BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig898
         (828 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|E96786|E96786 protein F10A5.13 [imported] - Arabidopsis thal...   214   2e-59   Arabidopsis thaliana [mouse-ear cress]
gb:AY086475_1571523 Arabidopsis thaliana clone 253404 mRNA, comp...   213   3e-59   
gb:AP005092_1847664 Oryza sativa (japonica cultivar-group) genom...   209   2e-58   
pir|G86332|G86332 F6F9.1 protein - Arabidopsis thaliana>gb:AE005...   196   6e-53   Arabidopsis thaliana [mouse-ear cress]
gb:T20H2_1723724 Sequence of BAC T20H2 from Arabidopsis thaliana...   196   6e-53   
gb:AP003614_1831406 Oryza sativa (japonica cultivar-group) genom...   186   2e-50   
pir|T01583|T01583 cellulase (EC 3.2.1.4) At2g44560 - Arabidopsis...   137   7e-35   Arabidopsis thaliana [mouse-ear cress]
gb:AF098292_1767912 Lycopersicon esculentum endo-beta-1,4-D-gluc...   135   4e-34   
gb:AF362949_1791510 Nicotiana tabacum endo-beta-1,4-glucanase pr...   133   7e-34   
pir|T02410|T02410 cellulase (EC 3.2.1.4) At2g44540 - Arabidopsis...   135   7e-34   Arabidopsis thaliana [mouse-ear cress]
pir|T01584|T01584 cellulase (EC 3.2.1.4) F16B22.6 - Arabidopsis ...   135   1e-33   Arabidopsis thaliana [mouse-ear cress]
pir|T02411|T02411 cellulase (EC 3.2.1.4) F4I1.37 - Arabidopsis t...   134   1e-33   Arabidopsis thaliana [mouse-ear cress]
gb:AB084464_1524342 Pyrus communis PC-EG2 mRNA for endo-1,4-beta...   132   3e-33   
pir|T46610|T46610 cellulase (EC 3.2.1.4) 2 precursor - Monterey ...   131   6e-33   Pinus radiata
gb:AP002094_1822032 Oryza sativa (japonica cultivar-group) genom...   132   1e-32   
gb:AP005412_1851378 Oryza sativa (japonica cultivar-group) genom...   129   1e-32   
gb:AP002094_1822030 Oryza sativa (japonica cultivar-group) genom...   131   2e-32   
gb:AC135914_1742790 Oryza sativa (japonica cultivar-group) chrom...   130   2e-32   
gb:AF128404_1770602 Nicotiana alata cellulase homolog mRNA, comp...   133   4e-32   
gb:AF054615_1764554 Fragaria x ananassa cellulase (Cel2) mRNA, c...   129   5e-32   
gb:FRX414708_1679256 Fragaria x ananassa faEG3 gene for endo-bet...   129   5e-32   
gb:FAN6349_1678786 Fragaria x ananassa mRNA for endo-beta-1,4-gl...   129   5e-32   
sp|P26221|GUN4_THEFU|GUN4_THEFU Endoglucanase E-4 precursor (EC 3.2.1.4) (E...   139   5e-32   Thermobifida fusca
gb:BT000696_1634971 Arabidopsis thaliana clone RAFL07-09-J02 (R1...   129   1e-31   
pir|A96668|A96668 probable endo-beta-1,4-glucanase F15H21.9 [imp...   129   1e-31   Arabidopsis thaliana [mouse-ear cress]
pir|T01108|T01108 cellulase (EC 3.2.1.4) T21L14.7 - Arabidopsis ...   125   4e-31   Arabidopsis thaliana [mouse-ear cress]
pir|B42360|B42360 cellulase (EC 3.2.1.4) E4 precursor - Thermomo...   135   7e-31   Thermobifida fusca
gb:AB032830_1518745 Pisum sativum EGL2 mRNA for endo-1,4-beta-gl...   126   9e-31   
pir|JC7226|JC7226 endo-1,3(4)-beta-glucanase (EC 3.2.1.6) - gard...   126   9e-31   Pisum sativum [garden pea]
gb:AF362947_1791508 Nicotiana tabacum endo-beta-1,4-glucanase pr...   126   2e-30   
sp|P05522|GUN1_PERAE|GUN1_PERAE Endoglucanase 1 precursor (EC 3.2.1.4) (End...   127   3e-30   Persea americana
gb:AY133685_1581505 Arabidopsis thaliana clone C103115 putative ...   125   3e-30   
pir|T01929|T01929 probable cellulase (EC 3.2.1.4) F2P3.1 - Arabi...   125   3e-30   Arabidopsis thaliana [mouse-ear cress]
pir|T04021|T04021 cellulase (EC 3.2.1.4) F17A8.90 - Arabidopsis ...   124   3e-30   Arabidopsis thaliana [mouse-ear cress]
gb:POPCEL_1700994 Populus alba mRNA for cellulase (endo-1,4-beta...   127   6e-30   
gb:AB025796_1516794 Populus alba POPCEL2 mRNA for endo-1,4-beta ...   126   6e-30   
pir|T05588|T05588 cellulase (EC 3.2.1.4) F9D16.30 - Arabidopsis ...   121   6e-30   Arabidopsis thaliana [mouse-ear cress]
gb:AP005112_1848055 Oryza sativa (japonica cultivar-group) genom...   122   7e-30   
gb:AP005682_1855931 Oryza sativa (japonica cultivar-group) genom...   122   7e-30   
gb:MDA511339_1389472 Mastotermes darwinensis mRNA for beta-1,4-e...   124   7e-30   
gb:AP004689_1843447 Oryza sativa (japonica cultivar-group) genom...   122   1e-29   
gb:AP004846_1845880 Oryza sativa (japonica cultivar-group) genom...   123   1e-29   
gb:MDA511341_1389474 Mastotermes darwinensis mRNA for beta-1,4-e...   123   1e-29   
gb:MDA511340_1389473 Mastotermes darwinensis mRNA for beta-1,4-e...   123   1e-29   
pir|A86158|A86158 endo-1,4-beta glucanase [imported] - Arabidops...   125   2e-29   Arabidopsis thaliana [mouse-ear cress]
pir|T52135|T52135 cellulase (EC 3.2.1.4) [imported] - Arabidopsi...   125   2e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AY072099_1566993 Arabidopsis thaliana putative cellulase (At3...   124   2e-29   
pir|T47422|T47422 cellulase-like protein - Arabidopsis thaliana>...   124   2e-29   Arabidopsis thaliana [mouse-ear cress]
pir|T01419|T01419 cellulase (EC 3.2.1.4) T2H3.5 precursor - Arab...   122   2e-29   Arabidopsis thaliana [mouse-ear cress]
pir|T10734|T10734 cellulase (EC 3.2.1.4) 1 precursor - Monterey ...   121   2e-29   Pinus radiata
gb:AB049199_1520788 Populus alba PopCel1 gene for endo-1,4-beta ...   125   2e-29   
gb:SNCELLUMR_1715553 S.nigra mRNA for cellulase.                      121   3e-29   
pir|S46500|S46500 cellulase (EC 3.2.1.4) - European elder (fragm...   121   3e-29   Sambucus nigra
gb:PPPCEL1_1701412 P.persica mRNA for endo-beta-1,4-glucanase, p...   124   3e-29   
gb:AB055886_1521610 Atriplex lentiformis Al-cel1 mRNA for beta-1...   124   3e-29   
gb:AF220596_1252369 Panesthia cribrata beta-1,4-endoglucanase 1 ...   122   3e-29   
gb:MDA511343_1389476 Mastotermes darwinensis mRNA for beta-1,4-e...   122   4e-29   
gb:AP005319_1850531 Oryza sativa (japonica cultivar-group) genom...   122   5e-29   
pir|T07883|T07883 cellulase (EC 3.2.1.4) - sweet orange>gb:AF000...   124   5e-29   Citrus sinensis [apfelsine]
gb:AY781897_1628327 Saccharum hybrid cultivar isolate c3 cellula...   129   5e-29   
gb:MDA511342_1389475 Mastotermes darwinensis mRNA for beta-1,4-e...   121   6e-29   
gb:AP003722_1832402 Oryza sativa (japonica cultivar-group) genom...   120   8e-29   
pir|T07025|T07025 cellulase (EC 3.2.1.4) - tomato>gb:LEE14BDGL_1...   129   9e-29   Solanum lycopersicum
gb:OSJN00293_1698078 Oryza sativa genomic DNA, chromosome 4, BAC...   118   1e-28   
gb:CAN010950_1645055 Capsicum annuum eg2 gene.                        122   1e-28   
gb:CACCEL2_1644854 Capsicum annuum mRNA for endo-beta-1,4-glucan...   122   1e-28   
gb:AF077339_1766215 Lycopersicon esculentum endo-1,4-beta-glucan...   121   2e-28   
gb:AF051346_1764244 Fragaria x ananassa cellulase (Cel1) mRNA, c...   121   2e-28   
pir|T07885|T07885 cellulase (EC 3.2.1.4) - sweet orange>gb:AF000...   116   3e-28   Citrus sinensis [apfelsine]
gb:AB058671_1196903 Coptotermes formosanus CfEG4 mRNA for endo-b...   117   3e-28   
gb:AB058670_1196902 Coptotermes formosanus CfEG3 mRNA for endo-b...   117   3e-28   
gb:AB058669_1196901 Coptotermes formosanus CfEG2 mRNA for endo-b...   117   3e-28   
gb:AB058667_1196899 Coptotermes formosanus CfEG1a mRNA for endo-...   117   3e-28   
gb:AJ585346_526235 Clostridium thermocellum celR gene for beta-1...   126   4e-28   
gb:CSCELZ_119220 C.stercorarium celZ gene for endo-beta-1,4-gluc...   126   4e-28   
sp|P23659|GUNZ_CLOSR|GUNZ_CLOSR Endoglucanase Z precursor (EC 3.2.1.4) (End...   126   4e-28   Thermoclostridium stercorarium
gb:ATU17888_1556786 Arabidopsis thaliana beta-glucanase mRNA, pa...   115   5e-28   
pir|S61430|S61430 cellulase (EC 3.2.1.4) - Arabidopsis thaliana ...   115   5e-28   Arabidopsis thaliana [mouse-ear cress]
gb:GMU34755_1680649 Glycine max cellulase gene, partial cds.          116   5e-28   
pir|T06591|T06591 cellulase (EC 3.2.1.4) R10 - soybean (fragment)     116   5e-28   Glycine max [soybeans]
gb:BSP133614_750786 Bacillus sp. BP23 celB gene.                      126   6e-28   
pir|G86362|G86362 beta-glucanase [imported] - Arabidopsis thalia...   117   7e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AY086043_1571104 Arabidopsis thaliana clone 20797 mRNA, compl...   115   7e-28   
gb:AC016163_1538128 Arabidopsis thaliana chromosome 1 BAC F26A9 ...   115   7e-28   
gb:AF336120_1263677 Coptotermes acinaciformis cellulase mRNA, co...   116   7e-28   
gb:AF078038S5_476986 Caldicellulosiruptor sp. Tok7B.1 glycosyl h...   125   1e-27   
sp|P26224|GUNF_CLOTM|GUNF_CLOTM Endoglucanase F precursor (EC 3.2.1.4) (EGF...   125   1e-27   Hungateiclostridium thermocellum
pir|E86366|E86366 protein F26F24.6 [imported] - Arabidopsis thal...   120   1e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AF220597_1252370 Panesthia cribrata beta-1,4-endoglucanase 2 ...   119   1e-27   
gb:AY339624_611177 Bacillus pumilus endoglucanase A precursor (E...   124   2e-27   
pir|B96527|B96527 protein F27J15.28 [imported] - Arabidopsis tha...   116   2e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AF357596_1790806 Fragaria x ananassa endo-1,4-beta-glucanase ...   118   2e-27   
gb:AF357595_1790805 Fragaria x ananassa endo-1,4-beta-glucanase ...   118   2e-27   
gb:AF357591_1790801 Fragaria x ananassa endo-1,4-beta-glucanase ...   118   2e-27   
gb:AF357588_1790798 Fragaria x ananassa endo-1,4-beta-glucanase ...   118   2e-27   
gb:AF357587_1790797 Fragaria x ananassa endo-1,4-beta-glucanase ...   118   2e-27   
gb:AF074923_1766126 Fragaria x ananassa endo-1,4-beta-glucanase ...   118   2e-27   
gb:FAN6348_1678785 Fragaria x ananassa mRNA for endo-beta-1,4-gl...   118   2e-27   
gb:AY350734_1601660 Malus x domestica endo-1,4-beta-glucanase mR...   114   2e-27   
gb:AY660968_1620404 Populus tremula x Populus tremuloides Cel9B ...   115   2e-27   
gb:AF357590_1790800 Fragaria x ananassa endo-1,4-beta-glucanase ...   117   2e-27   
gb:CACCEL3_1644855 Capsicum annuum mRNA for endo-beta-1,4-glucan...   117   2e-27   
pir|S57808|S57808 cellulase (EC 3.2.1.4) precursor - tomato>gb:S...   115   3e-27   Solanum lycopersicum
gb:AF041405_1763460 Fragaria x ananassa putative cellulase mRNA,...   118   3e-27   
gb:AF148497_1245134 Cherax quadricarinatus beta 1,4-endoglucanas...   115   3e-27   
gb:AY176645_1306834 Cherax quadricarinatus cellulase GHF9 (EG) g...   115   3e-27   
gb:AB013273_1193450 Nasutitermes walkeri mRNA for NwEG, complete...   115   4e-27   
gb:AP004885_1846620 Oryza sativa (japonica cultivar-group) genom...   116   5e-27   
gb:AF357589_1790799 Fragaria x ananassa endo-1,4-beta-glucanase ...   116   5e-27   
gb:AY445620_618147 Bacillus licheniformis strain GXN151 cellulas...   122   6e-27   
gb:AF206716_488401 Bacillus pumilus endoglucanase gene, complete...   122   6e-27   
gb:AE017333_447737 Bacillus licheniformis DSM 13, complete genom...   122   6e-27   
pir|I40807|I40807 cellulase (EC 3.2.1.4) engC - Clostridium cell...   122   6e-27   Clostridium cellulovorans
sp|P26225|GUNB_CELFI|GUNB_CELFI Endoglucanase B precursor (EC 3.2.1.4) (End...   122   6e-27   Cellulomonas fimi
sp|P28622|GUN4_BACS5|GUN4_BACS5 Endoglucanase 4 precursor (EC 3.2.1.4) (End...   122   6e-27   Bacillus sp. (in: Bacteria)
gb:AB013272_1193449 Nasutitermes takasagoensis mRNA for endo-b-1...   114   7e-27   
gb:AB019095_1193812 Reticulitermes speratus mRNA for Endoglucana...   112   1e-26   
gb:AB008778_1193141 Reticulitermes speratus RsEG mRNA for saliva...   112   1e-26   
gb:AY572862_1178679 Reticulitermes flavipes endogenous cellulase...   112   1e-26   
gb:CTH275974_119538 Clostridium thermocellum ORF1 (partial), cel...   121   1e-26   
sp|Q02934|GUNI_CLOTM|GUNI_CLOTM Endoglucanase I precursor (EC 3.2.1.4) (EGI...   121   1e-26   Hungateiclostridium thermocellum
gb:AP005619_1855021 Oryza sativa (japonica cultivar-group) genom...   114   2e-26   
sp|P22503|GUN_PHAVU|GUN_PHAVU Endoglucanase precursor (EC 3.2.1.4) (Endo-1...   112   2e-26   Phaseolus vulgaris [French bean]
gb:ATX98544_1557455 A.thaliana mRNA for endo-1,4-beta-glucanase.      121   2e-26   
pir|E96731|E96731 endo-1,4-beta-glucanase, 41628-45234 [imported...   121   2e-26   Arabidopsis thaliana [mouse-ear cress]
gb:PVU34754_1703013 Phaseolus vulgaris cellulase gene, complete ...   112   2e-26   
pir|F97012|F97012 hypothetical protein CAC0913 [imported] - Clos...   120   2e-26   Clostridium acetobutylicum
pir|T06350|T06350 cellulase (EC 3.2.1.4) Cel2 precursor - tomato...   112   3e-26   Solanum lycopersicum
gb:AP004463_1841398 Oryza sativa (japonica cultivar-group) genom...   109   3e-26   
gb:AF362948_1791509 Nicotiana tabacum endo-beta-1,4-glucanase pr...   114   3e-26   
gb:ATZ86105_583506 A.thermophilum celA gene and manA pseudogene.      120   4e-26   
pir|T31337|T31337 1,4-beta-glucanase (EC 3.2.1.-) - Anaerocellum...   120   4e-26   Caldicellulosiruptor bescii
gb:AP006453_1861899 Oryza sativa (japonica cultivar-group) genom...   109   4e-26   
gb:ATX98543_1557454 A.thaliana endo-1,4-beta-glucanase gene.          119   7e-26   
gb:AP005657_1855604 Oryza sativa (japonica cultivar-group) genom...   110   8e-26   
gb:OSJN00002_1693088 Oryza sativa genomic DNA, chromosome 4, BAC...   115   1e-25   
gb:AY205300_1589136 Lilium longiflorum endo-1,4-beta-glucanase (...   109   1e-25   
pir|T06770|T06770 cellulase (EC 3.2.1.4) precursor - garden pea>...   110   1e-25   Pisum sativum [garden pea]
sp|P22534|GUNA_CALSA|GUNA_CALSA Endoglucanase A precursor (EC 3.2.1.4) (End...   118   2e-25   Caldicellulosiruptor saccharolyticus
gb:AC084414_1733641 Arabidopsis thaliana chromosome 1 BAC F27K7 ...   109   2e-25   
gb:AF180561_486131 Myxobacter sp. AL-1 thermophilic extracellula...   117   3e-25   
pir|T06348|T06348 cellulase (EC 3.2.1.4) Cel1 precursor - tomato...   117   3e-25   Solanum lycopersicum
gb:CCU34793_845663 Clostridium cellulovorans exoglucanase S (exg...   116   4e-25   
gb:CACCEL1_1644853 C.annuum mRNA for endo-beta-1,4-glucanase, cc...   115   8e-25   
pir|S57663|S57663 cellulase (EC 3.2.1.4) 3D precursor - pepper>g...   115   8e-25   Capsicum annuum
gb:AY059825_1564669 Arabidopsis thaliana putative endo-1, 4-beta...   105   3e-24   
pir|T06061|T06061 cellulase (EC 3.2.1.4) F19H22.110 - Arabidopsi...   105   3e-24   Arabidopsis thaliana [mouse-ear cress]
gb:AB118800_1200830 Odontotermes formosanus OfEG1 mRNA for putat...   102   4e-24   
gb:AY094488_1575780 Phanerochaete chrysosporium family 9 glycosy...   112   6e-24   
gb:AB118802_1200832 Odontotermes formosanus OfEG3 mRNA for putat...   100   1e-23   
gb:AB118804_1200834 Sinocapritermes mushae SmEG1 mRNA for putati...   103   1e-23   
gb:AB118801_1200831 Odontotermes formosanus OfEG2 mRNA for putat...   100   1e-23   
gb:AY651250_1344147 Biomphalaria glabrata beta-1,4-endoglucanase...   110   2e-23   
gb:AY449462_1327414 Oikopleura dioica clone BACOIKO006 3xn11, co...   110   2e-23   
gb:AB118798_1200828 Neotermes koshunensis NkEG2 mRNA for putativ...   101   2e-23   
sp|P37700|GUNG_CLOCE|GUNG_CLOCE Endoglucanase G precursor (EC 3.2.1.4) (End...   110   3e-23   Ruminiclostridium cellulolyticum
gb:AB118806_1200836 Sinocapritermes mushae SmEG3 mRNA for putati...   102   3e-23   
gb:AB118805_1200835 Sinocapritermes mushae SmEG2 mRNA for putati...   101   6e-23   
gb:AB118796_1200826 Hodotermopsis sjoestedti HsEG4 mRNA for puta...   101   7e-23   
gb:AB118794_1200824 Hodotermopsis sjoestedti HsEG2 mRNA for puta...   101   7e-23   
gb:AF132735_481976 Clostridium cellulovorans endoglucanase K (en...   108   9e-23   
gb:BNA242807_1633273 Brassica napus Cel16 gene for endo-1,4-beta...    99   1e-22   
gb:BT002221_1635824 Arabidopsis thaliana At5g49720/K2I5_8 mRNA, ...    99   2e-22   
gb:AY086165_1571221 Arabidopsis thaliana clone 21922 mRNA, compl...    99   2e-22   
gb:AY037218_1560112 Arabidopsis thaliana AT5g49720/K2I5_8 mRNA, ...    99   2e-22   
pir|S71215|S71215 cellulase (EC 3.2.1.4) KOR, membrane-anchored ...    99   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AB118797_1200827 Neotermes koshunensis NkEG1 mRNA for putativ...    98   2e-22   
gb:AB118803_1200833 Nasutitermes takasagoensis NtEG2 mRNA for pu...   100   2e-22   
gb:AB118795_1200825 Hodotermopsis sjoestedti HsEG3 mRNA for puta...    98   8e-22   
gb:AB118662_1200798 Hodotermopsis sjoestedti mRNA for putative e...    98   8e-22   
gb:FXA223387_1679530 Fragaria x ananassa partial mRNA for endo-b...    95   8e-22   
gb:AE017348_1758419 Cryptococcus neoformans var. neoformans JEC2...   105   1e-21   
pir|B96681|B96681 F5I14.14 protein [imported] - Arabidopsis thal...    96   2e-21   Arabidopsis thaliana [mouse-ear cress]
pir|T06059|T06059 cellulase (EC 3.2.1.4) F19H22.90 - Arabidopsis...    97   2e-21   Arabidopsis thaliana [mouse-ear cress]
gb:AF316823_499255 Clostridium cellulolyticum cellulase gene clu...   104   2e-21   
gb:AB162804_1201928 Haliotis discus discus celhdd mRNA for cellu...   101   4e-21   
gb:AB125892_1201207 Haliotis discus hannai Hdcel gene for cellul...   101   4e-21   
gb:AB092978_1198905 Haliotis discus hdcel-1 mRNA for cellulase, ...   101   4e-21   
gb:MIN505608_1686348 Mangifera indica partial mRNA for putative ...    91   8e-21   
gb:AF220594_1252367 Mastotermes darwiniensis beta-1,4-glucanase ...    94   1e-20   
gb:AF155197_483997 Acetivibrio cellulolyticus cellulosomal scaff...   101   1e-20   
pir|T06060|T06060 cellulase (EC 3.2.1.4) F19H22.100 - Arabidopsi...    95   2e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AF220593_1252366 Mastotermes darwiniensis beta-1,4-glucanase ...    92   3e-20   
gb:MIN505607_1686347 Mangifera indica partial mRNA for putative ...   100   3e-20   
pir|T07612|T07612 cellulase (EC 3.2.1.4) Cel3, membrane-anchored...    93   4e-20   Solanum lycopersicum
gb:AF220592_1252365 Hodotermopsis japonica beta-1,4-glucanase (E...    92   5e-20   
sp|P22699|GUN6_DICDI|GUN6_DICDI Endoglucanase precursor (EC 3.2.1.4) (Endo-...    95   9e-20   Dictyostelium discoideum
gb:AB040769_1519643 Hordeum vulgare mRNA for endo-1,4-beta-gluca...    93   1e-19   
gb:AY574906_1615878 Gossypium hirsutum membrane-anchored endo-1,...    94   1e-19   
gb:AY253447_1592991 Gossypium hirsutum endo-1,4-beta-glucanase m...    94   1e-19   
gb:AY387483_1604279 Oryza sativa (japonica cultivar-group) BAC O...    91   1e-19   
gb:AK117850_1815860 Arabidopsis thaliana At4g39000 mRNA for puta...    92   1e-19   
gb:AB084463_1524341 Pyrus communis PC-EG1 mRNA for endo-1,4-beta...    91   2e-19   
pir|T09889|T09889 cellulase homolog T22A6.90 - Arabidopsis thali...    94   2e-19   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00052_1693942 Oryza sativa genomic DNA, chromosome 4, BAC...    91   2e-19   
gb:AF459453_1801722 Piromyces sp. E2 cellulase Cel9A precursor (...    97   5e-19   
gb:AF459452_1801721 Piromyces sp. E2 cellulase Cel9A precursor (...    97   5e-19   
gb:CTH275974_119541 Clostridium thermocellum ORF1 (partial), cel...    97   5e-19   
gb:AB072270_9573 Eubacterium cellulosolvens cbpe1 gene for cellu...    97   5e-19   
gb:AF500793_1806441 Piromyces sp. E2 cellulosomal glycoside hydr...    96   6e-19   
gb:AF220591_1252364 Neotermes koshunensis beta-1,4-glucanase (EG...    86   7e-19   
pir|S75712|S75712 cellulase (EC 3.2.1.4) - Synechocystis sp. (st...    93   1e-18   Synechocystis sp. PCC 6803
gb:AF316823_499258 Clostridium cellulolyticum cellulase gene clu...    95   2e-18   
gb:AF220590_1252363 Cryptocercus clevelandi beta-1,4-glucanase 1...    86   2e-18   
gb:AF220595_1252368 Blattella germanica beta-1,4-glucanase (EG) ...    85   5e-18   
gb:AY308955_1597859 Medicago truncatula cellulase mRNA, complete...    93   5e-18   
gb:AY660967_1620403 Populus tremula x Populus tremuloides Cel9A ...    85   8e-18   
gb:AF220583_1252356 Polyphaga aegyptiaca beta-1,4-glucanase 3 (E...    89   1e-17   
gb:AF220587_1252360 Periplaneta americana beta-1,4-glucanase 2 (...    82   1e-17   
gb:AY535003_1612308 Populus tremuloides endo-1,4-beta-glucanase ...    84   1e-17   
gb:AF220585_1252358 Polyphaga aegyptiaca beta-1,4-glucanase 2 (E...    84   2e-17   
gb:D83704_120517 Clostridium thermocellum DNA for endoglucanase,...    91   2e-17   
gb:AB047845_7211 Clostridium thermocellum celQ gene for endogluc...    91   2e-17   
gb:AF220589_1252362 Cryptocercus clevelandi beta-1,4-glucanase 2...    84   2e-17   
gb:AY091512_1574658 Triticum aestivum endo-1,4-beta-glucanase mR...    85   3e-17   
gb:TAE577371_1724478 Triticum aestivum partial mRNA for putative...    82   3e-17   
gb:AF220586_1252359 Periplaneta americana beta-1,4-glucanase 1 (...    82   4e-17   
pir|B97013|B97013 and cellulose-binding endoglucanase family 9, ...    90   5e-17   Clostridium acetobutylicum
gb:AF220584_1252357 Polyphaga aegyptiaca beta-1,4-glucanase 1 (E...    84   6e-17   
gb:AF220588_1252361 Cryptocercus clevelandi beta-1,4-glucanase 3...    80   1e-16   
pir|A97013|A97013 hypothetical protein CAC0916 [imported] - Clos...    86   1e-15   Clostridium acetobutylicum
gb:FXA223386_1679529 Fragaria x ananassa partial mRNA for endo-b...    78   2e-15   
gb:CACCX3_1644860 C.annuum mRNA for endo-1,4-beta-glucanase (ccx...    77   3e-15   
pir|S61447|S61447 cellulase (EC 3.2.1.4) CX3 - pepper (fragment)       77   3e-15   Capsicum annuum var. annuum [chilli pepper]
gb:LES505749_1684606 Lycopersicon esculentum partial mRNA for pu...    72   3e-14   
gb:AK095918_1914460 Homo sapiens cDNA FLJ38599 fis, clone HEART2...    78   2e-13   
gb:AF077340_1766216 Lycopersicon esculentum endo-1,4-beta-glucan...    76   7e-13   
gb:VREBGPA_1727341 V.radiata gene for endo-1,4-beta-glucanase (p...    71   2e-12   
pir|T10907|T10907 cellulase (EC 3.2.1.4) cel1 - mung bean (fragm...    71   2e-12   Vigna radiata var. radiata [golden gram]
gb:VREBGPB_1727342 V.radiata gene for endo-1,4-beta-glucanase (p...    74   3e-12   
pir|T10934|T10934 cellulase (EC 3.2.1.4) cel1 - mung bean (fragm...    74   3e-12   Vigna radiata var. radiata [golden gram]
gb:AF316823_499256 Clostridium cellulolyticum cellulase gene clu...    72   1e-11   
gb:VREBGPC_1727343 V.radiata gene for endo-1,4-beta-glucanase (p...    71   2e-11   
pir|T10936|T10936 cellulase (EC 3.2.1.4) cel1 - mung bean (fragm...    71   2e-11   Vigna radiata var. radiata [golden gram]
gb:AB044407_6780 Clostridium thermocellum celT gene for endogluc...    70   5e-11   
gb:VREBGPD_1727344 V.radiata gene for endo-1,4-beta-glucanase (p...    65   2e-09   
pir|T10937|T10937 cellulase (EC 3.2.1.4) cel1 - mung bean (fragm...    65   2e-09   Vigna radiata var. radiata [golden gram]
gb:AB028321_4597 Ruminococcus albus cel5D, cel9A genes for beta-...    57   6e-07   
gb:AB118799_1200829 Neotermes koshunensis NkEG3 mRNA for putativ...    39   6e-05   
gb:SLU59308_1715416 Stellaria longipes endo 1,4-glucanase (SLEG....    45   0.001   
gb:FSU05897_136258 Fibrobacter succinogenes S85 endoglucanase E ...    38   0.27    
gb:FIBE14B_136000 Fibrobacter succinogenes endo-1,4-beta-D-gluca...    38   0.27    
gb:FMU81184_136020 Fusobacterium mortiferum phospho-beta-glucosi...    37   0.35    
pir|A39416|A39416 endo-glucanase (EC 3.2.1.-) family E - Fibroba...    37   0.45    Fibrobacter succinogenes
sp|P23665|GUNA_FIBSU|GUNA_FIBSU Endoglucanase A precursor (EC 3.2.1.4) (End...    37   0.45    Fibrobacter succinogenes
gb:AE015942_320871 Clostridium tetani E88, section 7 of 10 of th...    35   1.3     
pir|T15153|T15153 hypothetical protein F35F10.2 - Caenorhabditis...    35   1.7     Caenorhabditis elegans [roundworm]
gb:AF002198_1230697 Caenorhabditis elegans cosmid F35F10, comple...    35   2.2     
gb:SCO939132_181249 Streptomyces coelicolor A3(2) complete genom...    35   2.2     
gb:FIBFSENDA_136007 F.succinogenes ORF 1 and endo-1,4-beta-gluca...    34   2.9     
gb:BX572606_803829 Rhodopseudomonas palustris CGA009 complete ge...    33   5.0     
gb:HSM801056_2017242 Homo sapiens mRNA; cDNA DKFZp434E192 (from ...    33   8.5     
gb:AB030243_1865952 Homo sapiens mRNA for BDG-29, complete cds.        33   8.5     
gb:AB011151_1864311 Homo sapiens mRNA for KIAA0579 protein, part...    33   8.5     
pir|T17291|T17291 hypothetical protein DKFZp434E192.1 - human (f...    33   8.5     Homo sapiens [man]
sp|Q64733|FXB2_MOUSE|FXB2_MOUSE Forkhead box protein B2 (Transcription fact...    33   8.5     Mus musculus [mouse]


