BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig911
         (736 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP003766_1833224 Oryza sativa (japonica cultivar-group) genom...    92   1e-17   
pir|D96762|D96762 probable lipid transfer protein F6D5.5 [import...    80   4e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AY088017_1573041 Arabidopsis thaliana clone 4043 mRNA, comple...    79   7e-14   
gb:AE005172_890793 Arabidopsis thaliana chromosome 1, top arm co...    77   4e-13   
pir|D96725|D96725 hypothetical protein F20P5.4 [imported] - Arab...    72   8e-12   Arabidopsis thaliana [mouse-ear cress]
gb:BT011764_1641286 Arabidopsis thaliana At1g62790 mRNA, complet...    71   2e-11   
gb:AE005173_893947 Arabidopsis thaliana chromosome 1, bottom arm...    71   2e-11   
pir|T14827|T14827 lipid transfer protein - Norway spruce>gb:AB00...    70   3e-11   Picea abies
gb:AC012396_1537640 Arabidopsis thaliana chromosome 1 BAC T9L24 ...    69   7e-11   
pir|C96762|C96762 hypothetical protein F6D5.6 [imported] - Arabi...    69   7e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1021370 Oryza sativa (japonica cultivar-group) chrom...    57   3e-07   
gb:AP003843_1834111 Oryza sativa (japonica cultivar-group) genom...    53   7e-06   
gb:AB005230_1509243 Arabidopsis thaliana genomic DNA, chromosome...    52   1e-05   
gb:AY087167_1572201 Arabidopsis thaliana clone 32411 mRNA, compl...    50   4e-05   
pir|G84923|G84923 hypothetical protein At2g48130 [imported] - Ar...    50   4e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AF083791_1767021 Arabidopsis thaliana clone sps870 unknown mRNA.    50   6e-05   
gb:AY085883_1570946 Arabidopsis thaliana clone 19287 mRNA, compl...    50   6e-05   
gb:AY045650_1561241 Arabidopsis thaliana AT3g22600/F16J14_17 mRN...    50   6e-05   
gb:AP004315_1840079 Oryza sativa (japonica cultivar-group) genom...    49   7e-05   
gb:AP003843_1834117 Oryza sativa (japonica cultivar-group) genom...    49   9e-05   
gb:AC090871_1734492 Oryza sativa chromosome 3 BAC OSJNBb0060J21 ...    49   1e-04   
gb:AB159560_1528436 Zinnia elegans ZeXYP1 mRNA for xylogen prote...    48   2e-04   
pir|E96766|E96766 hypothetical protein F2P9.24 [imported] - Arab...    47   4e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AP003843_1834104 Oryza sativa (japonica cultivar-group) genom...    45   0.001   
gb:AP003509_1830101 Oryza sativa (japonica cultivar-group) genom...    45   0.001   
pir|T48146|T48146 hypothetical protein T4C9.200 - Arabidopsis th...    44   0.002   Arabidopsis thaliana [mouse-ear cress]
gb:AY087113_1572148 Arabidopsis thaliana clone 31856 mRNA, compl...    44   0.003   
gb:AC135563_1742570 Oryza sativa chromosome 3 BAC OSJNBb0015I02 ...    44   0.004   
gb:AY085224_1570297 Arabidopsis thaliana clone 13962 mRNA, compl...    44   0.004   
gb:AY062857_1565513 Arabidopsis thaliana Unknown protein mRNA, c...    44   0.004   
pir|T02385|T02385 hypothetical protein At2g44290 [imported] - Ar...    44   0.004   Arabidopsis thaliana [mouse-ear cress]
gb:BT002886_1636477 Arabidopsis thaliana clone RAFL15-05-B21 (R2...    43   0.005   
gb:AB020745_1514604 Arabidopsis thaliana genomic DNA, chromosome...    43   0.005   
gb:AP005257_1849706 Oryza sativa (japonica cultivar-group) genom...    42   0.009   
gb:AY088880_1573888 Arabidopsis thaliana clone 98459 mRNA, compl...    42   0.012   
gb:AY070743_1566893 Arabidopsis thaliana AT5g64080/MHJ24_6 mRNA,...    42   0.012   
gb:AB008266_1510418 Arabidopsis thaliana genomic DNA, chromosome...    42   0.012   
gb:BT003062_1636644 Arabidopsis thaliana At2g13820 gene, complet...    42   0.015   
pir|B84511|B84511 hypothetical protein At2g13820 [imported] - Ar...    42   0.015   Arabidopsis thaliana [mouse-ear cress]
gb:AP003843_1834112 Oryza sativa (japonica cultivar-group) genom...    41   0.020   
gb:OSJN00239_1697225 Oryza sativa genomic DNA, chromosome 4, BAC...    41   0.020   
gb:AY086176_1571231 Arabidopsis thaliana clone 21969 mRNA, compl...    41   0.026   
gb:ATT5E8_1556132 Arabidopsis thaliana DNA chromosome 5, BAC clo...    41   0.026   
sp|Q42952|NLT1_TOBAC|NLT1_TOBAC Nonspecific lipid-transfer protein 1 precur...    41   0.026   Nicotiana tabacum [American tobacco]
gb:AY574218_1615872 Tamarix androssowii probable lipid transfer ...    40   0.033   
gb:AP004268_1839483 Oryza sativa (japonica cultivar-group) genom...    40   0.044   
gb:AY804336_1628653 Capsicum chinense cultivar Peach Savina lipi...    40   0.044   
gb:AY804335_1628652 Capsicum annuum cultivar Perennial lipid tra...    40   0.044   
gb:AY085407_1570476 Arabidopsis thaliana clone 15027 mRNA, compl...    40   0.044   
gb:AX384586_1466757 Sequence 3 from Patent WO0214502.                  40   0.044   
pir|JQ2343|JQ2343 P48h-10 protein precursor - Zinnia elegans (cv...    40   0.044   Zinnia elegans [garden zinnia]
pir|JQ2342|JQ2342 hypothetical 10.0K protein - Zinnia elegans>gb...    40   0.044   Zinnia elegans [garden zinnia]
pir|T02386|T02386 hypothetical protein At2g44300 [imported] - Ar...    40   0.044   Arabidopsis thaliana [mouse-ear cress]
gb:AP003803_1833587 Oryza sativa (japonica cultivar-group) genom...    40   0.057   
gb:AP000731_1820538 Arabidopsis thaliana genomic DNA, chromosome...    40   0.057   
gb:OSJN00010_1693225 Oryza sativa genomic DNA, chromosome 4, BAC...    40   0.057   
gb:AP004179_1838583 Oryza sativa (japonica cultivar-group) genom...    39   0.075   
gb:AJ630658_1812771 Cicer arietinum mRNA for putative lipid tran...    39   0.075   
sp|Q9C7F7|UGP5_ARATH|UGP5_ARATH Uncharacterized GPI-anchored protein At1g27...    39   0.075   Arabidopsis thaliana [mouse-ear cress]
sp|Q43767|NL41_HORVU|NL41_HORVU Nonspecific lipid-transfer protein 4.1 prec...    39   0.075   Hordeum vulgare [barley]
gb:AY035005_1559784 Arabidopsis thaliana unknown protein (At3g22...    39   0.097   
pir|A86162|A86162 protein F10O3.7 [imported] - Arabidopsis thali...    39   0.097   Arabidopsis thaliana [mouse-ear cress]
gb:AC090871_1734490 Oryza sativa chromosome 3 BAC OSJNBb0060J21 ...    39   0.13    
gb:AY572530_1615736 Malus x domestica clone Mal d 3.02-IM1 lipid...    39   0.13    
gb:AY045643_1561234 Arabidopsis thaliana At2g48140/F11L15.4 mRNA...    39   0.13    
pir|H84923|H84923 hypothetical protein At2g48140 [imported] - Ar...    39   0.13    Arabidopsis thaliana [mouse-ear cress]
gb:AY572519_1615725 Malus x domestica clone Mal d 3.02-PM2 lipid...    38   0.17    
gb:AY572517_1615723 Malus x domestica clone Mal d 3.02-FS lipid ...    38   0.17    
gb:AY327042_1599683 Oryza sativa (japonica cultivar-group) lipid...    38   0.17    
gb:AY088620_1573636 Arabidopsis thaliana clone 8461 mRNA, comple...    38   0.17    
gb:AY059472_1564551 Davidia involucrata lipid transfer protein p...    38   0.17    
pir|T47408|T47408 lipid-transfer-like protein - Arabidopsis thal...    38   0.17    Arabidopsis thaliana [mouse-ear cress]
sp|Q42999|NLT3_ORYSA|NLT3_ORYSA Nonspecific lipid-transfer protein 3 precur...    38   0.17    Oryza sativa [red rice]
sp|Q43766|NLT3_HORVU|NLT3_HORVU Nonspecific lipid-transfer protein 3 precur...    38   0.17    Hordeum vulgare [barley]
gb:AP004797_1845233 Oryza sativa (japonica cultivar-group) genom...    38   0.22    
gb:AP004797_1845222 Oryza sativa (japonica cultivar-group) genom...    38   0.22    
sp|Q42842|NL43_HORVU|NL43_HORVU Nonspecific lipid-transfer protein 4.3 prec...    38   0.22    Hordeum vulgare [barley]
sp|Q43875|NL42_HORVU|NL42_HORVU Nonspecific lipid-transfer protein 4.2 prec...    38   0.22    Hordeum vulgare [barley]
gb:AF233297_1779438 Nicotiana tabacum lipid transfer protein gen...    37   0.28    
pir|T02048|T02048 lipid transfer protein (clone ant43C) - common...    37   0.28    Nicotiana tabacum [American tobacco]
gb:AC146521_1744602 Oryza sativa chromosome 3 B1246D11 genomic s...    37   0.37    
gb:AE005172_889569 Arabidopsis thaliana chromosome 1, top arm co...    37   0.37    
gb:AY572532_1615738 Malus x domestica clone Mal d 3.02-IM2 lipid...    37   0.48    
gb:AY039903_1560417 Arabidopsis thaliana AT3g18280/MIE15_7 mRNA,...    37   0.48    
gb:SNELIPTRA_1715564 Senecio odorus lipid transfer protein mRNA,...    36   0.63    
pir|T00941|T00941 hypothetical protein T3F12.2 - Arabidopsis tha...    36   0.63    Arabidopsis thaliana [mouse-ear cress]
gb:AK175803_1817791 Arabidopsis thaliana mRNA for putative lipid...    36   0.82    
gb:MTY15371_1687724 Medicago truncatula mRNA for MtN5 gene.            36   0.82    
gb:AY621633_1618372 Nicotiana glauca lipid transfer protein (LTP...    36   0.82    
gb:AE016959_1021406 Oryza sativa (japonica cultivar-group) chrom...    36   0.82    
pir|D84524|D84524 probable lipid transfer protein [imported] - A...    36   0.82    Arabidopsis thaliana [mouse-ear cress]
gb:AC097175_1736473 Oryza sativa (japonica cultivar-group) chrom...    35   1.1     
pir|T45809|T45809 hypothetical protein F28O9.160 - Arabidopsis t...    35   1.1     Arabidopsis thaliana [mouse-ear cress]
pir|E84563|E84563 probable lipid transfer protein [imported] - A...    35   1.1     Arabidopsis thaliana [mouse-ear cress]
gb:AP003570_1831029 Oryza sativa (japonica cultivar-group) genom...    35   1.4     
gb:AF331710_1787131 Avicennia marina lipid transfer protein mRNA...    35   1.4     
sp|O04004|NLT6_AMBAR|NLT6_AMBAR Nonspecific lipid-transfer protein precurso...    35   1.4     Ambrosia artemisiifolia [annual ragweed]
gb:AY754742_1626924 Triticum aestivum lipid transfer protein (LT...    35   1.8     
gb:A63831_1450121 Sequence 4 from Patent WO9723617.                    35   1.8     
pir|T04560|T04560 hypothetical protein T12H17.40 - Arabidopsis t...    35   1.8     Arabidopsis thaliana [mouse-ear cress]
gb:AP004127_1838039 Oryza sativa (japonica cultivar-group) genom...    34   2.4     
gb:AF525363_1808308 Solanum tuberosum putative non-specific lipi...    34   2.4     
gb:AF525362_1808307 Solanum tuberosum putative non-specific lipi...    34   2.4     
gb:AY088619_1573635 Arabidopsis thaliana clone 8450 mRNA, comple...    34   2.4     
gb:AC005623_1532861 Arabidopsis thaliana chromosome 2 clone T20P...    34   2.4     
gb:AY496100_1178444 Capsicum annuum nonspecific lipid transfer p...    34   2.4     
pir|B84798|B84798 hypothetical protein At2g37870 [imported] - Ar...    34   2.4     Arabidopsis thaliana [mouse-ear cress]
pir|B84669|B84669 hypothetical protein At2g27130 [imported] - Ar...    34   2.4     Arabidopsis thaliana [mouse-ear cress]
pir|T02038|T02038 phospholipid transfer protein - rice>gb:AF0173...    34   2.4     Oryza sativa [red rice]
sp|Q43748|NLTP_BETVU|NLTP_BETVU Nonspecific lipid-transfer protein precurso...    34   2.4     Beta vulgaris [beet]
gb:AP005529_1853567 Oryza sativa (japonica cultivar-group) genom...    34   3.1     
gb:AP005529_1853566 Oryza sativa (japonica cultivar-group) genom...    34   3.1     
gb:AY098530_1576447 Ananas comosus PVR3-like protein mRNA, parti...    34   3.1     
gb:AY247416_602114 Polyangium cellulosum strain So9733-1 clone 0...    34   3.1     
pir|D85259|D85259 hypothetical protein AT4g22650 [imported] - Ar...    34   3.1     Arabidopsis thaliana [mouse-ear cress]
pir|T04093|T04093 phospholipid transfer protein - maize>gb:ZMU66...    34   3.1     Zea mays [maize]
sp|Q43681|NLTP_VIGUN|NLTP_VIGUN Probable nonspecific lipid-transfer protein...    34   3.1     Vigna unguiculata
gb:AF467945_1802450 Vitis vinifera lipid transfer protein isofor...    33   4.1     
gb:AF363506_1791541 Euphorbia lagascae lipid transfer protein 2 ...    33   4.1     
gb:AY456267_1607170 Nicotiana attenuata lipid-transfer protein m...    33   4.1     
gb:AY395741_1604830 Vitis aestivalis lipid transfer protein mRNA...    33   4.1     
gb:AP005515_1853271 Oryza sativa (japonica cultivar-group) genom...    33   5.3     
gb:AJ784903_1814018 Triticum turgidum subsp. durum partial mRNA ...    33   5.3     
gb:AJ784901_1814016 Triticum aestivum mRNA for type 1 non-specif...    33   5.3     
gb:MZEPLTPA_1688015 Maize phospholipid transfer protein mRNA, 3'...    33   5.3     
pir|T02049|T02049 lipid transfer protein (clone ant43D) - common...    33   5.3     Nicotiana tabacum [American tobacco]
pir|S45635|S45635 lipid-transfer protein - maize                       33   5.3     Zea mays [maize]
pir|JH0379|JH0379 phospholipid transfer protein 6B6 - maize (fra...    33   5.3     Zea mays [maize]
sp|Q9M5X8|NLTP_PRUAV|NLTP_PRUAV Nonspecific lipid-transfer protein precurso...    33   5.3     Prunus avium [gean]
sp|P19656|NLTP_MAIZE|NLTP_MAIZE Nonspecific lipid-transfer protein precurso...    33   5.3     Zea mays [maize]
gb:HUMASPA_2029411 Homo sapiens agouti signalling protein (ASP) ...    32   9.1     
gb:AY621631_1618370 Nicotiana glauca lipid transfer protein (LTP...    32   9.1     
gb:AY572516_1615722 Malus x domestica clone Mal d 3.01-PS2 lipid...    32   9.1     
gb:AE016959_1021404 Oryza sativa (japonica cultivar-group) chrom...    32   9.1     
pir|T02042|T02042 lipid transfer protein LPT II - rice>gb:AF0173...    32   9.1     Oryza sativa Indica Group [Indian rice]
sp|Q42616|NLT3_BRANA|NLT3_BRANA Nonspecific lipid-transfer protein 3 precur...    32   9.1     Brassica napus [oilseed rape]
sp|Q03461|NLT2_TOBAC|NLT2_TOBAC Nonspecific lipid-transfer protein 2 precur...    32   9.1     Nicotiana tabacum [American tobacco]
sp|Q43194|NLT2_SORBI|NLT2_SORBI Nonspecific lipid-transfer protein 2 precur...    32   9.1     Sorghum bicolor [broomcorn]
sp|P42127|AGSW_HUMAN|AGSW_HUMAN Agouti switch protein precursor (Agouti sig...    32   9.1     Homo sapiens [man]


