auxin-induced protein 22E (Indole-3-acetic
           acid induced protein ARG14).>pir|T10885|T10885
           auxin-induced protein Aux22e - mung
           bean>gb:AB004933_1509225 Vigna radiata mRNA for Aux22e,
           complete cds.
          Length = 203

 Score = 72.8 bits (177), Expect = 5e-12
 Identities = 48/153 (31%), Positives = 69/153 (45%), Gaps = 6/153 (3%)
 Frame = +3

Query: 117 TDLCLGLPGGNNE------SAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXX 278
           T+L LGLPG +        S   ++ + KR   E  + +    I  +             
Sbjct: 13  TELRLGLPGSDEPQEKRPCSGSVVRSSNKRSSPELEESRCKSNINSDSSDSTTTSD---- 68

Query: 279 XXXXHHEPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANL 458
               H+E  ++     P K QVVGWPP++++RK   Q+   E  +               
Sbjct: 69  ----HNEDSVQ-----PAKVQVVGWPPIRSFRKNSLQQKKVEQGD----------GTGMY 109

Query: 459 VKVCMDGAPYLRKVDLKIYTSYQNLYDALANMF 557
           +KV M GAPYLRK+DLK+Y SY  L  AL N+F
Sbjct: 110 LKVSMAGAPYLRKIDLKVYKSYPELLKALQNLF 142



>gb:AF123504_1769919 Nicotiana tabacum Nt-iaa2.3 deduced protein
           mRNA, complete cds.
          Length = 179

 Score = 72.0 bits (175), Expect = 8e-12
 Identities = 49/147 (33%), Positives = 60/147 (40%)
 Frame = +3

Query: 117 TDLCLGLPGGNNESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXXXHH 296
           T+L LGLPG  +ES       +KR   E+ +                             
Sbjct: 16  TELRLGLPGTEDESIVSSSKNKKRGLPESAE----------------------------- 46

Query: 297 EPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMD 476
                +      K Q+VGWPPV++YRK   Q   TE                  VKV MD
Sbjct: 47  ----DEDCESKKKTQIVGWPPVRSYRKNNIQPKKTE------------TECGMYVKVSMD 90

Query: 477 GAPYLRKVDLKIYTSYQNLYDALANMF 557
           GAPYLRK+DLK+Y  Y  L  AL NMF
Sbjct: 91  GAPYLRKIDLKMYKGYAELLKALENMF 117



>gb:AP002524_1822385 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0406H10.>gb:AP002903_1823789 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0509B06.
          Length = 199

 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 43/103 (41%), Positives = 55/103 (53%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVD 503
           P PKA+VVGWPPV+++RK                       AA  VKV +DGAPYLRKVD
Sbjct: 71  PAPKARVVGWPPVRSFRKN--------------------ALAAKFVKVAVDGAPYLRKVD 110

Query: 504 LKIYTSYQNLYDALANMFTSFTTIGNNGMIDFMNERKLMDLLH 632
           L+ Y+ Y  L  AL + F S  TI         +ERKL+D ++
Sbjct: 111 LEAYSGYDQLLRALQDKFFSHFTIRKFA----DDERKLVDAVN 149



>gb:ATHIAA1A_1553240 Arabidopsis thaliana auxin-responsive protein
           (IAA1) mRNA, 5' partial cds.
          Length = 168

 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 47/151 (31%), Positives = 65/151 (43%), Gaps = 3/151 (1%)
 Frame = +3

Query: 114 ETDLCLGLPGGNNESA---ECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXX 284
           +T+L LGLPG   E      C++   KR+ +++ +                         
Sbjct: 11  DTELRLGLPGAQEEQQLELSCVRSNNKRKNNDSTE------------------------- 45

Query: 285 XXHHEPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVK 464
                    +   PP K Q+VGWPPV++ RK    K+                   + VK
Sbjct: 46  ---------ESAPPPTKTQIVGWPPVRSNRKNNNNKN------------------VSYVK 78

Query: 465 VCMDGAPYLRKVDLKIYTSYQNLYDALANMF 557
           V MDGAPYLRK+DLK+Y +Y  L  AL NMF
Sbjct: 79  VSMDGAPYLRKIDLKMYKNYPELLKALENMF 109



>sp|P49677|IAA1_ARATH Auxin-responsive protein IAA1 (Indoleacetic
           acid-induced protein 1).>pir|A71408|A71408 auxin-induced
           protein IAA1 - Arabidopsis thaliana>gb:ATCHRIV39_1545220
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 39.>gb:ATFCA1_1551506 Arabidopsis thaliana DNA
           chromosome 4, ESSA I FCA contig fragment No.
           1.>gb:AY133714_1581534 Arabidopsis thaliana clone C00009
           auxin-responsive protein IAA1 (At4g14560) mRNA, complete
           cds.>gb:AK176546_1818534 Arabidopsis thaliana mRNA for
           auxin-responsive protein IAA1, complete cds, clone:
           RAFL25-06-K23.
          Length = 168

 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 47/151 (31%), Positives = 65/151 (43%), Gaps = 3/151 (1%)
 Frame = +3

Query: 114 ETDLCLGLPGGNNESA---ECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXX 284
           +T+L LGLPG   E      C++   KR+ +++ +                         
Sbjct: 11  DTELRLGLPGAQEEQQLELSCVRSNNKRKNNDSTE------------------------- 45

Query: 285 XXHHEPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVK 464
                    +   PP K Q+VGWPPV++ RK    K+                   + VK
Sbjct: 46  ---------ESAPPPAKTQIVGWPPVRSNRKNNNNKN------------------VSYVK 78

Query: 465 VCMDGAPYLRKVDLKIYTSYQNLYDALANMF 557
           V MDGAPYLRK+DLK+Y +Y  L  AL NMF
Sbjct: 79  VSMDGAPYLRKIDLKMYKNYPELLKALENMF 109



>gb:AP003835_1833996 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1506_G02.
          Length = 219

 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 43/102 (42%), Positives = 55/102 (53%), Gaps = 7/102 (6%)
 Frame = +3

Query: 312 DPIMPPPKAQVVGWPPVKNYRKKM------AQKSNTEGSEEKXXXXXXXXXAANLVKVCM 473
           D    P KAQVVGWPPV+ YR+        A  +  +G +EK             VKV M
Sbjct: 79  DDTAAPAKAQVVGWPPVRAYRRNTFHQAAAAAAATKKGGDEKQKQQQQGGGL--YVKVSM 136

Query: 474 DGAPYLRKVDLKIYTSYQNLYDALANMFTS-FTTIGNNGMID 596
           DGAPYLRKVDLK+   Y+ L +AL  +FT  F+   ++G  D
Sbjct: 137 DGAPYLRKVDLKMCKGYRELREALDLLFTKCFSATASDGCSD 178



>gb:AC144738_1744170 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0029B02, complete sequence.
          Length = 212

 Score = 69.3 bits (168), Expect = 5e-11
 Identities = 43/100 (43%), Positives = 51/100 (51%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVD 503
           P PKA+VVGWPPV+ +RK          S +           A  VKV +DGAPYLRKVD
Sbjct: 76  PSPKARVVGWPPVRAFRKNALAALAAASSSK-----------AKFVKVAVDGAPYLRKVD 124

Query: 504 LKIYTSYQNLYDALANMFTSFTTIGNNGMIDFMNERKLMD 623
           L+ Y  Y  L  AL + F S  TI   G      E KL+D
Sbjct: 125 LEAYRGYDQLLAALQDKFFSHFTIRKLG----NEEMKLVD 160



>gb:AC093713_1736106 Oryza sativa chromosome 3 BAC OSJNBa0094F01
           genomic sequence, complete sequence.
          Length = 195

 Score = 68.6 bits (166), Expect = 9e-11
 Identities = 38/95 (40%), Positives = 50/95 (52%), Gaps = 7/95 (7%)
 Frame = +3

Query: 306 LKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAAN-------LVK 464
           ++D   P  K QVVGWPPV +YR+   Q S++  +                       VK
Sbjct: 53  VEDGASPASKVQVVGWPPVGSYRRSTFQSSSSSTAAAAKGKGGGETDQGRKNKGGGLYVK 112

Query: 465 VCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFT 569
           V MDGAPYLRKVDL++Y  Y+ L DAL  +F  F+
Sbjct: 113 VSMDGAPYLRKVDLRMYGGYRELRDALDALFGCFS 147



>sp|Q9C966|IAAF_ARATH Auxin-responsive protein IAA15 (Indoleacetic
           acid-induced protein 15).>pir|F96835|F96835 unknown
           protein F5I6.14 [imported] - Arabidopsis
           thaliana>gb:AE005173_895552 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC018848_1538409 Arabidopsis thaliana
           chromosome 1 BAC F5I6 genomic sequence, complete
           sequence.>gb:ATH441300_1552601 Arabidopsis thaliana mRNA
           for putative auxin-induced protein 21 (iaa21 gene).
          Length = 179

 Score = 68.2 bits (165), Expect = 1e-10
 Identities = 54/156 (34%), Positives = 62/156 (39%), Gaps = 1/156 (0%)
 Frame = +3

Query: 111 GETDLCLGLPGG-NNESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXX 287
           G T+L L LPG   N S    K   KR F ETVDLKL    + N                
Sbjct: 17  GGTELTLALPGTPTNASEGPKKFGNKRRFLETVDLKLGEAHENNYISSMVTND------- 69

Query: 288 XHHEPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKV 467
                            Q+VGWPPV   RK + +K                      VKV
Sbjct: 70  -----------------QLVGWPPVATARKTVRRK---------------------YVKV 91