>pir|E96786|E96786 protein F10A5.13 [imported] - Arabidopsis
           thaliana>gb:AE005173_895104 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC006434_1534216 Genomic sequence for
           Arabidopsis thaliana BAC F10A5, complete
           sequence.>gb:AY039938_1560449 Arabidopsis thaliana
           putative endo-beta-1,4-glucanase (At1g75680) mRNA,
           complete cds.>gb:AY150451_1585016 Arabidopsis thaliana
           putative endo-beta-1,4-glucanase (At1g75680) mRNA,
           complete cds.
          Length = 525

 Score =  214 bits (544), Expect(2) = 2e-59
 Identities = 109/183 (59%), Positives = 128/183 (69%), Gaps = 5/183 (2%)
 Frame = +1

Query: 223 MGDKSRSKGGWCGWLLXXXXXXXXXXXXXXLVK---KKHGG--GGSSEPDXXXXXXXXXX 387
           M +KS+S+G WCGW +               VK   KK G   GG   P           
Sbjct: 1   MEEKSKSRG-WCGWFIAIIVLASVILAVVYTVKLRTKKSGDDDGGGPVPGPPGAID---- 55

Query: 388 XTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
             +KY DALK+A+QFFD+QKSGKL +NKI WRGDSGLKDG   +LDLSKG+YDAGD +KF
Sbjct: 56  --KKYADALKLALQFFDIQKSGKLENNKIPWRGDSGLKDGSEDNLDLSKGLYDAGDHIKF 113

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD 747
           GFPMA+TATVL+W+ILEYGDQM  V QL+PAK SL+WITDYL+ AHP DNVLYIQVGDP 
Sbjct: 114 GFPMAFTATVLSWSILEYGDQMNAVNQLDPAKDSLRWITDYLIKAHPSDNVLYIQVGDPK 173

Query: 748 LDH 756
           +DH
Sbjct: 174 VDH 176



 Score = 38.5 bits (88), Expect(2) = 2e-59
 Identities = 14/22 (63%), Positives = 17/22 (77%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM E RPLT+I+   P
Sbjct: 178 CWERPEDMKEKRPLTKIDVDTP 199



>gb:AY086475_1571523 Arabidopsis thaliana clone 253404 mRNA,
           complete sequence.
          Length = 525

 Score =  213 bits (543), Expect(2) = 3e-59
 Identities = 109/183 (59%), Positives = 128/183 (69%), Gaps = 5/183 (2%)
 Frame = +1

Query: 223 MGDKSRSKGGWCGWLLXXXXXXXXXXXXXXLVK---KKHGG--GGSSEPDXXXXXXXXXX 387
           M +KS+S+G WCGW +               VK   KK G   GG   P           
Sbjct: 1   MEEKSKSRG-WCGWFIAIIVLASVILAVVYTVKLRTKKSGDDDGGCPVPGPPGAID---- 55

Query: 388 XTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
             +KY DALK+A+QFFD+QKSGKL +NKI WRGDSGLKDG   +LDLSKG+YDAGD +KF
Sbjct: 56  --KKYADALKLALQFFDIQKSGKLENNKIPWRGDSGLKDGSEDNLDLSKGLYDAGDHIKF 113

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD 747
           GFPMA+TATVL+W+ILEYGDQM  V QL+PAK SL+WITDYL+ AHP DNVLYIQVGDP 
Sbjct: 114 GFPMAFTATVLSWSILEYGDQMNAVNQLDPAKDSLRWITDYLIKAHPSDNVLYIQVGDPK 173

Query: 748 LDH 756
           +DH
Sbjct: 174 VDH 176



 Score = 38.5 bits (88), Expect(2) = 3e-59
 Identities = 14/22 (63%), Positives = 17/22 (77%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM E RPLT+I+   P
Sbjct: 178 CWERPEDMKEKRPLTKIDVDTP 199



>gb:AP005092_1847664 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OJ1112_E07.
          Length = 528

 Score =  209 bits (533), Expect(2) = 2e-58
 Identities = 104/179 (58%), Positives = 124/179 (69%), Gaps = 1/179 (0%)
 Frame = +1

Query: 223 MGDKSRSKGGWCGWLLXXXXXXXXXXXXX-XLVKKKHGGGGSSEPDXXXXXXXXXXXTQK 399
           MG K++   G CGWL+               ++KKK GGG   +               K
Sbjct: 1   MGSKTK---GCCGWLIVALVASLVATAAVVAIMKKKVGGGSGRKLKPLPVPGPPGAIDSK 57

Query: 400 YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM 579
           YGDAL +A+QFF VQK+GKL +N+I WRGDS L DGK A LDLSKGMYDAGD +KF FPM
Sbjct: 58  YGDALGVALQFFQVQKAGKLENNQIPWRGDSALDDGKPAGLDLSKGMYDAGDHIKFSFPM 117

Query: 580 AYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           A+TATVL+W+ILEYGDQM+  KQL+PA  +L+WITD+LVNAHP DNV YIQVGDPDLDH
Sbjct: 118 AFTATVLSWSILEYGDQMSATKQLDPALDALRWITDFLVNAHPSDNVFYIQVGDPDLDH 176



 Score = 39.3 bits (90), Expect(2) = 2e-58
 Identities = 15/22 (68%), Positives = 17/22 (77%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPE M+E RPLTQIN   P
Sbjct: 178 CWERPETMSEKRPLTQINTKSP 199



>pir|G86332|G86332 F6F9.1 protein - Arabidopsis
           thaliana>gb:AE005172_890955 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC007797_1536215 Arabidopsis thaliana
           chromosome I BAC F6F9 genomic sequence, complete
           sequence.>gb:AY048245_1561706 Arabidopsis thaliana
           At1g19940/F6F9_1 mRNA, complete cds.>gb:AY113063_1578223
           Arabidopsis thaliana At1g19940/F6F9_1 mRNA, complete
           cds.
          Length = 515

 Score =  196 bits (499), Expect(2) = 6e-53
 Identities = 92/122 (75%), Positives = 106/122 (86%)
 Frame = +1

Query: 394 QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF 573
           + Y +ALKIAMQFFD+QKSGKL +N+ISWRGDSGLKDG  AS+DLSKG+YDAGD MKFGF
Sbjct: 47  KNYANALKIAMQFFDIQKSGKLENNEISWRGDSGLKDGSEASIDLSKGLYDAGDHMKFGF 106