>gb:AP003766_1833224 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0009H10.>gb:AP005395_1851038 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0623A10.
          Length = 125

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 40/69 (57%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = +3

Query: 183 LVPCAEYLNSTK-PPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHC 359
           LVPCA+Y+N T  PPA+CCDPLKE V  EL CLC+LY +PE+ K+  +NI+ AL L   C
Sbjct: 39  LVPCAQYMNGTDTPPAACCDPLKEAVKNELKCLCDLYASPEIFKAFNINISDALRLSTRC 98

Query: 360 GISNDVSAC 386
           GIS   S C
Sbjct: 99  GISQTTSMC 107



>pir|D96762|D96762 probable lipid transfer protein F6D5.5 [imported]
           - Arabidopsis thaliana>gb:AE005173_894902 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC012396_1537639 Arabidopsis thaliana
           chromosome 1 BAC T9L24 genomic sequence, complete
           sequence.>gb:AC079676_1732693 Arabidopsis thaliana
           chromosome 1 BAC F6D5 genomic sequence, complete
           sequence.
          Length = 112

 Score = 80.1 bits (196), Expect = 4e-14
 Identities = 37/72 (51%), Positives = 47/72 (65%), Gaps = 2/72 (2%)
 Frame = +3

Query: 183 LVPCAEYLNSTKPPA--SCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKH 356
           L+PC  Y++S  PP   SCC P+KE V K+  CLC  + NPEVLK+L +    AL LPK 
Sbjct: 37  LLPCQPYIHSLNPPPPPSCCGPMKEIVEKDAPCLCIAFNNPEVLKALNLTKENALLLPKA 96

Query: 357 CGISNDVSACDK 392
           CG++ DVS C K
Sbjct: 97  CGVNPDVSLCSK 108



>gb:AY088017_1573041 Arabidopsis thaliana clone 4043 mRNA, complete
           sequence.
          Length = 147

 Score = 79.3 bits (194), Expect = 7e-14
 Identities = 36/72 (50%), Positives = 46/72 (63%), Gaps = 2/72 (2%)
 Frame = +3

Query: 183 LVPCAEYLNSTKPPA--SCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKH 356
           L+PC  Y++S  PP   SCC P+KE V K+  CLC  + NPEVLK+L +    AL LP  
Sbjct: 37  LLPCQPYIHSLNPPPPPSCCGPMKEIVEKDAPCLCTAFNNPEVLKALNLTKENALLLPNA 96

Query: 357 CGISNDVSACDK 392
           CG++ DVS C K
Sbjct: 97  CGVNPDVSLCSK 108



>gb:AE005172_890793 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC013354_1537908 Genomic sequence
           for Arabidopsis thaliana BAC F15H18 from chromosome I,
           complete sequence.>gb:AC069551_1540966 Genomic sequence
           for Arabidopsis thaliana BAC T10O22 from chromosome I,
           complete sequence.>gb:AY086971_1572009 Arabidopsis
           thaliana clone 30040 mRNA, complete sequence.
          Length = 180

 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 35/69 (50%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = +3

Query: 183 LVPCAEYLN-STKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHC 359
           L+PC  YL+ +T PPA+CC PL E V K+ +CLC ++ N ++LKSL +    AL+LPK C
Sbjct: 45  LMPCQPYLHLATPPPATCCMPLNEIVAKDATCLCAVFNNVDMLKSLNLTKENALDLPKAC 104

Query: 360 GISNDVSAC 386
           G   DVS C
Sbjct: 105 GAKADVSLC 113



>pir|D96725|D96725 hypothetical protein F20P5.4 [imported] -
           Arabidopsis thaliana>gb:AE005173_894606 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:F20P5_1677758 Sequence of BAC F20P5 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 104

 Score = 72.4 bits (176), Expect = 8e-12
 Identities = 31/73 (42%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +3

Query: 183 LVPCAEYLNST-KPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHC 359
           +VPC  +LN+T KP   CC+ +KE + K+ SCLC +Y  P +L    +   QAL L   C
Sbjct: 22  IVPCFRFLNTTTKPSTDCCNSIKEAMEKDFSCLCTIYNTPGLLAQFNITTDQALGLNLRC 81

Query: 360 GISNDVSACDKAL 398
           G++ D+SAC   L
Sbjct: 82  GVNTDLSACSGTL 94



>gb:BT011764_1641286 Arabidopsis thaliana At1g62790 mRNA, complete
           cds.>gb:BT012377_1641528 Arabidopsis thaliana At1g62790
           mRNA, complete cds.
          Length = 150

 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +3

Query: 183 LVPCAEYLNSTKPPAS-CCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHC 359
           LVPC   LN+T  P   CCD +KE V KEL+CLC +Y +P +L    V   +AL L + C
Sbjct: 33  LVPCFNDLNTTTTPVKECCDSIKEAVEKELTCLCTIYTSPGLLAQFNVTTEKALGLSRRC 92

Query: 360 GISNDVSAC 386
            ++ D+SAC
Sbjct: 93  NVTTDLSAC 101



>gb:AE005173_893947 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC007190_1535516 Genomic sequence
           for Arabidopsis thaliana BAC F23N19 from chromosome I,
           complete sequence.
          Length = 114

 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +3

Query: 183 LVPCAEYLNSTKPPAS-CCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHC 359
           LVPC   LN+T  P   CCD +KE V KEL+CLC +Y +P +L    V   +AL L + C
Sbjct: 33  LVPCFNDLNTTTTPVKECCDSIKEAVEKELTCLCTIYTSPGLLAQFNVTTEKALGLSRRC 92

Query: 360 GISNDVSAC 386
            ++ D+SAC
Sbjct: 93  NVTTDLSAC 101



>pir|T14827|T14827 lipid transfer protein - Norway
           spruce>gb:AB007843_1510327 Picea abies mRNA for lipid
           transfer protein, complete cds.
          Length = 173

 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 33/72 (45%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +3

Query: 180 NLVPCAEYLNST-KPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKH 356
           +L  CA YLN+T KP +SCC  L   + K+  CLCNL  N + +K LGVN+TQA+++P  
Sbjct: 36  SLSSCAPYLNATTKPDSSCCSALISVIDKDSQCLCNLL-NSDTVKQLGVNVTQAMKMPAE 94

Query: 357 CGISNDVSACDK 392
           CG +   + C+K
Sbjct: 95  CGKNVSATQCNK 106



>gb:AC012396_1537640 Arabidopsis thaliana chromosome 1 BAC T9L24
           genomic sequence, complete sequence.
          Length = 134

 Score = 69.3 bits (168), Expect = 7e-11
 Identities = 28/71 (39%), Positives = 48/71 (67%), Gaps = 1/71 (1%)
 Frame = +3

Query: 183 LVPCAEYLN-STKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHC 359
           L+PC  Y++ S  PP  CC+P+K+   K++SCLC  +K+P++L+ L +    A+++   C
Sbjct: 39  LMPCQPYIHLSIPPPPLCCNPMKQIAEKDVSCLCTAFKHPDLLRFLALTKENAIKILDSC 98

Query: 360 GISNDVSACDK 392
           GI++D S C+K
Sbjct: 99  GINHDPSVCNK 109



>pir|C96762|C96762 hypothetical protein F6D5.6 [imported] -
           Arabidopsis thaliana>gb:AE005173_894901 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC079676_1732694 Arabidopsis thaliana
           chromosome 1 BAC F6D5 genomic sequence, complete
           sequence.
          Length = 124

 Score = 69.3 bits (168), Expect = 7e-11
 Identities = 28/71 (39%), Positives = 48/71 (67%), Gaps = 1/71 (1%)
 Frame = +3

Query: 183 LVPCAEYLN-STKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHC 359
           L+PC  Y++ S  PP  CC+P+K+   K++SCLC  +K+P++L+ L +    A+++   C
Sbjct: 39  LMPCQPYIHLSIPPPPLCCNPMKQIAEKDVSCLCTAFKHPDLLRFLALTKENAIKILDSC 98

Query: 360 GISNDVSACDK 392
           GI++D S C+K
Sbjct: 99  GINHDPSVCNK 109



>gb:AE016959_1021370 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC097278_1736558
           Oryza sativa chromosome 10 BAC OSJNBa0040E17 genomic
           sequence, complete sequence.>gb:AE017067_1751189 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           21 of 77 of the complete sequence.
          Length = 218

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 27/70 (38%), Positives = 40/70 (57%), Gaps = 2/70 (2%)
 Frame = +3

Query: 183 LVPCAE-YLNST-KPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKH 356
           L PC+E Y N+T KP  +CC PLK+    EL CLC++  NP +  ++GV+  + L+L   
Sbjct: 131 LAPCSEFYRNATAKPTGACCAPLKKAYESELGCLCSVLTNPAMAATVGVDTKKGLDLFGR 190

Query: 357 CGISNDVSAC 386
           C +      C
Sbjct: 191 CDVKVPADVC 200



>gb:AP003843_1834111 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1656_E11.
          Length = 171

 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 28/74 (37%), Positives = 38/74 (51%), Gaps = 3/74 (4%)
 Frame = +3

Query: 180 NLVPCAEYL--NSTKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPK 353
           +L PC +Y+  N+++P ASCC  L   V     CLC +         + VN T+ALELP 
Sbjct: 37  SLAPCLDYMQGNASRPTASCCAALSSVVKSRPECLCAVLGGGASSLGVTVNTTRALELPA 96

Query: 354 HCGISN-DVSACDK 392
            CG+     S C K
Sbjct: 97  ACGVKTPPPSECSK 110



>gb:AB005230_1509243 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MAC12.>gb:BT015106_1642076 Arabidopsis thaliana
           At5g13900 gene, complete cds.>gb:AF463514_1801992
           Arabidopsis thaliana lipid transfer protein-like VAS
           (VAS) gene, complete cds.>gb:AK175242_1817230
           Arabidopsis thaliana mRNA for predicted GPI-anchored
           protein, complete cds, clone: RAFL21-67-F10.
          Length = 151

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 26/71 (36%), Positives = 34/71 (47%), Gaps = 3/71 (4%)
 Frame = +3

Query: 183 LVPCAEYLNSTKP-PASCCDPLKETVTKELSCLCNLYKN--PEVLKSLGVNITQALELPK 353
           L PC  YLN TK  P  CC+PLK  +     CLC +  N      +  G+++  A  LP 
Sbjct: 36  LAPCLNYLNGTKEVPQVCCNPLKSVIRNNPECLCRMISNRWSSQAERAGIDVNDAQMLPA 95

Query: 354 HCGISNDVSAC 386
            CG   +  AC
Sbjct: 96  RCGEHVNPIAC 106



>gb:AY087167_1572201 Arabidopsis thaliana clone 32411 mRNA, complete
           sequence.
          Length = 183

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 26/74 (35%), Positives = 36/74 (48%), Gaps = 3/74 (4%)
 Frame = +3

Query: 183 LVPCAEYL--NSTKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKH 356
           L PC  Y+  NST P   CC  L   +     C+C+   +P     L +N TQAL+LP  
Sbjct: 37  LSPCLSYITGNSTTPSQPCCSRLDSVIKSSPQCICSAVNSPIPNIGLNINRTQALQLPNA 96

Query: 357 CGISN-DVSACDKA 395
           C I    ++ C+ A
Sbjct: 97  CNIQTPPLTQCNAA 110



>pir|G84923|G84923 hypothetical protein At2g48130 [imported] -
           Arabidopsis thaliana>gb:AY065446_1566552 Arabidopsis
           thaliana unknown protein (At2g48130) mRNA, complete
           cds.>gb:AY117278_1579319 Arabidopsis thaliana unknown
           protein (At2g48130) mRNA, complete cds.
          Length = 183

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 26/74 (35%), Positives = 36/74 (48%), Gaps = 3/74 (4%)
 Frame = +3

Query: 183 LVPCAEYL--NSTKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKH 356
           L PC  Y+  NST P   CC  L   +     C+C+   +P     L +N TQAL+LP  
Sbjct: 37  LSPCLSYITGNSTTPSQPCCSRLDSVIKSSPQCICSAVNSPIPNIGLNINRTQALQLPNA 96

Query: 357 CGISN-DVSACDKA 395
           C I    ++ C+ A
Sbjct: 97  CNIQTPPLTQCNAA 110



>gb:AF083791_1767021 Arabidopsis thaliana clone sps870 unknown mRNA.
          Length = 168

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 3/73 (4%)
 Frame = +3

Query: 180 NLVPCAEYL--NSTKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPK 353
           ++ PC  Y+  NST P   CC+ L   V     CLC +         + VN TQAL LP+
Sbjct: 32  SMSPCLNYITGNSTSPNQQCCNQLSRVVQSSPDCLCQVLNGGGSQLGINVNQTQALGLPR 91

Query: 354 HCGISN-DVSACD 389
            C +    VS C+
Sbjct: 92  ACNVQTPPVSRCN 104



>gb:AY085883_1570946 Arabidopsis thaliana clone 19287 mRNA, complete
           sequence.
          Length = 166

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 3/73 (4%)
 Frame = +3

Query: 180 NLVPCAEYL--NSTKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPK 353
           ++ PC  Y+  NST P   CC+ L   V     CLC +         + VN TQAL LP+
Sbjct: 30  SMSPCLNYITGNSTSPNQQCCNQLSRVVQSSPDCLCQVLNGGGSQLGINVNQTQALGLPR 89

Query: 354 HCGISN-DVSACD 389
            C +    VS C+
Sbjct: 90  ACNVQTPPVSRCN 102



>gb:AY045650_1561241 Arabidopsis thaliana AT3g22600/F16J14_17 mRNA,
           complete cds.>gb:AY079122_1568183 Arabidopsis thaliana
           AT3g22600/F16J14_17 mRNA, complete
           cds.>gb:AP000731_1820540 Arabidopsis thaliana genomic
           DNA, chromosome 3, BAC clone:F16J14.
          Length = 170

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 3/73 (4%)
 Frame = +3

Query: 180 NLVPCAEYL--NSTKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPK 353
           ++ PC  Y+  NST P   CC+ L   V     CLC +         + VN TQAL LP+
Sbjct: 34  SMSPCLNYITGNSTSPNQQCCNQLSRVVQSSPDCLCQVLNGGGSQLGINVNQTQALGLPR 93

Query: 354 HCGISN-DVSACD 389
            C +    VS C+
Sbjct: 94  ACNVQTPPVSRCN 106



>gb:AP004315_1840079 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0571D04.
          Length = 273

 Score = 49.3 bits (116), Expect = 7e-05
 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 4/74 (5%)
 Frame = +3

Query: 183 LVPCAEYLNSTK---PPASCCDPLKETVTKELSCLCN-LYKNPEVLKSLGVNITQALELP 350
           L+PC EY+       PP+ CCD  K  V K   CLC+ +  N   L    +++T+ + LP
Sbjct: 173 LMPCMEYVTKADVPAPPSVCCDGFKSLVEKAPICLCHGINGNISKLMPAPIDLTRIMSLP 232

Query: 351 KHCGISNDVSACDK 392
             CG++  V A  K
Sbjct: 233 ATCGVAPPVEALTK 246



>gb:AP003843_1834117 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1656_E11.>gb:AP004307_1839953 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0534H07.
          Length = 170

 Score = 48.9 bits (115), Expect = 9e-05
 Identities = 28/72 (38%), Positives = 34/72 (47%), Gaps = 3/72 (4%)
 Frame = +3

Query: 180 NLVPCAEYL--NSTKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPK 353
           ++ PC  YL  N T P ASCC  L E V  +  CLC           L +N T+AL LP 
Sbjct: 41  SMSPCLNYLTGNETAPSASCCGKLGEVVKSQPECLCVALNADTAALGLSINRTRALGLPD 100