Query: 468 CMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTI 575
            +DGA YLRKVDL +Y  Y  L+ AL NMF    TI
Sbjct: 92  ALDGAAYLRKVDLGMYDCYGQLFTALENMFQGIITI 127



>gb:AP004236_1839117 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0417D05.
          Length = 193

 Score = 67.4 bits (163), Expect = 2e-10
 Identities = 41/102 (40%), Positives = 52/102 (50%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVD 503
           P PKA+ VGWPPV+ YR+   ++ +                 A LVKV +DGAPYLRKVD
Sbjct: 56  PSPKARAVGWPPVRAYRRNALREDSAR---------------AKLVKVAVDGAPYLRKVD 100

Query: 504 LKIYTSYQNLYDALANMFTSFTTIGNNGMIDFMNERKLMDLL 629
           L  +  Y  L  AL  MF S   +   G  D     KL+DL+
Sbjct: 101 LAAHAGYAPLLRALHGMFASCLAVRGGGGGD-GEGTKLVDLV 141



>sp|Q38824|IAA6_ARATH Auxin-responsive protein IAA6 (Indoleacetic
           acid-induced protein 6).>pir|E96569|E96569 probable IAA6
           protein, 42631-41742 [imported] - Arabidopsis
           thaliana>gb:AE005173_893194 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC019018_1538490 Arabidopsis thaliana
           chromosome 1 BAC F14G24 genomic sequence, complete
           sequence.>gb:AF336915_1787607 Arabidopsis thaliana clone
           C00013 (h) IAA6 (At1g52830) mRNA, complete cds.
          Length = 189

 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 49/148 (33%), Positives = 67/148 (45%), Gaps = 1/148 (0%)
 Frame = +3

Query: 117 TDLCLGLPGGN-NESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXXXH 293
           T+L LGLPG N +E + C    +K+     +     L  +                    
Sbjct: 11  TELRLGLPGDNYSEISVCGSSKKKKRVLSDMMTSSALDTENENSVVSS------------ 58

Query: 294 HEPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCM 473
               ++D  +P  K+Q VGWPPV +YR+K   K+N E S+           A   VKV M
Sbjct: 59  ----VEDESLPVVKSQAVGWPPVCSYRRK---KNNEEASK-----------AIGYVKVSM 100

Query: 474 DGAPYLRKVDLKIYTSYQNLYDALANMF 557
           DG PY+RK+DL    SY NL   L N+F
Sbjct: 101 DGVPYMRKIDLGSSNSYINLVTVLENLF 128



>gb:AY085353_1570424 Arabidopsis thaliana clone 147711 mRNA,
           complete sequence.
          Length = 189

 Score = 65.9 bits (159), Expect = 6e-10
 Identities = 47/148 (31%), Positives = 68/148 (45%), Gaps = 1/148 (0%)
 Frame = +3

Query: 117 TDLCLGLPGGN-NESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXXXH 293
           T+L LG+PG N +E + C    +K+     +    +L  +                    
Sbjct: 11  TELRLGIPGDNYSEISICGSSKKKKRVLSDMMTSSSLDTENENSVVSS------------ 58

Query: 294 HEPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCM 473
               ++D  +P  K+Q VGWPPV +YR+K   K+N E S+           A   VKV M
Sbjct: 59  ----VEDESLPVVKSQAVGWPPVCSYRRK---KNNEEASK-----------AIGYVKVSM 100

Query: 474 DGAPYLRKVDLKIYTSYQNLYDALANMF 557
           DG PY+RK+DL    +Y NL   L N+F
Sbjct: 101 DGVPYMRKIDLGSSNNYINLVTVLENLF 128



>pir|S58493|S58493 auxin-induced protein IAA6 - Arabidopsis
           thaliana>gb:ATU18408_1556794 Arabidopsis thaliana IAA6
           (IAA6) gene, complete cds.
          Length = 189

 Score = 65.9 bits (159), Expect = 6e-10
 Identities = 37/84 (44%), Positives = 48/84 (57%)
 Frame = +3

Query: 306 LKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAP 485
           ++D  +P  K+Q VGWPPV +YR+K   K+N E S+           A   VKV MDG P
Sbjct: 59  VEDESLPVVKSQAVGWPPVCSYRRK---KNNEEASK-----------AIGYVKVSMDGVP 104

Query: 486 YLRKVDLKIYTSYQNLYDALANMF 557
           Y+RK+DL    SY NL   L N+F
Sbjct: 105 YMRKIDLGSSNSYINLVTVLENLF 128



>gb:AY681124_1622096 Citrus limon auxin-induced protein 22D mRNA,
           partial cds.
          Length = 111

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 32/61 (52%), Positives = 38/61 (62%)
 Frame = +3

Query: 333 KAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVDLKI 512
           KAQVVGWPP+++YRK   Q+   EG             A   VKV MDGAPYLRK+DLK+
Sbjct: 60  KAQVVGWPPIRSYRKNSLQQKKNEGE-----------CAGIYVKVSMDGAPYLRKIDLKL 108

Query: 513 Y 515
           Y
Sbjct: 109 Y 109



>gb:AB061223_1521995 Physcomitrella patens PpIAA1b mRNA for IAA/AUX
           protein, complete cds.
          Length = 503

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 33/85 (38%), Positives = 41/85 (48%), Gaps = 4/85 (4%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQ----KSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYL 491
           PP + Q VGWPPVKN+ K         +                 + NLVK+ MDG P+ 
Sbjct: 331 PPAQNQTVGWPPVKNFNKMNTPAPPASTPARACPSVQRKGASTSSSGNLVKIYMDGVPFG 390

Query: 492 RKVDLKIYTSYQNLYDALANMFTSF 566
           RKVDLK   SY  LY  L +MF  +
Sbjct: 391 RKVDLKTNDSYDKLYSMLEDMFQQY 415



>gb:AB061222_1521994 Physcomitrella patens PpIAA1a mRNA for IAA/AUX
           protein, complete cds.
          Length = 484

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 33/85 (38%), Positives = 41/85 (48%), Gaps = 4/85 (4%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQ----KSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYL 491
           PP + Q VGWPPVKN+ K         +                 + NLVK+ MDG P+ 
Sbjct: 312 PPAQNQTVGWPPVKNFNKMNTPAPPASTPARACPSVQRKGASTSSSGNLVKIYMDGVPFG 371

Query: 492 RKVDLKIYTSYQNLYDALANMFTSF 566
           RKVDLK   SY  LY  L +MF  +
Sbjct: 372 RKVDLKTNDSYDKLYSMLEDMFQQY 396



>gb:AF123505_1769920 Nicotiana tabacum Nt-iaa2.5 deduced protein
           mRNA, partial cds.
          Length = 176

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 34/76 (44%), Positives = 43/76 (56%), Gaps = 3/76 (3%)
 Frame = +3

Query: 339 QVVGWPPVKNYRKK---MAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVDLK 509
           Q+VGWPPV++YRK      +K+ TE                 + KV MDGAPYLRK+DL+
Sbjct: 52  QLVGWPPVRSYRKNNIPTQRKTETE-------------CGMYVSKVSMDGAPYLRKIDLE 98

Query: 510 IYTSYQNLYDALANMF 557
           +Y  Y  L  AL NMF
Sbjct: 99  MYKGYSELLKALENMF 114



>gb:AF022015_1761752 Lycopersicon esculentum auxin-regulated IAA4
           (IAA4) mRNA, partial cds.
          Length = 100

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 39/98 (39%), Positives = 52/98 (53%), Gaps = 5/98 (5%)
 Frame = +3

Query: 360 VKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVDLKIYTSYQNLYD 539
           ++++RK     ++    E            A  +KV MDGAPYLRKVDL+  ++YQ L  
Sbjct: 1   IRSFRKNTLASASKNNEE----VDGKAGSPALFIKVSMDGAPYLRKVDLRTCSAYQELSS 56

Query: 540 ALANMFTSFTTIGNNGM-----IDFMNERKLMDLLHTS 638
           AL  MF+ F TIG  G       D ++E KL DLLH S
Sbjct: 57  ALEKMFSCF-TIGQYGSHGAPGKDMLSESKLKDLLHGS 93



>pir|T05364|T05364 auxin-induced protein IAA4 - tomato (fragment)
          Length = 100

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 39/98 (39%), Positives = 52/98 (53%), Gaps = 5/98 (5%)
 Frame = +3

Query: 360 VKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVDLKIYTSYQNLYD 539
           ++++RK     ++    E            A  +KV MDGAPYLRKVDL+  ++YQ L  
Sbjct: 1   IRSFRKNTLASASKNNEE----VDGKAGSPALFIKVSMDGAPYLRKVDLRTCSAYQELSS 56

Query: 540 ALANMFTSFTTIGNNGM-----IDFMNERKLMDLLHTS 638
           AL  MF+ F TIG  G       D ++E KL DLLH S
Sbjct: 57  ALEKMFSCF-TIGQYGSHGAPGKDMLSESKLKDLLHGS 93



>gb:AF022019_1761756 Lycopersicon esculentum auxin-regulated IAA8
           (IAA8) mRNA, partial cds.
          Length = 75

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 32/56 (57%), Positives = 39/56 (69%)
 Frame = +3

Query: 459 VKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNGMIDFMNERKLMDL 626
           VKV +DGAPYLRKVDL++Y SYQ L +AL NMFT  T      + +  +E KLMDL
Sbjct: 15  VKVAVDGAPYLRKVDLEMYDSYQKLLNALENMFTCLT------ICNSQSESKLMDL 64