Query: 574 PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD 753
           PMA+TATVL+W+ILEYGDQMA +  L+ AK SLKW TD+L+NAHP  NVLYIQVGDP  D
Sbjct: 107 PMAFTATVLSWSILEYGDQMASLNLLDHAKDSLKWTTDFLINAHPSPNVLYIQVGDPVTD 166

Query: 754 HK 759
           HK
Sbjct: 167 HK 168



 Score = 34.3 bits (77), Expect(2) = 6e-53
 Identities = 13/23 (56%), Positives = 15/23 (65%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           KCW RPE MT  R LT+I+   P
Sbjct: 168 KCWDRPETMTRKRTLTKIDTKTP 190



>gb:T20H2_1723724 Sequence of BAC T20H2 from Arabidopsis thaliana
           chromosome 1, complete sequence.
          Length = 300

 Score =  196 bits (499), Expect(2) = 6e-53
 Identities = 92/122 (75%), Positives = 106/122 (86%)
 Frame = +1

Query: 394 QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF 573
           + Y +ALKIAMQFFD+QKSGKL +N+ISWRGDSGLKDG  AS+DLSKG+YDAGD MKFGF
Sbjct: 47  KNYANALKIAMQFFDIQKSGKLENNEISWRGDSGLKDGSEASIDLSKGLYDAGDHMKFGF 106

Query: 574 PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD 753
           PMA+TATVL+W+ILEYGDQMA +  L+ AK SLKW TD+L+NAHP  NVLYIQVGDP  D
Sbjct: 107 PMAFTATVLSWSILEYGDQMASLNLLDHAKDSLKWTTDFLINAHPSPNVLYIQVGDPVTD 166

Query: 754 HK 759
           HK
Sbjct: 167 HK 168



 Score = 34.3 bits (77), Expect(2) = 6e-53
 Identities = 13/23 (56%), Positives = 15/23 (65%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           KCW RPE MT  R LT+I+   P
Sbjct: 168 KCWDRPETMTRKRTLTKIDTKTP 190



>gb:AP003614_1831406 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0481E08.
          Length = 518

 Score =  186 bits (473), Expect(2) = 2e-50
 Identities = 94/168 (55%), Positives = 108/168 (64%)
 Frame = +1

Query: 256 CGWLLXXXXXXXXXXXXXXLVKKKHGGGGSSEPDXXXXXXXXXXXTQKYGDALKIAMQFF 435
           C WLL               V+ K+G G    P              KY DAL +A+QFF
Sbjct: 8   CCWLLVLMLMALAITAAVVFVRYKNGEGVFPFPGVPGAVD------HKYADALAVALQFF 61

Query: 436 DVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTIL 615
            VQKSGKLV+N I WRGDS L DGK A +DLSKGMYDAGD MKFGFPMA+TAT+L+W++L
Sbjct: 62  QVQKSGKLVNNTIHWRGDSALDDGKEAGIDLSKGMYDAGDHMKFGFPMAFTATMLSWSVL 121

Query: 616 EYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHK 759
           EYGD M    Q + A  +L WI DYLVNAHP D+VLYIQVGDP  DHK
Sbjct: 122 EYGDAMRAADQRDSAIDALNWIMDYLVNAHPSDDVLYIQVGDPKADHK 169



 Score = 36.2 bits (82), Expect(2) = 2e-50
 Identities = 14/23 (60%), Positives = 16/23 (69%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           KCW+RPE M E RPLT+I    P
Sbjct: 169 KCWERPEKMKEKRPLTKITPKSP 191



>pir|T01583|T01583 cellulase (EC 3.2.1.4) At2g44560 - Arabidopsis
           thaliana>gb:AC003672_1531122 Arabidopsis thaliana
           chromosome 2 clone F16B22 map m336, complete
           sequence.>gb:AK175889_1817877 Arabidopsis thaliana mRNA
           for putative glucanase, complete cds, clone:
           RAFL22-53-E13.
          Length = 491

 Score =  137 bits (345), Expect(2) = 7e-35
 Identities = 63/124 (50%), Positives = 90/124 (72%), Gaps = 1/124 (0%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           ++ YGDAL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKF
Sbjct: 31  SRNYGDALTKSLLYFEAQRSGKLPSNQRVTWRGDSALRDGSDAHVDLTGGYYDAGDNMKF 90

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD 747
           GFP+A+  T+LAW+ +E   Q+   ++ E A  +LKW TD+L+ AHP+ NVLY QVGD +
Sbjct: 91  GFPLAFFTTMLAWSNIEMATQLKAHQEQENALAALKWATDFLIKAHPEPNVLYGQVGDGN 150

Query: 748 LDHK 759
            DH+
Sbjct: 151 SDHE 154



 Score = 33.1 bits (74), Expect(2) = 7e-35
 Identities = 13/23 (56%), Positives = 16/23 (69%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           +CW RPEDMT  RP  +I+A  P
Sbjct: 154 ECWMRPEDMTTPRPSFRIDAQHP 176



>gb:AF098292_1767912 Lycopersicon esculentum
           endo-beta-1,4-D-glucanase (Cel8) mRNA, complete cds.
          Length = 625

 Score =  135 bits (340), Expect(2) = 4e-34
 Identities = 64/120 (53%), Positives = 87/120 (72%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG+AL  +  F++ Q+SG L  N ++ WRG+SGL DGK++ +DL  G YDAGD +KFG P
Sbjct: 25  YGEALSKSFLFYEAQRSGYLPRNQRVQWRGNSGLNDGKASGIDLVGGYYDAGDNVKFGLP 84

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+L+W+ILEYG QMA   +L  A  ++KW TDYL+ AHP+  VLY +VGD + DH
Sbjct: 85  MAFTVTMLSWSILEYGRQMAASGELSHAMDAVKWGTDYLLKAHPEPYVLYGEVGDGNTDH 144



 Score = 32.3 bits (72), Expect(2) = 4e-34
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CWQRPEDMT SR   +I+ + P
Sbjct: 146 CWQRPEDMTTSRAAYRIDPNHP 167



>gb:AF362949_1791510 Nicotiana tabacum endo-beta-1,4-glucanase
           precursor (Cel8) mRNA, complete cds.
          Length = 624

 Score =  133 bits (335), Expect(2) = 7e-34
 Identities = 62/123 (50%), Positives = 87/123 (70%), Gaps = 1/123 (0%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           +  YG+AL  +  F++ Q+SG L  D ++ WRG+SGL DGK++ +DL  G YDAGD +KF
Sbjct: 30  SHNYGEALSKSFLFYEAQRSGYLPHDQRVQWRGNSGLLDGKASGVDLVGGYYDAGDNVKF 89

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD 747
           G PMA+T T+++W+I+EYG QM    +L  A  ++KW TDYL+ AHP+ NVLY +VGD  
Sbjct: 90  GLPMAFTVTMMSWSIIEYGKQMGESGELSNAIDAVKWGTDYLLKAHPEPNVLYGEVGDGT 149

Query: 748 LDH 756
            DH
Sbjct: 150 TDH 152



 Score = 33.5 bits (75), Expect(2) = 7e-34
 Identities = 14/22 (63%), Positives = 16/22 (72%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CWQRPEDMT SR   +I+ S P
Sbjct: 154 CWQRPEDMTTSRAAYRIDPSRP 175



>pir|T02410|T02410 cellulase (EC 3.2.1.4) At2g44540 - Arabidopsis
           thaliana>gb:AC003672_1531120 Arabidopsis thaliana
           chromosome 2 clone F16B22 map m336, complete
           sequence.>gb:AC004521_1531832 Arabidopsis thaliana
           chromosome 2 clone F4I1 map m336, complete sequence.
          Length = 491

 Score =  135 bits (340), Expect(2) = 7e-34
 Identities = 63/121 (52%), Positives = 87/121 (71%), Gaps = 1/121 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y +AL+ ++ +F+ Q+SGKL  N K++WRGDS LKDG  A +DL+ G YDAGD MKFGFP
Sbjct: 34  YAEALQKSLLYFEAQRSGKLPPNQKVTWRGDSALKDGSDAHIDLTGGYYDAGDNMKFGFP 93

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           +A+T T+LAW+ +E G ++    +   +  +LKW TDYL+ AHP  NVLY QVG+ + DH
Sbjct: 94  LAFTTTMLAWSNIEMGSELRAHHEQGNSLRALKWATDYLIKAHPQPNVLYGQVGEGNSDH 153

Query: 757 K 759
           K
Sbjct: 154 K 154



 Score = 31.6 bits (70), Expect(2) = 7e-34
 Identities = 13/23 (56%), Positives = 15/23 (65%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           KCW RPEDMT  R   +I+A  P
Sbjct: 154 KCWMRPEDMTTPRTSYRIDAQHP 176



>pir|T01584|T01584 cellulase (EC 3.2.1.4) F16B22.6 - Arabidopsis
           thaliana>gb:AC003672_1531123 Arabidopsis thaliana
           chromosome 2 clone F16B22 map m336, complete sequence.
          Length = 492

 Score =  135 bits (340), Expect(2) = 1e-33
 Identities = 62/120 (51%), Positives = 87/120 (72%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG+AL  ++ +F+ Q+SGKL +D ++ WRGDS L+DG  A +DL+ G YDAGD MKFGFP
Sbjct: 34  YGEALTKSLLYFEAQRSGKLPLDQRVIWRGDSALRDGSDAHVDLTGGYYDAGDNMKFGFP 93

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           +A+T T+LAW+ +E   Q+   ++      +L+W TDYL+ AHP+ NVLY QVGD +LDH
Sbjct: 94  LAFTTTMLAWSSVEMESQLKAHQEHGNTLAALRWATDYLIKAHPEPNVLYGQVGDANLDH 153



 Score = 30.8 bits (68), Expect(2) = 1e-33
 Identities = 12/22 (54%), Positives = 14/22 (63%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW RPEDMT  RP  +I+   P
Sbjct: 155 CWMRPEDMTTPRPSYRIDPQHP 176



>pir|T02411|T02411 cellulase (EC 3.2.1.4) F4I1.37 - Arabidopsis
           thaliana>gb:AC003672_1531121 Arabidopsis thaliana
           chromosome 2 clone F16B22 map m336, complete
           sequence.>gb:AC004521_1531833 Arabidopsis thaliana
           chromosome 2 clone F4I1 map m336, complete sequence.
          Length = 490

 Score =  134 bits (338), Expect(2) = 1e-33
 Identities = 63/121 (52%), Positives = 86/121 (71%), Gaps = 1/121 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y +ALK ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKFGFP
Sbjct: 34  YAEALKNSLLYFEAQRSGKLPPNQRVTWRGDSALRDGSDAHIDLTGGYYDAGDNMKFGFP 93

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           +A+T T+LAW+ +E   Q+    +   A  +LKW TDYL+ AHP  NVLY QVG+ + DH
Sbjct: 94  LAFTTTMLAWSNIEMASQLRAHHEKGNALRALKWATDYLIKAHPQPNVLYGQVGEGNSDH 153

Query: 757 K 759
           K
Sbjct: 154 K 154



 Score = 31.6 bits (70), Expect(2) = 1e-33
 Identities = 13/23 (56%), Positives = 15/23 (65%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           KCW RPEDMT  R   +I+A  P
Sbjct: 154 KCWMRPEDMTTPRTSYRIDAQHP 176



>gb:AB084464_1524342 Pyrus communis PC-EG2 mRNA for
           endo-1,4-beta-D-glucanase, complete cds.
          Length = 620

 Score =  132 bits (333), Expect(2) = 3e-33
 Identities = 62/120 (51%), Positives = 86/120 (71%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG AL  ++ FF+ Q+SG L  N +++WR +SGL DGK+  +DL  G YDAGD +KFG P
Sbjct: 28  YGQALSNSILFFEAQRSGFLPPNQRVTWRSNSGLYDGKANGVDLVGGYYDAGDNVKFGLP 87

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP+ NVLY +VGD + DH
Sbjct: 88  MAFTVTMMSWSIIEYGSQMAASGELGHAMDAVKWGTDYFIKAHPEPNVLYGEVGDGNTDH 147



 Score = 32.3 bits (72), Expect(2) = 3e-33
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CWQRPEDMT +R   +I+ S P
Sbjct: 149 CWQRPEDMTTNRQAYKISPSNP 170



>pir|T46610|T46610 cellulase (EC 3.2.1.4) 2 precursor - Monterey
           pine>gb:PRU76756_1701857 Pinus radiata
           endo-beta-1,4-glucanase (PrCel2) mRNA, complete cds.
          Length = 515

 Score =  131 bits (329), Expect(2) = 6e-33
 Identities = 61/121 (50%), Positives = 89/121 (73%), Gaps = 1/121 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL  ++ F++ Q+SGKL ++ ++ WRGDS L DG +  +DL+ G YDAGD +KFGFP
Sbjct: 54  YRDALTKSILFYEGQRSGKLPLNQRMRWRGDSALSDGAAGHVDLTGGYYDAGDNVKFGFP 113

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+L+W++LE+G +M     L+ AK +++W TDYL+ A     V+Y+QVGDP+LDH
Sbjct: 114 MAFTTTMLSWSVLEFGGRMG--DNLDHAKAAIRWATDYLLKATARPGVIYVQVGDPNLDH 171

Query: 757 K 759
           K
Sbjct: 172 K 172



 Score = 32.7 bits (73), Expect(2) = 6e-33
 Identities = 13/23 (56%), Positives = 17/23 (73%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           KCW+RPEDM  SR + +I+A  P
Sbjct: 172 KCWERPEDMDTSRNVYKIDADHP 194



>gb:AP002094_1822032 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0483F08.>gb:AP002745_1822746 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0489G09.
          Length = 640

 Score =  132 bits (331), Expect(2) = 1e-32
 Identities = 61/120 (50%), Positives = 86/120 (71%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG AL  ++ +F+ Q+SG L  + +I+WR +SGL DGK+  +DL  G YDAGD +KFG P
Sbjct: 41  YGMALSKSILYFEAQRSGVLPGSQRIAWRANSGLADGKANGVDLVGGYYDAGDNVKFGLP 100

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T++AW+++EYG++MA   +L  A  ++KW TDY   AHP+ NVLY +VGD D DH
Sbjct: 101 MAFTVTMMAWSVIEYGEEMAAAGELGHAVEAIKWGTDYFAKAHPEPNVLYAEVGDGDSDH 160



 Score = 31.2 bits (69), Expect(2) = 1e-32
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CWQRPEDMT SR   +++   P
Sbjct: 162 CWQRPEDMTTSRQAYRLDPQNP 183



>gb:AP005412_1851378 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0050G13.
          Length = 534

 Score =  129 bits (325), Expect(2) = 1e-32
 Identities = 60/120 (50%), Positives = 84/120 (70%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG+AL  ++ +F+ Q+SG+L  N ++ WRG SGL DG    +DL  G YDAGD +KFG P
Sbjct: 30  YGEALSKSLLYFEAQRSGRLPYNQRVRWRGHSGLTDGLEQGVDLVGGYYDAGDHVKFGLP 89

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+L+W++LEYG+++A   +L  A  ++KW TDY + AH   NVL+ QVGD D DH
Sbjct: 90  MAFTVTMLSWSVLEYGEEIAAAGELGHALHAIKWGTDYFIKAHTHPNVLWTQVGDGDSDH 149



 Score = 33.1 bits (74), Expect(2) = 1e-32
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CWQRPEDMT SR   +++A  P
Sbjct: 151 CWQRPEDMTTSRHAYKVDAENP 172



>gb:AP002094_1822030 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0483F08.>gb:AP002745_1822744 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0489G09.
          Length = 640

 Score =  131 bits (329), Expect(2) = 2e-32
 Identities = 68/143 (47%), Positives = 89/143 (62%), Gaps = 1/143 (0%)
 Frame = +1

Query: 331 GGGGSSEPDXXXXXXXXXXXTQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDG 507
           GGGG    D              Y  AL  ++ +F+ Q+SG L  N +I+WR +SGL DG
Sbjct: 33  GGGGGGRHD--------------YRMALSKSILYFEAQRSGVLPGNQRIAWRANSGLADG 78

Query: 508 KSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITD 687
           K+  +DL  G YDAGD +KFGFPMA+T T++AW++LEYG QMA   +L  A  +++W  D
Sbjct: 79  KANGVDLVGGYYDAGDNVKFGFPMAFTVTMMAWSVLEYGKQMAAAGELGHAMDAVRWGAD 138

Query: 688 YLVNAHPDDNVLYIQVGDPDLDH 756
           Y V AHP  NVLY +VGD D DH
Sbjct: 139 YFVKAHPAPNVLYGEVGDGDSDH 161



 Score = 31.2 bits (69), Expect(2) = 2e-32
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CWQRPEDMT SR   +++   P
Sbjct: 163 CWQRPEDMTTSRQAYRLDPQHP 184



>gb:AC135914_1742790 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0074P11, complete sequence.
          Length = 629

 Score =  130 bits (328), Expect(2) = 2e-32
 Identities = 62/120 (51%), Positives = 84/120 (70%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y  AL+ ++ +F  Q+SG L  N ++SWR  SGL DGK+  +DL  G YDAGD +KFG P
Sbjct: 35  YAMALRKSILYFQAQRSGVLPPNQRVSWRASSGLFDGKANGVDLVGGYYDAGDNVKFGLP 94

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+++W+ILEYG QMA   +L  A  ++KW TDY + AHP+ +VLY +VGD D DH
Sbjct: 95  MAFTVTMMSWSILEYGKQMAAAGELRNAMDAVKWGTDYFIKAHPEPDVLYGEVGDGDTDH 154



 Score = 31.6 bits (70), Expect(2) = 2e-32
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CWQRPEDMT SR   +++   P
Sbjct: 156 CWQRPEDMTTSRQAFRVDPQHP 177



>gb:AF128404_1770602 Nicotiana alata cellulase homolog mRNA,
           complete cds.
          Length = 481

 Score =  133 bits (334), Expect(2) = 4e-32
 Identities = 59/121 (48%), Positives = 87/121 (71%), Gaps = 1/121 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG AL  ++ +F+ Q+SGKL  N ++ WRGDS L DGK A +DL+ G YDAGD +KFGFP
Sbjct: 26  YGIALTKSLLYFEAQRSGKLPPNQRVQWRGDSALNDGKDAGIDLTGGYYDAGDNVKFGFP 85

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+LAW+++E+G+++   K+L  A  ++KW TDY + AH   ++ Y +VGD + DH
Sbjct: 86  MAFTVTMLAWSVVEFGEKLEAKKELTNALNAIKWGTDYFIKAHTQPHIFYGEVGDGNSDH 145

Query: 757 K 759
           +
Sbjct: 146 Q 146



 Score = 28.1 bits (61), Expect(2) = 4e-32
 Identities = 10/23 (43%), Positives = 15/23 (65%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           +CW+RPEDMT  R   +++   P
Sbjct: 146 QCWERPEDMTTPRNSYKVDEQHP 168



>gb:AF054615_1764554 Fragaria x ananassa cellulase (Cel2) mRNA,
           complete cds.
          Length = 620