Query: 354 HCGISN-DVSAC 386
            C +    VS C
Sbjct: 101 ACKVQTPPVSNC 112



>gb:AC090871_1734492 Oryza sativa chromosome 3 BAC OSJNBb0060J21
           genomic sequence, complete sequence.
          Length = 177

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 29/77 (37%), Positives = 36/77 (46%), Gaps = 5/77 (6%)
 Frame = +3

Query: 180 NLVPCAEYL--NSTKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNI--TQALEL 347
           NL PC  Y+  N T P  +CC  L   V  +  CLC            GV I  T+ALEL
Sbjct: 38  NLYPCLNYISGNETSPTRTCCSQLATVVQSQPQCLCAAISGDSSSSIGGVTIDKTRALEL 97

Query: 348 PKHCG-ISNDVSACDKA 395
           PK C  ++   S C+ A
Sbjct: 98  PKACNVVTPPASRCNSA 114



>gb:AB159560_1528436 Zinnia elegans ZeXYP1 mRNA for xylogen protein
           1, complete cds.
          Length = 183

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 4/67 (5%)
 Frame = +3

Query: 180 NLVPCAEYLNS----TKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALEL 347
           N+  C  Y+ +     KP  +CC  LK  +  +  CLC  +KN   L  + +NIT+AL L
Sbjct: 43  NMADCLSYVTAGSTVKKPEGTCCSGLKTVLKTDAECLCEAFKNSAQL-GVSLNITKALAL 101

Query: 348 PKHCGIS 368
           P  C I+
Sbjct: 102 PSACHIN 108



>pir|E96766|E96766 hypothetical protein F2P9.24 [imported] -
           Arabidopsis thaliana>gb:AE005173_894935 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC016662_1538236 Arabidopsis thaliana
           chromosome 1 BAC F2P9 genomic sequence, complete
           sequence.
          Length = 193

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 3/75 (4%)
 Frame = +3

Query: 180 NLVPCAEYLN--STKPPASCCDPLKETVTKELSCLCNLYKNPEVLK-SLGVNITQALELP 350
           +L PC  ++   +  P   CCD L +  ++E +CLC    N   L  +  +N T AL+LP
Sbjct: 36  SLAPCGPFVQGFAQLPAQPCCDSLNQIYSQEATCLCLFLNNTSTLSPAFPINQTLALQLP 95

Query: 351 KHCGISNDVSACDKA 395
             C I  + S C  +
Sbjct: 96  PLCNIPANSSTCSSS 110



>gb:AP003843_1834104 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1656_E11.>gb:AP004670_1843068 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0496D04.
          Length = 188

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
 Frame = +3

Query: 180 NLVPCAEYL--NSTKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPK 353
           +L  C  Y+  NS+ P  SCC  L   VT + +CLC +         + +N T+ALELP 
Sbjct: 45  SLASCLGYMSGNSSAPKPSCCTALSSVVTSKPACLCAVLGGGASSLGVTINNTRALELPA 104

Query: 354 HCGI 365
            C +
Sbjct: 105 ACNV 108



>gb:AP003509_1830101 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0525F01.
          Length = 116

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 4/71 (5%)
 Frame = +3

Query: 183 LVPCAEYLNSTK---PPASCCDPLKETVTKELSCLCN-LYKNPEVLKSLGVNITQALELP 350
           L+PC EY   T    PP+ CCD  K  V     CLC+ +  N        +++T+ + LP
Sbjct: 3   LMPCVEYATKTDVPAPPSVCCDGFKSLVEMAPICLCHGINGNIGKFMPAPIDLTRMMSLP 62

Query: 351 KHCGISNDVSA 383
             CG++  V A
Sbjct: 63  ATCGVTPPVEA 73



>pir|T48146|T48146 hypothetical protein T4C9.200 - Arabidopsis
           thaliana>gb:ATCHRIV33_1545001 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 33.>gb:ATT4C9_1556003
           Arabidopsis thaliana DNA chromosome 4, BAC clone T4C9
           (ESSA project).>gb:BT010827_1640773 Arabidopsis thaliana
           At4g12360 mRNA, complete cds.>gb:BT011305_1641055
           Arabidopsis thaliana At4g12360 gene, complete cds.
          Length = 161

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 1/71 (1%)
 Frame = +3

Query: 183 LVPCAEYLNSTKPPAS-CCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHC 359
           L  C   +    PP+  CC  ++  +T +LSCLC   K+P +L    V    AL   K C
Sbjct: 46  LAVCLPAITQRGPPSQECCTAVETALTTQLSCLCGFIKSPMLLIPFNVTDFNAL-FSKTC 104

Query: 360 GISNDVSACDK 392
           G++ D + C +
Sbjct: 105 GLTTDPNLCSE 115



>gb:AY087113_1572148 Arabidopsis thaliana clone 31856 mRNA, complete
           sequence.
          Length = 156

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 2/64 (3%)
 Frame = +3

Query: 180 NLVPCAEYL--NSTKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPK 353
           ++ PC  ++  N++ P   CC+ L   V     CLC +         + VN TQAL LPK
Sbjct: 32  SMAPCLSFITQNTSLPSQQCCNQLAHVVRYSSECLCQVLDGGGSQLGINVNETQALALPK 91

Query: 354 HCGI 365
            C +
Sbjct: 92  ACHV 95



>gb:AC135563_1742570 Oryza sativa chromosome 3 BAC OSJNBb0015I02
           genomic sequence, complete sequence.
          Length = 195

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 25/77 (32%), Positives = 35/77 (45%), Gaps = 5/77 (6%)
 Frame = +3

Query: 183 LVPCAEYLN----STKPPASCCDPLKETVTKELSCLCNLYKN-PEVLKSLGVNITQALEL 347
           L  C  Y+     +  P   CC  L + V     CLC L K+  E      +N+T+A++L
Sbjct: 41  LATCLTYVEEKATARAPTRDCCAGLGQVVAGSKKCLCVLVKDRDEPALGFRINVTRAMDL 100

Query: 348 PKHCGISNDVSACDKAL 398
           P  C I+   S C K L
Sbjct: 101 PSGCSIAATFSDCPKML 117



>gb:AY085224_1570297 Arabidopsis thaliana clone 13962 mRNA, complete
           sequence.
          Length = 102

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 24/61 (39%), Positives = 30/61 (49%)
 Frame = +3

Query: 189 PCAEYLNSTKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHCGIS 368
           P     N T P   CC  L+     + +CLC  YKN   L S GV+   A  LPK CG++
Sbjct: 42  PAVSKENPTSPSQPCCTALQHA---DFACLCG-YKNSPWLGSFGVDPELASALPKQCGLA 97

Query: 369 N 371
           N
Sbjct: 98  N 98



>gb:AY062857_1565513 Arabidopsis thaliana Unknown protein mRNA,
           complete cds.>gb:BT006510_1639397 Arabidopsis thaliana
           At5g48485 gene, complete cds.>gb:AF342726_1789545
           Arabidopsis thaliana DIR1 protein gene, complete cds.
          Length = 102

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 24/61 (39%), Positives = 30/61 (49%)
 Frame = +3

Query: 189 PCAEYLNSTKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHCGIS 368
           P     N T P   CC  L+     + +CLC  YKN   L S GV+   A  LPK CG++
Sbjct: 42  PAVSKENPTSPSQPCCTALQHA---DFACLCG-YKNSPWLGSFGVDPELASALPKQCGLA 97

Query: 369 N 371
           N
Sbjct: 98  N 98



>pir|T02385|T02385 hypothetical protein At2g44290 [imported] -
           Arabidopsis thaliana>gb:AC004521_1531807 Arabidopsis
           thaliana chromosome 2 clone F4I1 map m336, complete
           sequence.>gb:BT005512_1638452 Arabidopsis thaliana clone
           U50676 unknown protein (At2g44290) mRNA, complete
           cds.>gb:AK118152_1816146 Arabidopsis thaliana At2g44290
           mRNA for putative non-specific lipid transfer protein
           (nLTP), complete cds, clone: RAFL19-45-L01.
          Length = 205

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 5/77 (6%)
 Frame = +3

Query: 183 LVPCAEYLN--STKPPASCCDPLKETVTKELSCLCNLYK---NPEVLKSLGVNITQALEL 347
           +  C  Y+   +  P   CC  LK+ +  ++ CLC + +   +P++   L VN++ AL L
Sbjct: 43  MATCLPYVQGKAKSPTPDCCSGLKQVINSDMKCLCMIIQERNDPDL--GLQVNVSLALAL 100

Query: 348 PKHCGISNDVSACDKAL 398
           P  C  + D++ C   L
Sbjct: 101 PSVCHATADITKCPALL 117



>gb:BT002886_1636477 Arabidopsis thaliana clone RAFL15-05-B21
           (R20382) unknown protein (At5g48490) mRNA, partial cds.
          Length = 100

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 24/62 (38%), Positives = 31/62 (50%)
 Frame = +3

Query: 186 VPCAEYLNSTKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHCGI 365
           +P     N T P   CC+ LK     + +CLC  YKN   L S GV+   A  LPK C +
Sbjct: 39  LPAVSKNNPTSPSLLCCNALKHA---DYTCLCG-YKNSPWLGSFGVDPKLASSLPKECDL 94

Query: 366 SN 371
           +N
Sbjct: 95  TN 96



>gb:AB020745_1514604 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MJE7.>gb:AY087218_1572252 Arabidopsis thaliana
           clone 32925 mRNA, complete sequence.
          Length = 101

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 24/62 (38%), Positives = 31/62 (50%)
 Frame = +3

Query: 186 VPCAEYLNSTKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHCGI 365
           +P     N T P   CC+ LK     + +CLC  YKN   L S GV+   A  LPK C +
Sbjct: 40  LPAVSKNNPTSPSLLCCNALKHA---DYTCLCG-YKNSPWLGSFGVDPKLASSLPKECDL 95

Query: 366 SN 371
           +N
Sbjct: 96  TN 97



>gb:AP005257_1849706 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0417F02.
          Length = 207

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 1/61 (1%)
 Frame = +3

Query: 219 PPASCCDPLKETVTKELSCLCNLYKNPEVLK-SLGVNITQALELPKHCGISNDVSACDKA 395
           P   CC  LK  +     CLC L K+ +     L +N+T+AL LP+ C    ++S C + 
Sbjct: 62  PTPDCCSGLKAVLAASRKCLCVLIKDRDDPNLGLKINVTKALSLPQLCNAPANISDCPRL 121

Query: 396 L 398
           L
Sbjct: 122 L 122



>gb:AY088880_1573888 Arabidopsis thaliana clone 98459 mRNA, complete
           sequence.
          Length = 182

 Score = 42.0 bits (97), Expect = 0.012
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 6/66 (9%)
 Frame = +3

Query: 180 NLVPCAEYLNS----TKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGV--NITQAL 341
           N+  C  +++S     KP  +CC  LK  +  +  CLC  +K+     SLGV  NIT+A 
Sbjct: 49  NMADCLSFVSSGGTVAKPEGTCCSGLKTVLKADSQCLCEAFKSS---ASLGVTLNITKAS 105

Query: 342 ELPKHC 359
            LP  C
Sbjct: 106 TLPAAC 111



>gb:AY070743_1566893 Arabidopsis thaliana AT5g64080/MHJ24_6 mRNA,
           complete cds.>gb:AY093740_1575400 Arabidopsis thaliana
           AT5g64080/MHJ24_6 mRNA, complete cds.
          Length = 182

 Score = 42.0 bits (97), Expect = 0.012
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 6/66 (9%)
 Frame = +3

Query: 180 NLVPCAEYLNS----TKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGV--NITQAL 341
           N+  C  +++S     KP  +CC  LK  +  +  CLC  +K+     SLGV  NIT+A 
Sbjct: 49  NMADCLSFVSSGGTVAKPEGTCCSGLKTVLKADSQCLCEAFKSS---ASLGVTLNITKAS 105

Query: 342 ELPKHC 359
            LP  C
Sbjct: 106 TLPAAC 111



>gb:AB008266_1510418 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MHJ24.
          Length = 173

 Score = 42.0 bits (97), Expect = 0.012
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 6/66 (9%)
 Frame = +3

Query: 180 NLVPCAEYLNS----TKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGV--NITQAL 341
           N+  C  +++S     KP  +CC  LK  +  +  CLC  +K+     SLGV  NIT+A 
Sbjct: 49  NMADCLSFVSSGGTVAKPEGTCCSGLKTVLKADSQCLCEAFKSS---ASLGVTLNITKAS 105

Query: 342 ELPKHC 359
            LP  C
Sbjct: 106 TLPAAC 111



>gb:BT003062_1636644 Arabidopsis thaliana At2g13820 gene, complete
           cds.
          Length = 169

 Score = 41.6 bits (96), Expect = 0.015
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 4/72 (5%)
 Frame = +3

Query: 180 NLVPCAEYLNS----TKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALEL 347
           N+  C  ++ S     KP  +CC  LK  V     CLC  +KN   L  L +++++A  L
Sbjct: 33  NMADCLSFVTSGSTVVKPEGTCCSGLKTVVRTGPECLCEAFKNSGSL-GLTLDLSKAASL 91

Query: 348 PKHCGISNDVSA 383
           P  C ++   SA
Sbjct: 92  PSVCKVAAPPSA 103



>pir|B84511|B84511 hypothetical protein At2g13820 [imported] -
           Arabidopsis thaliana>gb:AC006218_1533643 Arabidopsis
           thaliana chromosome 2 clone F17L24 map GPC6, complete
           sequence.>gb:AC006436_1534248 Arabidopsis thaliana
           chromosome 2 clone F13J11 map mi398, complete
           sequence.>gb:AY086354_1571404 Arabidopsis thaliana clone
           24286 mRNA, complete sequence.
          Length = 169

 Score = 41.6 bits (96), Expect = 0.015
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 4/72 (5%)
 Frame = +3

Query: 180 NLVPCAEYLNS----TKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALEL 347
           N+  C  ++ S     KP  +CC  LK  V     CLC  +KN   L  L +++++A  L
Sbjct: 33  NMADCLSFVTSGSTVVKPEGTCCSGLKTVVRTGPECLCEAFKNSGSL-GLTLDLSKAASL 91

Query: 348 PKHCGISNDVSA 383
           P  C ++   SA
Sbjct: 92  PSVCKVAAPPSA 103



>gb:AP003843_1834112 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1656_E11.
          Length = 181

 Score = 41.2 bits (95), Expect = 0.020
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 3/71 (4%)
 Frame = +3

Query: 183 LVPCAEYLN--STKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKH 356
           L PC +Y++  S  P  +CC  L   V  +  CLC +         + +N T+ALELP  
Sbjct: 44  LSPCLDYISGKSPIPEFTCCTTLAGVVQSDPRCLCMVLDGSAASFGISINHTRALELPGV 103

Query: 357 CGI-SNDVSAC 386
           C + +  +S C
Sbjct: 104 CKVQAPPISQC 114



>gb:OSJN00239_1697225 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0039G19, complete sequence.
          Length = 392

 Score = 41.2 bits (95), Expect = 0.020
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 5/75 (6%)
 Frame = +3

Query: 183 LVPCAEYLNSTK---PPASCCDPLKETVTKELSCLCNLYKNPEVLKSL--GVNITQALEL 347
           L+PC EYL       PP+  CD  K  V K   CLC+   N ++ K +   ++  + + L
Sbjct: 246 LMPCMEYLTKADEPAPPSIGCDSFKSLVEKAPICLCHGI-NGDISKFMPAPIDFARMMSL 304

Query: 348 PKHCGISNDVSACDK 392
           P  CG++  V A  K
Sbjct: 305 PATCGVAPPVEALTK 319



>gb:AY086176_1571231 Arabidopsis thaliana clone 21969 mRNA, complete
           sequence.
          Length = 129

 Score = 40.8 bits (94), Expect = 0.026
 Identities = 27/75 (36%), Positives = 40/75 (53%), Gaps = 6/75 (8%)
 Frame = +3

Query: 183 LVPCAEYLN----STKPPASCCDPLKETVTKELSCLC-NLYKNPEVLKSLGVNITQALEL 347
           L PC  +++    +  P ASCC  LK  +  +  CLC  L K P  +K   +N+T++  L
Sbjct: 35  LFPCLPFISIGGTADTPTASCCSSLKNILDTKPICLCEGLKKAPLGIK---LNVTKSATL 91