>pir|T05706|T05706 auxin-induced protein IAA8 - tomato (fragment)
          Length = 75

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 32/56 (57%), Positives = 39/56 (69%)
 Frame = +3

Query: 459 VKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNGMIDFMNERKLMDL 626
           VKV +DGAPYLRKVDL++Y SYQ L +AL NMFT  T      + +  +E KLMDL
Sbjct: 15  VKVAVDGAPYLRKVDLEMYDSYQKLLNALENMFTCLT------ICNSQSESKLMDL 64



>sp|O24409|IAAJ_ARATH Auxin-responsive protein IAA19 (Indoleacetic
           acid-induced protein 19) (MASSUGU2
           protein).>gb:AB022218_1515101 Arabidopsis thaliana
           genomic DNA, chromosome 3, P1 clone:
           MJK13.>gb:AC024081_1539280 Arabidopsis thaliana
           chromosome III P1 MJK13 genomic sequence, complete
           sequence.
          Length = 197

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 55/154 (35%), Positives = 66/154 (42%)
 Frame = +3

Query: 117 TDLCLGLPGGNNESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXXXHH 296
           T+L LGLPG   + AE  K+ +KR F+E            N                   
Sbjct: 11  TELRLGLPG--RDVAE--KMMKKRAFTEM-----------NMTSSGSNSDQCESGVVSSG 55

Query: 297 EPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMD 476
               K    P  K+QVVGWPPV +YRKK + K   E S  K             VKV MD
Sbjct: 56  GDAEKVNDSPAAKSQVVGWPPVCSYRKKNSCK---EASTTKV--------GLGYVKVSMD 104

Query: 477 GAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIG 578
           G PYLRK+DL     Y +L  AL  +F  F  IG
Sbjct: 105 GVPYLRKMDLGSSQGYDDLAFALDKLF-GFRGIG 137



>sp|P13088|AX22_SOYBN Auxin-induced protein AUX22.>pir|B28993|B28993
           auxin-induced protein aux22 -
           soybean>gb:SOYAUX22_1715966 Soybean auxin-regulated
           protein (Aux22) mRNA, complete cds.
          Length = 195

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 36/82 (43%), Positives = 46/82 (56%)
 Frame = +3

Query: 312 DPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYL 491
           D  M   K+QVVGWPPV +YRKK    S  EG+ +              VKV MDGAP+L
Sbjct: 55  DRKMETNKSQVVGWPPVCSYRKK---NSMNEGASKMY------------VKVSMDGAPFL 99

Query: 492 RKVDLKIYTSYQNLYDALANMF 557
           RK+DL ++  Y +L  AL  +F
Sbjct: 100 RKIDLGLHKGYSDLALALDKLF 121



>gb:AC144740_1744194 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0075A10, complete sequence.
          Length = 327

 Score = 58.9 bits (141), Expect = 7e-08
 Identities = 31/80 (38%), Positives = 44/80 (55%), Gaps = 5/80 (6%)
 Frame = +3

Query: 342 VVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAA-----NLVKVCMDGAPYLRKVDL 506
           VVGWPP++++R+ +   S+ + S E+                 LVK+ MDG P  RKVDL
Sbjct: 168 VVGWPPIRSFRRNLTNGSSFKQSPERQNDEADDKAKPICKKRPLVKINMDGIPIGRKVDL 227

Query: 507 KIYTSYQNLYDALANMFTSF 566
           +IY SYQ L  A+  +F  F
Sbjct: 228 QIYDSYQKLSSAVEELFRGF 247



>gb:AP003768_1833262 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0439E07.
          Length = 335

 Score = 58.5 bits (140), Expect = 9e-08
 Identities = 30/82 (36%), Positives = 43/82 (52%), Gaps = 5/82 (6%)
 Frame = +3

Query: 336 AQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAAN-----LVKVCMDGAPYLRKV 500
           A VVGWPP++++R+ +A  S+++ S E                  LVK+ MDG P  RK+
Sbjct: 174 APVVGWPPIRSFRRNLASSSSSKHSPEPQNDNANAKVTLTCKKNPLVKINMDGIPIGRKI 233

Query: 501 DLKIYTSYQNLYDALANMFTSF 566
           DL  Y SY  L  A+  +F  F
Sbjct: 234 DLAAYNSYDGLSSAVKQLFHGF 255



>gb:AY088753_1573766 Arabidopsis thaliana clone 94231 mRNA, complete
           sequence.
          Length = 197

 Score = 58.5 bits (140), Expect = 9e-08
 Identities = 54/154 (35%), Positives = 66/154 (42%)
 Frame = +3

Query: 117 TDLCLGLPGGNNESAECLKITRKREFSETVDLKLNLPIQPNXXXXXXXXXXXXXXXXXHH 296
           T+L LGLPG   + AE  K+ +KR F+E            N                   
Sbjct: 11  TELRLGLPG--RDVAE--KMMKKRAFTEM-----------NMTSSGSNSDQCESGVVSSG 55

Query: 297 EPILKDPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMD 476
               K    P  K+QVVGWPPV +YRKK + K   E S  K             VKV MD
Sbjct: 56  GDAEKVNDSPAAKSQVVGWPPVCSYRKKNSCK---EASTTK--------VGLGYVKVSMD 104

Query: 477 GAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIG 578
           G PYLRK+DL     Y +L  +L  +F  F  IG
Sbjct: 105 GVPYLRKMDLGSSQGYDDLAFSLDKLF-GFRGIG 137



>gb:ATU49075_1557046 Arabidopsis thaliana early auxin-induced
           (IAA19) mRNA, partial cds.
          Length = 145

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 39/85 (45%), Positives = 45/85 (52%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVD 503
           P  K+QVVGWPPV +YRKK + K   E S  K             VKV MDG PYLRK+D
Sbjct: 13  PAAKSQVVGWPPVCSYRKKNSCK---EASTTKV--------GLGYVKVSMDGVPYLRKMD 61

Query: 504 LKIYTSYQNLYDALANMFTSFTTIG 578
           L     Y +L  AL  +F  F  IG
Sbjct: 62  LGSSQGYDDLAFALDKLF-GFRGIG 85



>gb:ATU18407_1556793 Arabidopsis thaliana IAA5 (IAA5) gene, partial
           cds.
          Length = 158

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 31/78 (39%), Positives = 45/78 (57%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVD 503
           P  K+QVVGWPPV +YR+K + +                   ++ VKV +DGA +LRK+D
Sbjct: 43  PAKKSQVVGWPPVCSYRRKNSLERTK----------------SSYVKVSVDGAAFLRKID 86

Query: 504 LKIYTSYQNLYDALANMF 557
           L++Y  YQ+L  AL  +F
Sbjct: 87  LEMYKCYQDLASALQILF 104



>pir|G86289|G86289 auxin-induced protein AUX2-27 [imported] -
           Arabidopsis thaliana>gb:AE005172_890547 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC013453_1537942 Arabidopsis thaliana
           chromosome I BAC T16N11 genomic sequence, complete
           sequence.>gb:ATAUX227_1544125 A.thaliana auxin-inducible
           Aux2-27 gene.
          Length = 174

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 31/78 (39%), Positives = 45/78 (57%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVD 503
           P  K+QVVGWPPV +YR+K + +                   ++ VKV +DGA +LRK+D
Sbjct: 48  PAKKSQVVGWPPVCSYRRKNSLERTK----------------SSYVKVSVDGAAFLRKID 91

Query: 504 LKIYTSYQNLYDALANMF 557
           L++Y  YQ+L  AL  +F
Sbjct: 92  LEMYKCYQDLASALQILF 109



>pir|S58492|S58492 auxin-induced protein IAA5 - Arabidopsis thaliana
          Length = 174

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 31/78 (39%), Positives = 45/78 (57%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVD 503
           P  K+QVVGWPPV +YR+K + +                   ++ VKV +DGA +LRK+D
Sbjct: 48  PAKKSQVVGWPPVCSYRRKNSLERTK----------------SSYVKVSVDGAAFLRKID 91

Query: 504 LKIYTSYQNLYDALANMF 557
           L++Y  YQ+L  AL  +F
Sbjct: 92  LEMYKCYQDLASALQILF 109



>sp|P33078|IAA5_ARATH Auxin-responsive protein IAA5 (Indoleacetic
           acid-induced protein 5) (Auxin-induced protein
           AUX2-27).>gb:AY150496_1585061 Arabidopsis thaliana
           putative auxin-induced protein IAA5 (At1g15580) mRNA,
           complete cds.
          Length = 163

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 31/78 (39%), Positives = 45/78 (57%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVD 503
           P  K+QVVGWPPV +YR+K + +                   ++ VKV +DGA +LRK+D
Sbjct: 48  PAKKSQVVGWPPVCSYRRKNSLERTK----------------SSYVKVSVDGAAFLRKID 91

Query: 504 LKIYTSYQNLYDALANMF 557
           L++Y  YQ+L  AL  +F
Sbjct: 92  LEMYKCYQDLASALQILF 109



>pir|S12244|S12244 auxin-induced protein AUX2-27 - Arabidopsis
           thaliana
          Length = 174

 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 30/78 (38%), Positives = 45/78 (57%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVD 503
           P  K+QVVGWPPV +YR+K + +                   ++ VKV ++GA +LRK+D
Sbjct: 48  PAKKSQVVGWPPVCSYRRKNSLERTK----------------SSYVKVSVEGAAFLRKID 91

Query: 504 LKIYTSYQNLYDALANMF 557
           L++Y  YQ+L  AL  +F
Sbjct: 92  LEMYKCYQDLASALQILF 109



>gb:PSIAA6R_1702191 P.sativum mRNA for auxin-induced protein (clone
           pIAA6).
          Length = 156