 Score =  129 bits (324), Expect(2) = 5e-32
 Identities = 61/120 (50%), Positives = 86/120 (71%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG AL  ++ FF+ Q+SG L  N +++WR  SGL DGK++ ++L  G YDAGD +KFG P
Sbjct: 28  YGAALSKSILFFEAQRSGVLPHNQRVTWRSHSGLYDGKASGVNLVGGYYDAGDNVKFGLP 87

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP+ NVLY +VGD + DH
Sbjct: 88  MAFTVTMMSWSIIEYGKQMASSGELGHALDAVKWGTDYFIKAHPEPNVLYGEVGDGNTDH 147



 Score = 31.6 bits (70), Expect(2) = 5e-32
 Identities = 13/22 (59%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CWQRPEDMT  R   +I+ S P
Sbjct: 149 CWQRPEDMTTDRRAYKISPSNP 170



>gb:FRX414708_1679256 Fragaria x ananassa faEG3 gene for
           endo-beta-1,4-glucanase, exons 1-8.
          Length = 620

 Score =  129 bits (324), Expect(2) = 5e-32
 Identities = 61/120 (50%), Positives = 86/120 (71%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG AL  ++ FF+ Q+SG L  N +++WR  SGL DGK++ ++L  G YDAGD +KFG P
Sbjct: 28  YGAALSKSILFFEAQRSGVLPHNQRVTWRSHSGLYDGKASGVNLVGGYYDAGDNVKFGLP 87

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP+ NVLY +VGD + DH
Sbjct: 88  MAFTVTMMSWSIIEYGKQMASSGELGHALDAVKWGTDYFIKAHPEPNVLYGEVGDGNTDH 147



 Score = 31.6 bits (70), Expect(2) = 5e-32
 Identities = 13/22 (59%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CWQRPEDMT  R   +I+ S P
Sbjct: 149 CWQRPEDMTTDRRAYKISPSNP 170



>gb:FAN6349_1678786 Fragaria x ananassa mRNA for
           endo-beta-1,4-glucanase, eg3.
          Length = 620

 Score =  129 bits (324), Expect(2) = 5e-32
 Identities = 61/120 (50%), Positives = 86/120 (71%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG AL  ++ FF+ Q+SG L  N +++WR  SGL DGK++ ++L  G YDAGD +KFG P
Sbjct: 28  YGAALSKSILFFEAQRSGVLPHNQRVTWRSHSGLYDGKASGVNLVGGYYDAGDNVKFGLP 87

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP+ NVLY +VGD + DH
Sbjct: 88  MAFTVTMMSWSIIEYGKQMASSGELGHALDAVKWGTDYFIKAHPEPNVLYGEVGDGNTDH 147



 Score = 31.6 bits (70), Expect(2) = 5e-32
 Identities = 13/22 (59%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CWQRPEDMT  R   +I+ S P
Sbjct: 149 CWQRPEDMTTDRRAYKISPSNP 170



>sp|P26221|GUN4_THEFU Endoglucanase E-4 precursor (EC 3.2.1.4)
           (Endo-1,4-beta-glucanase E-4) (Cellulase E-4) (Cellulase
           E4).>gb:THFEXOGLU_197632 Thermomonospora fusca
           beta-1,4-endoglucanase precursor (E4) gene, complete
           cds.
          Length = 880

 Score =  139 bits (351), Expect = 5e-32
 Identities = 65/121 (53%), Positives = 86/121 (71%), Gaps = 1/121 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y +AL+ +M F++ Q+SGKL +N ++SWRGDSGL DG    LDL+ G YDAGD +KFGFP
Sbjct: 52  YAEALQKSMFFYEAQRSGKLPENNRVSWRGDSGLNDGADVGLDLTGGWYDAGDHVKFGFP 111

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+TAT+LAW  +E  +      Q+   K +L+W+ DY + AHP  NVLY+QVGD D DH
Sbjct: 112 MAFTATMLAWGAIESPEGYIRSGQMPYLKDNLRWVNDYFIKAHPSPNVLYVQVGDGDADH 171

Query: 757 K 759
           K
Sbjct: 172 K 172



>gb:BT000696_1634971 Arabidopsis thaliana clone RAFL07-09-J02
           (R11012) putative endo-beta-1,4-glucanase (At1g64390)
           mRNA, complete cds.
          Length = 620

 Score =  129 bits (324), Expect(2) = 1e-31
 Identities = 59/120 (49%), Positives = 86/120 (71%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG AL  ++ FF+ Q+SG L  N +++WR  SGL DGKS+ ++L  G YDAGD +KFG P
Sbjct: 26  YGQALSKSLLFFEAQRSGVLPRNQRVTWRSHSGLTDGKSSGVNLVGGYYDAGDNVKFGLP 85

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T++AW+++EYG+Q+    +L  +  ++KW TDY + AHP+ NVLY +VGD + DH
Sbjct: 86  MAFTVTMMAWSVIEYGNQLQANGELGNSIDAIKWGTDYFIKAHPEPNVLYGEVGDGNTDH 145



 Score = 30.4 bits (67), Expect(2) = 1e-31
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CWQRPE+MT  R   +I+ S P
Sbjct: 147 CWQRPEEMTTDRKAYRIDPSNP 168



>pir|A96668|A96668 probable endo-beta-1,4-glucanase F15H21.9
           [imported] - Arabidopsis thaliana>gb:AE005173_894095
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC066689_1540283 Arabidopsis thaliana
           chromosome 1 BAC F15H21 genomic sequence, complete
           sequence.>gb:AY143945_1583402 Arabidopsis thaliana
           At1g64390/F15H21_9 mRNA, complete
           cds.>gb:AF372940_1792655 Arabidopsis thaliana
           At1g64390/F15H21_9 mRNA, complete cds.
          Length = 620

 Score =  129 bits (324), Expect(2) = 1e-31
 Identities = 59/120 (49%), Positives = 86/120 (71%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG AL  ++ FF+ Q+SG L  N +++WR  SGL DGKS+ ++L  G YDAGD +KFG P
Sbjct: 26  YGQALSKSLLFFEAQRSGVLPRNQRVTWRSHSGLTDGKSSGVNLVGGYYDAGDNVKFGLP 85

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T++AW+++EYG+Q+    +L  +  ++KW TDY + AHP+ NVLY +VGD + DH
Sbjct: 86  MAFTVTMMAWSVIEYGNQLQANGELGNSIDAIKWGTDYFIKAHPEPNVLYGEVGDGNTDH 145



 Score = 30.4 bits (67), Expect(2) = 1e-31
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CWQRPE+MT  R   +I+ S P
Sbjct: 147 CWQRPEEMTTDRKAYRIDPSNP 168



>pir|T01108|T01108 cellulase (EC 3.2.1.4) T21L14.7 - Arabidopsis
           thaliana>gb:AC003033_1530994 Arabidopsis thaliana
           chromosome 2 BAC T21L14 genomic sequence, complete
           sequence.>gb:AY062439_1565095 Arabidopsis thaliana
           putative glucanse (At2g32990; T21L14.7) mRNA, complete
           cds.>gb:BT008885_1640081 Arabidopsis thaliana At2g32990
           mRNA, complete cds.
          Length = 525

 Score =  125 bits (315), Expect(2) = 4e-31
 Identities = 57/120 (47%), Positives = 83/120 (69%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG+AL  ++ +F+ Q+SG+L  N +++WR  SGL DG    +DL  G +DAGD +KFG P
Sbjct: 40  YGEALSKSLLYFEAQRSGRLPYNQRVTWRDHSGLTDGLEQGVDLVGGYHDAGDHVKFGLP 99

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+L+W+++EYGD +A   +L  A  ++KW TDY + AH   NVL+ +VGD D DH
Sbjct: 100 MAFTVTMLSWSVIEYGDSLASTGELSHALEAIKWGTDYFIKAHTSPNVLWAEVGDGDTDH 159



 Score = 32.0 bits (71), Expect(2) = 4e-31
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CWQRPEDMT SR   +I+ + P
Sbjct: 161 CWQRPEDMTTSRRAFKIDENNP 182



>pir|B42360|B42360 cellulase (EC 3.2.1.4) E4 precursor -
           Thermomonospora fusca
          Length = 507

 Score =  135 bits (341), Expect = 7e-31
 Identities = 65/121 (53%), Positives = 87/121 (71%), Gaps = 1/121 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y +AL+ +M F++ Q+SGKL +N ++SWRGDSGL DG    LDL+ G YDAGD +KFGFP
Sbjct: 52  YAEALQKSMFFYEAQRSGKLPENNRVSWRGDSGLNDGADVGLDLTGGWYDAGDHVKFGFP 111

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+TAT+LAW   + G ++    Q+   K +L+W+ DY + AHP  NVLY+QVGD D DH
Sbjct: 112 MAFTATMLAWGASKPG-RLHRSGQMPYLKDNLRWVNDYFIKAHPSPNVLYVQVGDGDADH 170

Query: 757 K 759
           K
Sbjct: 171 K 171



>gb:AB032830_1518745 Pisum sativum EGL2 mRNA for
           endo-1,4-beta-glucanase, complete cds.
          Length = 506

 Score =  126 bits (316), Expect(2) = 9e-31
 Identities = 62/123 (50%), Positives = 84/123 (68%), Gaps = 1/123 (0%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           T  Y DAL  ++ FF  Q+SGKL  N +ISWR DSGL DG +  +DL  G YDAGD +KF
Sbjct: 40  THNYRDALTKSILFFQGQRSGKLPSNQRISWRRDSGLSDGSALHVDLVGGYYDAGDNVKF 99

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD 747
           GFPMA+T T+L+W+++E+G  M    +L  AK +++W TDYL+ A    N++Y+QVGD  
Sbjct: 100 GFPMAFTTTMLSWSVIEFGGLMK--SELPNAKKAVRWATDYLLKATAHPNIIYVQVGDAK 157

Query: 748 LDH 756
            DH
Sbjct: 158 KDH 160



 Score = 30.4 bits (67), Expect(2) = 9e-31
 Identities = 10/22 (45%), Positives = 16/22 (72%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +++A+ P
Sbjct: 162 CWERPEDMDTPRSVFKVDANAP 183



>pir|JC7226|JC7226 endo-1,3(4)-beta-glucanase (EC 3.2.1.6) - garden
           pea
          Length = 506

 Score =  126 bits (316), Expect(2) = 9e-31
 Identities = 62/123 (50%), Positives = 84/123 (68%), Gaps = 1/123 (0%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           T  Y DAL  ++ FF  Q+SGKL  N +ISWR DSGL DG +  +DL  G YDAGD +KF
Sbjct: 40  THNYRDALTKSILFFQGQRSGKLPSNQRISWRRDSGLSDGSALHVDLVGGYYDAGDNVKF 99

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD 747
           GFPMA+T T+L+W+++E+G  M    +L  AK +++W TDYL+ A    N++Y+QVGD  
Sbjct: 100 GFPMAFTTTMLSWSVIEFGGLMK--SELPNAKKAVRWATDYLLKATAHPNIIYVQVGDAK 157

Query: 748 LDH 756
            DH
Sbjct: 158 KDH 160



 Score = 30.4 bits (67), Expect(2) = 9e-31
 Identities = 10/22 (45%), Positives = 16/22 (72%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +++A+ P
Sbjct: 162 CWERPEDMDTPRSVFKVDANAP 183



>gb:AF362947_1791508 Nicotiana tabacum endo-beta-1,4-glucanase
           precursor (Cel7) mRNA, complete cds.
          Length = 489

 Score =  126 bits (316), Expect(2) = 2e-30
 Identities = 63/122 (51%), Positives = 87/122 (71%), Gaps = 2/122 (1%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y +AL+ ++ FF+ Q+SGKL  N ++SWRG SGL DG  A +DL+ G YDAGD +KF FP
Sbjct: 30  YREALEKSILFFEGQRSGKLPHNQRVSWRGSSGLSDGSLAKVDLTGGYYDAGDNVKFNFP 89

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVN-AHPDDNVLYIQVGDPDLD 753
           MAYT T+L+W  LEYG +M    QL+ A+ +++W TDYL+  A+   N L++ VGDP+ D
Sbjct: 90  MAYTTTLLSWNTLEYGKRMG--PQLQNARAAIRWATDYLLKCANAAPNKLFVGVGDPNSD 147

Query: 754 HK 759
           HK
Sbjct: 148 HK 149



 Score = 29.6 bits (65), Expect(2) = 2e-30
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           KCW+RPEDM   R +  ++ S P
Sbjct: 149 KCWERPEDMDTVRSVYYVSPSSP 171



>sp|P05522|GUN1_PERAE Endoglucanase 1 precursor (EC 3.2.1.4)
           (Endo-1,4-beta-glucanase) (Abscission cellulase
           1).>pir|S11946|S11946 cellulase (EC 3.2.1.4) cel1
           precursor - avocado>gb:AVOCEL_1557687 Avocado cellulase
           (endo-(1-4)-beta-n-glucanase), complete
           cds.>gb:PACELLG_1698671 P.americana cel1 gene for
           cellulase (endo-beta-1,4-glucanase).
          Length = 494

 Score =  127 bits (319), Expect(2) = 3e-30
 Identities = 64/122 (52%), Positives = 88/122 (72%), Gaps = 2/122 (1%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL+ ++ FF+ Q+SGKL  N +++WRGDSGL DG S  +DL  G YDAGD +KFG P
Sbjct: 30  YSDALEKSILFFEGQRSGKLPTNQRLTWRGDSGLSDGSSYHVDLVGGYYDAGDNLKFGLP 89

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAH-PDDNVLYIQVGDPDLD 753
           MA+T T+LAW I+E+G  M   +Q+E A+ +L+W TDYL+ A     N LY+QVG+P+ D
Sbjct: 90  MAFTTTMLAWGIIEFGCLMP--EQVENARAALRWSTDYLLKASTATSNSLYVQVGEPNAD 147

Query: 754 HK 759
           H+
Sbjct: 148 HR 149



 Score = 27.7 bits (60), Expect(2) = 3e-30
 Identities = 9/23 (39%), Positives = 15/23 (65%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           +CW+RPEDM   R + +++   P
Sbjct: 149 RCWERPEDMDTPRNVYKVSTQNP 171



>gb:AY133685_1581505 Arabidopsis thaliana clone C103115 putative
           glucanase (At4g11050) mRNA, complete cds.
          Length = 626

 Score =  125 bits (315), Expect(2) = 3e-30
 Identities = 61/120 (50%), Positives = 81/120 (67%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y  AL  ++ FF+ Q+SG L  N ++SWR  SGL DGKS+ +DL  G YDAGD +KFG P
Sbjct: 27  YKQALSKSILFFEAQRSGHLPPNQRVSWRSHSGLYDGKSSGVDLVGGYYDAGDNVKFGLP 86

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T + W+I+EYG Q+    +L  A  ++KW TDY + AHP+ NVLY +VGD   DH
Sbjct: 87  MAFTVTTMCWSIIEYGGQLESNGELGHAIDAVKWGTDYFIKAHPEPNVLYGEVGDGKSDH 146



 Score = 28.9 bits (63), Expect(2) = 3e-30
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CWQRPE+MT  R   +I+ + P
Sbjct: 148 CWQRPEEMTTDRRAYKIDRNNP 169



>pir|T01929|T01929 probable cellulase (EC 3.2.1.4) F2P3.1 -
           Arabidopsis thaliana>gb:ATCHRIV30_1544870 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           30.>gb:ATT22B4_1555201 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T22B4 (ESSA
           project).>gb:F2P3_1678218 Arabidopsis thaliana BAC F2P3.
          Length = 625

 Score =  125 bits (315), Expect(2) = 3e-30
 Identities = 61/120 (50%), Positives = 81/120 (67%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y  AL  ++ FF+ Q+SG L  N ++SWR  SGL DGKS+ +DL  G YDAGD +KFG P
Sbjct: 27  YKQALSKSILFFEAQRSGHLPPNQRVSWRSHSGLYDGKSSGVDLVGGYYDAGDNVKFGLP 86

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T + W+I+EYG Q+    +L  A  ++KW TDY + AHP+ NVLY +VGD   DH
Sbjct: 87  MAFTVTTMCWSIIEYGGQLESNGELGHAIDAVKWGTDYFIKAHPEPNVLYGEVGDGKSDH 146



 Score = 28.9 bits (63), Expect(2) = 3e-30
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CWQRPE+MT  R   +I+ + P
Sbjct: 148 CWQRPEEMTTDRRAYKIDRNNP 169



>pir|T04021|T04021 cellulase (EC 3.2.1.4) F17A8.90 - Arabidopsis
           thaliana>gb:ATCHRIV27_1544688 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 27.>gb:ATF17A8_1548871
           Arabidopsis thaliana DNA chromosome 4, BAC clone F17A8
           (ESSA project).
          Length = 480

 Score =  124 bits (310), Expect(2) = 3e-30
 Identities = 58/120 (48%), Positives = 85/120 (70%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YGDAL  ++ FF+ Q+SGKL  N ++ WR DSGL DG SA+++L  G YDAGD +KF +P
Sbjct: 24  YGDALNKSILFFEGQRSGKLPTNQRVKWRADSGLSDGASANVNLIGGYYDAGDNVKFVWP 83

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           M++T T+L+W  LEY +++  V QL   + ++KW T++++ AH   N+LY QVGD + DH
Sbjct: 84  MSFTTTLLSWAALEYQNEITFVNQLGYLRSTIKWGTNFILRAHTSTNMLYTQVGDGNSDH 143



 Score = 30.8 bits (68), Expect(2) = 3e-30
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R L  I++S P
Sbjct: 145 CWERPEDMDTPRTLYSISSSSP 166



>gb:POPCEL_1700994 Populus alba mRNA for cellulase
           (endo-1,4-beta-glucanase), complete cds.
          Length = 494

 Score =  127 bits (318), Expect(2) = 6e-30
 Identities = 61/125 (48%), Positives = 91/125 (72%), Gaps = 2/125 (1%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           +Q Y +AL+ ++ FF+ Q+SGKL  N +++WRGDSGL DG +  ++L  G YDAGD +KF
Sbjct: 30  SQDYANALEKSILFFEGQRSGKLPSNQRLAWRGDSGLSDGSTYHVNLVGGYYDAGDNVKF 89

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVN-AHPDDNVLYIQVGDP 744
           G PMA+T T+LAW+++E+G  M    Q+E AK +++W TDYL+  A    + LY+QVGDP
Sbjct: 90  GLPMAFTTTLLAWSVIEFGTLMQ--NQIENAKAAIRWSTDYLLKAATATPDTLYVQVGDP 147

Query: 745 DLDHK 759
           ++DH+
Sbjct: 148 NMDHR 152



 Score = 26.9 bits (58), Expect(2) = 6e-30
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           +CW+RPEDM   R + ++    P
Sbjct: 152 RCWERPEDMDTPRNVYKVTIQNP 174