Query: 348 PKHCGI-SNDVSACD 389
           P  C + +  VSACD
Sbjct: 92  PVACKLNAPPVSACD 106



>gb:ATT5E8_1556132 Arabidopsis thaliana DNA chromosome 5, BAC clone
           T5E8 (ESSA project).>gb:AK118479_1816452 Arabidopsis
           thaliana At5g09370 mRNA for putative lipid transfer
           protein, complete cds, clone: RAFL19-71-J05.
          Length = 158

 Score = 40.8 bits (94), Expect = 0.026
 Identities = 27/75 (36%), Positives = 40/75 (53%), Gaps = 6/75 (8%)
 Frame = +3

Query: 183 LVPCAEYLN----STKPPASCCDPLKETVTKELSCLC-NLYKNPEVLKSLGVNITQALEL 347
           L PC  +++    +  P ASCC  LK  +  +  CLC  L K P  +K   +N+T++  L
Sbjct: 35  LFPCLPFISIGGTADTPTASCCSSLKNILDTKPICLCEGLKKAPLGIK---LNVTKSATL 91

Query: 348 PKHCGI-SNDVSACD 389
           P  C + +  VSACD
Sbjct: 92  PVACKLNAPPVSACD 106



>sp|Q42952|NLT1_TOBAC Nonspecific lipid-transfer protein 1 precursor
           (LTP 1).>pir|S22168|S22168 lipid transfer protein -
           common tobacco>gb:NTLTP1_1691598 N.tabacum ltp1 gene for
           lipid transferase.
          Length = 114

 Score = 40.8 bits (94), Expect = 0.026
 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 5/68 (7%)
 Frame = +3

Query: 180 NLVPCAEYLNSTKPPASCCDPLKETV-----TKELSCLCNLYKNPEVLKSLGVNITQALE 344
           NL PC  YL +T P   CC  +K  V     T++    C   K+     S G+N+ +A  
Sbjct: 33  NLAPCLAYLRNTGPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAIS-GINLGKAAG 91

Query: 345 LPKHCGIS 368
           LP  CG++
Sbjct: 92  LPSTCGVN 99



>gb:AY574218_1615872 Tamarix androssowii probable lipid transfer
           protein family protein mRNA, complete cds.
          Length = 94

 Score = 40.4 bits (93), Expect = 0.033
 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 1/63 (1%)
 Frame = +3

Query: 183 LVPCAEYLNSTKPP-ASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHC 359
           L PCA  +  + PP A+CC  L+E    +  CLC  Y++P + +   VN   A ++ + C
Sbjct: 35  LSPCAGAITGSGPPSATCCSRLRE----QTPCLCGYYRDPNLRQY--VNSPNAQKVARTC 88

Query: 360 GIS 368
           G+S
Sbjct: 89  GVS 91



>gb:AP004268_1839483 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0045F02.
          Length = 104

 Score = 40.0 bits (92), Expect = 0.044
 Identities = 19/53 (35%), Positives = 30/53 (56%)
 Frame = +3

Query: 210 STKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHCGIS 368
           +T P A CC  L      +L+CLC+ YKN   L    ++  +A++LP  CG++
Sbjct: 51  TTNPSAGCCSALSHA---DLNCLCS-YKNSPWLSIYNIDPNRAMQLPAKCGLT 99



>gb:AY804336_1628653 Capsicum chinense cultivar Peach Savina lipid
           transfer protein gene, complete cds.>gb:AY804337_1628654
           Capsicum chinense cultivar PI159234 lipid transfer
           protein gene, promoter region and complete
           cds.>gb:AY804338_1628655 Capsicum annuum cultivar RNaky
           lipid transfer protein gene, complete
           cds.>gb:AY804339_1628656 Capsicum annuum cultivar Super
           Hot lipid transfer protein gene, complete cds.
          Length = 172

 Score = 40.0 bits (92), Expect = 0.044
 Identities = 21/57 (36%), Positives = 26/57 (45%), Gaps = 1/57 (1%)
 Frame = +3

Query: 219 PPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHCGISN-DVSAC 386
           PPASCC  L   +     CLC +         + +N TQAL LP  C +    VS C
Sbjct: 52  PPASCCSSLSGVLQSNPRCLCVIVNGGGSSLGVQINQTQALALPSACNLQTPPVSRC 108



>gb:AY804335_1628652 Capsicum annuum cultivar Perennial lipid
           transfer protein gene, complete cds.
          Length = 172

 Score = 40.0 bits (92), Expect = 0.044
 Identities = 21/57 (36%), Positives = 26/57 (45%), Gaps = 1/57 (1%)
 Frame = +3

Query: 219 PPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHCGISN-DVSAC 386
           PPASCC  L   +     CLC +         + +N TQAL LP  C +    VS C
Sbjct: 52  PPASCCSSLSGVLQSNPRCLCVIVNGGGSSLGVQINQTQALALPSACNLQTPPVSRC 108



>gb:AY085407_1570476 Arabidopsis thaliana clone 15027 mRNA, complete
           sequence.
          Length = 193

 Score = 40.0 bits (92), Expect = 0.044
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 5/68 (7%)
 Frame = +3

Query: 210 STKPPASCCDPLKETVTKELSCLCNLYKNP----EVLKSLGVNITQALELPKHCGISN-D 374
           +T P   CCD +++   ++  CLC + +      + LK LGV   + ++LP  C + N  
Sbjct: 53  ATTPSKKCCDAVEDIKERDPKCLCFVIQQAKTGGQALKDLGVQEDKLIQLPTSCQLHNAS 112

Query: 375 VSACDKAL 398
           ++ C K L
Sbjct: 113 ITNCPKLL 120



>gb:AX384586_1466757 Sequence 3 from Patent WO0214502.
          Length = 97

 Score = 40.0 bits (92), Expect = 0.044
 Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 1/63 (1%)
 Frame = +3

Query: 183 LVPCAEYLNSTKPPA-SCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHC 359
           LVPCA  ++S++PP+ SCC  ++E    +  C C   +NP + +   V+   A ++   C
Sbjct: 37  LVPCAGAISSSQPPSGSCCSKVRE----QRPCFCGYLRNPSLRQF--VSPAAAQKIASQC 90

Query: 360 GIS 368
           G+S
Sbjct: 91  GVS 93



>pir|JQ2343|JQ2343 P48h-10 protein precursor - Zinnia elegans (cv.
           Envy)
          Length = 95

 Score = 40.0 bits (92), Expect = 0.044
 Identities = 24/62 (38%), Positives = 35/62 (56%), Gaps = 1/62 (1%)
 Frame = +3

Query: 183 LVPCAEYLNSTKPPAS-CCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHC 359
           L PCA  ++S+ PP+S CC  +KE    +  CLC   KNP  LK+  V+   A ++   C
Sbjct: 35  LAPCASAISSSSPPSSQCCAKIKE----QKPCLCQYMKNPS-LKAY-VSSPNAKKVANAC 88

Query: 360 GI 365
           G+
Sbjct: 89  GV 90



>pir|JQ2342|JQ2342 hypothetical 10.0K protein - Zinnia
           elegans>gb:ZEU19266_1731384 Zinnia elegans putative
           nonspecific lipid transfer protein mRNA, complete
           cds.>gb:ZINTED4_1731409 Zinnia elegans mRNA for TED4,
           complete cds.
          Length = 95

 Score = 40.0 bits (92), Expect = 0.044
 Identities = 24/62 (38%), Positives = 35/62 (56%), Gaps = 1/62 (1%)
 Frame = +3

Query: 183 LVPCAEYLNSTKPPAS-CCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHC 359
           L PCA  ++S+ PP+S CC  +KE    +  CLC   KNP  LK+  V+   A ++   C
Sbjct: 35  LAPCASAISSSSPPSSQCCAKIKE----QKPCLCQYMKNPS-LKAY-VSSPNAKKVANAC 88

Query: 360 GI 365
           G+
Sbjct: 89  GV 90



>pir|T02386|T02386 hypothetical protein At2g44300 [imported] -
           Arabidopsis thaliana>gb:AC004521_1531808 Arabidopsis
           thaliana chromosome 2 clone F4I1 map m336, complete
           sequence.>gb:BT006196_1639088 Arabidopsis thaliana
           At2g44300 mRNA, complete cds.
          Length = 204

 Score = 40.0 bits (92), Expect = 0.044
 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 5/77 (6%)
 Frame = +3

Query: 183 LVPCAEYLN--STKPPASCCDPLKETVTKELSCLCNLYK---NPEVLKSLGVNITQALEL 347
           +  C  Y+   +  P   CC  LK+ +     CLC + +   +P++   L +N++ AL L
Sbjct: 42  MATCLPYVQGQAKSPTPDCCSGLKQVLNSNKKCLCVIIQDRNDPDL--GLQINVSLALAL 99

Query: 348 PKHCGISNDVSACDKAL 398
           P  C  + DV+ C   L
Sbjct: 100 PSVCHAAADVTKCPALL 116



>gb:AP003803_1833587 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1060_D03.
          Length = 170

 Score = 39.7 bits (91), Expect = 0.057
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 2/36 (5%)
 Frame = +3

Query: 183 LVPCAEYL--NSTKPPASCCDPLKETVTKELSCLCN 284
           L+PC +YL  ++T PP +CCD  +  V   L CLC+
Sbjct: 80  LLPCVDYLTNDATAPPGACCDGFRSLVGSALICLCH 115



>gb:AP000731_1820538 Arabidopsis thaliana genomic DNA, chromosome 3,
           BAC clone:F16J14.
          Length = 127

 Score = 39.7 bits (91), Expect = 0.057
 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 4/66 (6%)
 Frame = +3

Query: 180 NLVPCAEYLNSTKPP----ASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALEL 347
           +L PC  YL S+ P     + CC  L +     + C C    +   +  +  N  QA  L
Sbjct: 37  SLKPCFSYLTSSYPSLPDDSDCCPSLLDISKTSVDCFCQYLNSGGSILDINANFIQARRL 96

Query: 348 PKHCGI 365
           P+ CG+
Sbjct: 97  PEICGV 102



>gb:OSJN00010_1693225 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OJ991214_12, complete sequence.
          Length = 123

 Score = 39.7 bits (91), Expect = 0.057
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 3/66 (4%)
 Frame = +3

Query: 183 LVPCAEYLNS--TKPPASCCDPLKETVTKEL-SCLCNLYKNPEVLKSLGVNITQALELPK 353
           L PCA+       +PPA+CC  +++  T +  +CLC +  +  V +S GV    A+ +PK
Sbjct: 42  LAPCAKAAQDPGARPPAACCAAVRDIGTHQSHACLCAVLLSSTVRRS-GVKPEVAITIPK 100

Query: 354 HCGISN 371
            C ++N
Sbjct: 101 RCKLAN 106



>gb:AP004179_1838583 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1124_G07.>gb:AP005113_1848089 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0685G12.
          Length = 279

 Score = 39.3 bits (90), Expect = 0.075
 Identities = 16/38 (42%), Positives = 25/38 (65%), Gaps = 3/38 (7%)
 Frame = +3

Query: 180 NLVPCAEYLNSTK---PPASCCDPLKETVTKELSCLCN 284
           +++PCA+YL +T    PPA+CCD  +  V+    CLC+
Sbjct: 178 SVMPCADYLTNTAVPTPPATCCDGFRSLVSTAPICLCH 215



>gb:AJ630658_1812771 Cicer arietinum mRNA for putative lipid
           transfer protein GPI-anchored (Ltp2 gene).
          Length = 185

 Score = 39.3 bits (90), Expect = 0.075
 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 7/79 (8%)
 Frame = +3

Query: 183 LVPCAEYLN--STKPPASCCDPLKETVTKELSCLCNL----YKNPEVLKSLGVNITQALE 344
           ++PC ++    +  P   CCD        +  CLC +    +K     KSLG+   + L+
Sbjct: 35  VIPCLDFATGKALTPKKECCDAANSIKETDPECLCYIIQQTHKGSPESKSLGIQEDKLLQ 94

Query: 345 LPKHCGISN-DVSACDKAL 398
           LP  C + N +++ C K L
Sbjct: 95  LPTVCKVKNANLTDCPKLL 113



>sp|Q9C7F7|UGP5_ARATH Uncharacterized GPI-anchored protein At1g27950
           precursor.>pir|H86404|H86404 probable lipid transfer
           protein [imported] - Arabidopsis
           thaliana>gb:AE005172_891678 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC069471_1540841 Arabidopsis thaliana
           chromosome 1 BAC F13K9 genomic sequence, complete
           sequence.>gb:AY092956_1574910 Arabidopsis thaliana lipid
           transfer protein, putative (At1g27950) mRNA, complete
           cds.>gb:AY128712_1580792 Arabidopsis thaliana lipid
           transfer protein, putative (At1g27950) mRNA, complete
           cds.
          Length = 193

 Score = 39.3 bits (90), Expect = 0.075
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 5/68 (7%)
 Frame = +3

Query: 210 STKPPASCCDPLKETVTKELSCLCNLYKNP----EVLKSLGVNITQALELPKHCGISN-D 374
           +T P   CCD +++   ++  CLC + +      + LK LGV   + ++LP  C + N  
Sbjct: 53  ATIPSKKCCDAVEDIKERDPKCLCFVIQQAKTGGQALKDLGVQEDKLIQLPTSCQLHNAS 112

Query: 375 VSACDKAL 398
           ++ C K L
Sbjct: 113 ITNCPKLL 120



>sp|Q43767|NL41_HORVU Nonspecific lipid-transfer protein 4.1
           precursor (LTP 4.1) (CW21) (CW- 21).>pir|S45371|S45371
           nonspecific lipid transfer protein Cw-21 precursor -
           barley>gb:HVCW21_1682327 H.vulgare Cw-21 mRNA.
          Length = 115

 Score = 39.3 bits (90), Expect = 0.075
 Identities = 25/73 (34%), Positives = 34/73 (46%), Gaps = 11/73 (15%)
 Frame = +3

Query: 183 LVPCAEYL--NSTKPPASCCDPLK-------ETVTKELSCLCNLYKNPEVLKSL--GVNI 329
           L PC  Y   N  KPPA+CC  +K        T  K+ +C C        +KS   G+N 
Sbjct: 36  LSPCISYARGNGAKPPAACCSGVKRLAGAAQSTADKQAACKC--------IKSAAGGLNA 87

Query: 330 TQALELPKHCGIS 368
            +A  +P  CG+S
Sbjct: 88  GKAAGIPSMCGVS 100



>gb:AY035005_1559784 Arabidopsis thaliana unknown protein
           (At3g22620) mRNA, complete cds.>gb:AY113897_1578308
           Arabidopsis thaliana unknown protein (At3g22620) mRNA,
           complete cds.>gb:AP000731_1820541 Arabidopsis thaliana
           genomic DNA, chromosome 3, BAC clone:F16J14.
          Length = 203

 Score = 38.9 bits (89), Expect = 0.097
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 5/64 (7%)
 Frame = +3

Query: 189 PCAEYL-----NSTKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPK 353
           PC  ++     N T P + CC+ L+   T  + CLC L     V  ++ +N T A+ LP+
Sbjct: 39  PCMGFITNSSSNGTSPSSDCCNSLRSLTTGGMGCLC-LIVTGTVPFNIPINRTTAVSLPR 97

Query: 354 HCGI 365
            C +
Sbjct: 98  ACNM 101



>pir|A86162|A86162 protein F10O3.7 [imported] - Arabidopsis
           thaliana>gb:AE005172_889330 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F10O3_1677285 Arabidopsis thaliana
           chromosome 1 BAC F10O3 sequence, complete sequence.
          Length = 129

 Score = 38.9 bits (89), Expect = 0.097
 Identities = 23/65 (35%), Positives = 28/65 (43%), Gaps = 3/65 (4%)
 Frame = +3

Query: 180 NLVPCAEYLN--STKPPASCCDPLKETVTKELSCLCNLY-KNPEVLKSLGVNITQALELP 350
           +L PC  YLN  S+ P  SCC      V     CLC++   N         N T AL LP
Sbjct: 31  SLSPCLYYLNGGSSSPSWSCCRQFSTVVQSSPECLCSVVNSNESSFYGFKFNRTLALNLP 90