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 34/75 (45%), Positives = 42/75 (56%)
 Frame = +3

Query: 333 KAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVDLKI 512
           K QVVGWPPV +YRKK    +  EGS+               +KV MDGAPYLRK+DL +
Sbjct: 30  KNQVVGWPPVCSYRKK----NMNEGSKM-------------YMKVSMDGAPYLRKIDLCL 72

Query: 513 YTSYQNLYDALANMF 557
           +  Y  L  AL  +F
Sbjct: 73  HKGYLELALALEKLF 87



>sp|P49680|IAA6_PEA Auxin-induced protein IAA6.>pir|S39078|S39078
           auxin-induced protein IAA6 - garden
           pea>gb:PSIAA6D_1702190 P.sativum gene for PS-IAA6.
          Length = 179

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 34/75 (45%), Positives = 42/75 (56%)
 Frame = +3

Query: 333 KAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVDLKI 512
           K QVVGWPPV +YRKK    +  EGS+               +KV MDGAPYLRK+DL +
Sbjct: 53  KNQVVGWPPVCSYRKK----NMNEGSKM-------------YMKVSMDGAPYLRKIDLCL 95

Query: 513 YTSYQNLYDALANMF 557
           +  Y  L  AL  +F
Sbjct: 96  HKGYLELALALEKLF 110



>gb:AP005394_1851031 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0620H05.>gb:AP005756_1857293 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBb0035N08.
          Length = 300

 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 28/78 (35%), Positives = 41/78 (52%), Gaps = 2/78 (2%)
 Frame = +3

Query: 330 PKAQVVGWPPVKNYRKKMA--QKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVD 503
           P   VVGWPPV+ +R+ +A   K++ E    K          A  +K+ MDG P  RK+D
Sbjct: 135 PSTPVVGWPPVRTFRRNLATSSKASLELQNGKKAAKAEEIKRAPFIKINMDGVPIGRKID 194

Query: 504 LKIYTSYQNLYDALANMF 557
           L  + SY+ L  A+  +F
Sbjct: 195 LNAFDSYEKLSLAVDKLF 212



>sp|P32293|AX2A_PHAAU Auxin-induced protein 22A (Indole-3-acetic
           acid induced protein ARG3).>pir|T10939|T10939
           auxin-induced protein aux22 - mung
           bean>gb:VIRAUX22A_1727240 Vigna radiata auxin-regulated
           mRNA.
          Length = 194

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 34/75 (45%), Positives = 42/75 (56%)
 Frame = +3

Query: 333 KAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVDLKI 512
           K QVVGWPPV +YRKK    S  E S+               VKV MDGAP+LRK+DL +
Sbjct: 62  KNQVVGWPPVCSYRKK---NSVNEASKM-------------YVKVSMDGAPFLRKMDLGM 105

Query: 513 YTSYQNLYDALANMF 557
           +  Y +L  AL  +F
Sbjct: 106 HKGYSDLAFALEKLF 120



>pir|T05400|T05400 hypothetical protein F10M6.80 - Arabidopsis
           thaliana>gb:ATCHRIV76_1547149 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 76.>gb:ATF10M6_1548194
           Arabidopsis thaliana DNA chromosome 4, BAC clone F10M6
           (ESSAII project).
          Length = 842

 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 29/83 (34%), Positives = 42/83 (50%), Gaps = 6/83 (7%)
 Frame = +3

Query: 336 AQVVGWPPVKNYRKKMAQKSN------TEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRK 497
           ++VVGWPPVK    K     N      T  +            ++  VKV MDG    RK
Sbjct: 93  SEVVGWPPVKTCMIKRITAMNNNISNPTTATVGSSSSSSISSRSSMYVKVKMDGVAIARK 152

Query: 498 VDLKIYTSYQNLYDALANMFTSF 566
           VD+K++ SY++L ++L  MFT +
Sbjct: 153 VDIKLFNSYESLTNSLITMFTEY 175



>sp|O24541|AX2C_PHAAU Auxin-induced protein 22C (Indole-3-acetic
           acid induced protein ARG12).>pir|T10859|T10859
           auxin-induced protein Aux22c - mung
           bean>gb:AB004931_1509223 Vigna radiata mRNA for Aux22c,
           complete cds.
          Length = 188

 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 33/75 (44%), Positives = 40/75 (53%)
 Frame = +3

Query: 333 KAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVDLKI 512
           K QVVGWPPV +YRKK     NT    +              VKV MDGAP+LRK+DL +
Sbjct: 57  KNQVVGWPPVCSYRKK-----NTVNEPKLY------------VKVSMDGAPFLRKIDLAM 99

Query: 513 YTSYQNLYDALANMF 557
           +  Y +L  AL   F
Sbjct: 100 HKGYSDLAFALDKFF 114



>gb:AY137961_1582213 Mirabilis jalapa clone SM-36 Aux/IAA1 mRNA,
           partial cds.
          Length = 97

 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 2/42 (4%)
 Frame = +3

Query: 519 SYQNLYDALANMFTSFT--TIGNNGMIDFMNERKLMDLLHTS 638
           SYQ+L DAL  MF+SFT    G+ GMIDFMNE KLMDL++ S
Sbjct: 2   SYQDLSDALGKMFSSFTLGNYGSQGMIDFMNESKLMDLINGS 43



>gb:AB026821_1517412 Cucumis sativus CsIAA1 mRNA for Aux/IAA
           protein, complete cds.
          Length = 188

 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 29/77 (37%), Positives = 41/77 (53%)
 Frame = +3

Query: 333 KAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVDLKI 512
           + QVVGWPPV +YR++ + K   E  E +             VKV  +G P+LRKVDL +
Sbjct: 59  RKQVVGWPPVCSYRRRNSFKGKGEQCESEEIMNMGMKKQM-YVKVSFEGTPFLRKVDLGM 117

Query: 513 YTSYQNLYDALANMFTS 563
              Y +L  A+  +F S
Sbjct: 118 VKGYGDLVGAMEKLFGS 134



>gb:AP004732_1843950 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0021M10.
          Length = 265

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 30/95 (31%), Positives = 46/95 (48%), Gaps = 14/95 (14%)
 Frame = +3

Query: 336 AQVVGWPPVKNYRKKMA--------------QKSNTEGSEEKXXXXXXXXXAANLVKVCM 473
           AQ+VGWPPV+ +RK ++              +  + EG   +         +   VKV +
Sbjct: 39  AQLVGWPPVRTFRKNLSTPKPADADDLMNKMKPCSDEGHGSRDAAQERRPSSTMFVKVNL 98

Query: 474 DGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIG 578
           +G    RK+DLK + SY +L  AL +MF  F + G
Sbjct: 99  EGYAVGRKIDLKAHRSYDSLSQALQSMFHGFLSDG 133



>gb:AF022017_1761754 Lycopersicon esculentum auxin-regulated IAA6
           (IAA6) mRNA, partial cds.
          Length = 97

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 5/65 (7%)
 Frame = +3

Query: 459 VKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNGM-----IDFMNERKLMD 623
           VKV MDGAPYLRKVD+K Y++Y  L  AL  MF+ F +IG          + ++E  LMD
Sbjct: 27  VKVSMDGAPYLRKVDIKTYSNYAALSSALEKMFSCF-SIGQCASDKIPGQEKLSESHLMD 85

Query: 624 LLHTS 638
           LL+ S
Sbjct: 86  LLNGS 90



>pir|T05368|T05368 auxin-induced protein IAA6 - tomato (fragment)
          Length = 97

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 5/65 (7%)
 Frame = +3

Query: 459 VKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNGM-----IDFMNERKLMD 623
           VKV MDGAPYLRKVD+K Y++Y  L  AL  MF+ F +IG          + ++E  LMD
Sbjct: 27  VKVSMDGAPYLRKVDIKTYSNYAALSSALEKMFSCF-SIGQCASDKIPGQEKLSESHLMD 85

Query: 624 LLHTS 638
           LL+ S
Sbjct: 86  LLNGS 90



>gb:AF022014_1761751 Lycopersicon esculentum auxin-regulated IAA3
           (IAA3) mRNA, partial cds.
          Length = 79

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 27/66 (40%), Positives = 37/66 (56%)
 Frame = +3

Query: 360 VKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVDLKIYTSYQNLYD 539
           V++YRK    K +   +            +   +KV MDGAPYLRK+DL++Y SYQ L  
Sbjct: 1   VRSYRKNHVSKLSESDNNS----------SGMYLKVSMDGAPYLRKIDLQVYKSYQELLK 50

Query: 540 ALANMF 557
           AL +MF
Sbjct: 51  ALQSMF 56



>gb:AY099670_1576695 Arabidopsis thaliana early auxin-inducible
           protein 11 (At4g28640) mRNA, complete
           cds.>gb:BT000261_1634539 Arabidopsis thaliana early
           auxin-inducible protein 11 (At4g28640) mRNA, complete
           cds.
          Length = 246

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 29/90 (32%), Positives = 41/90 (45%), Gaps = 11/90 (12%)
 Frame = +3

Query: 321 MPPPKAQVVGWPPVKNYR-KKMAQKSNTEGSEE----------KXXXXXXXXXAANLVKV 467
           M     QVVGWPP++ YR   M  ++    +E+          K          +  VKV
Sbjct: 82  MAATSGQVVGWPPIRTYRMNSMVNQAKASATEDPNLEISQAVNKNRSDSTKMRNSMFVKV 141