>gb:AB025796_1516794 Populus alba POPCEL2 mRNA for endo-1,4-beta
           glucanase, complete cds.>gb:AB049200_1520789 Populus
           alba PopCel2 gene for endo-1,4-beta-glucanase, complete
           cds.
          Length = 494

 Score =  126 bits (317), Expect(2) = 6e-30
 Identities = 60/125 (48%), Positives = 91/125 (72%), Gaps = 2/125 (1%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           +Q Y DAL+ ++ FF+ Q+SGKL V+ +++WRGDSGL DG +  ++L  G YDAGD +KF
Sbjct: 30  SQDYADALEKSILFFEGQRSGKLPVNQRLTWRGDSGLSDGSAYHVNLVGGYYDAGDNVKF 89

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVN-AHPDDNVLYIQVGDP 744
           G PMA+T T+LAW+++E+G  M    Q+  A+ +++W TDYL+  A    + LY+QVGDP
Sbjct: 90  GLPMAFTTTLLAWSVIEFGSSMQ--NQITNAEAAIRWSTDYLLKAATATPDTLYVQVGDP 147

Query: 745 DLDHK 759
           ++DH+
Sbjct: 148 NMDHR 152



 Score = 27.3 bits (59), Expect(2) = 6e-30
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           +CW+RPEDM   R + ++    P
Sbjct: 152 RCWERPEDMDTPRNVYKVTTQNP 174



>pir|T05588|T05588 cellulase (EC 3.2.1.4) F9D16.30 - Arabidopsis
           thaliana>gb:ATCHRIV59_1546193 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 59.>gb:ATF9D16_1551280
           Arabidopsis thaliana DNA chromosome 4, BAC clone F9D16
           (ESSAII project).
          Length = 479

 Score =  121 bits (303), Expect(2) = 6e-30
 Identities = 56/121 (46%), Positives = 85/121 (70%), Gaps = 1/121 (0%)
 Frame = +1

Query: 397 KYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF 573
           +YGDAL  ++ FF+ Q+SGKL  N ++ WR DS L DG  A+++L  G YDAGD +KF +
Sbjct: 23  EYGDALNKSILFFEGQRSGKLPTNQRVKWRADSALSDGSLANVNLIGGYYDAGDNVKFVW 82

Query: 574 PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD 753
           PM++T T+L+W  +EY ++++ V QL   + ++KW TD+++ AH   N+LY QVGD + D
Sbjct: 83  PMSFTTTLLSWAAIEYQNEISSVNQLGYLRSTIKWGTDFILRAHTSPNMLYTQVGDGNSD 142

Query: 754 H 756
           H
Sbjct: 143 H 143



 Score = 32.7 bits (73), Expect(2) = 6e-30
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM  SR L  I++S P
Sbjct: 145 CWERPEDMDTSRTLYSISSSSP 166



>gb:AP005112_1848055 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0684F11.
          Length = 531

 Score =  122 bits (305), Expect(2) = 7e-30
 Identities = 56/120 (46%), Positives = 81/120 (67%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL+ ++ +F+ Q+SG+L  N +++WR  SGL DG    +DL  G YDAGD +KFG P
Sbjct: 37  YEDALRKSLLYFEAQRSGRLPHNQRVAWRDHSGLTDGLEQGVDLVGGYYDAGDHVKFGLP 96

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+L+W+++EYGD +    +L  A  ++KW TDY + AH   N L+ +VGD D DH
Sbjct: 97  MAFTVTMLSWSMIEYGDDVEAAGELGHALEAIKWGTDYFIKAHTKPNELWAEVGDGDTDH 156



 Score = 31.6 bits (70), Expect(2) = 7e-30
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CWQRPEDMT SR   +++   P
Sbjct: 158 CWQRPEDMTTSRQAYKVDRERP 179



>gb:AP005682_1855931 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OJ1531_B07.
          Length = 515

 Score =  122 bits (307), Expect(2) = 7e-30
 Identities = 59/121 (48%), Positives = 83/121 (68%), Gaps = 2/121 (1%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKL--VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF 573
           YGDAL  ++ FF+ Q+SG+L     + +WRGDS + DG +A +DL  G YDAGD +KFGF
Sbjct: 42  YGDALAKSILFFEGQRSGRLPAAGQRAAWRGDSAVSDGGAAGVDLEGGYYDAGDNVKFGF 101

Query: 574 PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD 753
           PMA+TAT+LAW ++E+GD M   ++   A  +++W TDYL+       V++IQVGDP  D
Sbjct: 102 PMAFTATMLAWGVVEFGDAMPPAERAH-AADAVRWATDYLLKTISHPGVIFIQVGDPTKD 160

Query: 754 H 756
           H
Sbjct: 161 H 161



 Score = 30.8 bits (68), Expect(2) = 7e-30
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 743 PT*TIKCWQRPEDMTESRPLTQINASVP 826
           PT    CW+RPEDM  +R +  I+A+ P
Sbjct: 157 PTKDHGCWERPEDMDTARTVYNISAARP 184



>gb:MDA511339_1389472 Mastotermes darwinensis mRNA for
           beta-1,4-endoglucanase (cel1 gene).
          Length = 447

 Score =  124 bits (311), Expect(2) = 7e-30
 Identities = 60/120 (50%), Positives = 80/120 (66%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y D L  ++ F++ Q+SGKL  D K++WR DS L D      DL+ G YDAGD +KFGFP
Sbjct: 20  YNDVLTKSLLFYEAQRSGKLPSDQKVTWRKDSALNDKGQNGEDLTGGYYDAGDYVKFGFP 79

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAYTATVLAW ++++    +    L+  + +LKW+TDYL+ AH  +N LY QVGD D DH
Sbjct: 80  MAYTATVLAWGLVDHPAGYSSAGLLDDGRKALKWVTDYLIKAHVSENELYGQVGDGDADH 139



 Score = 29.3 bits (64), Expect(2) = 7e-30
 Identities = 12/21 (57%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT +RP  +I+ S P
Sbjct: 142 WGRPEDMTMARPAYKIDTSNP 162



>gb:AP004689_1843447 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0434E03.
          Length = 516

 Score =  122 bits (305), Expect(2) = 1e-29
 Identities = 56/121 (46%), Positives = 83/121 (68%), Gaps = 1/121 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YGDAL  A+ FF+ Q+SG+L  N + +WRGDS L DG+  +++L+ G YDAGD +KFG+P
Sbjct: 41  YGDALAKAILFFEGQRSGRLPANQRATWRGDSALTDGREENVNLTGGYYDAGDNVKFGYP 100

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+L W+ +EYG  +A   +L   + +++W  D+L+ AH     LY QVGD + DH
Sbjct: 101 MAFTVTLLGWSAVEYGAAVAAAGELGNLRAAIRWGADFLLRAHASPTTLYTQVGDGNADH 160

Query: 757 K 759
           +
Sbjct: 161 Q 161



 Score = 30.8 bits (68), Expect(2) = 1e-29
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           +CW+RPEDM   R L +I A  P
Sbjct: 161 QCWERPEDMDTPRTLYKITADSP 183



>gb:AP004846_1845880 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1293_A01.
          Length = 501

 Score =  123 bits (308), Expect(2) = 1e-29
 Identities = 55/121 (45%), Positives = 84/121 (69%), Gaps = 1/121 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL  ++ F + Q+SGKL   N+I WRGDSG++DGK A++DL+ G YDAGD +K+G P
Sbjct: 43  YKDALTKSIMFLEAQRSGKLPPTNRIKWRGDSGMEDGKLANVDLTGGYYDAGDNVKYGLP 102

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           +A+T T LAWT + +  ++   ++LE    +++W TDY + A    + L++QVGDP+ DH
Sbjct: 103 LAFTVTTLAWTAMAFEKELKAARELENVHAAIRWGTDYFLKAATKKDHLWVQVGDPNADH 162

Query: 757 K 759
           +
Sbjct: 163 Q 163



 Score = 29.6 bits (65), Expect(2) = 1e-29
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           +CW RPE+M   R L QIN   P
Sbjct: 163 QCWVRPENMPTPRTLYQINDKTP 185



>gb:MDA511341_1389474 Mastotermes darwinensis mRNA for
           beta-1,4-endoglucanase (cel3 gene).
          Length = 447

 Score =  123 bits (309), Expect(2) = 1e-29
 Identities = 60/120 (50%), Positives = 80/120 (66%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y D L  ++ F++ Q+SGKL  D K++WR DS L D      DL+ G YDAGD +KFGFP
Sbjct: 20  YKDVLTKSLLFYEAQRSGKLPSDQKVTWRKDSALNDKGQNGEDLTGGYYDAGDYVKFGFP 79

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAYTATVLAW ++++    +    L+  + +LKW+TDYL+ AH  +N LY QVGD D DH
Sbjct: 80  MAYTATVLAWGLVDHPAGYSSAGLLDDGRKALKWVTDYLIKAHVSENELYGQVGDGDADH 139



 Score = 29.3 bits (64), Expect(2) = 1e-29
 Identities = 12/21 (57%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT +RP  +I+ S P
Sbjct: 142 WGRPEDMTMARPAYKIDTSNP 162



>gb:MDA511340_1389473 Mastotermes darwinensis mRNA for
           beta-1,4-endoglucanase (cel2 gene).
          Length = 449

 Score =  123 bits (309), Expect(2) = 1e-29
 Identities = 60/120 (50%), Positives = 80/120 (66%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y D L  ++ F++ Q+SGKL  D K++WR DS L D      DL+ G YDAGD +KFGFP
Sbjct: 20  YKDVLTKSLLFYEAQRSGKLPSDQKVTWRKDSALNDKGQNGEDLTGGYYDAGDYVKFGFP 79

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAYTATVLAW ++++    +    L+  + +LKW+TDYL+ AH  +N LY QVGD D DH
Sbjct: 80  MAYTATVLAWGLVDHPAGYSSAGLLDDGRKALKWVTDYLIKAHVSENELYGQVGDGDADH 139



 Score = 29.3 bits (64), Expect(2) = 1e-29
 Identities = 12/21 (57%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT +RP  +I+ S P
Sbjct: 144 WGRPEDMTMARPAYKIDTSRP 164



>pir|A86158|A86158 endo-1,4-beta glucanase [imported] - Arabidopsis
           thaliana>gb:AE005172_889298 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC009525_1536843 Arabidopsis thaliana
           chromosome I BAC F22D16 genomic sequence, complete
           sequence.
          Length = 501

 Score =  125 bits (313), Expect(2) = 2e-29
 Identities = 58/120 (48%), Positives = 87/120 (72%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL  ++ FF+ Q+SGKL  N +++WR +SGL DG + ++DL  G YDAGD MKFGFP
Sbjct: 44  YKDALSKSILFFEGQRSGKLPPNQRMTWRSNSGLSDGSALNVDLVGGYYDAGDNMKFGFP 103

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+L+W+++E+G  M    +L  AK +++W TD+L+ A    + +Y+QVGDP++DH
Sbjct: 104 MAFTTTMLSWSLIEFGGLMK--SELPNAKDAIRWATDFLLKATSHPDTIYVQVGDPNMDH 161



 Score = 27.3 bits (59), Expect(2) = 2e-29
 Identities = 9/22 (40%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +++ + P
Sbjct: 163 CWERPEDMDTPRSVFKVDKNNP 184



>pir|T52135|T52135 cellulase (EC 3.2.1.4) [imported] - Arabidopsis
           thaliana>gb:AF034573_1762778 Arabidopsis thaliana
           endo-1,4-beta glucanase (CEL2) mRNA, complete cds.
          Length = 501

 Score =  125 bits (313), Expect(2) = 2e-29
 Identities = 58/120 (48%), Positives = 87/120 (72%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL  ++ FF+ Q+SGKL  N +++WR +SGL DG + ++DL  G YDAGD MKFGFP
Sbjct: 44  YKDALSKSILFFEGQRSGKLPPNQRMTWRSNSGLSDGSALNVDLVGGYYDAGDNMKFGFP 103

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+L+W+++E+G  M    +L  AK +++W TD+L+ A    + +Y+QVGDP++DH
Sbjct: 104 MAFTTTMLSWSLIEFGGLMK--SELPNAKDAIRWATDFLLKATSHPDTIYVQVGDPNMDH 161



 Score = 27.3 bits (59), Expect(2) = 2e-29
 Identities = 9/22 (40%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +++ + P
Sbjct: 163 CWERPEDMDTPRSVFKVDKNNP 184



>gb:AY072099_1566993 Arabidopsis thaliana putative cellulase
           (At3g43860) mRNA, complete cds.
          Length = 486

 Score =  124 bits (312), Expect(2) = 2e-29
 Identities = 58/125 (46%), Positives = 84/125 (67%), Gaps = 1/125 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL  ++ F + Q+SGKL  +N++ WRGDS L DGK  ++DLS G YDAGD +K+G P
Sbjct: 35  YKDALTKSLIFLEAQRSGKLPPNNRVPWRGDSALDDGKLVNVDLSGGYYDAGDNVKYGLP 94

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T LAW+ + Y  ++    +LE A+ +++W TDY +      N LY+QVGDP+ DH
Sbjct: 95  MAFTITTLAWSTITYEKELRATGELENARAAIRWGTDYFLKCASRKNRLYVQVGDPNADH 154

Query: 757 KMLAK 771
           +  A+
Sbjct: 155 QCWAR 159



 Score = 27.7 bits (60), Expect(2) = 2e-29
 Identities = 10/23 (43%), Positives = 15/23 (65%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           +CW RPE+M   R + +I+  VP
Sbjct: 155 QCWARPENMKTPRTVLEISDKVP 177



>pir|T47422|T47422 cellulase-like protein - Arabidopsis
           thaliana>gb:ATT28A8_1555560 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T28A8.
          Length = 483

 Score =  124 bits (312), Expect(2) = 2e-29
 Identities = 58/125 (46%), Positives = 84/125 (67%), Gaps = 1/125 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL  ++ F + Q+SGKL  +N++ WRGDS L DGK  ++DLS G YDAGD +K+G P
Sbjct: 35  YKDALTKSLIFLEAQRSGKLPPNNRVPWRGDSALDDGKLVNVDLSGGYYDAGDNVKYGLP 94

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T LAW+ + Y  ++    +LE A+ +++W TDY +      N LY+QVGDP+ DH
Sbjct: 95  MAFTITTLAWSTITYEKELRATGELENARAAIRWGTDYFLKCASRKNRLYVQVGDPNADH 154

Query: 757 KMLAK 771
           +  A+
Sbjct: 155 QCWAR 159



 Score = 27.7 bits (60), Expect(2) = 2e-29
 Identities = 10/23 (43%), Positives = 15/23 (65%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           +CW RPE+M   R + +I+  VP
Sbjct: 155 QCWARPENMKTPRTVLEISDKVP 177



>pir|T01419|T01419 cellulase (EC 3.2.1.4) T2H3.5 precursor -
           Arabidopsis thaliana>gb:ATCHRIV6_1546217 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           6.>gb:AY079162_1568186 Arabidopsis thaliana
           AT4g02290/T2H3_5 mRNA, complete cds.>gb:AY101518_1577629
           Arabidopsis thaliana AT4g02290/T2H3_5 mRNA, complete
           cds.>gb:T2H3_1723950 Arabidopsis thaliana BAC T2H3.
          Length = 516

 Score =  122 bits (307), Expect(2) = 2e-29
 Identities = 59/120 (49%), Positives = 85/120 (70%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL  ++ FF+ Q+SGKL  N ++SWR DSGL DG +  +DL  G YDAGD +KFGFP
Sbjct: 53  YKDALTKSILFFEGQRSGKLPSNQRMSWRRDSGLSDGSALHVDLVGGYYDAGDNIKFGFP 112

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+L+W+++E+G  M    +L+ AK +++W TDYL+ A    + +Y+QVGD + DH
Sbjct: 113 MAFTTTMLSWSVIEFGGLMK--SELQNAKIAIRWATDYLLKATSQPDTIYVQVGDANKDH 170



 Score = 29.3 bits (64), Expect(2) = 2e-29
 Identities = 9/22 (40%), Positives = 16/22 (72%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +++ ++P
Sbjct: 172 CWERPEDMDTVRSVFKVDKNIP 193



>pir|T10734|T10734 cellulase (EC 3.2.1.4) 1 precursor - Monterey
           pine>gb:PRU76725_1701855 Pinus radiata
           endo-beta-1,4-glucanase (PrCel1) mRNA, complete cds.
          Length = 510

 Score =  121 bits (303), Expect(2) = 2e-29
 Identities = 59/124 (47%), Positives = 85/124 (68%), Gaps = 1/124 (0%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           +  Y DAL  A+ F++ Q+SGKL  + +++WR DS L DG S  +DL  G YDAGD +KF
Sbjct: 45  SHNYRDALSKAILFYEGQRSGKLPGSQRMTWRRDSALSDGFSQHVDLVGGYYDAGDNVKF 104

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD 747
           GFPMA+T T+L+W++LE+G  M    +L  +K +++W TDYL+ A      +Y+QVGDP+
Sbjct: 105 GFPMAFTTTMLSWSVLEFGGFMG--GELANSKDAIRWATDYLLKATAHPGTIYVQVGDPN 162

Query: 748 LDHK 759
            DHK
Sbjct: 163 TDHK 166



 Score = 30.8 bits (68), Expect(2) = 2e-29
 Identities = 11/23 (47%), Positives = 17/23 (73%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           KCW+RPEDM  +R + +I++  P
Sbjct: 166 KCWERPEDMDTARTVYKIDSQHP 188



>gb:AB049199_1520788 Populus alba PopCel1 gene for endo-1,4-beta
           glucanase, complete cds.
          Length = 494

 Score =  125 bits (314), Expect(2) = 2e-29
 Identities = 60/125 (48%), Positives = 90/125 (72%), Gaps = 2/125 (1%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           +Q Y +AL+  + FF+ Q+SGKL  N +++WRGDSGL DG +  ++L  G YDAGD +KF
Sbjct: 30  SQDYANALEKPILFFEGQRSGKLPSNQRLAWRGDSGLSDGSTYHVNLVGGYYDAGDNVKF 89

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVN-AHPDDNVLYIQVGDP 744
           G PMA+T T+LAW+++E+G  M    Q+E AK +++W TDYL+  A    + LY+QVG+P
Sbjct: 90  GLPMAFTTTLLAWSVIEFGSSMQ--NQIENAKAAIRWSTDYLLKAATATPDTLYVQVGNP 147

Query: 745 DLDHK 759
           ++DH+
Sbjct: 148 NMDHR 152



 Score = 26.6 bits (57), Expect(2) = 2e-29
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           +CW+RPEDM   R + ++    P
Sbjct: 152 RCWERPEDMDTPRNVYKVTIHNP 174