Query: 351 KHCGI 365
             C +
Sbjct: 91  TACNV 95



>gb:AC090871_1734490 Oryza sativa chromosome 3 BAC OSJNBb0060J21
           genomic sequence, complete sequence.
          Length = 189

 Score = 38.5 bits (88), Expect = 0.13
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 3/75 (4%)
 Frame = +3

Query: 180 NLVPCAEYL--NSTKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPK 353
           +L PC  Y+  N+T P A+CC  L   +     CLC +         + V+  +A  LP 
Sbjct: 53  SLSPCMGYMSGNATAPAAACCSALSGVLRSSPRCLCMVLGGTAASLGVAVDTARAALLPG 112

Query: 354 HCGI-SNDVSACDKA 395
            C + +   S C+ A
Sbjct: 113 ACSVQAPPASQCNAA 127



>gb:AY572530_1615736 Malus x domestica clone Mal d 3.02-IM1 lipid
           transfer protein precursor (Mal d 3.02) gene, Mal d
           3.0202a allele, complete cds.>gb:AY572531_1615737 Malus
           x domestica clone Mal d 3.02-CO2 lipid transfer protein
           precursor (Mal d 3.02) gene, Mal d 3.0202a allele,
           complete cds.
          Length = 115

 Score = 38.5 bits (88), Expect = 0.13
 Identities = 27/76 (35%), Positives = 37/76 (48%), Gaps = 13/76 (17%)
 Frame = +3

Query: 180 NLVPCAEYLNSTKP-PASCCDPL-------KETVTKELSCLCNLYKNPEVLKSL-----G 320
           NLVPC +Y+ S  P P +CC+ +       K T  ++ +C C        LKSL     G
Sbjct: 33  NLVPCFDYVRSDGPVPPACCNGIRTINGLAKTTPDRQAACNC--------LKSLAGSVSG 84

Query: 321 VNITQALELPKHCGIS 368
           VN   A  LP  CG++
Sbjct: 85  VNPGNAESLPGKCGVN 100



>gb:AY045643_1561234 Arabidopsis thaliana At2g48140/F11L15.4 mRNA,
           complete cds.>gb:AY059652_1564564 Arabidopsis thaliana
           At2g48140/F11L15.4 mRNA, complete
           cds.>gb:AY088054_1573078 Arabidopsis thaliana clone 4074
           mRNA, complete sequence.
          Length = 200

 Score = 38.5 bits (88), Expect = 0.13
 Identities = 22/74 (29%), Positives = 30/74 (40%), Gaps = 5/74 (6%)
 Frame = +3

Query: 189 PCAEYLN-----STKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPK 353
           PC  ++      S  P A CCD LK      + C C +      L +  +N T AL LP+
Sbjct: 37  PCLNFITGSSGGSVTPTAGCCDSLKTLTNTGMGCACLILTANVPLPTGFINRTLALALPR 96

Query: 354 HCGISNDVSACDKA 395
            C +      C  A
Sbjct: 97  ACKMGGVPIQCQAA 110



>pir|H84923|H84923 hypothetical protein At2g48140 [imported] -
           Arabidopsis thaliana
          Length = 171

 Score = 38.5 bits (88), Expect = 0.13
 Identities = 22/74 (29%), Positives = 30/74 (40%), Gaps = 5/74 (6%)
 Frame = +3

Query: 189 PCAEYLN-----STKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPK 353
           PC  ++      S  P A CCD LK      + C C +      L +  +N T AL LP+
Sbjct: 28  PCLNFITGSSGGSVTPTAGCCDSLKTLTNTGMGCACLILTANVPLPTGFINRTLALALPR 87

Query: 354 HCGISNDVSACDKA 395
            C +      C  A
Sbjct: 88  ACKMGGVPIQCQAA 101



>gb:AY572519_1615725 Malus x domestica clone Mal d 3.02-PM2 lipid
           transfer protein precursor (Mal d 3.02) gene, Mal d
           3.0201c allele, complete cds.>gb:AY572527_1615733 Malus
           x domestica clone Mal d 3.02-PS2 lipid transfer protein
           precursor (Mal d 3.02) gene, Mal d 3.0201c allele,
           complete cds.>gb:AY572528_1615734 Malus x domestica
           clone Mal d 3.02-FJ2 lipid transfer protein precursor
           (Mal d 3.02) gene, Mal d 3.0201d allele, complete
           cds.>gb:AY572529_1615735 Malus x domestica clone Mal d
           3.02-DS2 lipid transfer protein precursor (Mal d 3.02)
           gene, Mal d 3.0201e allele, complete cds.
          Length = 115

 Score = 38.1 bits (87), Expect = 0.17
 Identities = 27/76 (35%), Positives = 37/76 (48%), Gaps = 13/76 (17%)
 Frame = +3

Query: 180 NLVPCAEYLNSTKP-PASCCDPL-------KETVTKELSCLCNLYKNPEVLKSL-----G 320
           NLVPC +Y+ S  P P +CC+ +       K T  ++ +C C        LKSL     G
Sbjct: 33  NLVPCFDYVRSGGPVPPACCNGIRTINGLAKTTPDRQAACNC--------LKSLAGSVSG 84

Query: 321 VNITQALELPKHCGIS 368
           VN   A  LP  CG++
Sbjct: 85  VNPGNAESLPGKCGVN 100



>gb:AY572517_1615723 Malus x domestica clone Mal d 3.02-FS lipid
           transfer protein precursor (Mal d 3.02) gene, Mal d
           3.0201a allele, complete cds.>gb:AY572518_1615724 Malus
           x domestica clone Mal d 3.02-PM1 lipid transfer protein
           precursor (Mal d 3.02) gene, Mal d 3.0201b allele,
           complete cds.>gb:AY572520_1615726 Malus x domestica
           clone Mal d 3.02-PS1 lipid transfer protein precursor
           (Mal d 3.02) gene, Mal d 3.0201a allele, complete
           cds.>gb:AY572521_1615727 Malus x domestica clone Mal d
           3.02-JO lipid transfer protein precursor (Mal d 3.02)
           gene, Mal d 3.0201a allele, complete
           cds.>gb:AY572522_1615728 Malus x domestica clone Mal d
           3.02-CO1 lipid transfer protein precursor (Mal d 3.02)
           gene, Mal d 3.0201a allele, complete
           cds.>gb:AY572523_1615729 Malus x domestica clone Mal d
           3.02-RD lipid transfer protein precursor (Mal d 3.02)
           gene, Mal d 3.0201a allele, complete
           cds.>gb:AY572524_1615730 Malus x domestica clone Mal d
           3.02-FJ1 lipid transfer protein precursor (Mal d 3.02)
           gene, Mal d 3.0201a allele, complete
           cds.>gb:AY572525_1615731 Malus x domestica clone Mal d
           3.02-GD lipid transfer protein precursor (Mal d 3.02)
           gene, Mal d 3.0201b allele, complete
           cds.>gb:AY572526_1615732 Malus x domestica clone Mal d
           3.02-DS1 lipid transfer protein precursor (Mal d 3.02)
           gene, Mal d 3.0201b allele, complete cds.
          Length = 115

 Score = 38.1 bits (87), Expect = 0.17
 Identities = 27/76 (35%), Positives = 37/76 (48%), Gaps = 13/76 (17%)
 Frame = +3

Query: 180 NLVPCAEYLNSTKP-PASCCDPL-------KETVTKELSCLCNLYKNPEVLKSL-----G 320
           NLVPC +Y+ S  P P +CC+ +       K T  ++ +C C        LKSL     G
Sbjct: 33  NLVPCFDYVRSGGPVPPACCNGIRTINGLAKTTPDRQAACNC--------LKSLAGSVSG 84

Query: 321 VNITQALELPKHCGIS 368
           VN   A  LP  CG++
Sbjct: 85  VNPGNAESLPGKCGVN 100



>gb:AY327042_1599683 Oryza sativa (japonica cultivar-group) lipid
           transfer protein LPT1 mRNA, complete cds.
          Length = 118

 Score = 38.1 bits (87), Expect = 0.17
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 6/66 (9%)
 Frame = +3

Query: 189 PCAEYLNSTKPPASCCDPLKE-----TVTKELSCLCNLYKNPEVLKSL-GVNITQALELP 350
           PC  Y    +P A+CC  ++      + T +    CN  KN  V  S+ G+N   A  +P
Sbjct: 39  PCLSYARGLRPSAACCSGVRSLNSAASTTADRRTACNCLKN--VAGSISGLNAGNAASIP 96

Query: 351 KHCGIS 368
             CG+S
Sbjct: 97  SKCGVS 102



>gb:AY088620_1573636 Arabidopsis thaliana clone 8461 mRNA, complete
           sequence.
          Length = 193

 Score = 38.1 bits (87), Expect = 0.17
 Identities = 26/78 (33%), Positives = 36/78 (46%), Gaps = 9/78 (11%)
 Frame = +3

Query: 180 NLVPCAEYLN------STKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNI--TQ 335
           N+  C  Y+       + KP  +CC  L   V     CLC L    ++   LG+ I   +
Sbjct: 44  NMTGCLSYVTVGEGGGAAKPDKTCCPALAGLVESSPQCLCYLLSG-DMAAQLGIKIDKAK 102

Query: 336 ALELPKHCG-ISNDVSAC 386
           AL+LP  CG I+ D S C
Sbjct: 103 ALKLPGVCGVITPDPSLC 120



>gb:AY059472_1564551 Davidia involucrata lipid transfer protein
           precursor, mRNA, complete cds.
          Length = 120

 Score = 38.1 bits (87), Expect = 0.17
 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 6/69 (8%)
 Frame = +3

Query: 180 NLVPCAEYLNSTKP-PASCCDPLKET-----VTKELSCLCNLYKNPEVLKSLGVNITQAL 341
           +L PC  YL    P P +CC+ +K        T +    CN  K        G+N++ A 
Sbjct: 38  SLAPCLNYLKKGGPVPPACCNGIKSLNAAAKTTADRQAACNCLKTAST-SIAGINLSYAS 96

Query: 342 ELPKHCGIS 368
            LP  CG++
Sbjct: 97  SLPGKCGVN 105



>pir|T47408|T47408 lipid-transfer-like protein - Arabidopsis
           thaliana>gb:ATT28A8_1555546 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T28A8.>gb:AY045908_1561412
           Arabidopsis thaliana putative lipid transfer protein
           (At3g43720) mRNA, complete cds.>gb:AY079420_1568309
           Arabidopsis thaliana putative lipid-transfer protein
           (At3g43720) mRNA, complete cds.
          Length = 193

 Score = 38.1 bits (87), Expect = 0.17
 Identities = 26/78 (33%), Positives = 36/78 (46%), Gaps = 9/78 (11%)
 Frame = +3

Query: 180 NLVPCAEYLN------STKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNI--TQ 335
           N+  C  Y+       + KP  +CC  L   V     CLC L    ++   LG+ I   +
Sbjct: 44  NMTGCLSYVTVGEGGGAAKPDKTCCPALAGLVESSPQCLCYLLSG-DMAAQLGIKIDKAK 102

Query: 336 ALELPKHCG-ISNDVSAC 386
           AL+LP  CG I+ D S C
Sbjct: 103 ALKLPGVCGVITPDPSLC 120



>sp|Q42999|NLT3_ORYSA Nonspecific lipid-transfer protein 3 precursor
           (LTP 3).>pir|T03782|T03782 probable lipid transfer
           protein - rice>gb:OSLPTPRA_1698263 O.sativa lipid
           transfer protein gene, complete CDS.
          Length = 117

 Score = 38.1 bits (87), Expect = 0.17
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 6/66 (9%)
 Frame = +3

Query: 189 PCAEYLNSTKPPASCCDPLKE-----TVTKELSCLCNLYKNPEVLKSL-GVNITQALELP 350
           PC  Y    +P A+CC  ++      + T +    CN  KN  V  S+ G+N   A  +P
Sbjct: 39  PCLSYARGLRPSAACCSGVRSLNSAASTTADRRTACNCLKN--VAGSISGLNAGNAASIP 96

Query: 351 KHCGIS 368
             CG+S
Sbjct: 97  SKCGVS 102



>sp|Q43766|NLT3_HORVU Nonspecific lipid-transfer protein 3 precursor
           (LTP 3) (CW20) (CW-20) (CW-19).>pir|S49198|S49198
           nonspecific lipid transfer protein Cw-19 precursor -
           barley>gb:HVCW19_1682326 H.vulgare Cw-19 mRNA.
          Length = 118

 Score = 38.1 bits (87), Expect = 0.17
 Identities = 25/76 (32%), Positives = 34/76 (44%), Gaps = 14/76 (18%)
 Frame = +3

Query: 183 LVPCAEYL--NSTKPPASCCDPLK-------ETVTKELSCLCNLYKNPEVLKSL-----G 320
           L PC  Y   N  KPP +CC  +K        T  K+ +C C        LKSL     G
Sbjct: 36  LSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACRC--------LKSLATSIKG 87

Query: 321 VNITQALELPKHCGIS 368
           +N+ +   +P  CG+S
Sbjct: 88  INMGKVSGVPGKCGVS 103



>gb:AP004797_1845233 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0547F09.
          Length = 270

 Score = 37.7 bits (86), Expect = 0.22
 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 4/65 (6%)
 Frame = +3

Query: 180 NLVPCAEYLNSTK---PPASCCDPLKETVTKELSCLCN-LYKNPEVLKSLGVNITQALEL 347
           +++ CA+YL ++    PP +CC+  K  V+    CLC+ +  +      L V++ + + L
Sbjct: 171 SMMSCADYLTNSSAQTPPGTCCEGFKSLVSTAPICLCHGINGDLSKFLPLPVDMMKMMTL 230

Query: 348 PKHCG 362
           P  CG
Sbjct: 231 PNTCG 235



>gb:AP004797_1845222 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0547F09.
          Length = 268

 Score = 37.7 bits (86), Expect = 0.22
 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 4/65 (6%)
 Frame = +3

Query: 180 NLVPCAEYLNSTK---PPASCCDPLKETVTKELSCLCN-LYKNPEVLKSLGVNITQALEL 347
           +++ CA+YL ++    PP +CC+  K  V+    CLC+ +  +      L V++ + + L
Sbjct: 171 SMMSCADYLTNSSAQTPPGTCCEGFKSLVSTAPICLCHGINGDLSKFLPLPVDMMKMMTL 230

Query: 348 PKHCG 362
           P  CG
Sbjct: 231 PNTCG 235



>sp|Q42842|NL43_HORVU Nonspecific lipid-transfer protein 4.3
           precursor (LTP 4.3).>gb:HVGLTP4X3_1682366 H.vulgare
           ltp4.3 gene.
          Length = 115

 Score = 37.7 bits (86), Expect = 0.22
 Identities = 24/73 (32%), Positives = 33/73 (45%), Gaps = 11/73 (15%)
 Frame = +3

Query: 183 LVPCAEYL--NSTKPPASCCDPLK-------ETVTKELSCLCNLYKNPEVLKSL--GVNI 329
           L PC  Y   N  KPP +CC  +K        T  K+ +C C        +KS   G+N 
Sbjct: 36  LSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACKC--------IKSAAGGLNA 87

Query: 330 TQALELPKHCGIS 368
            +A  +P  CG+S
Sbjct: 88  GKAAGIPSMCGVS 100



>sp|Q43875|NL42_HORVU Nonspecific lipid-transfer protein 4.2
           precursor (LTP 4.2) (Low- temperature-responsive protein
           4.9).>gb:HVGLTP4X9_1682367 H.vulgare Ltp4.2
           gene.>gb:HVU63993_1682831 Hordeum vulgare lipid transfer
           protein (blt4.9) gene, complete cds.
          Length = 115

 Score = 37.7 bits (86), Expect = 0.22
 Identities = 24/73 (32%), Positives = 33/73 (45%), Gaps = 11/73 (15%)
 Frame = +3

Query: 183 LVPCAEYL--NSTKPPASCCDPLK-------ETVTKELSCLCNLYKNPEVLKSL--GVNI 329
           L PC  Y   N  KPP +CC  +K        T  K+ +C C        +KS   G+N 
Sbjct: 36  LSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACKC--------IKSAAGGLNA 87