Query: 468 CMDGAPYLRKVDLKIYTSYQNLYDALANMF 557
            MDG P  RK+DL  +  Y++L + L  MF
Sbjct: 142 TMDGIPIGRKIDLNAHKCYESLSNTLEEMF 171



>pir|T04352|T04352 auxin-induced protein IAA3 - tomato (fragment)
          Length = 79

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 27/66 (40%), Positives = 37/66 (56%)
 Frame = +3

Query: 360 VKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVDLKIYTSYQNLYD 539
           V++YRK    K +   +            +   +KV MDGAPYLRK+DL++Y SYQ L  
Sbjct: 1   VRSYRKNHVSKLSESDNNS----------SGMYLKVSMDGAPYLRKIDLQVYKSYQELLK 50

Query: 540 ALANMF 557
           AL +MF
Sbjct: 51  ALQSMF 56



>sp|Q38829|IAAB_ARATH Auxin-responsive protein IAA11 (Indoleacetic
           acid-induced protein 11).>pir|S58497|S58497 early
           auxin-inducible protein IAA11 - Arabidopsis
           thaliana>gb:ATCHRIV69_1546744 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           69.>gb:ATU18413_1556799 Arabidopsis thaliana IAA11
           (IAA11) gene, complete cds.>gb:AF332397_1787210
           Arabidopsis thaliana clone C00018 (e) early
           auxin-inducible protein 11 (At4g28640) mRNA, complete
           cds.>gb:AK118377_1816358 Arabidopsis thaliana At4g28640
           mRNA for putative early auxin-inducible protein 11
           (IAA11), complete cds, clone: RAFL19-64-E04.
          Length = 246

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 29/90 (32%), Positives = 41/90 (45%), Gaps = 11/90 (12%)
 Frame = +3

Query: 321 MPPPKAQVVGWPPVKNYR-KKMAQKSNTEGSEE----------KXXXXXXXXXAANLVKV 467
           M     QVVGWPP++ YR   M  ++    +E+          K          +  VKV
Sbjct: 82  MAATSGQVVGWPPIRTYRMNSMVNQAKASATEDPNLEISQAVNKNRSDSTKMRNSMFVKV 141

Query: 468 CMDGAPYLRKVDLKIYTSYQNLYDALANMF 557
            MDG P  RK+DL  +  Y++L + L  MF
Sbjct: 142 TMDGIPIGRKIDLNAHKCYESLSNTLEEMF 171



>gb:AY137962_1582214 Mirabilis jalapa clone RS-31 Aux/IAA2 mRNA,
           partial cds.
          Length = 93

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 23/33 (69%), Positives = 25/33 (75%)
 Frame = +3

Query: 459 VKVCMDGAPYLRKVDLKIYTSYQNLYDALANMF 557
           VKV MDGAPYLRK+DLK+Y SY  L   L NMF
Sbjct: 1   VKVSMDGAPYLRKIDLKVYQSYAELLRGLENMF 33



>pir|S58499|S58499 auxin regulated protein (IAA13) [imported] -
           Arabidopsis thaliana>gb:AC002332_1530303 Arabidopsis
           thaliana chromosome 2 clone F4P9 map ve015, complete
           sequence.>gb:ATU18415_1556801 Arabidopsis thaliana IAA13
           (IAA13) gene, complete cds.>gb:AY085194_1570273
           Arabidopsis thaliana clone 13741 mRNA, complete
           sequence.>gb:AF332399_1787212 Arabidopsis thaliana clone
           C00020 (e) auxin-regulated protein IAA13 (At2g33310)
           mRNA, complete cds.
          Length = 246

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 34/103 (33%), Positives = 48/103 (46%), Gaps = 18/103 (17%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYR---------------KKMAQKSNTEGSEEKXXXXXXXXXA-AN 455
           PP  +QVVGWPP+ ++R               ++ A K   +  E K             
Sbjct: 70  PPRSSQVVGWPPIGSHRMNSLVNNQATKSAREEEEAGKKKVKDDEPKDVTKKVNGKVQVG 129

Query: 456 LVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMF--TSFTTIG 578
            +KV MDG    RKVDL  ++SY+NL   L +MF  T+  T+G
Sbjct: 130 FIKVNMDGVAIGRKVDLNAHSSYENLAQTLEDMFFRTNPGTVG 172



>gb:AF088281_1767266 Arabidopsis thaliana phytochrome-associated
           protein 1 (PAP1) mRNA, complete cds.
          Length = 267

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 28/83 (33%), Positives = 39/83 (46%), Gaps = 11/83 (13%)
 Frame = +3

Query: 342 VVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXX-----------AANLVKVCMDGAPY 488
           VVGWPPV+++RK +A  S+++   E                         VK+ MDG P 
Sbjct: 102 VVGWPPVRSFRKNLASTSSSKLGNESSHGGQINKSDDGEKQVETKKEGMFVKINMDGVPI 161

Query: 489 LRKVDLKIYTSYQNLYDALANMF 557
            RKVDL  Y SY+ L   +  +F
Sbjct: 162 GRKVDLNAYNSYEQLSFVVDKLF 184



>gb:AY087745_1572773 Arabidopsis thaliana clone 38146 mRNA, complete
           sequence.
          Length = 269

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 28/83 (33%), Positives = 39/83 (46%), Gaps = 11/83 (13%)
 Frame = +3

Query: 342 VVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXX-----------AANLVKVCMDGAPY 488
           VVGWPPV+++RK +A  S+++   E                         VK+ MDG P 
Sbjct: 104 VVGWPPVRSFRKNLASTSSSKLGNESSHGGQINKSDDGEKQVETKKEGMFVKINMDGVPI 163

Query: 489 LRKVDLKIYTSYQNLYDALANMF 557
            RKVDL  Y SY+ L   +  +F
Sbjct: 164 GRKVDLNAYNSYEQLSFVVDKLF 186



>sp|Q8LAL2|IAAQ_ARATH Auxin-responsive protein IAA26 (Indoleacetic
           acid-induced protein 26) (Phytochrome-associated protein
           1).>gb:AY072502_1567319 Arabidopsis thaliana
           phytochrome-associated protein 1 (At3g16500; MDC8.13)
           mRNA, complete cds.>gb:AF332394_1787207 Arabidopsis
           thaliana clone C00012 (f) auxin-induced protein AUX2-11
           (At5g43700) mRNA, complete cds.>gb:AF332401_1787214
           Arabidopsis thaliana clone C00023 (e) putative
           phytochrome-associated protein 1 (At3g16500) mRNA,
           complete cds.>gb:AF386948_1794753 Arabidopsis thaliana
           phytochrome-associated protein 1 (MDC8.13) mRNA,
           complete cds.>gb:AP000373_1819811 Arabidopsis thaliana
           genomic DNA, chromosome 3, P1 clone: MDC8.
          Length = 269

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 28/83 (33%), Positives = 39/83 (46%), Gaps = 11/83 (13%)
 Frame = +3

Query: 342 VVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXX-----------AANLVKVCMDGAPY 488
           VVGWPPV+++RK +A  S+++   E                         VK+ MDG P 
Sbjct: 104 VVGWPPVRSFRKNLASTSSSKLGNESSHGGQINKSDDGEKQVETKKEGMFVKINMDGVPI 163

Query: 489 LRKVDLKIYTSYQNLYDALANMF 557
            RKVDL  Y SY+ L   +  +F
Sbjct: 164 GRKVDLNAYNSYEQLSFVVDKLF 186



>gb:AY088042_1573066 Arabidopsis thaliana clone 40608 mRNA, complete
           sequence.
          Length = 239

 Score = 48.9 bits (115), Expect = 7e-05
 Identities = 33/100 (33%), Positives = 44/100 (44%), Gaps = 18/100 (18%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYR-------KKMAQKSNTEGSEEKXXXXXXXXXAANL-------- 458
           PP  +QVVGWPP+  +R       + M      EG  EK           ++        
Sbjct: 64  PPRSSQVVGWPPIGLHRMNSLVNNQAMKAARAEEGDGEKKVVKNDELKDVSMKVNAKVQG 123

Query: 459 ---VKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFT 569
              VKV MDG    RKVD++ ++SY+NL   L  MF   T
Sbjct: 124 LGFVKVNMDGVGIGRKVDMRAHSSYENLAQTLEEMFFGMT 163



>sp|Q38830|IAAC_ARATH Auxin-responsive protein IAA12 (Indoleacetic
           acid-induced protein 12) (BODENLOS
           protein).>pir|S58498|S58498 IAA12 protein - Arabidopsis
           thaliana>gb:AE005172_889475 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:ATU18414_1556800 Arabidopsis thaliana IAA12
           (IAA12) gene, complete cds.>gb:AY065240_1566392
           Arabidopsis thaliana auxin-induced protein IAA12
           (At1g04550) mRNA, complete cds.>gb:AY096535_1576077
           Arabidopsis thaliana auxin-induced protein IAA12
           (At1g04550) mRNA, complete cds.>gb:T1G11_1723599
           Sequence of BAC T1G11 from Arabidopsis thaliana
           chromosome 1, complete sequence.>gb:AF332398_1787211
           Arabidopsis thaliana auxin-induced protein, IAA12
           (At1g04550) mRNA, complete cds.
          Length = 239

 Score = 48.9 bits (115), Expect = 7e-05
 Identities = 33/100 (33%), Positives = 44/100 (44%), Gaps = 18/100 (18%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYR-------KKMAQKSNTEGSEEKXXXXXXXXXAANL-------- 458
           PP  +QVVGWPP+  +R       + M      EG  EK           ++        
Sbjct: 64  PPRSSQVVGWPPIGLHRMNSLVNNQAMKAARAEEGDGEKKVVKNDELKDVSMKVNPKVQG 123