>gb:SNCELLUMR_1715553 S.nigra mRNA for cellulase.
          Length = 508

 Score =  121 bits (304), Expect(2) = 3e-29
 Identities = 57/124 (45%), Positives = 84/124 (67%), Gaps = 1/124 (0%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           T  Y DAL  A+ FF+ Q+SGKL  N ++ WRGDS L DGK  +++L+ G YDAGD +KF
Sbjct: 31  TYDYKDALTKAILFFEGQRSGKLPTNQRVKWRGDSALSDGKPHNVNLTGGYYDAGDNVKF 90

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD 747
           G+PMAYT ++L+W  +EY  +++   QL   + +++W T+Y++ AH     LY QVGD +
Sbjct: 91  GWPMAYTVSLLSWAAVEYKQEISPTNQLRYLQTAIRWGTNYILRAHTSSTTLYTQVGDGN 150

Query: 748 LDHK 759
            DH+
Sbjct: 151 SDHQ 154



 Score = 30.0 bits (66), Expect(2) = 3e-29
 Identities = 11/23 (47%), Positives = 16/23 (69%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           +CW+RPEDM   R L +I ++ P
Sbjct: 154 QCWERPEDMDTPRTLYKITSTSP 176



>pir|S46500|S46500 cellulase (EC 3.2.1.4) - European elder
           (fragment)
          Length = 507

 Score =  121 bits (304), Expect(2) = 3e-29
 Identities = 57/124 (45%), Positives = 84/124 (67%), Gaps = 1/124 (0%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           T  Y DAL  A+ FF+ Q+SGKL  N ++ WRGDS L DGK  +++L+ G YDAGD +KF
Sbjct: 31  TYDYKDALTKAILFFEGQRSGKLPTNQRVKWRGDSALSDGKPHNVNLTGGYYDAGDNVKF 90

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD 747
           G+PMAYT ++L+W  +EY  +++   QL   + +++W T+Y++ AH     LY QVGD +
Sbjct: 91  GWPMAYTVSLLSWAAVEYKQEISPTNQLRYLQTAIRWGTNYILRAHTSSTTLYTQVGDGN 150

Query: 748 LDHK 759
            DH+
Sbjct: 151 SDHQ 154



 Score = 30.0 bits (66), Expect(2) = 3e-29
 Identities = 11/23 (47%), Positives = 16/23 (69%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           +CW+RPEDM   R L +I ++ P
Sbjct: 154 QCWERPEDMDTPRTLYKITSTSP 176



>gb:PPPCEL1_1701412 P.persica mRNA for endo-beta-1,4-glucanase,
           pcel1.>gb:PPPPEG1_1701424 P.persica ppEG1 gene.
          Length = 497

 Score =  124 bits (311), Expect(2) = 3e-29
 Identities = 62/124 (50%), Positives = 86/124 (69%), Gaps = 2/124 (1%)
 Frame = +1

Query: 394 QKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG 570
           Q Y DAL+ ++ FF+ Q+SGKL  N + +WR +SGL DG S  +DL  G YDAGD +KFG
Sbjct: 31  QDYSDALEKSILFFEGQRSGKLPANQRATWRANSGLSDGSSYHVDLVGGYYDAGDNVKFG 90

Query: 571 FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPD-DNVLYIQVGDPD 747
            PMA+T T+LAW+++E+GD M    Q+E AK +++W TDYL+ A       LY+QV DP+
Sbjct: 91  LPMAFTTTLLAWSVIEFGDSMH--NQIENAKDAIRWSTDYLLKAATSTPGALYVQVADPN 148

Query: 748 LDHK 759
            DH+
Sbjct: 149 ADHQ 152



 Score = 27.3 bits (59), Expect(2) = 3e-29
 Identities = 9/23 (39%), Positives = 15/23 (65%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           +CW+RPEDM   R + +++   P
Sbjct: 152 QCWERPEDMDTPRNVYKVSTQNP 174



>gb:AB055886_1521610 Atriplex lentiformis Al-cel1 mRNA for
           beta-1,4-glucanase, complete cds.
          Length = 493

 Score =  124 bits (311), Expect(2) = 3e-29
 Identities = 60/121 (49%), Positives = 85/121 (70%), Gaps = 1/121 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL+ ++ FF+ Q+SG L  + +++WRGDSGL DG S  +DL  G YDAGD +KFG P
Sbjct: 30  YHDALQKSILFFEGQRSGPLPSSQRLNWRGDSGLSDGSSYHVDLVGGYYDAGDNVKFGLP 89

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+LAW+++E+G  M    QL  AK +++W  DYL+ A      LY+QVG+P+LDH
Sbjct: 90  MAFTTTMLAWSVIEFGSSMH--DQLSAAKDAVRWGADYLLKAAATPGTLYVQVGEPNLDH 147

Query: 757 K 759
           +
Sbjct: 148 Q 148



 Score = 27.3 bits (59), Expect(2) = 3e-29
 Identities = 9/23 (39%), Positives = 15/23 (65%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           +CW+RPEDM   R + +++   P
Sbjct: 148 QCWERPEDMDTPRNVYKVSTQNP 170



>gb:AF220596_1252369 Panesthia cribrata beta-1,4-endoglucanase 1
           mRNA, complete cds.
          Length = 450

 Score =  122 bits (307), Expect(2) = 3e-29
 Identities = 59/123 (47%), Positives = 77/123 (62%), Gaps = 1/123 (0%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           T  Y   L+ ++ F++ Q+SGKL  D K++WR DS L D      DL+ G YDAGD +KF
Sbjct: 20  TYDYAQVLQYSLLFYEAQRSGKLPADQKVTWRKDSALNDKGQNGEDLTGGYYDAGDFVKF 79

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD 747
           GFPMAYTATVLAW ++ +         LE A+ ++KW TDY + AH  +N  Y QVG  D
Sbjct: 80  GFPMAYTATVLAWGVISHEQGYQKANALEDARKAVKWATDYFIKAHVSENEFYGQVGRGD 139

Query: 748 LDH 756
           LDH
Sbjct: 140 LDH 142



 Score = 28.9 bits (63), Expect(2) = 3e-29
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT  RP  +I+A  P
Sbjct: 145 WGRPEDMTMERPAYKIDAQHP 165



>gb:MDA511343_1389476 Mastotermes darwinensis mRNA for
           beta-1,4-endoglucanase (cel5 gene).
          Length = 448

 Score =  122 bits (305), Expect(2) = 4e-29
 Identities = 59/120 (49%), Positives = 79/120 (65%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y D L  ++ F++ Q+SGKL  D K++WR DS L D      DL+ G YDAGD +KFGFP
Sbjct: 20  YNDVLTKSLLFYEAQRSGKLPSDQKVTWRKDSALNDKGQNGEDLTGGYYDAGDYVKFGFP 79

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAYTATVLAW ++++    +    L+  + ++KW+TDYL+ AH   N LY QVGD D DH
Sbjct: 80  MAYTATVLAWGLVDHPAGYSSAGVLDDGRKAVKWVTDYLIKAHVSKNELYGQVGDGDADH 139



 Score = 29.3 bits (64), Expect(2) = 4e-29
 Identities = 12/21 (57%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT +RP  +I+ S P
Sbjct: 142 WGRPEDMTMARPAYKIDTSRP 162



>gb:AP005319_1850531 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0643A10.
          Length = 508

 Score =  122 bits (306), Expect(2) = 5e-29
 Identities = 59/120 (49%), Positives = 85/120 (70%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YGDAL  ++ FF+ Q+SG+L  D ++ WR DSGL DG +AS+DL+ G YDAGD +KFGFP
Sbjct: 37  YGDALHKSILFFEGQRSGRLPPDQRLRWRRDSGLHDGAAASVDLTGGYYDAGDNVKFGFP 96

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+TAT+++W ++++G      K  E A+ +++W TDYL+ A    N +Y+QVGD   DH
Sbjct: 97  MAFTATLMSWGLIDFGRSFGPHK--EEARKAVRWATDYLMKATAKPNTVYVQVGDAFRDH 154



 Score = 28.5 bits (62), Expect(2) = 5e-29
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +++ S P
Sbjct: 156 CWERPEDMDTPRTVYKVDPSHP 177



>pir|T07883|T07883 cellulase (EC 3.2.1.4) - sweet
           orange>gb:AF000135_1760472 Citrus sinensis acidic
           cellulase mRNA, complete cds.
          Length = 505

 Score =  124 bits (310), Expect(2) = 5e-29
 Identities = 61/123 (49%), Positives = 86/123 (69%), Gaps = 2/123 (1%)
 Frame = +1

Query: 394 QKYGDALKIAMQFFDVQKSGKLVDNK-ISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG 570
           Q Y DAL  ++ FF+ Q+SG+L  N+ ++WRG+SGL DG S  +DL  G YDAGD +KFG
Sbjct: 39  QDYSDALGKSILFFEGQRSGRLPPNQQLTWRGNSGLSDGSSYHVDLVGGYYDAGDNVKFG 98

Query: 571 FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAH-PDDNVLYIQVGDPD 747
            PMA+T T+L+W+++E+G  M     LE AK +++W TDYL+ A       LY+QVGDP+
Sbjct: 99  LPMAFTTTLLSWSVIEFGSSMQ--NHLENAKAAIRWGTDYLLKASTATPGALYVQVGDPN 156

Query: 748 LDH 756
           +DH
Sbjct: 157 MDH 159



 Score = 26.9 bits (58), Expect(2) = 5e-29
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +++   P
Sbjct: 161 CWERPEDMDTPRNVYKVSTQNP 182



>gb:AY781897_1628327 Saccharum hybrid cultivar isolate c3 cellulase
           mRNA, partial cds.
          Length = 84

 Score =  129 bits (325), Expect = 5e-29
 Identities = 61/82 (74%), Positives = 69/82 (84%)
 Frame = +1

Query: 448 SGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGD 627
           SGKL +N+I WRGDS L DGK A LDLSKGMYDAGD MKF FPMA+TATVLAW++LEYGD
Sbjct: 1   SGKLENNQIPWRGDSALTDGKEAGLDLSKGMYDAGDHMKFTFPMAFTATVLAWSVLEYGD 60

Query: 628 QMAVVKQLEPAKGSLKWITDYL 693
           QM+  KQL+PA  +LKWITD L
Sbjct: 61  QMSAAKQLDPALDALKWITDSL 82



>gb:MDA511342_1389475 Mastotermes darwinensis mRNA for
           beta-1,4-endoglucanase (cel4 gene).
          Length = 448

 Score =  121 bits (303), Expect(2) = 6e-29
 Identities = 59/120 (49%), Positives = 79/120 (65%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y D L  ++ F++ Q+SGKL  D K++WR DS L D      DL+ G YDAGD +KFGFP
Sbjct: 20  YKDVLTKSLLFYEAQRSGKLPSDQKVTWRRDSALNDKGQNGEDLTGGYYDAGDYVKFGFP 79

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAYTATVLAW ++++    +    L+  + ++KW+TDYL+ AH   N LY QVGD D DH
Sbjct: 80  MAYTATVLAWGLVDHPAGYSSAGVLDDGRKAVKWVTDYLIKAHVSKNELYGQVGDGDADH 139



 Score = 29.3 bits (64), Expect(2) = 6e-29
 Identities = 12/21 (57%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT +RP  +I+ S P
Sbjct: 142 WGRPEDMTMARPAYKIDTSRP 162



>gb:AP003722_1832402 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1011A07.
          Length = 499

 Score =  120 bits (301), Expect(2) = 8e-29
 Identities = 58/120 (48%), Positives = 86/120 (71%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL  ++ FF+ Q+SGKL  + ++SWRGDSGL DG S  +DL  G YDAGD MKFGFP
Sbjct: 36  YRDALTKSILFFEGQRSGKLPPSQRVSWRGDSGLSDGSSIKVDLVGGYYDAGDNMKFGFP 95

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           +A++ T+LAW+++E+G  M    +L+ A+ +++W +DYL+ A    + +Y+QVGD + DH
Sbjct: 96  LAFSMTMLAWSVVEFGGLMK--GELQHARDAVRWGSDYLLKATAHPDTVYVQVGDANRDH 153



 Score = 29.6 bits (65), Expect(2) = 8e-29
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +++ S P
Sbjct: 155 CWERPEDMDTPRTVYKVDPSTP 176



>pir|T07025|T07025 cellulase (EC 3.2.1.4) -
           tomato>gb:LEE14BDGL_1684294 L.esculentum mRNA for
           endo-1,4-beta-D-glucanase.
          Length = 479

 Score =  129 bits (323), Expect = 9e-29
 Identities = 67/137 (48%), Positives = 93/137 (67%), Gaps = 2/137 (1%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL+ ++ FF+ Q+SGKL  N ++SWRG+SGL+DG  A +DLS G YDAGD +KF FP
Sbjct: 20  YRDALEKSILFFEGQRSGKLPPNQRLSWRGNSGLQDGSLAKVDLSGGYYDAGDNVKFNFP 79

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVN-AHPDDNVLYIQVGDPDLD 753
           MAYT T+L+W  LEYG +M    QL+ A+ +++W TDY +  A+   N L++ VGDP+ D
Sbjct: 80  MAYTTTMLSWNTLEYGKRMGA--QLQHARAAIRWATDYFLKCANAAPNKLFVGVGDPNAD 137

Query: 754 HKMLAKA*RHD*IEASY 804
           HK   +    D I + Y
Sbjct: 138 HKCWERPEDMDTIRSVY 154



>gb:OSJN00293_1698078 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: P0041A24, complete sequence.
          Length = 500

 Score =  118 bits (295), Expect(2) = 1e-28
 Identities = 58/122 (47%), Positives = 83/122 (68%), Gaps = 2/122 (1%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL  ++ FF  Q+SG+L  D  + WR +SGL DG +A++DL+ G YD GD +KFGFP
Sbjct: 39  YADALAKSILFFQGQRSGRLPPDQAVKWRSNSGLSDGSAANVDLTGGYYDGGDNVKFGFP 98

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVN-AHPDDNVLYIQVGDPDLD 753
           MA+T T+L+W ++EYG +M   + L  A+ +++W  DYL+  A     VLY+ VGDPD D
Sbjct: 99  MAFTTTMLSWGVVEYGGRMR-GRVLRDARDAVRWAADYLLRAATATPGVLYVGVGDPDAD 157

Query: 754 HK 759
           H+
Sbjct: 158 HR 159



 Score = 31.2 bits (69), Expect(2) = 1e-28
 Identities = 11/23 (47%), Positives = 16/23 (69%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           +CW+RPEDM   R +  ++AS P
Sbjct: 159 RCWERPEDMDTPRAVYSVSASSP 181



>gb:CAN010950_1645055 Capsicum annuum eg2 gene.
          Length = 497

 Score =  122 bits (305), Expect(2) = 1e-28
 Identities = 60/125 (48%), Positives = 88/125 (70%), Gaps = 2/125 (1%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           +Q Y +AL+ ++ FF+ Q+SGKL  N ++ WRG+SGL DG  + ++L  G YDAGD +KF
Sbjct: 30  SQDYSNALEKSILFFEGQRSGKLPANQRVKWRGNSGLSDGSGSHVNLVGGYYDAGDNVKF 89

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVN-AHPDDNVLYIQVGDP 744
           G PMA+T T+LAW+++E+G  M    QL  AK +++W TDYL+  A    + LY+QVGDP
Sbjct: 90  GLPMAFTTTLLAWSVIEFGSSMH--SQLGHAKEAIRWSTDYLLKAATASPDTLYVQVGDP 147

Query: 745 DLDHK 759
           + DH+
Sbjct: 148 NQDHR 152



 Score = 27.3 bits (59), Expect(2) = 1e-28
 Identities = 9/23 (39%), Positives = 15/23 (65%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           +CW+RPEDM   R + +++   P
Sbjct: 152 RCWERPEDMDTPRNVYKVSPQNP 174



>gb:CACCEL2_1644854 Capsicum annuum mRNA for
           endo-beta-1,4-glucanase, ccel2.
          Length = 497

 Score =  122 bits (305), Expect(2) = 1e-28
 Identities = 60/125 (48%), Positives = 88/125 (70%), Gaps = 2/125 (1%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           +Q Y +AL+ ++ FF+ Q+SGKL  N ++ WRG+SGL DG  + ++L  G YDAGD +KF
Sbjct: 30  SQDYSNALEKSILFFEGQRSGKLPANQRVKWRGNSGLSDGSGSHVNLVGGYYDAGDNVKF 89

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVN-AHPDDNVLYIQVGDP 744
           G PMA+T T+LAW+++E+G  M    QL  AK +++W TDYL+  A    + LY+QVGDP
Sbjct: 90  GLPMAFTTTLLAWSVIEFGSSMH--SQLGHAKEAIRWSTDYLLKAATASPDTLYVQVGDP 147

Query: 745 DLDHK 759
           + DH+
Sbjct: 148 NQDHR 152



 Score = 27.3 bits (59), Expect(2) = 1e-28
 Identities = 9/23 (39%), Positives = 15/23 (65%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           +CW+RPEDM   R + +++   P
Sbjct: 152 RCWERPEDMDTPRNVYKVSPQNP 174



>gb:AF077339_1766215 Lycopersicon esculentum endo-1,4-beta-glucanase
           (cel5) mRNA, complete cds.
          Length = 497

 Score =  121 bits (304), Expect(2) = 2e-28
 Identities = 60/125 (48%), Positives = 85/125 (68%), Gaps = 2/125 (1%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           +Q Y +AL  + +FF+ Q+SGKL  N ++ WR DSGL DG    +DL  G YDAGD +KF
Sbjct: 33  SQDYSNALDKSTRFFEGQRSGKLPANQRLKWRADSGLSDGSGYHVDLVGGYYDAGDNVKF 92

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVN-AHPDDNVLYIQVGDP 744
           G PMA+T T+LAW+++E+G  M    QL  AK +++W +DYL+  A    + LY+QVGDP
Sbjct: 93  GLPMAFTTTLLAWSVIEFGSSMH--SQLNNAKAAIRWSSDYLLKAATASPDTLYVQVGDP 150

Query: 745 DLDHK 759
           + DH+
Sbjct: 151 NQDHR 155



 Score = 27.3 bits (59), Expect(2) = 2e-28
 Identities = 9/23 (39%), Positives = 15/23 (65%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           +CW+RPEDM   R + +++   P
Sbjct: 155 RCWERPEDMDTPRNVYKVSPQNP 177



>gb:AF051346_1764244 Fragaria x ananassa cellulase (Cel1) mRNA,
           complete cds.
          Length = 496

 Score =  121 bits (303), Expect(2) = 2e-28
 Identities = 60/120 (50%), Positives = 84/120 (70%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL+ ++ FF+ Q+SGKL  D ++ WRGDS L DG +A +DL+ G YDAGD +KFGFP
Sbjct: 36  YHDALRKSILFFEGQRSGKLPHDQRLKWRGDSALHDGSTAGVDLTGGYYDAGDNVKFGFP 95

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+LAW+I+++G  M    +   A  +L+W TDYL+ A     V+++QVGDP  DH
Sbjct: 96  MAFTTTLLAWSIIDFGRVMGT--EQRNAVKALRWGTDYLLKATAVPGVVFVQVGDPYSDH 153