Query: 330 TQALELPKHCGIS 368
            +A  +P  CG+S
Sbjct: 88  GKAAGIPSMCGVS 100



>gb:AF233297_1779438 Nicotiana tabacum lipid transfer protein gene,
           complete cds.
          Length = 116

 Score = 37.4 bits (85), Expect = 0.28
 Identities = 27/80 (33%), Positives = 35/80 (43%), Gaps = 10/80 (12%)
 Frame = +3

Query: 183 LVPCAEYLNST-----KPPASCCDPLKETV----TKE-LSCLCNLYKNPEVLKSLGVNIT 332
           L PC  Y+ +       P   CC  +        TKE    +CN  KN   + +  VN T
Sbjct: 32  LAPCLSYIQNRVKGGGNPSVPCCTGINNIYELAKTKEDRVAICNCLKNA-FIHAGNVNPT 90

Query: 333 QALELPKHCGISNDVSACDK 392
              ELPK CGIS ++   DK
Sbjct: 91  LVAELPKKCGISFNMPPIDK 110



>pir|T02048|T02048 lipid transfer protein (clone ant43C) - common
           tobacco>gb:NTU14167_1691815 Nicotiana tabacum Xanthi-nc
           clone ant43C lipid transfer protein mRNA, complete cds.
          Length = 120

 Score = 37.4 bits (85), Expect = 0.28
 Identities = 27/80 (33%), Positives = 35/80 (43%), Gaps = 10/80 (12%)
 Frame = +3

Query: 183 LVPCAEYLNST-----KPPASCCDPLKETV----TKE-LSCLCNLYKNPEVLKSLGVNIT 332
           L PC  Y+ +       P   CC  +        TKE    +CN  KN   + +  VN T
Sbjct: 32  LAPCLSYIQNRVKGGGNPSVPCCTGINNIYELAKTKEDRVAICNCLKNA-FIHAGNVNPT 90

Query: 333 QALELPKHCGISNDVSACDK 392
              ELPK CGIS ++   DK
Sbjct: 91  LVAELPKKCGISFNMPPIDK 110



>gb:AC146521_1744602 Oryza sativa chromosome 3 B1246D11 genomic
           sequence, complete sequence.
          Length = 178

 Score = 37.0 bits (84), Expect = 0.37
 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 7/79 (8%)
 Frame = +3

Query: 183 LVPCAEYLNSTK-----PPASCCDPLKETV--TKELSCLCNLYKNPEVLKSLGVNITQAL 341
           L  C +Y+   K     P   CC  +K  +  +  + CLC  + +  +   L +NIT+AL
Sbjct: 47  LADCLDYVTPGKTAPSRPSKLCCGEVKGALKDSAAVGCLCAAFTSKTL--PLPINITRAL 104

Query: 342 ELPKHCGISNDVSACDKAL 398
            LP  CG   D SA  K L
Sbjct: 105 HLPAACGA--DASAFSKCL 121



>gb:AE005172_889569 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC005106_1532180 Genomic sequence
           for Arabidopsis thaliana BAC T25N20 from chromosome I,
           complete sequence.
          Length = 233

 Score = 37.0 bits (84), Expect = 0.37
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 2/60 (3%)
 Frame = +3

Query: 192 CAEYLNS--TKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHCGI 365
           C  +L    + P + CC  LK      + CLC L     V  S+ +N T A+ LP+ CGI
Sbjct: 44  CTSFLTGGGSFPTSDCCGALKSLTGTGMDCLC-LIVTAGVPISIPINRTLAISLPRACGI 102



>gb:AY572532_1615738 Malus x domestica clone Mal d 3.02-IM2 lipid
           transfer protein precursor (Mal d 3.02) gene, Mal d
           3.0203a allele, complete cds.
          Length = 115

 Score = 36.6 bits (83), Expect = 0.48
 Identities = 26/76 (34%), Positives = 36/76 (47%), Gaps = 13/76 (17%)
 Frame = +3

Query: 180 NLVPCAEYLNSTKP-PASCCDPL-------KETVTKELSCLCNLYKNPEVLKSL-----G 320
           NLVPC +Y+ S  P P +CC+ +       K T  ++ +C C        LKSL     G
Sbjct: 33  NLVPCFDYVRSGGPVPPACCNGIRTINGLAKTTPDRQAACNC--------LKSLAGSVSG 84

Query: 321 VNITQALELPKHCGIS 368
           VN      LP  CG++
Sbjct: 85  VNPGNVESLPGKCGVN 100



>gb:AY039903_1560417 Arabidopsis thaliana AT3g18280/MIE15_7 mRNA,
           complete cds.>gb:AY077680_1567882 Arabidopsis thaliana
           AT3g18280/MIE15_7 mRNA, complete
           cds.>gb:AP000414_1820090 Arabidopsis thaliana genomic
           DNA, chromosome 3, P1 clone: MIE15.
          Length = 96

 Score = 36.6 bits (83), Expect = 0.48
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 1/60 (1%)
 Frame = +3

Query: 183 LVPCAEYLNSTKPP-ASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHC 359
           L PCA  + S+ PP A CC  LKE    +  CLC   +NP + +   V+   A ++ K C
Sbjct: 36  LSPCATAITSSSPPSALCCAKLKE----QRPCLCGYMRNPSLRRF--VSTPNARKVSKSC 89



>gb:SNELIPTRA_1715564 Senecio odorus lipid transfer protein mRNA, 3'
           end.
          Length = 89

 Score = 36.2 bits (82), Expect = 0.63
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 1/62 (1%)
 Frame = +3

Query: 183 LVPCAE-YLNSTKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHC 359
           L+PC+  + +S  P A CC  LKE    +  CLC   KNP  LK    N   A ++   C
Sbjct: 29  LMPCSSAFTSSAAPTAQCCTKLKE----QSPCLCGYLKNP-TLKQYITN-PNAKKVTSTC 82

Query: 360 GI 365
           G+
Sbjct: 83  GV 84



>pir|T00941|T00941 hypothetical protein T3F12.2 - Arabidopsis
           thaliana>gb:AC002983_1530904 Arabidopsis thaliana BAC
           T3F12 from chromosome IV near 24 cM, complete
           sequence.>gb:ATCHRIV24_1544583 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 24.
          Length = 194

 Score = 36.2 bits (82), Expect = 0.63
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 5/68 (7%)
 Frame = +3

Query: 180 NLVPCAEYL----NSTKPPASCCDPLKETVTKELSCLC-NLYKNPEVLKSLGVNITQALE 344
           +++ C  YL    N TKP  SCC  ++  +     C+C  L    E+   + +N T+AL 
Sbjct: 54  SMMDCLGYLGVGSNETKPEKSCCTGIETVLQYNPQCICAGLVSAGEM--GIELNSTRALA 111

Query: 345 LPKHCGIS 368
            PK C +S
Sbjct: 112 TPKACKLS 119



>gb:AK175803_1817791 Arabidopsis thaliana mRNA for putative lipid
           transfer protein, complete cds, clone: RAFL22-40-A04.
          Length = 115

 Score = 35.8 bits (81), Expect = 0.82
 Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 8/70 (11%)
 Frame = +3

Query: 180 NLVPCAEYLNS---TKPPASCCDPLKETVTKELSCL-----CNLYKNPEVLKSLGVNITQ 335
           NL PC  YL +   T P   CC+ +++     L+ L     C   KN       G+N  +
Sbjct: 35  NLKPCTGYLTNGGITSPGPQCCNGVRKLNGMVLTTLDRRQACRCIKNAARNVGPGLNADR 94

Query: 336 ALELPKHCGI 365
           A  +P+ CGI
Sbjct: 95  AAGIPRRCGI 104



>gb:MTY15371_1687724 Medicago truncatula mRNA for MtN5 gene.
          Length = 102

 Score = 35.8 bits (81), Expect = 0.82
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 3/61 (4%)
 Frame = +3

Query: 192 CAEYLNSTKPPAS---CCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHCG 362
           C++++    PP +   CC  L+      L CLC  YK+   L   G+N  +AL LP  CG
Sbjct: 42  CSKFVTGRNPPRADEACCGVLRRA---NLPCLCG-YKS--ALTYYGINAKKALALPGQCG 95

Query: 363 I 365
           +
Sbjct: 96  L 96



>gb:AY621633_1618372 Nicotiana glauca lipid transfer protein (LTP5)
           mRNA, complete cds.
          Length = 117

 Score = 35.8 bits (81), Expect = 0.82
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 6/69 (8%)
 Frame = +3

Query: 180 NLVPCAEY-LNSTKPPASCCDPLKE-----TVTKELSCLCNLYKNPEVLKSLGVNITQAL 341
           +L+PC  Y +     PA CC+ +K      T T +    CN  K+       G+N + A 
Sbjct: 35  SLIPCINYVIKGGAIPAPCCNGIKSLNNQATSTPDRQTACNCIKSAAA-SIKGINFSHAG 93

Query: 342 ELPKHCGIS 368
            LP  CG++
Sbjct: 94  SLPGKCGVN 102



>gb:AE016959_1021406 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC104322_1737572
           Oryza sativa chromosome 10 BAC OSJNBb0005F01 genomic
           sequence, complete sequence.>gb:AE017068_1751225 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           22 of 77 of the complete sequence.
          Length = 188

 Score = 35.8 bits (81), Expect = 0.82
 Identities = 22/78 (28%), Positives = 36/78 (46%), Gaps = 7/78 (8%)
 Frame = +3

Query: 180 NLVPCAEYLNSTKPPASCCDPLKETVTKELSCLCNLYK----NPEVLKSLGVNITQALEL 347
           +L+PCA   +       CC+ + E +  +  CLC + +    N   L S+  N+    +L
Sbjct: 58  DLMPCATVSDDPTMLTPCCEAVAEVLKSDPECLCKVAEMSRNNTRKLASVSNNLDSDQQL 117

Query: 348 PKHC---GISNDVSACDK 392
              C   G+S+DV   DK
Sbjct: 118 FAQCKITGVSSDVCHKDK 135



>pir|D84524|D84524 probable lipid transfer protein [imported] -
           Arabidopsis thaliana>gb:AC005957_1533255 Arabidopsis
           thaliana chromosome 2 clone T15J14 map mi398, complete
           sequence.>gb:AF325066_1786520 Arabidopsis thaliana
           putative lipid transfer protein (At2g15050) mRNA,
           complete cds.
          Length = 123

 Score = 35.8 bits (81), Expect = 0.82
 Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 8/70 (11%)
 Frame = +3

Query: 180 NLVPCAEYLNS---TKPPASCCDPLKETVTKELSCL-----CNLYKNPEVLKSLGVNITQ 335
           NL PC  YL +   T P   CC+ +++     L+ L     C   KN       G+N  +
Sbjct: 35  NLKPCTGYLTNGGITSPGPQCCNGVRKLNGMVLTTLDRRQACRCIKNAARNVGPGLNADR 94

Query: 336 ALELPKHCGI 365
           A  +P+ CGI
Sbjct: 95  AAGIPRRCGI 104



>gb:AC097175_1736473 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1119_H02, complete sequence.
          Length = 210

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 22/74 (29%), Positives = 31/74 (41%), Gaps = 5/74 (6%)
 Frame = +3

Query: 180 NLVPCAEYLNS----TKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALEL 347
           N+  C  Y+ +     +P   CC  L   V     CLC L         + V+ ++AL L
Sbjct: 58  NMSDCLTYVQNGSRARRPDKPCCPELAGLVESNPVCLCELLSGAGDSYGIAVDYSRALAL 117

Query: 348 PKHCGISN-DVSAC 386
           P  C +S   VS C
Sbjct: 118 PAICRVSTPPVSTC 131



>pir|T45809|T45809 hypothetical protein F28O9.160 - Arabidopsis
           thaliana>gb:ATF28O9_1550384 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F28O9.
          Length = 103

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 1/41 (2%)
 Frame = +3

Query: 180 NLVPCAE-YLNSTKPPASCCDPLKETVTKELSCLCNLYKNP 299
           NL+ C    L  ++PPA CC+ LKE    + SCLC   K+P
Sbjct: 42  NLMSCLPAILKGSQPPAYCCEMLKE----QQSCLCGYIKSP 78



>pir|E84563|E84563 probable lipid transfer protein [imported] -
           Arabidopsis thaliana>gb:AC006439_1534290 Arabidopsis
           thaliana chromosome 2 clone T30D6 map mi39, complete
           sequence.>gb:AY084369_1569460 Arabidopsis thaliana clone
           105626 mRNA, complete sequence.
          Length = 116

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 25/75 (33%), Positives = 33/75 (44%), Gaps = 7/75 (9%)
 Frame = +3

Query: 180 NLVPCAEYLNSTK--PPASCCDPLKE-----TVTKELSCLCNLYKNPEVLKSLGVNITQA 338
           +L PC  YL S    PP +CCD +K      T + +    C   K+  V  S+ V    A
Sbjct: 34  DLQPCVSYLTSGSGNPPETCCDGVKSLAAATTTSADKKAACQCIKS--VANSVTVKPELA 91

Query: 339 LELPKHCGISNDVSA 383
             L  +CG S  V A
Sbjct: 92  QALASNCGASLPVDA 106



>gb:AP003570_1831029 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0432B10.>gb:AP004331_1840307 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OSJNBa0085D07.
          Length = 187

 Score = 35.0 bits (79), Expect = 1.4
 Identities = 21/74 (28%), Positives = 33/74 (44%), Gaps = 5/74 (6%)
 Frame = +3

Query: 180 NLVPCAEYL----NSTKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALEL 347
           N+  C  Y+     + KP   CC  L   +  +  CLC L         + V+  +A+ L
Sbjct: 51  NMSDCLTYVMNGSTARKPDEPCCPELAGLLESKPVCLCQLLAGGASSYDISVDYKRAMAL 110

Query: 348 PKHCGI-SNDVSAC 386
           P  CG+ +  V+AC
Sbjct: 111 PGICGLAAPPVTAC 124



>gb:AF331710_1787131 Avicennia marina lipid transfer protein mRNA,
           complete cds.
          Length = 117

 Score = 35.0 bits (79), Expect = 1.4
 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 5/67 (7%)
 Frame = +3

Query: 183 LVPCAEYLNSTKPPASCCDPLKE-----TVTKELSCLCNLYKNPEVLKSLGVNITQALEL 347
           L PC  Y+ +  P   CC  +K        T +   +C   K+  +  S  VN+ +A  L
Sbjct: 38  LAPCIPYVTNRGPLGGCCGGVKSLYGLARTTPDRQSVCGCLKS--LASSYNVNLGKAAGL 95

Query: 348 PKHCGIS 368
           P  CG++
Sbjct: 96  PGQCGVN 102



>sp|O04004|NLT6_AMBAR Nonspecific lipid-transfer protein precursor
           (LTP) (Pollen allergen Amb a 6) (Amb a VI) (Allergen
           Ra6).>gb:AAU89793_1508270 Ambrosia artemisiifolia
           allergen Amb a VI (Amb-a-VI) mRNA, complete cds.
          Length = 118

 Score = 35.0 bits (79), Expect = 1.4
 Identities = 22/77 (28%), Positives = 33/77 (42%), Gaps = 5/77 (6%)
 Frame = +3

Query: 183 LVPCAEYLNSTKPPASCCDPL-----KETVTKELSCLCNLYKNPEVLKSLGVNITQALEL 347
           L PCA +L   +P  +CC  +           +   +CN  K  E+ KS+  +  +   L
Sbjct: 37  LAPCAGFLTGQEPSKACCTGVNNLNNSRKTKADRVAVCNCIK--ELTKSIAYDPKRMPLL 94

Query: 348 PKHCGISNDVSACDKAL 398
              CG+  D  A DK L
Sbjct: 95  STKCGVKPDFPAVDKNL 111



>gb:AY754742_1626924 Triticum aestivum lipid transfer protein (LTP2)
           mRNA, complete cds.>gb:AF334185_1787439 Triticum
           aestivum lipid transfer protein precursor (LTP2) mRNA,
           complete cds.
          Length = 115

 Score = 34.7 bits (78), Expect = 1.8
 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 11/73 (15%)
 Frame = +3