Query: 459 ---VKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFT 569
              VKV MDG    RKVD++ ++SY+NL   L  MF   T
Sbjct: 124 LGFVKVNMDGVGIGRKVDMRAHSSYENLAQTLEEMFFGMT 163



>gb:AF022012_1761749 Lycopersicon esculentum auxin-regulated IAA1
           (IAA1) mRNA, partial cds.
          Length = 77

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 22/33 (66%), Positives = 24/33 (72%)
 Frame = +3

Query: 459 VKVCMDGAPYLRKVDLKIYTSYQNLYDALANMF 557
           VKV MDGAPYLRK+DLK+Y  Y  L  AL  MF
Sbjct: 22  VKVSMDGAPYLRKIDLKLYKGYPELLKALEKMF 54



>pir|T04345|T04345 auxin-induced protein IAA1 - tomato (fragment)
          Length = 77

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 22/33 (66%), Positives = 24/33 (72%)
 Frame = +3

Query: 459 VKVCMDGAPYLRKVDLKIYTSYQNLYDALANMF 557
           VKV MDGAPYLRK+DLK+Y  Y  L  AL  MF
Sbjct: 22  VKVSMDGAPYLRKIDLKLYKGYPELLKALEKMF 54



>gb:AP002743_1822682 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0710E05.
          Length = 238

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 27/85 (31%), Positives = 38/85 (44%), Gaps = 11/85 (12%)
 Frame = +3

Query: 336 AQVVGWPPVKNYRKKMAQKSNTEGSEE-----------KXXXXXXXXXAANLVKVCMDGA 482
           A VVGWPPV+++R+ +A  S++   +                          VK+ MDG 
Sbjct: 69  APVVGWPPVRSFRRNLASSSSSSSKQAPPPPSSSPQNGDKASKDGGAEKGMFVKINMDGV 128

Query: 483 PYLRKVDLKIYTSYQNLYDALANMF 557
           P  RKVDL  Y  Y  L  A+  +F
Sbjct: 129 PIGRKVDLAAYGGYAQLSAAVDKLF 153



>gb:AF022013_1761750 Lycopersicon esculentum auxin-regulated IAA2
           (IAA2) mRNA, partial cds.
          Length = 69

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 23/36 (63%), Positives = 25/36 (69%)
 Frame = +3

Query: 450 ANLVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMF 557
           A+ VKV MDGA YLRK+DL  Y SY  L  AL NMF
Sbjct: 11  ASYVKVSMDGAAYLRKIDLNTYKSYPQLLKALENMF 46



>gb:T1N24_1723668 Arabidopsis thaliana BAC T1N24.
          Length = 147

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 28/80 (35%), Positives = 40/80 (50%), Gaps = 5/80 (6%)
 Frame = +3

Query: 336 AQVVGWPPVKNYRKKMA-----QKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKV 500
           A VVGWPPV++ R+ +      +    E  EEK             VK+ M+G P  RKV
Sbjct: 47  APVVGWPPVRSSRRNLTAQLKEEMKKKESDEEKELY----------VKINMEGVPIGRKV 96

Query: 501 DLKIYTSYQNLYDALANMFT 560
           +L  Y +YQ L  A+  +F+
Sbjct: 97  NLSAYNNYQQLSHAVDQLFS 116



>gb:PTR306828_1702722 Populus tremula x Populus tremuloides mRNA for
           aux/IAA protein (IAA5 gene).
          Length = 289

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 33/115 (28%), Positives = 50/115 (43%), Gaps = 19/115 (16%)
 Frame = +3

Query: 336 AQVVGWPPVKNYRKK-MAQKSNTEGSEE------------------KXXXXXXXXXAANL 458
           +QVVGWPP++++R   M  ++ ++ +EE                             +  
Sbjct: 119 SQVVGWPPIRSHRMHIMVNQAKSQATEEFNSMNKRKNAVEEKVGNKNINIGNTKTRTSLF 178

Query: 459 VKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNGMIDFMNERKLMD 623
           VKV MDG    RKVDL  +  Y+ L  AL NMF   TT  N   +     + ++D
Sbjct: 179 VKVNMDGTLIGRKVDLSAHGCYETLAQALENMFLRTTTTLNMARLSTPEYKIMID 233



>pir|S58502|S58502 probable IAA15 pseudogene - Arabidopsis thaliana
          Length = 69

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 23/39 (58%), Positives = 26/39 (66%)
 Frame = +3

Query: 459 VKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTI 575
           VKV +DGA YLRKVDL +Y  Y  L+ AL NMF    TI
Sbjct: 13  VKVALDGAAYLRKVDLGMYDCYGQLFTALENMFQGIITI 51



>pir|T04350|T04350 auxin-induced protein IAA2 - tomato (fragment)
          Length = 69

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 23/36 (63%), Positives = 25/36 (69%)
 Frame = +3

Query: 450 ANLVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMF 557
           A+ VKV MDGA YLRK+DL  Y SY  L  AL NMF
Sbjct: 11  ASYVKVSMDGAAYLRKIDLNTYKSYPQLLKALENMF 46



>sp|Q9XFM0|IAAS_ARATH Auxin-responsive protein IAA28 (Indoleacetic
           acid-induced protein 28).>pir|T52143|T52143
           auxin-induced protein IAA28 [imported] - Arabidopsis
           thaliana>gb:BT000427_1634705 Arabidopsis thaliana
           putative protein (At5g25890) mRNA, complete
           cds.>gb:BT002175_1635778 Arabidopsis thaliana putative
           protein (At5g25890) mRNA, complete
           cds.>gb:AF149816_1772540 Arabidopsis thaliana IAA28
           (IAA28) mRNA, complete cds.
          Length = 175

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 28/80 (35%), Positives = 40/80 (50%), Gaps = 5/80 (6%)
 Frame = +3

Query: 336 AQVVGWPPVKNYRKKMA-----QKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKV 500
           A VVGWPPV++ R+ +      +    E  EEK             VK+ M+G P  RKV
Sbjct: 47  APVVGWPPVRSSRRNLTAQLKEEMKKKESDEEKELY----------VKINMEGVPIGRKV 96

Query: 501 DLKIYTSYQNLYDALANMFT 560
           +L  Y +YQ L  A+  +F+
Sbjct: 97  NLSAYNNYQQLSHAVDQLFS 116



>sp|Q38831|IAAD_ARATH Auxin-responsive protein IAA13 (Indoleacetic
           acid-induced protein 13).>gb:BT005874_1638796
           Arabidopsis thaliana At2g33310 gene, complete cds.
          Length = 247

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 33/103 (32%), Positives = 47/103 (45%), Gaps = 18/103 (17%)
 Frame = +3

Query: 324 PPPKAQVVGWPPVKNYR---------------KKMAQKSNTEGSEEKXXXXXXXXXA-AN 455
           P   +QVVGWPP+ ++R               ++ A K   +  E K             
Sbjct: 71  PRSSSQVVGWPPIGSHRMNSLVNNQATKSAREEEEAGKKKVKDDEPKDVTKKVNGKVQVG 130

Query: 456 LVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMF--TSFTTIG 578
            +KV MDG    RKVDL  ++SY+NL   L +MF  T+  T+G
Sbjct: 131 FIKVNMDGVAIGRKVDLNAHSSYENLAQTLEDMFFRTNPGTVG 173



>gb:AY254569_1593096 Gossypium barbadense auxin responsive protein
           IAA-Re (iaa-Re) mRNA, complete cds.
          Length = 91

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 20/29 (68%), Positives = 23/29 (79%)
 Frame = +3

Query: 471 MDGAPYLRKVDLKIYTSYQNLYDALANMF 557
           MDGAPYLRK+DLKIY+ Y  L  A+ NMF
Sbjct: 1   MDGAPYLRKIDLKIYSGYPELLQAIENMF 29



>gb:AX365265_1466305 Sequence 1 from Patent WO0206499.
          Length = 197

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 28/79 (35%), Positives = 37/79 (46%)
 Frame = +3

Query: 327 PPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVDL 506
           P K ++VGWPPVK  R++                          VKV ++G P  RKVD+
Sbjct: 82  PRKKRLVGWPPVKCARRRSC--------------------GGGYVKVKLEGVPIGRKVDV 121

Query: 507 KIYTSYQNLYDALANMFTS 563
            I+ SYQ L   L +MF S
Sbjct: 122 SIHGSYQELLRTLESMFPS 140



>gb:AY054137_1562959 Arabidopsis thaliana AT4g32280/F10M6_80 mRNA,
           complete cds.>gb:AF380646_1793630 Arabidopsis thaliana
           AT4g32280/F10M6_80 mRNA, complete cds.
          Length = 194

 Score = 45.8 bits (107), Expect = 6e-04
 Identities = 30/105 (28%), Positives = 45/105 (42%), Gaps = 28/105 (26%)
 Frame = +3

Query: 336 AQVVGWPPVKNY------------------------RKKMAQKSN----TEGSEEKXXXX 431
           ++VVGWPPVK                          R+  A  +N    T  +       
Sbjct: 36  SEVVGWPPVKTCMIKYGSYHHRHIRNHHHCPYHHRGRRITAMNNNISNPTTATVGSSSSS 95

Query: 432 XXXXXAANLVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSF 566
                ++  VKV MDG    RKVD+K++ SY++L ++L  MFT +
Sbjct: 96  SISSRSSMYVKVKMDGVAIARKVDIKLFNSYESLTNSLITMFTEY 140