 Score = 27.3 bits (59), Expect(2) = 2e-28
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +I+ + P
Sbjct: 155 CWERPEDMDTRRTVYKIDHNNP 176



>pir|T07885|T07885 cellulase (EC 3.2.1.4) - sweet
           orange>gb:AF000136_1760473 Citrus sinensis basic
           cellulase mRNA, complete cds.
          Length = 488

 Score =  116 bits (291), Expect(2) = 3e-28
 Identities = 59/122 (48%), Positives = 84/122 (68%), Gaps = 2/122 (1%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y +AL  ++ FF  Q+SG+L  D +I+WR +SGL DG  A +DL+ G YDAGD +KF FP
Sbjct: 28  YREALAKSLLFFQGQRSGRLPKDQQITWRSNSGLSDGLFAHVDLTGGYYDAGDNVKFNFP 87

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVN-AHPDDNVLYIQVGDPDLD 753
           MA+T T+L+W+ LEYG +M    +L+ A+ +++W TDYL+  A      LY+ VGDP+ D
Sbjct: 88  MAFTTTMLSWSTLEYGKKMG--PELQNARAAIRWATDYLLKCATATPGKLYVGVGDPNAD 145

Query: 754 HK 759
           HK
Sbjct: 146 HK 147



 Score = 31.6 bits (70), Expect(2) = 3e-28
 Identities = 12/23 (52%), Positives = 16/23 (69%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           KCW+RPEDM   R +  ++AS P
Sbjct: 147 KCWERPEDMDTVRSVYSVSASNP 169



>gb:AB058671_1196903 Coptotermes formosanus CfEG4 mRNA for
           endo-b-1,4-glucanase, complete cds.
          Length = 448

 Score =  117 bits (293), Expect(2) = 3e-28
 Identities = 57/120 (47%), Positives = 75/120 (62%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y   LK ++ F++ Q+SGKL  D K++WR DS L D      DL+ G YDAGD +KFGFP
Sbjct: 20  YKTVLKNSLLFYEAQRSGKLPADQKVTWRKDSALNDKGQKGEDLTGGYYDAGDFVKFGFP 79

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAYT TVLAW +++Y    +    L+  + +LKW TDY + AH   N  Y QVG  D+DH
Sbjct: 80  MAYTVTVLAWGLVDYESAYSTAGALDDGRKALKWGTDYFLKAHTAANEFYGQVGQGDVDH 139



 Score = 30.8 bits (68), Expect(2) = 3e-28
 Identities = 13/21 (61%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT SRP  +I+ S P
Sbjct: 142 WGRPEDMTMSRPAYKIDTSKP 162



>gb:AB058670_1196902 Coptotermes formosanus CfEG3 mRNA for
           endo-b-1,4-glucanase, complete cds.
          Length = 448

 Score =  117 bits (293), Expect(2) = 3e-28
 Identities = 57/120 (47%), Positives = 75/120 (62%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y   LK ++ F++ Q+SGKL  D K++WR DS L D      DL+ G YDAGD +KFGFP
Sbjct: 20  YKTVLKNSLLFYEAQRSGKLPADQKVTWRKDSALNDKGQKGEDLTGGYYDAGDFVKFGFP 79

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAYT TVLAW +++Y    +    L+  + +LKW TDY + AH   N  Y QVG  D+DH
Sbjct: 80  MAYTVTVLAWGLVDYESAYSTAGALDDGRKALKWGTDYFLKAHTAANEFYGQVGQGDVDH 139



 Score = 30.8 bits (68), Expect(2) = 3e-28
 Identities = 13/21 (61%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT SRP  +I+ S P
Sbjct: 142 WGRPEDMTMSRPAYKIDTSKP 162



>gb:AB058669_1196901 Coptotermes formosanus CfEG2 mRNA for
           endo-b-1,4-glucanase, complete cds.
          Length = 448

 Score =  117 bits (293), Expect(2) = 3e-28
 Identities = 57/120 (47%), Positives = 75/120 (62%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y   LK ++ F++ Q+SGKL  D K++WR DS L D      DL+ G YDAGD +KFGFP
Sbjct: 20  YKTVLKNSLLFYEAQRSGKLPADKKVTWRKDSALNDKGQKGEDLTGGYYDAGDFVKFGFP 79

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAYT TVLAW +++Y    +    L+  + +LKW TDY + AH   N  Y QVG  D+DH
Sbjct: 80  MAYTVTVLAWGLVDYESAYSTAGALDDGRKALKWGTDYFLKAHTAANEFYGQVGQGDVDH 139



 Score = 30.8 bits (68), Expect(2) = 3e-28
 Identities = 13/21 (61%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT SRP  +I+ S P
Sbjct: 142 WGRPEDMTMSRPAYKIDTSKP 162



>gb:AB058667_1196899 Coptotermes formosanus CfEG1a mRNA for
           endo-b-1,4-glucanase, complete cds.>gb:AB058668_1196900
           Coptotermes formosanus CfEG1b mRNA for
           endo-b-1,4-glucanase, complete cds.
          Length = 448

 Score =  117 bits (293), Expect(2) = 3e-28
 Identities = 57/120 (47%), Positives = 75/120 (62%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y   LK ++ F++ Q+SGKL  D K++WR DS L D      DL+ G YDAGD +KFGFP
Sbjct: 20  YKTVLKNSLLFYEAQRSGKLPADKKVTWRKDSALNDKGQKGEDLTGGYYDAGDFVKFGFP 79

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAYT TVLAW +++Y    +    L+  + +LKW TDY + AH   N  Y QVG  D+DH
Sbjct: 80  MAYTVTVLAWGLVDYESAYSTAGALDDGRKALKWGTDYFLKAHTAANEFYGQVGQGDVDH 139



 Score = 30.8 bits (68), Expect(2) = 3e-28
 Identities = 13/21 (61%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT SRP  +I+ S P
Sbjct: 142 WGRPEDMTMSRPAYKIDTSKP 162



>gb:AJ585346_526235 Clostridium thermocellum celR gene for
           beta-1,4-glucanase, strain F7.
          Length = 736

 Score =  126 bits (317), Expect = 4e-28
 Identities = 60/121 (49%), Positives = 80/121 (66%), Gaps = 1/121 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG+AL+ A+ F++ Q SGKL DN + +WRGDS L DG    LDL+ G +DAGD +KF  P
Sbjct: 31  YGEALQKAIMFYEFQMSGKLPDNIRNNWRGDSCLGDGSDVGLDLTGGWFDAGDHVKFNLP 90

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAYTAT+LAW + EY D +    QL      +KW +DY +  HP+  V Y QVG+ D+DH
Sbjct: 91  MAYTATMLAWAVYEYKDALQKSGQLGYLMDQIKWASDYFIRCHPEKYVYYYQVGNGDMDH 150

Query: 757 K 759
           +
Sbjct: 151 R 151



>gb:CSCELZ_119220 C.stercorarium celZ gene for
           endo-beta-1,4-glucanase (Avicelase I).
          Length = 946

 Score =  126 bits (317), Expect = 4e-28
 Identities = 60/120 (50%), Positives = 80/120 (66%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDNKI-SWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG+AL+ A+ F++ Q+SGKL +NK  +WRGDSGL DG    LDL+ G YDAGD +KF  P
Sbjct: 32  YGEALQKAIMFYEFQRSGKLPENKRDNWRGDSGLNDGADVGLDLTGGWYDAGDHVKFNLP 91

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAY+ T+LAW   E  + +    Q+     ++KW++DYL+  HP  NV Y QVGD  LDH
Sbjct: 92  MAYSQTMLAWAAYEAEEALERSGQMGYLLDAIKWVSDYLIKCHPSPNVFYYQVGDGHLDH 151



>sp|P23659|GUNZ_CLOSR Endoglucanase Z precursor (EC 3.2.1.4)
           (Endo-1,4-beta-glucanase) (Thermoactive cellulase)
           (Avicelase I).>pir|S12021|S12021 thermoactive cellulase
           - Clostridium stercorarium
          Length = 986

 Score =  126 bits (317), Expect = 4e-28
 Identities = 60/120 (50%), Positives = 80/120 (66%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDNKI-SWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG+AL+ A+ F++ Q+SGKL +NK  +WRGDSGL DG    LDL+ G YDAGD +KF  P
Sbjct: 32  YGEALQKAIMFYEFQRSGKLPENKRDNWRGDSGLNDGADVGLDLTGGWYDAGDHVKFNLP 91

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAY+ T+LAW   E  + +    Q+     ++KW++DYL+  HP  NV Y QVGD  LDH
Sbjct: 92  MAYSQTMLAWAAYEAEEALERSGQMGYLLDAIKWVSDYLIKCHPSPNVFYYQVGDGHLDH 151



>gb:ATU17888_1556786 Arabidopsis thaliana beta-glucanase mRNA,
           partial cds.
          Length = 319

 Score =  115 bits (288), Expect(2) = 5e-28
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 2/122 (1%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y +AL  ++ FF  Q+SG L    +ISWR  SGL DG +A +DL+ G YDAGD +KF  P
Sbjct: 21  YKEALSKSLLFFQGQRSGPLPRGQQISWRASSGLSDGSAAHVDLTGGYYDAGDNVKFNLP 80

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVN-AHPDDNVLYIQVGDPDLD 753
           MA+T T+L+W+ LEYG +M    +LE A+ +++W TDYL+  A      LY+ VGDP++D
Sbjct: 81  MAFTTTMLSWSALEYGKRMG--PELENARVNIRWATDYLLKCARATPGKLYVAVGDPNVD 138

Query: 754 HK 759
           HK
Sbjct: 139 HK 140



 Score = 32.0 bits (71), Expect(2) = 5e-28
 Identities = 12/23 (52%), Positives = 16/23 (69%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           KCW+RPEDM   R +  ++AS P
Sbjct: 140 KCWERPEDMDTPRTVYSVSASNP 162



>pir|S61430|S61430 cellulase (EC 3.2.1.4) - Arabidopsis thaliana
           (fragment)
          Length = 319

 Score =  115 bits (288), Expect(2) = 5e-28
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 2/122 (1%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y +AL  ++ FF  Q+SG L    +ISWR  SGL DG +A +DL+ G YDAGD +KF  P
Sbjct: 21  YKEALSKSLLFFQGQRSGPLPRGQQISWRASSGLSDGSAAHVDLTGGYYDAGDNVKFNLP 80

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVN-AHPDDNVLYIQVGDPDLD 753
           MA+T T+L+W+ LEYG +M    +LE A+ +++W TDYL+  A      LY+ VGDP++D
Sbjct: 81  MAFTTTMLSWSALEYGKRMG--PELENARVNIRWATDYLLKCARATPGKLYVAVGDPNVD 138

Query: 754 HK 759
           HK
Sbjct: 139 HK 140



 Score = 32.0 bits (71), Expect(2) = 5e-28
 Identities = 12/23 (52%), Positives = 16/23 (69%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           KCW+RPEDM   R +  ++AS P
Sbjct: 140 KCWERPEDMDTPRTVYSVSASNP 162



>gb:GMU34755_1680649 Glycine max cellulase gene, partial cds.
          Length = 217

 Score =  116 bits (291), Expect(2) = 5e-28
 Identities = 55/120 (45%), Positives = 78/120 (65%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YGDAL  A+ FF+ Q+SG L    ++ WRGDS L DGK  ++DL  G YDAGD +KFG+P
Sbjct: 40  YGDALGKAILFFEGQRSGNLPATQRVKWRGDSALSDGKLQNVDLIGGYYDAGDNVKFGWP 99

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T ++L+W  +EY  +++ V QL     ++ W  D+++ AH     LY QVGD + DH
Sbjct: 100 MAFTTSLLSWAAVEYESEISSVNQLGYLHSAIHWGADFILRAHTSPTTLYTQVGDGNADH 159



 Score = 30.8 bits (68), Expect(2) = 5e-28
 Identities = 11/22 (50%), Positives = 17/22 (77%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM  +R + +I+A+ P
Sbjct: 161 CWERPEDMDTARAVYKIDANSP 182



>pir|T06591|T06591 cellulase (EC 3.2.1.4) R10 - soybean (fragment)
          Length = 217

 Score =  116 bits (291), Expect(2) = 5e-28
 Identities = 55/120 (45%), Positives = 78/120 (65%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YGDAL  A+ FF+ Q+SG L    ++ WRGDS L DGK  ++DL  G YDAGD +KFG+P
Sbjct: 40  YGDALGKAILFFEGQRSGNLPATQRVKWRGDSALSDGKLQNVDLIGGYYDAGDNVKFGWP 99

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T ++L+W  +EY  +++ V QL     ++ W  D+++ AH     LY QVGD + DH
Sbjct: 100 MAFTTSLLSWAAVEYESEISSVNQLGYLHSAIHWGADFILRAHTSPTTLYTQVGDGNADH 159



 Score = 30.8 bits (68), Expect(2) = 5e-28
 Identities = 11/22 (50%), Positives = 17/22 (77%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM  +R + +I+A+ P
Sbjct: 161 CWERPEDMDTARAVYKIDANSP 182



>gb:BSP133614_750786 Bacillus sp. BP23 celB gene.
          Length = 997

 Score =  126 bits (316), Expect = 6e-28
 Identities = 58/120 (48%), Positives = 83/120 (69%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y +AL+ A+ F++ Q+SG L  +N++ WRGDSG++DG    +DL+ G YDAGD +KFGFP
Sbjct: 41  YAEALQKAIYFYEAQRSGPLPANNRVEWRGDSGMQDGADVGVDLTGGWYDAGDHVKFGFP 100

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA +AT+LAW+++EY D      QLE  K +++W TDY + AH   N L+ QVG  + DH
Sbjct: 101 MAASATMLAWSVVEYADGYEQAGQLEEIKDNIRWATDYFMKAHTKPNELWGQVGAGNTDH 160



>pir|G86362|G86362 beta-glucanase [imported] - Arabidopsis
           thaliana>gb:AE005172_891240 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:ATAF000657_1543821 Arabidopsis thaliana BAC
           F19G10, complete sequence.
          Length = 484

 Score =  117 bits (292), Expect(2) = 7e-28
 Identities = 59/122 (48%), Positives = 84/122 (68%), Gaps = 2/122 (1%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y +AL  ++ FF  Q+SG+L  D ++SWR  SGL DG SA +DL+ G YDAGD +KF FP
Sbjct: 25  YREALSKSLLFFQGQRSGRLPSDQQLSWRSSSGLSDGSSAHVDLTGGYYDAGDNVKFNFP 84

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVN-AHPDDNVLYIQVGDPDLD 753
           MA+T T+L+W+ LEYG +M    +L+ ++ +++W TDYL+  A      LY+ VGDP+ D
Sbjct: 85  MAFTTTMLSWSSLEYGKKMG--PELQNSRVAIRWATDYLLKCARATPGKLYVGVGDPNGD 142

Query: 754 HK 759
           HK
Sbjct: 143 HK 144



 Score = 30.0 bits (66), Expect(2) = 7e-28
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           KCW+RPEDM   R +  ++ S P
Sbjct: 144 KCWERPEDMDTPRTVYSVSPSNP 166



>gb:AY086043_1571104 Arabidopsis thaliana clone 20797 mRNA, complete
           sequence.
          Length = 484

 Score =  115 bits (287), Expect(2) = 7e-28
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 2/122 (1%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y +AL  ++ FF  Q+SG L    +ISWR  SGL DG +A +DL+ G YDAGD +KF  P
Sbjct: 25  YKEALSKSLLFFQGQRSGPLPRGQQISWRASSGLSDGSAAHVDLTGGYYDAGDNVKFNLP 84

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVN-AHPDDNVLYIQVGDPDLD 753
           MA+T T+L+W+ LEYG +M    +LE A+ +++W TDYL+  A      LY+ VGDP++D
Sbjct: 85  MAFTTTMLSWSALEYGKRMG--PELENARVNIRWATDYLLKCARATPGKLYVGVGDPNVD 142

Query: 754 HK 759
           HK
Sbjct: 143 HK 144



 Score = 32.0 bits (71), Expect(2) = 7e-28
 Identities = 12/23 (52%), Positives = 16/23 (69%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           KCW+RPEDM   R +  ++AS P
Sbjct: 144 KCWERPEDMDTPRTVYSVSASNP 166



>gb:AC016163_1538128 Arabidopsis thaliana chromosome 1 BAC F26A9
           genomic sequence, complete sequence.
          Length = 484

 Score =  115 bits (287), Expect(2) = 7e-28
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 2/122 (1%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y +AL  ++ FF  Q+SG L    +ISWR  SGL DG +A +DL+ G YDAGD +KF  P
Sbjct: 25  YKEALSKSLLFFQGQRSGPLPRGQQISWRASSGLSDGSAAHVDLTGGYYDAGDNVKFNLP 84

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVN-AHPDDNVLYIQVGDPDLD 753
           MA+T T+L+W+ LEYG +M    +LE A+ +++W TDYL+  A      LY+ VGDP++D
Sbjct: 85  MAFTTTMLSWSALEYGKRMG--PELENARVNIRWATDYLLKCARATPGKLYVGVGDPNVD 142

Query: 754 HK 759
           HK
Sbjct: 143 HK 144



 Score = 32.0 bits (71), Expect(2) = 7e-28
 Identities = 12/23 (52%), Positives = 16/23 (69%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           KCW+RPEDM   R +  ++AS P
Sbjct: 144 KCWERPEDMDTPRTVYSVSASNP 166



>gb:AF336120_1263677 Coptotermes acinaciformis cellulase mRNA,
           complete cds.
          Length = 448

 Score =  116 bits (290), Expect(2) = 7e-28
 Identities = 57/120 (47%), Positives = 77/120 (64%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y   LK ++ F++ Q+SGKL  D K++WR DS L D  +   DL+ G YDAGD +KFGFP
Sbjct: 20  YTTVLKSSLLFYEAQRSGKLPADQKVTWRKDSALDDKGNNGEDLTGGYYDAGDFVKFGFP 79

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           +AYTATVLAW +++Y    +     +  + ++KW TDYL+ AH     LY QVGD D DH
Sbjct: 80  LAYTATVLAWGLVDYEAGYSSAGATDDGRKAVKWATDYLLKAHTAATELYGQVGDGDADH 139



 Score = 30.8 bits (68), Expect(2) = 7e-28
 Identities = 13/21 (61%), Positives = 16/21 (76%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT +RP  +I+AS P
Sbjct: 142 WGRPEDMTMARPAYKIDASRP 162



>gb:AF078038S5_476986 Caldicellulosiruptor sp. Tok7B.1 glycosyl
           hydrolase 6 gene, partial cds; and CelE gene, complete
           cds.
          Length = 1751

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/129 (46%), Positives = 78/129 (60%), Gaps = 1/129 (0%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           T  YG+AL+  + F++ Q SGKL    + +WRGDSGL DGK   LDL+ G +DAGD +KF
Sbjct: 38  TYNYGEALQKTIMFYEFQMSGKLPSWVRNNWRGDSGLDDGKDVGLDLTGGWHDAGDHVKF 97