Query: 183 LVPCAEYL--NSTKPPASCCDPLKE-------TVTKELSCLCNLYKNPEVLKSL--GVNI 329
           L PC  Y   + T P  +CC  +++       T  K+ +C C        LKS+  G+N 
Sbjct: 36  LTPCVAYAKGSGTSPSGACCSGVRKLAGLARSTADKQATCRC--------LKSVAGGLNP 87

Query: 330 TQALELPKHCGIS 368
            +A  +P  CG+S
Sbjct: 88  NKAAGIPSKCGVS 100



>gb:A63831_1450121 Sequence 4 from Patent WO9723617.
          Length = 94

 Score = 34.7 bits (78), Expect = 1.8
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 1/40 (2%)
 Frame = +3

Query: 183 LVPCAEYLNSTKPPAS-CCDPLKETVTKELSCLCNLYKNP 299
           L PCA  + S + P S CC  L+E    +  CLC  YKNP
Sbjct: 35  LSPCAPAIMSNQTPTSACCAKLRE----QKPCLCGYYKNP 70



>pir|T04560|T04560 hypothetical protein T12H17.40 - Arabidopsis
           thaliana>gb:ATT12H17_1554350 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T12H17 (ESSAII project).
          Length = 138

 Score = 34.7 bits (78), Expect = 1.8
 Identities = 24/69 (34%), Positives = 34/69 (49%), Gaps = 1/69 (1%)
 Frame = +3

Query: 192 CAEYLNSTKPPASCCDPLKETVTKELSCLC-NLYKNPEVLKSLGVNITQALELPKHCGIS 368
           C   LN+  P   CC  LK    +E++CLC N+  +P+ L       T   ++ K CG+ 
Sbjct: 57  CYATLNAF-PSKECCKDLKTASKREVTCLCNNVIAHPDPL------YTNTNQVNKACGVL 109

Query: 369 NDVSACDKA 395
            D  ACD A
Sbjct: 110 -DKYACDVA 117



>gb:AP004127_1838039 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0005H10.
          Length = 118

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 2/65 (3%)
 Frame = +3

Query: 183 LVPCAEYLNSTKP--PASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKH 356
           L PCA    + +   P +CC  ++ ++ +   CLC +  +    +S GV    A+ +PK 
Sbjct: 43  LAPCAAATQNPRAAVPPNCCAQVR-SIGRNPKCLCAVMLS-NTARSAGVKPAVAMTIPKR 100

Query: 357 CGISN 371
           C I+N
Sbjct: 101 CAIAN 105



>gb:AF525363_1808308 Solanum tuberosum putative non-specific lipid
           transfer protein StnsLTP (nsltp12) gene, complete cds.
          Length = 114

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 7/69 (10%)
 Frame = +3

Query: 183 LVPCAEYLNSTKPPASCCDPL-------KETVTKELSCLCNLYKNPEVLKSLGVNITQAL 341
           L PC  YL    P   CC  +       K    ++ +C C L      +K  G+N+ +A 
Sbjct: 34  LAPCLPYLQGRGPIGGCCGGIKGLLGAAKTPADRKTACTC-LKSAASAIK--GINVGKAA 90

Query: 342 ELPKHCGIS 368
            +P+ CG++
Sbjct: 91  GIPRLCGVN 99



>gb:AF525362_1808307 Solanum tuberosum putative non-specific lipid
           transfer protein StnsLTP (nsltp2) gene, complete cds.
          Length = 114

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 7/69 (10%)
 Frame = +3

Query: 183 LVPCAEYLNSTKPPASCCDPL-------KETVTKELSCLCNLYKNPEVLKSLGVNITQAL 341
           L PC  YL    P   CC  +       K    ++ +C C L      +K  G+N+ +A 
Sbjct: 34  LAPCLPYLQGRGPIGGCCGGIKGLLGAAKTPADRKTACTC-LKSAASAIK--GINVGKAA 90

Query: 342 ELPKHCGIS 368
            +P+ CG++
Sbjct: 91  GIPRVCGVN 99



>gb:AY088619_1573635 Arabidopsis thaliana clone 8450 mRNA, complete
           sequence.
          Length = 177

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 4/41 (9%)
 Frame = +3

Query: 180 NLVPCAEYL----NSTKPPASCCDPLKETVTKELSCLCNLY 290
           N+  C  Y+    N  KP A+CC  L   V     C+CNLY
Sbjct: 47  NVSDCFSYVQVGSNEIKPEAACCPELAGMVQSSPECVCNLY 87



>gb:AC005623_1532861 Arabidopsis thaliana chromosome 2 clone T20P8
           map B68, complete sequence.>gb:AK175830_1817818
           Arabidopsis thaliana mRNA for predicted GPI-anchored
           protein, complete cds, clone:
           RAFL22-43-L04.>gb:AK175855_1817843 Arabidopsis thaliana
           mRNA for predicted GPI-anchored protein, complete cds,
           clone: RAFL22-47-M12.>gb:AK175860_1817848 Arabidopsis
           thaliana mRNA for predicted GPI-anchored protein,
           complete cds, clone: RAFL22-48-D12.
          Length = 176

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 4/41 (9%)
 Frame = +3

Query: 180 NLVPCAEYL----NSTKPPASCCDPLKETVTKELSCLCNLY 290
           N+  C  Y+    N  KP A+CC  L   V     C+CNLY
Sbjct: 46  NVSDCFSYVQVGSNEIKPEAACCPELAGMVQSSPECVCNLY 86



>gb:AY496100_1178444 Capsicum annuum nonspecific lipid transfer
           protein 2 precursor, mRNA, complete cds.
          Length = 114

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 7/70 (10%)
 Frame = +3

Query: 180 NLVPCAEYLNSTKPPASCCDPL-------KETVTKELSCLCNLYKNPEVLKSLGVNITQA 338
           +L  C  YL  + P  SCC  +       K    ++ +C C L      +K  G+N+++A
Sbjct: 33  DLAACLPYLQGSGPLGSCCGGVRALLGAAKTPADRKTACTC-LKSAANAIK--GINLSKA 89

Query: 339 LELPKHCGIS 368
             LP  CG++
Sbjct: 90  AGLPTACGVN 99



>pir|B84798|B84798 hypothetical protein At2g37870 [imported] -
           Arabidopsis thaliana>gb:AC007661_1536099 Arabidopsis
           thaliana chromosome II section 205 of 255 of the
           complete sequence. Sequence from clones F13M22, T8P21,
           F16M14.>gb:AY054635_1563289 Arabidopsis thaliana Unknown
           protein (At2g37870; T8P21.22) mRNA, complete
           cds.>gb:AY072489_1567306 Arabidopsis thaliana unknown
           protein (At2g37870; T8P21.22) mRNA, complete cds.
          Length = 115

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 2/66 (3%)
 Frame = +3

Query: 180 NLVPCAEYLNST--KPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPK 353
           +L PC     +   K P  CC  +   +     CLC +  +P + K  G+N   A+ +PK
Sbjct: 38  SLSPCLPATKNPRGKVPPVCCAKVGALIRTNPRCLCAVMLSP-LAKKAGINPGIAIGVPK 96

Query: 354 HCGISN 371
            C I N
Sbjct: 97  RCNIRN 102



>pir|B84669|B84669 hypothetical protein At2g27130 [imported] -
           Arabidopsis thaliana
          Length = 159

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 4/41 (9%)
 Frame = +3

Query: 180 NLVPCAEYL----NSTKPPASCCDPLKETVTKELSCLCNLY 290
           N+  C  Y+    N  KP A+CC  L   V     C+CNLY
Sbjct: 46  NVSDCFSYVQVGSNEIKPEAACCPELAGMVQSSPECVCNLY 86



>pir|T02038|T02038 phospholipid transfer protein -
           rice>gb:AF017358_1761540 Oryza sativa lipid transfer
           protein mRNA, complete cds.
          Length = 115

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 22/67 (32%), Positives = 31/67 (46%), Gaps = 7/67 (10%)
 Frame = +3

Query: 189 PCAEYLNS-TKPPASCCDPLKE-----TVTKELSCLCNLYKNPEVLKSL-GVNITQALEL 347
           PC  Y    + P A+CC  ++      T T +    CN  KN  V  S+ G+N   A  +
Sbjct: 36  PCLSYARGGSGPSAACCSGVRNLNSAATTTADRRTACNCLKN--VAGSISGLNAGNAASI 93

Query: 348 PKHCGIS 368
           P  CG+S
Sbjct: 94  PSKCGVS 100



>sp|Q43748|NLTP_BETVU Nonspecific lipid-transfer protein precursor
           (LTP).>pir|T14553|T14553 probable lipid transfer protein
           IWF1' precursor - beet>gb:BVIWF1_1643133 B.vulgaris mRNA
           for IWF1'.
          Length = 117

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 8/70 (11%)
 Frame = +3

Query: 183 LVPCAEYLNSTK-PPASCCDPLKET-------VTKELSCLCNLYKNPEVLKSLGVNITQA 338
           L PC  YL     P A+CC  +K           ++ +C C L      +K  G+N  +A
Sbjct: 36  LAPCIGYLQGAPGPSAACCGGIKSLNSAAASPADRKTACTC-LKSAATSIK--GINYGKA 92

Query: 339 LELPKHCGIS 368
             LP+ CG+S
Sbjct: 93  ASLPRQCGVS 102



>gb:AP005529_1853567 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0702E04.
          Length = 179

 Score = 33.9 bits (76), Expect = 3.1
 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 7/75 (9%)
 Frame = +3

Query: 183 LVPCAEYLNSTK--PPASCCDPLKETVTKELSCLC----NLYKNPEVLKSLGVNITQALE 344
           L  C +Y    +  P ++CC  +  T      CLC     ++     ++SLG+   + L 
Sbjct: 39  LTDCMDYATGHEEAPSSTCCGDMSATQQARPECLCYIIQQVHGGRNEVQSLGLRFDRLLA 98

Query: 345 LPKHCGISN-DVSAC 386
           +P  C + N +VS C
Sbjct: 99  MPTACKLPNANVSLC 113



>gb:AP005529_1853566 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0702E04.
          Length = 178

 Score = 33.9 bits (76), Expect = 3.1
 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 7/75 (9%)
 Frame = +3

Query: 183 LVPCAEYLNSTK--PPASCCDPLKETVTKELSCLC----NLYKNPEVLKSLGVNITQALE 344
           L  C +Y    +  P ++CC  +  T      CLC     ++     ++SLG+   + L 
Sbjct: 39  LTDCMDYATGHEEAPSSTCCGDMSATQQARPECLCYIIQQVHGGRNEVQSLGLRFDRLLA 98

Query: 345 LPKHCGISN-DVSAC 386
           +P  C + N +VS C
Sbjct: 99  MPTACKLPNANVSLC 113



>gb:AY098530_1576447 Ananas comosus PVR3-like protein mRNA, partial
           cds.
          Length = 112

 Score = 33.9 bits (76), Expect = 3.1
 Identities = 18/50 (36%), Positives = 28/50 (56%)
 Frame = +3

Query: 219 PPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHCGIS 368
           P   CC  L      +L CLC+ Y++  +L SLG++   AL+LP  C ++
Sbjct: 62  PSKECCAALAGA---DLPCLCS-YRHSFLLPSLGIDPDLALQLPAKCNLT 107



>gb:AY247416_602114 Polyangium cellulosum strain So9733-1 clone 04
           ketoacyl synthase gene, partial cds.
          Length = 142

 Score = 33.9 bits (76), Expect = 3.1
 Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = -3

Query: 467 STWCSWRRLRH*WRSGISSGGWTQSFVAGADVIAYTAVLG--KLKGLSDVDSEG 312
           ST+  + RLR     G+S  GW++SF A AD + ++   G   LK LSD   +G
Sbjct: 35  STFVEFSRLR-----GLSPDGWSKSFSASADGVGWSEGCGVLALKRLSDAQRDG 83



>pir|D85259|D85259 hypothetical protein AT4g22650 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV57_1546102 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           57.>gb:ATF7K2_1551051 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F7K2 (ESSA project).
          Length = 156

 Score = 33.9 bits (76), Expect = 3.1
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 1/67 (1%)
 Frame = +3

Query: 192 CAEYLNSTKPPASCCDPLKETVTKELSCLC-NLYKNPEVLKSLGVNITQALELPKHCGIS 368
           C   LN+  P   CC  LK    +E++CLC N+  +P+ L       T   ++ K CG+ 
Sbjct: 57  CYATLNAF-PSKECCKDLKTASKREVTCLCNNVIAHPDPL------YTNTNQVNKACGVL 109

Query: 369 NDVSACD 389
            D  ACD
Sbjct: 110 -DKYACD 115



>pir|T04093|T04093 phospholipid transfer protein -
           maize>gb:ZMU66105_1732208 Zea mays phospholipid transfer
           protein mRNA, complete cds.
          Length = 121

 Score = 33.9 bits (76), Expect = 3.1
 Identities = 21/69 (30%), Positives = 29/69 (42%), Gaps = 7/69 (10%)
 Frame = +3

Query: 183 LVPCAEYLNSTK--PPASCCDPLKE-----TVTKELSCLCNLYKNPEVLKSLGVNITQAL 341
           + PC  Y   T   P ASCC  ++      +   +    CN  KN     S G+N   A 
Sbjct: 39  IAPCLSYARGTGSGPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVS-GLNAGNAA 97

Query: 342 ELPKHCGIS 368
            +P  CG+S
Sbjct: 98  SIPSKCGVS 106



>sp|Q43681|NLTP_VIGUN Probable nonspecific lipid-transfer protein
           AKCS9 precursor (LTP).>pir|S47084|S47084 lipid transfer
           like protein - cowpea>gb:VUAKCS9_1727423 V.unguiculata
           (Red Caloona) AKCS9 mRNA.
          Length = 99

 Score = 33.9 bits (76), Expect = 3.1
 Identities = 18/52 (34%), Positives = 29/52 (55%)
 Frame = +3

Query: 213 TKPPASCCDPLKETVTKELSCLCNLYKNPEVLKSLGVNITQALELPKHCGIS 368
           +KP ++CC  LK     +  CLCN  KNP + +   VN   A ++  +CG++
Sbjct: 50  SKPSSTCCSKLKV----QEPCLCNYIKNPSLKQY--VNSPGAKKVLSNCGVT 95



>gb:AF467945_1802450 Vitis vinifera lipid transfer protein isoform 1
           mRNA, complete cds.
          Length = 119

 Score = 33.5 bits (75), Expect = 4.1
 Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 8/68 (11%)
 Frame = +3

Query: 189 PCAEYLNST-KPPASCCDPLKE-------TVTKELSCLCNLYKNPEVLKSLGVNITQALE 344
           PCA YL      PA CC  +K        TV ++ +C C    +  +    G+N   A  
Sbjct: 40  PCASYLQKGGSVPAGCCSGIKSLNSAAKTTVDRQAACKCLKTFSGSIP---GINFGLASG 96

Query: 345 LPKHCGIS 368
           LP  CG+S
Sbjct: 97  LPGKCGVS 104



>gb:AF363506_1791541 Euphorbia lagascae lipid transfer protein 2
           mRNA, complete cds.
          Length = 116

 Score = 33.5 bits (75), Expect = 4.1
 Identities = 22/70 (31%), Positives = 27/70 (38%), Gaps = 9/70 (12%)
 Frame = +3

Query: 180 NLVPCAEYLNS--TKPPASCCDPLKE-------TVTKELSCLCNLYKNPEVLKSLGVNIT 332
           NL  C  YL    T PP +CCD +K        T  +  +C C             +N  
Sbjct: 34  NLATCIPYLTGKDTAPPTTCCDGVKNLPKIAQTTADRRAACEC----VKAAASHYTINEK 89

Query: 333 QALELPKHCG 362
            A  LPK CG
Sbjct: 90  AASSLPKDCG 99



>gb:AY456267_1607170 Nicotiana attenuata lipid-transfer protein
           mRNA, complete cds.
          Length = 117

 Score = 33.5 bits (75), Expect = 4.1
 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 6/69 (8%)
 Frame = +3

Query: 180 NLVPCAEYLNSTKP-PASCCDPLKE-----TVTKELSCLCNLYKNPEVLKSLGVNITQAL 341
           +L PC  Y+      PA CC  +K      T T +    CN  K+     + G+N + A 
Sbjct: 35  SLSPCISYVRQGGAIPAPCCSGIKSLNNQATSTPDRQTACNCIKSAAAAIN-GINYSLAG 93