>sp|Q93WC4|IAAT_ARATH Auxin-responsive protein IAA29 (Indoleacetic
           acid-induced protein 29).
          Length = 251

 Score = 45.8 bits (107), Expect = 6e-04
 Identities = 30/105 (28%), Positives = 45/105 (42%), Gaps = 28/105 (26%)
 Frame = +3

Query: 336 AQVVGWPPVKNY------------------------RKKMAQKSN----TEGSEEKXXXX 431
           ++VVGWPPVK                          R+  A  +N    T  +       
Sbjct: 93  SEVVGWPPVKTCMIKYGSYHHRHIRNHHHCPYHHRGRRITAMNNNISNPTTATVGSSSSS 152

Query: 432 XXXXXAANLVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSF 566
                ++  VKV MDG    RKVD+K++ SY++L ++L  MFT +
Sbjct: 153 SISSRSSMYVKVKMDGVAIARKVDIKLFNSYESLTNSLITMFTEY 197



>gb:AP005681_1855911 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OJ1439_F07.
          Length = 140

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 25/44 (56%), Positives = 29/44 (65%)
 Frame = +3

Query: 447 AANLVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIG 578
           AA  VKV MDG PYLRKVD+  Y  Y  L +AL +MF   +TIG
Sbjct: 44  AAYFVKVSMDGTPYLRKVDVAAYGDYLELVEALNDMFYC-STIG 86



>gb:AP004028_1836595 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1136_C12.>gb:AP005111_1848049 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0643F09.
          Length = 280

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 32/93 (34%), Positives = 39/93 (41%), Gaps = 15/93 (16%)
 Frame = +3

Query: 327 PPKAQVVGWPPVKNYRKKMA---QKSNTEGSEEKXXXXXXXXX------------AANLV 461
           P    VVGWPP++ +R        K NT  ++ K                      A  V
Sbjct: 106 PHSFGVVGWPPIRQFRMNSLFNQAKENTSETDTKKTATNESDVQKDKEEGEKKGRVAGWV 165

Query: 462 KVCMDGAPYLRKVDLKIYTSYQNLYDALANMFT 560
           KV MDG    RKVDL  + SY+ L  AL  MFT
Sbjct: 166 KVNMDGEVIGRKVDLNAHRSYKTLALALELMFT 198



>gb:AY847063_1630741 Avena sativa Aux/IAA2 mRNA, partial cds.
          Length = 110

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 25/51 (49%), Positives = 28/51 (54%), Gaps = 2/51 (3%)
 Frame = +3

Query: 342 VVGWPPVKNYRKK--MAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPY 488
           VVGWPPV+NYRK    A  S T+  EE            + VKV MDGAPY
Sbjct: 3   VVGWPPVRNYRKNTLAASASKTKAGEE-------AQGGPHYVKVSMDGAPY 46



>gb:AP004028_1836596 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1136_C12.>gb:AP005111_1848050 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0643F09.
          Length = 281

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 31/88 (35%), Positives = 38/88 (43%), Gaps = 15/88 (17%)
 Frame = +3

Query: 342 VVGWPPVKNYRKKMA---QKSNTEGSEEKXXXXXXXXX------------AANLVKVCMD 476
           VVGWPP++ +R        K NT  ++ K                      A  VKV MD
Sbjct: 112 VVGWPPIRQFRMNSLFNQAKENTSETDTKKTATNESDVQKDKEEGEKKGRVAGWVKVNMD 171

Query: 477 GAPYLRKVDLKIYTSYQNLYDALANMFT 560
           G    RKVDL  + SY+ L  AL  MFT
Sbjct: 172 GEVIGRKVDLNAHRSYKTLALALELMFT 199



>gb:AY088406_1573425 Arabidopsis thaliana clone 6493 mRNA, complete
           sequence.
          Length = 267

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 28/112 (25%), Positives = 46/112 (41%), Gaps = 16/112 (14%)
 Frame = +3

Query: 342 VVGWPPVKNYRKKMAQKSNT----------------EGSEEKXXXXXXXXXAANLVKVCM 473
           VVGWPPV+++RK +A  S++                +  ++              VK+ M
Sbjct: 97  VVGWPPVRSFRKNLASGSSSKLGNDSTTSNGVTLKNQKCDDAAKTTEPKRQGGMFVKINM 156

Query: 474 DGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNGMIDFMNERKLMDLL 629
            G P  RKVDL  + SY+ L   +  +F        +      +E+ +  LL
Sbjct: 157 YGVPIGRKVDLSAHNSYEQLSFTVDKLFRGLLAAQRDFPSSIEDEKPITGLL 208



>gb:ATU49074_1557045 Arabidopsis thaliana early auxin-induced
           (IAA18) mRNA, partial cds.
          Length = 236

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 28/111 (25%), Positives = 45/111 (40%), Gaps = 15/111 (13%)
 Frame = +3

Query: 342 VVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXX---------------XXAANLVKVCMD 476
           VVGWPPV+++RK +A  S+++   +                             VK+ M 
Sbjct: 67  VVGWPPVRSFRKNLASGSSSKLGNDSTTSNGVTLKNQKCDAAKTTEPKRQGGMFVKINMY 126

Query: 477 GAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNGMIDFMNERKLMDLL 629
           G P  RKVDL  + SY+ L   +  +F        +      +E+ +  LL
Sbjct: 127 GVPIGRKVDLSAHNSYEQLSFTVDKLFRGLLAAQRDFPSSIEDEKPITGLL 177



>pir|T52144|T52144 auxin-induced protein IAA18 [imported] -
           Arabidopsis thaliana (fragment)
          Length = 236

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 28/111 (25%), Positives = 45/111 (40%), Gaps = 15/111 (13%)
 Frame = +3

Query: 342 VVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXX---------------XXAANLVKVCMD 476
           VVGWPPV+++RK +A  S+++   +                             VK+ M 
Sbjct: 67  VVGWPPVRSFRKNLASGSSSKLGNDSTTSNGVTLKNQKCDAAKTTEPKRQGGMFVKINMY 126

Query: 477 GAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNGMIDFMNERKLMDLL 629
           G P  RKVDL  + SY+ L   +  +F        +      +E+ +  LL
Sbjct: 127 GVPIGRKVDLSAHNSYEQLSFTVDKLFRGLLAAQRDFPSSIEDEKPITGLL 177



>sp|O24408|IAAI_ARATH Auxin-responsive protein IAA18 (Indoleacetic
           acid-induced protein 18).>pir|H96558|H96558 IAA18
           [imported] - Arabidopsis thaliana>gb:AE005173_893108
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC015448_1538023 Arabidopsis thaliana
           chromosome I BAC T14L22 genomic sequence, complete
           sequence.>gb:AY056062_1563412 Arabidopsis thaliana
           At1g51950/T14L22_14 mRNA, complete
           cds.>gb:AF367263_1791716 Arabidopsis thaliana
           At1g51950/T14L22_14 mRNA, complete cds.
          Length = 267

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 28/112 (25%), Positives = 45/112 (40%), Gaps = 16/112 (14%)
 Frame = +3

Query: 342 VVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXX----------------XXAANLVKVCM 473
           VVGWPPV+++RK +A  S+++   +                              VK+ M
Sbjct: 97  VVGWPPVRSFRKNLASGSSSKLGNDSTTSNGVTLKNQKCDAAAKTTEPKRQGGMFVKINM 156

Query: 474 DGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNGMIDFMNERKLMDLL 629
            G P  RKVDL  + SY+ L   +  +F        +      +E+ +  LL
Sbjct: 157 YGVPIGRKVDLSAHNSYEQLSFTVDKLFRGLLAAQRDFPSSIEDEKPITGLL 208



>gb:AP005197_1849288 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC
           clone:P0592C06.>gb:AP005719_1856475 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:B1130E10.
          Length = 130

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 19/34 (55%), Positives = 24/34 (70%)
 Frame = +3

Query: 471 MDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTT 572
           MD APYLRKVDLK Y +Y+++   L  MF  F+T
Sbjct: 1   MDAAPYLRKVDLKTYKNYKDMSLGLEKMFIGFST 34



>gb:AC069158_1540668 Genomic Sequence for Oryza sativa, Nipponbare
           strain, clone OSJNBa0049O12, from chromosome 2, complete
           sequence.>gb:AP004240_1839145 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1548_F12.
          Length = 182

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 27/75 (36%), Positives = 33/75 (44%)
 Frame = +3

Query: 333 KAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVDLKI 512
           K  VVGWPPV + R+                        AN VKV  +G    RKVDL +
Sbjct: 73  KKTVVGWPPVSSARRACG--------------------GANYVKVKKEGDAIGRKVDLAL 112

Query: 513 YTSYQNLYDALANMF 557
           ++SY  L   LA MF
Sbjct: 113 HSSYDELAATLARMF 127



>gb:AF022022_1761759 Lycopersicon esculentum auxin-regulated IAA11
           (IAA11) mRNA, partial cds.
          Length = 77

 Score = 40.8 bits (94), Expect = 0.020
 Identities = 19/36 (52%), Positives = 23/36 (63%)
 Frame = +3

Query: 459 VKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSF 566
           VKV MDGAP+LRKVDL  +  Y  L  AL  +F  +
Sbjct: 23  VKVSMDGAPFLRKVDLSTHKGYDQLVMALEKLFDCY 58



>pir|T05712|T05712 auxin-induced protein IAA11 - tomato (fragment)
          Length = 77

 Score = 40.8 bits (94), Expect = 0.020
 Identities = 19/36 (52%), Positives = 23/36 (63%)
 Frame = +3

Query: 459 VKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSF 566
           VKV MDGAP+LRKVDL  +  Y  L  AL  +F  +
Sbjct: 23  VKVSMDGAPFLRKVDLSTHKGYDQLVMALEKLFDCY 58



>gb:BT000543_1634821 Arabidopsis thaliana putative auxin-induced
           protein (At3g17600/MKP6_15) mRNA, complete cds.
          Length = 158

 Score = 40.0 bits (92), Expect = 0.033
 Identities = 24/89 (26%), Positives = 40/89 (44%)
 Frame = +3

Query: 315 PIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLR 494
           P   P +     WPP+K         S    + +           +  VKV M+G P  R
Sbjct: 36  PSTSPQREARQDWPPIK---------SRLRDTLKGRRLLRRGDDTSLFVKVYMEGVPIGR 86

Query: 495 KVDLKIYTSYQNLYDALANMFTSFTTIGN 581
           K+DL +++ Y++L + L++MF +    GN
Sbjct: 87  KLDLCVFSGYESLLENLSHMFDTSIICGN 115



>sp|Q8H174|IAAV_ARATH Auxin-responsive protein IAA31 (Indoleacetic
           acid-induced protein 31).>gb:AB022219_1515116
           Arabidopsis thaliana genomic DNA, chromosome 3, P1
           clone: MKP6.>gb:AY054274_1563094 Arabidopsis thaliana
           AT3g17600/MKP6_15 mRNA, complete cds.
          Length = 158

 Score = 40.0 bits (92), Expect = 0.033
 Identities = 24/89 (26%), Positives = 40/89 (44%)
 Frame = +3

Query: 315 PIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLR 494
           P   P +     WPP+K         S    + +           +  VKV M+G P  R
Sbjct: 36  PSTSPQREARQDWPPIK---------SRLRDTLKGRRLLRRGDDTSLFVKVYMEGVPIGR 86

Query: 495 KVDLKIYTSYQNLYDALANMFTSFTTIGN 581
           K+DL +++ Y++L + L++MF +    GN
Sbjct: 87  KLDLCVFSGYESLLENLSHMFDTSIICGN 115



>sp|Q38828|IAAA_ARATH Auxin-responsive protein IAA10 (Indoleacetic
           acid-induced protein 10).>pir|S58496|S58496 IAA1 protein
           - Arabidopsis thaliana>gb:AE005172_889428 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:ATU18412_1556798 Arabidopsis thaliana IAA10
           (IAA10) gene, complete cds.>gb:F20D22_1677751
           Arabidopsis thaliana chromosome 1 BAC F20D22 sequence,
           complete sequence.>gb:AF332396_1787209 Arabidopsis
           thaliana clone C00017 (e) IAA10 (At1g04100) mRNA,
           complete cds.
          Length = 261

 Score = 39.3 bits (90), Expect = 0.057
 Identities = 30/92 (32%), Positives = 35/92 (38%), Gaps = 21/92 (22%)
 Frame = +3

Query: 345 VGWPPVKNYR--------KKMAQKSNTEGSEEKXXXXXXXXXAAN-------------LV 461
           VGWPP++ YR        K +A +       +K         A N             LV
Sbjct: 95  VGWPPLRTYRINSLVNQAKSLATEGGLSSGIQKETTKSVVVAAKNDDACFIKSSRTSMLV 154

Query: 462 KVCMDGAPYLRKVDLKIYTSYQNLYDALANMF 557
           KV MDG    RKVDL    SY  L   L  MF
Sbjct: 155 KVTMDGVIIGRKVDLNALDSYAALEKTLDLMF 186



>gb:PTR306827_1702721 Populus tremula x Populus tremuloides mRNA for
           aux/IAA protein (IAA4 gene).
          Length = 176

 Score = 37.0 bits (84), Expect = 0.28
 Identities = 25/81 (30%), Positives = 35/81 (43%), Gaps = 2/81 (2%)
 Frame = +3

Query: 327 PPKAQVVGWPPVK--NYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKV 500
           P   Q+  WPP+K  N  K +  + N   S            A   VKV M+G P  RK+
Sbjct: 55  PSDQQLSDWPPIKPLNLSKALESEENECSS------------ATFFVKVYMEGIPIGRKL 102

Query: 501 DLKIYTSYQNLYDALANMFTS 563
           +L  +  Y +L   L  MF +
Sbjct: 103 NLLAHDGYHDLIQTLDQMFNT 123



>gb:AB023482_1515593 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, clone P0680A03.>gb:AP002536_1822479
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 6, BAC clone:OSJNBa0015I14.
          Length = 183

 Score = 36.6 bits (83), Expect = 0.37
 Identities = 27/84 (32%), Positives = 34/84 (40%)
 Frame = +3

Query: 312 DPIMPPPKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYL 491
           D  M   + ++VGWPPVK   ++                          VKV M+G    
Sbjct: 69  DGEMGNKRRKLVGWPPVKCLHRRR-----------------DGGCGGGYVKVKMEGLAIG 111

Query: 492 RKVDLKIYTSYQNLYDALANMFTS 563
           RK+DL I  SY  L D L  MF S
Sbjct: 112 RKLDLSILGSYAELLDTLHLMFPS 135



>gb:AK128535_1917255 Homo sapiens cDNA FLJ46693 fis, clone
           TRACH3012864.
          Length = 208

 Score = 34.7 bits (78), Expect = 1.4
 Identities = 19/59 (32%), Positives = 34/59 (57%)
 Frame = +3

Query: 459 VKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNGMIDFMNERKLMDLLHT 635
           V VC++  P+LR V      +++NL    + +F SF  I  N ++DF N+ + + L+H+
Sbjct: 151 VLVCVNQCPHLRDVTTVKMQNHRNLKTTKSCIFDSFLPIKGNPLVDFKNKIR-VKLVHS 208



>gb:PTR306826_1702720 Populus tremula x Populus tremuloides mRNA for
           aux/IAA protein (IAA3 gene).
          Length = 174

 Score = 34.7 bits (78), Expect = 1.4
 Identities = 22/78 (28%), Positives = 31/78 (39%)
 Frame = +3

Query: 330 PKAQVVGWPPVKNYRKKMAQKSNTEGSEEKXXXXXXXXXAANLVKVCMDGAPYLRKVDLK 509
           P  Q++ WPP+K    K       E S                VKV M+G    RK++L 
Sbjct: 55  PSEQLLDWPPIKPSPGKAVTSEENEYSSSTL-----------FVKVYMEGIQIGRKLNLL 103

Query: 510 IYTSYQNLYDALANMFTS 563
            +  Y +L   L  MF +
Sbjct: 104 AHDGYHDLIQTLDQMFNT 121



>gb:AF022016_1761753 Lycopersicon esculentum auxin-regulated IAA5
           (IAA5) mRNA, partial cds.
          Length = 116

 Score = 33.5 bits (75), Expect = 3.1
 Identities = 19/45 (42%), Positives = 23/45 (51%)
 Frame = +3

Query: 453 NLVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNG 587
           + VKV MDG P  RKV+L  +  Y+ L   L  MF   T   N G
Sbjct: 49  DFVKVNMDGLPIGRKVNLSSHICYETLAKILEEMFFKSTKTTNCG 93



>pir|T36479|T36479 probable binding protein dependent transport
           protein - Streptomyces coelicolor>gb:SCO939104_173967
           Streptomyces coelicolor A3(2) complete genome; segment
           1/29.
          Length = 300

 Score = 33.5 bits (75), Expect = 3.1
 Identities = 19/43 (44%), Positives = 26/43 (60%)
 Frame = -2

Query: 145 PPGRPRQRSVSPWISIVAILISGLLVASL*SPSIGFYSFSMTT 17
           PPGR RQRS+ PW++  A++   L V     P IG ++ S TT
Sbjct: 8   PPGR-RQRSILPWLATPALV---LFVGFAVIPLIGVFALSFTT 46



>pir|T05366|T05366 auxin-induced protein IAA5 - tomato (fragment)
          Length = 116

 Score = 33.5 bits (75), Expect = 3.1
 Identities = 19/45 (42%), Positives = 23/45 (51%)
 Frame = +3

Query: 453 NLVKVCMDGAPYLRKVDLKIYTSYQNLYDALANMFTSFTTIGNNG 587
           + VKV MDG P  RKV+L  +  Y+ L   L  MF   T   N G
Sbjct: 49  DFVKVNMDGLPIGRKVNLSSHICYETLAKILEEMFFKSTKTTNCG 93



>pir|F64603|F64603 hypothetical protein HP0670 - Helicobacter pylori
           (strain 26695)>gb:AE000580_24843 Helicobacter pylori
           26695 section 58 of 134 of the complete
           genome.>gb:AE000511_880282 Helicobacter pylori 26695
           complete genome.
          Length = 449

 Score = 32.3 bits (72), Expect = 7.0
 Identities = 15/40 (37%), Positives = 24/40 (60%)
 Frame = -1

Query: 131 KAKISLSMDQHCRHFNFWFTRSFSLITFNWILFFLNDNRE 12
           K K S+ +D +    NF    +FS+I   WI+F++ DNR+
Sbjct: 258 KDKKSMEIDLYGIAINFQRIDNFSVILEKWIVFYIKDNRD 297


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 624,344,216
Number of Sequences: 1806583
Number of extensions: 11925442
Number of successful extensions: 31507
Number of sequences better than 10.0: 169
Number of HSP's better than 10.0 without gapping: 30502
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31291
length of database: 581,917,975
effective HSP length: 119
effective length of database: 366,934,598
effective search space used: 34124917614
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)