Query: 342 ELPKHCGIS 368
            LP  CG++
Sbjct: 94  SLPSKCGVN 102



>gb:AY395741_1604830 Vitis aestivalis lipid transfer protein mRNA,
           complete cds.
          Length = 119

 Score = 33.5 bits (75), Expect = 4.1
 Identities = 24/69 (34%), Positives = 30/69 (43%), Gaps = 7/69 (10%)
 Frame = +3

Query: 183 LVPCAEYLNS--TKPPASCCDPLKET-----VTKELSCLCNLYKNPEVLKSLGVNITQAL 341
           L PC  YL      PPA CC  +K        T +    C   KN     S G+N++ A 
Sbjct: 38  LSPCISYLQKGGAVPPA-CCSGIKSLNSSAKTTADRQAACKCLKNFSSTVS-GINLSLAS 95

Query: 342 ELPKHCGIS 368
            LP  CG+S
Sbjct: 96  GLPGKCGVS 104



>gb:AP005515_1853271 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBa0064M11.
          Length = 170

 Score = 33.1 bits (74), Expect = 5.3
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 6/66 (9%)
 Frame = +3

Query: 183 LVPCAEYLNS----TKPPASCCDPLKETVTKE--LSCLCNLYKNPEVLKSLGVNITQALE 344
           L  C +Y  +     +PP SCC  ++  V     + C+C L         L +N+T+A  
Sbjct: 58  LADCVQYATAGSPLRQPPGSCCTEVERGVKDPAAVGCVCTLLAGNTY--GLPLNLTRAAG 115

Query: 345 LPKHCG 362
           LP  CG
Sbjct: 116 LPAACG 121



>gb:AJ784903_1814018 Triticum turgidum subsp. durum partial mRNA for
           type 1 non-specific lipid transfer protein precursor
           (ltp9.2 gene).
          Length = 103

 Score = 33.1 bits (74), Expect = 5.3
 Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 11/73 (15%)
 Frame = +3

Query: 183 LVPCAEYL--NSTKPPASCCDPLKE-------TVTKELSCLCNLYKNPEVLKSL--GVNI 329
           L PC  Y   N   P A+CC  ++        T  K+ +C C        +KS   G+N 
Sbjct: 24  LSPCISYARGNGASPSAACCSGVRSLASSARSTADKQAACKC--------IKSAAAGLNA 75

Query: 330 TQALELPKHCGIS 368
            +A  +P  CG+S
Sbjct: 76  GKAAGIPTKCGVS 88



>gb:AJ784901_1814016 Triticum aestivum mRNA for type 1 non-specific
           lipid transfer protein precursor (ltp9.2 gene).
          Length = 115

 Score = 33.1 bits (74), Expect = 5.3
 Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 11/73 (15%)
 Frame = +3

Query: 183 LVPCAEYL--NSTKPPASCCDPLKE-------TVTKELSCLCNLYKNPEVLKSL--GVNI 329
           L PC  Y   N   P A+CC  ++        T  K+ +C C        +KS   G+N 
Sbjct: 36  LSPCISYARGNGASPSAACCSGVRSLASSARSTADKQAACKC--------IKSAAAGLNA 87

Query: 330 TQALELPKHCGIS 368
            +A  +P  CG+S
Sbjct: 88  GKAAGIPTKCGVS 100



>gb:MZEPLTPA_1688015 Maize phospholipid transfer protein mRNA, 3'
           end.
          Length = 99

 Score = 33.1 bits (74), Expect = 5.3
 Identities = 20/69 (28%), Positives = 28/69 (40%), Gaps = 7/69 (10%)
 Frame = +3

Query: 183 LVPCAEYLNS--TKPPASCCDPLKET-----VTKELSCLCNLYKNPEVLKSLGVNITQAL 341
           + PC  Y     + P A CC  ++        T +    CN  KN     S G+N   A 
Sbjct: 9   IAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS-GLNAGNAA 67

Query: 342 ELPKHCGIS 368
            +P  CG+S
Sbjct: 68  SIPSKCGVS 76



>pir|T02049|T02049 lipid transfer protein (clone ant43D) - common
           tobacco>gb:NTU14168_1691816 Nicotiana tabacum Xanthi-nc
           clone ant43D lipid transfer protein mRNA, complete cds.
          Length = 118

 Score = 33.1 bits (74), Expect = 5.3
 Identities = 25/76 (32%), Positives = 33/76 (43%), Gaps = 6/76 (7%)
 Frame = +3

Query: 183 LVPCAEYLNSTKPPA-SCCDPLKETV----TKE-LSCLCNLYKNPEVLKSLGVNITQALE 344
           L PC  Y+     P+  CC  +        TKE    +CN  K      +  VN T   +
Sbjct: 34  LAPCLSYIQGGGDPSVPCCTGINNIYELAKTKEDRVAICNCLKTA-FTHAGNVNPTLVAQ 92

Query: 345 LPKHCGISNDVSACDK 392
           LPK CGIS ++   DK
Sbjct: 93  LPKKCGISFNMPPIDK 108



>pir|S45635|S45635 lipid-transfer protein - maize
          Length = 94

 Score = 33.1 bits (74), Expect = 5.3
 Identities = 20/70 (28%), Positives = 28/70 (40%), Gaps = 8/70 (11%)
 Frame = +3

Query: 183 LVPCAEYLNS--TKPPASCCDPLKE------TVTKELSCLCNLYKNPEVLKSLGVNITQA 338
           + PC  Y     + P A CC  ++       T   +    CN  KN     S G+N   A
Sbjct: 11  IAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADDRRAACNCLKNAAAGVS-GLNAGNA 69

Query: 339 LELPKHCGIS 368
             +P  CG+S
Sbjct: 70  ASIPSKCGVS 79



>pir|JH0379|JH0379 phospholipid transfer protein 6B6 - maize
           (fragment)
          Length = 99

 Score = 33.1 bits (74), Expect = 5.3
 Identities = 20/69 (28%), Positives = 28/69 (40%), Gaps = 7/69 (10%)
 Frame = +3

Query: 183 LVPCAEYLNS--TKPPASCCDPLKET-----VTKELSCLCNLYKNPEVLKSLGVNITQAL 341
           + PC  Y     + P A CC  ++        T +    CN  KN     S G+N   A 
Sbjct: 9   IAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS-GLNAGNAA 67

Query: 342 ELPKHCGIS 368
            +P  CG+S
Sbjct: 68  SIPSKCGVS 76



>sp|Q9M5X8|NLTP_PRUAV Nonspecific lipid-transfer protein precursor
           (LTP) (Allergen Pru av 3).>gb:AF221501_1778324 Prunus
           avium lipid transfer protein precursor, mRNA, complete
           cds.
          Length = 117

 Score = 33.1 bits (74), Expect = 5.3
 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 9/72 (12%)
 Frame = +3

Query: 180 NLVPCAEYLNS--TKPPASCCDPL-------KETVTKELSCLCNLYKNPEVLKSLGVNIT 332
           NL PC  Y+      PPA CC+ +       K T  ++ +C C    +  V    GVN  
Sbjct: 35  NLAPCIAYVRGGGAVPPA-CCNGIRNINNLAKTTADRQTACNCLKQLSASVP---GVNAN 90

Query: 333 QALELPKHCGIS 368
            A  LP  CG++
Sbjct: 91  NAAALPGKCGVN 102



>sp|P19656|NLTP_MAIZE Nonspecific lipid-transfer protein precursor
           (LTP) (Phospholipid transfer protein) (PLTP) (Allergen
           Zea m 14).>pir|A31779|A31779 phospholipid transfer
           protein 9C2 precursor - maize>gb:MZEPLTP_1688014 Maize
           phospholipid transfer protein mRNA, complete cds. of
           clone 9C2.
          Length = 120

 Score = 33.1 bits (74), Expect = 5.3
 Identities = 20/69 (28%), Positives = 28/69 (40%), Gaps = 7/69 (10%)
 Frame = +3

Query: 183 LVPCAEYLNS--TKPPASCCDPLKET-----VTKELSCLCNLYKNPEVLKSLGVNITQAL 341
           + PC  Y     + P A CC  ++        T +    CN  KN     S G+N   A 
Sbjct: 38  IAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS-GLNAGNAA 96

Query: 342 ELPKHCGIS 368
            +P  CG+S
Sbjct: 97  SIPSKCGVS 105



>gb:HUMASPA_2029411 Homo sapiens agouti signalling protein (ASP)
           gene, complete cds.
          Length = 132

 Score = 32.3 bits (72), Expect = 9.1
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = +3

Query: 189 PCAEYLNSTKPPA-SCCDPLKETVTKELSCLCNLYKNPEVLKSLGVN 326
           PC    NS KPPA +CCDP         SC C  +++    + L +N
Sbjct: 92  PCVATRNSCKPPAPACCDPC-------ASCQCRFFRSACSCRVLSLN 131



>gb:AY621631_1618370 Nicotiana glauca lipid transfer protein (LTP3)
           mRNA, complete cds.
          Length = 117

 Score = 32.3 bits (72), Expect = 9.1
 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 6/69 (8%)
 Frame = +3

Query: 180 NLVPCAEYLNSTKP-PASCCDPLKE-----TVTKELSCLCNLYKNPEVLKSLGVNITQAL 341
           +L PC  Y+      PA CC+ ++      T T +    CN  K+       G+N + A 
Sbjct: 35  SLTPCISYVTKGGAIPAPCCNGIESLNNQATSTPDRQTACNCIKSAAA-SIKGINFSLAG 93

Query: 342 ELPKHCGIS 368
            LP  CG++
Sbjct: 94  SLPGKCGVN 102



>gb:AY572516_1615722 Malus x domestica clone Mal d 3.01-PS2 lipid
           transfer protein precursor (Mal d 3.01) gene, Mal d
           3.0102a allele, complete cds.
          Length = 115

 Score = 32.3 bits (72), Expect = 9.1
 Identities = 22/69 (31%), Positives = 31/69 (44%), Gaps = 6/69 (8%)
 Frame = +3

Query: 180 NLVPCAEYL-NSTKPPASCCDPLKET-----VTKELSCLCNLYKNPEVLKSLGVNITQAL 341
           +L PC  Y+ N    P +CC+ ++        T +    CN  KN     S GVN   A 
Sbjct: 33  SLAPCIGYVRNGGAVPPACCNGIRTINSLARTTADRQTACNCLKNLAGSIS-GVNPNNAA 91

Query: 342 ELPKHCGIS 368
            LP  CG++
Sbjct: 92  GLPGKCGVN 100



>gb:AE016959_1021404 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC104322_1737570
           Oryza sativa chromosome 10 BAC OSJNBb0005F01 genomic
           sequence, complete sequence.>gb:AE017068_1751223 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           22 of 77 of the complete sequence.
          Length = 193

 Score = 32.3 bits (72), Expect = 9.1
 Identities = 11/38 (28%), Positives = 21/38 (55%)
 Frame = +3

Query: 180 NLVPCAEYLNSTKPPASCCDPLKETVTKELSCLCNLYK 293
           +L+PCA   + +     CCD L +    + +CLC +++
Sbjct: 48  DLMPCASVYDDSSMLGPCCDALGKVFKSDRACLCQIWE 85



>pir|T02042|T02042 lipid transfer protein LPT II -
           rice>gb:AF017359_1761541 Oryza sativa lipid transfer
           protein LPT II mRNA, complete cds.
          Length = 118

 Score = 32.3 bits (72), Expect = 9.1
 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 7/67 (10%)
 Frame = +3

Query: 189 PCAEY-LNSTKPPASCCDPLKE-----TVTKELSCLCNLYKNPEVLKSL-GVNITQALEL 347
           PC  Y    + P A+CC  ++      + T +    CN  KN  V  S+ G+N   A  +
Sbjct: 39  PCLSYPRGGSGPSAACCSGVRNLNSAASTTADRRTACNCLKN--VAGSISGLNAGNAASI 96

Query: 348 PKHCGIS 368
           P  CG+S
Sbjct: 97  PSKCGVS 103



>sp|Q42616|NLT3_BRANA Nonspecific lipid-transfer protein 3 precursor
           (LTP 3).>pir|T07866|T07866 germination-specific lipid
           transfer protein 3 - rape>gb:BNU22175_1633672 Brassica
           napus germination-specific lipid transfer protein 3
           mRNA, complete cds.
          Length = 117

 Score = 32.3 bits (72), Expect = 9.1
 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 8/71 (11%)
 Frame = +3

Query: 180 NLVPCAEYLNSTKP-PASCCDPL-------KETVTKELSCLCNLYKNPEVLKSLGVNITQ 335
           NL  C  YL    P P +CC  +       + T  ++ +C C L      L +  +N+ +
Sbjct: 35  NLAACIGYLTQNGPVPTACCSGVTSLNNMARTTPDRQQACRC-LVGAANALPT--INVAR 91

Query: 336 ALELPKHCGIS 368
           A  LPK CG++
Sbjct: 92  AAGLPKACGVN 102



>sp|Q03461|NLT2_TOBAC Nonspecific lipid-transfer protein 2 precursor
           (LTP 2).>pir|S29227|S29227 lipid transfer protein -
           common tobacco>gb:TOBLTP_1725446 Nicotiana tabacum mRNA
           for lipid transfer protein, complete cds.
          Length = 114

 Score = 32.3 bits (72), Expect = 9.1
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 7/69 (10%)
 Frame = +3

Query: 183 LVPCAEYLNSTKPPASCCDPLKETV-------TKELSCLCNLYKNPEVLKSLGVNITQAL 341
           L PC  YL    P  SCC  +K  +        ++ +C C L      +K  G+++ +A 
Sbjct: 34  LAPCLPYLQGRGPLGSCCGGVKGLLGAAKSLSDRKTACTC-LKSAANAIK--GIDMGKAA 90

Query: 342 ELPKHCGIS 368
            LP  CG++
Sbjct: 91  GLPGACGVN 99



>sp|Q43194|NLT2_SORBI Nonspecific lipid-transfer protein 2 precursor
           (LTP 2).>pir|S33461|S33461 lipid transfer protein -
           sorghum>gb:SVLTP2_1723248 S.vulgare ltp2 gene.
          Length = 122

 Score = 32.3 bits (72), Expect = 9.1
 Identities = 19/67 (28%), Positives = 28/67 (41%), Gaps = 7/67 (10%)
 Frame = +3

Query: 189 PCAEYLNS--TKPPASCCDPLKET-----VTKELSCLCNLYKNPEVLKSLGVNITQALEL 347
           PC  Y     + P A CC  ++        T +    CN  KN       G+N+ +A  +
Sbjct: 42  PCLSYARGQGSGPSAGCCSGVRSLNSAARTTADRRAACNCLKNA-ARGIRGLNVGKAASI 100

Query: 348 PKHCGIS 368
           P  CG+S
Sbjct: 101 PSKCGVS 107



>sp|P42127|AGSW_HUMAN Agouti switch protein precursor (Agouti
           signaling protein).>pir|I37143|I37143 agouti protein
           precursor - human>gb:HS785G19_1999498 Human DNA sequence
           from clone RP4-785G19 on chromosome 20q11.1-11.23
           Contains the XPOTP1 gene for exportin tRNA (nuclear
           export receptor for tRNAs) pseudogene 1, a UTRN
           (utrophin (homologous to dystrophin)) pseudogene, the
           ASIP gene for agouti (mouse)-signaling protein, the 3'
           end of AHCY gene for S-adenosylhomocysteine hydrolase
           and three CpG islands, complete
           sequence.>gb:HSAGOTI3_2010160 Homo sapiens agouti gene,
           exon 3 and complete cds.
          Length = 132

 Score = 32.3 bits (72), Expect = 9.1
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = +3

Query: 189 PCAEYLNSTKPPA-SCCDPLKETVTKELSCLCNLYKNPEVLKSLGVN 326
           PC    NS KPPA +CCDP         SC C  +++    + L +N
Sbjct: 92  PCVATRNSCKPPAPACCDPC-------ASCQCRFFRSACSCRVLSLN 131


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 576,053,106
Number of Sequences: 1806583
Number of extensions: 9616446
Number of successful extensions: 26840
Number of sequences better than 10.0: 139
Number of HSP's better than 10.0 without gapping: 26272
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26790
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 44688536136
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)