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD 747
             PM+Y+A++L W + EY D     KQLE     ++W  DY V  HP   V Y QVGDP 
Sbjct: 98  NLPMSYSASMLGWAVYEYKDAFVKSKQLEHILNQIEWANDYFVKCHPSKYVYYYQVGDPT 157

Query: 748 LDHKMLAKA 774
           +DH     A
Sbjct: 158 VDHNFWGPA 166



>sp|P26224|GUNF_CLOTM Endoglucanase F precursor (EC 3.2.1.4) (EGF)
           (Endo-1,4-beta-glucanase) (Cellulase
           F).>pir|S15727|S15727 cellulase (EC 3.2.1.4) F precursor
           - Clostridium thermocellum>gb:CTCELFG_119507
           C.thermocellum celF gene for endo-1,4-beta-glucanase.
          Length = 739

 Score =  125 bits (314), Expect = 1e-27
 Identities = 61/120 (50%), Positives = 77/120 (64%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDNKIS-WRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG+AL+ A+ F++ Q+SGKL +NK + WRGDS L DG    LDL+ G YDAGD +KF  P
Sbjct: 32  YGEALQKAIMFYEFQRSGKLPENKRNNWRGDSALNDGADNGLDLTGGWYDAGDHVKFNLP 91

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAY  T+LAW++ E  D      QL     ++KW TDY +  HP  NV Y QVGD  LDH
Sbjct: 92  MAYAVTMLAWSVYESRDAYVQSGQLPYILDNIKWATDYFIKCHPSPNVYYYQVGDGALDH 151



>pir|E86366|E86366 protein F26F24.6 [imported] - Arabidopsis
           thaliana>gb:AE005172_891272 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC002311_1530214 Arabidopsis thaliana
           chromosome I BAC T26J12 genomic sequence, complete
           sequence.>gb:AC005292_1532415 Genomic sequence for
           Arabidopsis thaliana BAC F26F24 from chromosome I,
           complete sequence.
          Length = 489

 Score =  120 bits (301), Expect(2) = 1e-27
 Identities = 58/120 (48%), Positives = 86/120 (71%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL+ ++ FF+ Q+SGKL  D ++ WR DS L+DG SA +DL+ G YDAGD +KFGFP
Sbjct: 29  YRDALRKSILFFEGQRSGKLPPDQRLKWRRDSALRDGSSAGVDLTGGYYDAGDNVKFGFP 88

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+++W+++++G  M    +LE A  ++KW TDYL+ A    +V+++QVGD   DH
Sbjct: 89  MAFTTTMMSWSVIDFGKTMG--PELENAVKAIKWGTDYLMKATQIPDVVFVQVGDAYSDH 146



 Score = 25.8 bits (55), Expect(2) = 1e-27
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQIN 814
           CW+RPEDM   R + +I+
Sbjct: 148 CWERPEDMDTLRTVYKID 165



>gb:AF220597_1252370 Panesthia cribrata beta-1,4-endoglucanase 2
           mRNA, complete cds.
          Length = 447

 Score =  119 bits (297), Expect(2) = 1e-27
 Identities = 54/123 (43%), Positives = 81/123 (65%), Gaps = 1/123 (0%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           T  Y   ++ ++ F++ Q+SGKL  D K++WR DS L D      DL+ G YDAGD +KF
Sbjct: 18  TYDYSQLIQYSLLFYEAQRSGKLPADQKVTWRKDSALNDKGQNGEDLTGGYYDAGDYVKF 77

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD 747
           G+PMA+TAT+LAW++++Y    A    +E A+ ++KW TDY + AH  ++  Y QVG+ +
Sbjct: 78  GYPMAFTATLLAWSLIDYEQGYAKANSVEDARKAVKWATDYFLKAHVSEHEFYGQVGEGN 137

Query: 748 LDH 756
           LDH
Sbjct: 138 LDH 140



 Score = 26.9 bits (58), Expect(2) = 1e-27
 Identities = 11/21 (52%), Positives = 13/21 (61%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT  RP  +I+   P
Sbjct: 143 WGRPEDMTMERPAYKIDEQNP 163



>gb:AY339624_611177 Bacillus pumilus endoglucanase A precursor
           (EglA) gene, complete cds.
          Length = 659

 Score =  124 bits (312), Expect = 2e-27
 Identities = 58/120 (48%), Positives = 80/120 (66%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y + L+ +M F++ Q+SG+L + N+++WRGDSGLKDGK    DL+ G YDAGD +KFG P
Sbjct: 49  YVEVLQKSMLFYEAQRSGRLPESNRLNWRGDSGLKDGKDVGHDLTGGWYDAGDHVKFGLP 108

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAY+A VLAWT+ EY +     + L+     +KW TDY + AH   N  + QVGD + DH
Sbjct: 109 MAYSAAVLAWTVYEYREAYEEAELLDEILDQIKWATDYFLKAHTGPNEFWAQVGDGNADH 168



>pir|B96527|B96527 protein F27J15.28 [imported] - Arabidopsis
           thaliana>gb:AE005173_892835 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC016041_1538091 Genomic sequence for
           Arabidopsis thaliana BAC F27J15 from chromosome I,
           complete sequence.>gb:BT002935_1636523 Arabidopsis
           thaliana clone RAFL14-97-C17 (R20275) putative glycosyl
           hydrolase family 9 (endo-1,4-beta-glucanase) protein
           (At1g48930) mRNA, complete cds.>gb:BT005638_1638578
           Arabidopsis thaliana clone U20275 putative glycosyl
           hydrolase family 9 (endo-1,4-beta-glucanase) protein
           (At1g48930) mRNA, complete cds.
          Length = 627

 Score =  116 bits (290), Expect(2) = 2e-27
 Identities = 54/120 (45%), Positives = 76/120 (63%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG AL     FF+ Q+SGKL    ++ WRG SGLKDG +  + L  G YDAGD +KFG P
Sbjct: 31  YGSALDKTFLFFEAQRSGKLPAAQRVKWRGPSGLKDGLAQGVSLEGGYYDAGDHVKFGLP 90

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+  T+L+W  ++   +++   Q++    S++W TDY + AHP  NVL+ QVGD + DH
Sbjct: 91  MAFAVTMLSWAAVDNRKELSSSNQMQQTLWSIRWGTDYFIKAHPQPNVLWGQVGDGESDH 150



 Score = 29.3 bits (64), Expect(2) = 2e-27
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDMT SR   +++   P
Sbjct: 152 CWERPEDMTTSRTAYKLDPYHP 173



>gb:AF357596_1790806 Fragaria x ananassa endo-1,4-beta-glucanase
           isoform 10 (Cel1) mRNA, complete cds.
          Length = 496

 Score =  118 bits (295), Expect(2) = 2e-27
 Identities = 59/120 (49%), Positives = 83/120 (69%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL+ ++ FF+ Q+SGKL  D ++ WR DS L DG +A +DL+ G YDAGD +KFGFP
Sbjct: 36  YHDALRKSILFFEGQRSGKLPPDQRLKWRRDSALHDGSTAGVDLTGGYYDAGDNVKFGFP 95

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+LAW+I+++G  M    +   A  +L+W TDYL+ A     V+++QVGDP  DH
Sbjct: 96  MAFTTTLLAWSIIDFGRVMGT--EQRNAVKALRWGTDYLLKATAVPGVVFVQVGDPYSDH 153



 Score = 27.3 bits (59), Expect(2) = 2e-27
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +I+ + P
Sbjct: 155 CWERPEDMDTRRTVYKIDHNNP 176



>gb:AF357595_1790805 Fragaria x ananassa endo-1,4-beta-glucanase
           isoform 09 (Cel1) mRNA, complete cds.
          Length = 496

 Score =  118 bits (295), Expect(2) = 2e-27
 Identities = 59/120 (49%), Positives = 83/120 (69%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL+ ++ FF+ Q+SGKL  D ++ WR DS L DG +A +DL+ G YDAGD +KFGFP
Sbjct: 36  YHDALRKSILFFEGQRSGKLPPDQRLKWRRDSALHDGSTAGVDLTGGYYDAGDNVKFGFP 95

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+LAW+I+++G  M    +   A  +L+W TDYL+ A     V+++QVGDP  DH
Sbjct: 96  MAFTTTLLAWSIIDFGRVMGT--EQRNAVKALRWGTDYLLKATAVPGVVFVQVGDPYSDH 153



 Score = 27.3 bits (59), Expect(2) = 2e-27
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +I+ + P
Sbjct: 155 CWERPEDMDTRRTVYKIDHNNP 176



>gb:AF357591_1790801 Fragaria x ananassa endo-1,4-beta-glucanase
           isoform 05 (Cel1) mRNA, complete
           cds.>gb:AF357592_1790802 Fragaria x ananassa
           endo-1,4-beta-glucanase isoform 06 (Cel1) mRNA, complete
           cds.>gb:AF357593_1790803 Fragaria x ananassa
           endo-1,4-beta-glucanase isoform 07 (Cel1) mRNA, complete
           cds.
          Length = 496

 Score =  118 bits (295), Expect(2) = 2e-27
 Identities = 59/120 (49%), Positives = 83/120 (69%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL+ ++ FF+ Q+SGKL  D ++ WR DS L DG +A +DL+ G YDAGD +KFGFP
Sbjct: 36  YHDALRKSILFFEGQRSGKLPPDQRLKWRRDSALHDGSTAGVDLTGGYYDAGDNVKFGFP 95

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+LAW+I+++G  M    +   A  +L+W TDYL+ A     V+++QVGDP  DH
Sbjct: 96  MAFTTTLLAWSIIDFGRVMGT--EQRNAVKALRWGTDYLLKATAVPGVVFVQVGDPYSDH 153



 Score = 27.3 bits (59), Expect(2) = 2e-27
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +I+ + P
Sbjct: 155 CWERPEDMDTRRTVYKIDHNNP 176



>gb:AF357588_1790798 Fragaria x ananassa endo-1,4-beta-glucanase
           isoform 02 (Cel1) mRNA, complete
           cds.>gb:AF357594_1790804 Fragaria x ananassa
           endo-1,4-beta-glucanase isoform 08 (Cel1) mRNA, complete
           cds.
          Length = 496

 Score =  118 bits (295), Expect(2) = 2e-27
 Identities = 59/120 (49%), Positives = 83/120 (69%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL+ ++ FF+ Q+SGKL  D ++ WR DS L DG +A +DL+ G YDAGD +KFGFP
Sbjct: 36  YHDALRKSILFFEGQRSGKLPPDQRLKWRRDSALHDGSTAGVDLTGGYYDAGDNVKFGFP 95

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+LAW+I+++G  M    +   A  +L+W TDYL+ A     V+++QVGDP  DH
Sbjct: 96  MAFTTTLLAWSIIDFGRVMGT--EQRNAVKALRWGTDYLLKATAVPGVVFVQVGDPYSDH 153



 Score = 27.3 bits (59), Expect(2) = 2e-27
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +I+ + P
Sbjct: 155 CWERPEDMDTRRTVYKIDHNNP 176



>gb:AF357587_1790797 Fragaria x ananassa endo-1,4-beta-glucanase
           isoform 01 (Cel1) mRNA, complete cds.
          Length = 496

 Score =  118 bits (295), Expect(2) = 2e-27
 Identities = 59/120 (49%), Positives = 83/120 (69%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL+ ++ FF+ Q+SGKL  D ++ WR DS L DG +A +DL+ G YDAGD +KFGFP
Sbjct: 36  YHDALRKSILFFEGQRSGKLPPDQRLKWRRDSALHDGSTAGVDLTGGYYDAGDNVKFGFP 95

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+LAW+I+++G  M    +   A  +L+W TDYL+ A     V+++QVGDP  DH
Sbjct: 96  MAFTTTLLAWSIIDFGRVMGT--EQRNAVKALRWGTDYLLKATAVPGVVFVQVGDPYSDH 153



 Score = 27.3 bits (59), Expect(2) = 2e-27
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +I+ + P
Sbjct: 155 CWERPEDMDTRRTVYKIDHNNP 176



>gb:AF074923_1766126 Fragaria x ananassa endo-1,4-beta-glucanase
           precursor (Cel1) mRNA, complete cds.
          Length = 496

 Score =  118 bits (295), Expect(2) = 2e-27
 Identities = 59/120 (49%), Positives = 83/120 (69%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL+ ++ FF+ Q+SGKL  D ++ WR DS L DG +A +DL+ G YDAGD +KFGFP
Sbjct: 36  YHDALRKSILFFEGQRSGKLPPDQRLKWRRDSALHDGSTAGVDLTGGYYDAGDNVKFGFP 95

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+LAW+I+++G  M    +   A  +L+W TDYL+ A     V+++QVGDP  DH
Sbjct: 96  MAFTTTLLAWSIIDFGRVMGT--EQRNAVKALRWGTDYLLKATAVPGVVFVQVGDPYSDH 153



 Score = 27.3 bits (59), Expect(2) = 2e-27
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +I+ + P
Sbjct: 155 CWERPEDMDTRRTVYKIDHNNP 176



>gb:FAN6348_1678785 Fragaria x ananassa mRNA for
           endo-beta-1,4-glucanase, eg1.>gb:FRX414709_1679257
           Fragaria x ananassa faEG1 gene for
           endo-beta-1,4-glucanase, exons 1-7.
          Length = 496

 Score =  118 bits (295), Expect(2) = 2e-27
 Identities = 59/120 (49%), Positives = 83/120 (69%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL+ ++ FF+ Q+SGKL  D ++ WR DS L DG +A +DL+ G YDAGD +KFGFP
Sbjct: 36  YHDALRKSILFFEGQRSGKLPPDQRLKWRRDSALHDGSTAGVDLTGGYYDAGDNVKFGFP 95

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+LAW+I+++G  M    +   A  +L+W TDYL+ A     V+++QVGDP  DH
Sbjct: 96  MAFTTTLLAWSIIDFGRVMGT--EQRNAVKALRWGTDYLLKATAVPGVVFVQVGDPYSDH 153



 Score = 27.3 bits (59), Expect(2) = 2e-27
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +I+ + P
Sbjct: 155 CWERPEDMDTRRTVYKIDHNNP 176



>gb:AY350734_1601660 Malus x domestica endo-1,4-beta-glucanase mRNA,
           complete cds.
          Length = 497

 Score =  114 bits (286), Expect(2) = 2e-27
 Identities = 58/124 (46%), Positives = 82/124 (66%), Gaps = 4/124 (3%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKL---VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG 570
           Y +AL  ++ FF  Q+SG+L      +I+WR +SGL DG+ A +DL+ G YDAGD +KF 
Sbjct: 35  YREALAKSVLFFQGQRSGRLPAGAAQQITWRSNSGLSDGRQAYVDLTGGYYDAGDNVKFN 94

Query: 571 FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVN-AHPDDNVLYIQVGDPD 747
           FPMA+T T+L+W  LEYG +M    QL   + +++W TDYL+  A      LY+ VGDP+
Sbjct: 95  FPMAFTTTMLSWGALEYGKRMG--PQLPETRAAIRWATDYLIKCARQTPGRLYVGVGDPN 152

Query: 748 LDHK 759
           +DHK
Sbjct: 153 VDHK 156



 Score = 30.8 bits (68), Expect(2) = 2e-27
 Identities = 11/23 (47%), Positives = 16/23 (69%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           KCW+RPEDM  +R +  ++ S P
Sbjct: 156 KCWERPEDMDTTRTVYSVSPSNP 178



>gb:AY660968_1620404 Populus tremula x Populus tremuloides Cel9B
           mRNA, complete cds.
          Length = 486

 Score =  115 bits (288), Expect(2) = 2e-27
 Identities = 58/122 (47%), Positives = 84/122 (68%), Gaps = 2/122 (1%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDNK-ISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y +AL  ++ FF  Q+SG+L  ++ ++WR DSGL DG  A +DL+ G YDAGD +KF FP
Sbjct: 27  YNEALAKSILFFQGQRSGRLPGSQQLAWRSDSGLSDGLFAHVDLTGGYYDAGDNVKFNFP 86

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVN-AHPDDNVLYIQVGDPDLD 753
           MA+T T+L+W+ LEYG +M    +L  A+ +++W TDYL+  A      LY+ VGDP++D
Sbjct: 87  MAFTTTMLSWSTLEYGKRMG--PELPNARAAIRWATDYLLKCATATPGKLYVGVGDPNVD 144

Query: 754 HK 759
           HK
Sbjct: 145 HK 146



 Score = 30.0 bits (66), Expect(2) = 2e-27
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           KCW+RPEDM   R +  ++A  P
Sbjct: 146 KCWERPEDMDTVRTVFSVSARSP 168



>gb:AF357590_1790800 Fragaria x ananassa endo-1,4-beta-glucanase
           isoform 04 (Cel1) mRNA, complete cds.
          Length = 496

 Score =  117 bits (294), Expect(2) = 2e-27
 Identities = 59/120 (49%), Positives = 83/120 (69%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL+ ++ FF+ Q+SGKL  D ++ WR DS L DG +A +DL+ G YDAGD +KFGFP
Sbjct: 36  YHDALRKSILFFEGQRSGKLPPDQRLKWRRDSALHDGSTAGVDLTGGYYDAGDNVKFGFP 95

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+LAW+I+++G  M    +   A  +L+W TDYL+ A     V+++QVGDP  DH
Sbjct: 96  MAFTTTLLAWSIIDFGRVMGT--EQRNAVKALRWGTDYLLKATAVPGVVFVQVGDPYPDH 153



 Score = 27.3 bits (59), Expect(2) = 2e-27
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +I+ + P
Sbjct: 155 CWERPEDMDTRRTVYKIDHNNP 176



>gb:CACCEL3_1644855 Capsicum annuum mRNA for
           endo-beta-1,4-glucanase, ccel3.
          Length = 485

 Score =  117 bits (294), Expect(2) = 2e-27
 Identities = 59/120 (49%), Positives = 84/120 (70%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL+ ++ F++ Q+SGKL  D +I WR DS L DG SA +DL+ G YDAGD +KF FP
Sbjct: 25  YHDALRKSILFYEGQRSGKLPPDQRIKWRRDSALHDGASAGVDLAGGYYDAGDNVKFVFP 84

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+TAT+L+W+I+++   M    +L  A  ++KW TD+L+ A   + V+Y+QVGDP  DH
Sbjct: 85  MAFTATLLSWSIIDFKRNMG--SELGNAVKAVKWATDFLLKATAKEGVVYVQVGDPFSDH 142



 Score = 27.3 bits (59), Expect(2) = 2e-27
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +I+ + P
Sbjct: 144 CWERPEDMDTLRTVYKIDQNHP 165



>pir|S57808|S57808 cellulase (EC 3.2.1.4) precursor -
           tomato>gb:SLU20590_1715369 Solanum lycopersicum
           endo-1,4-beta-glucanase precursor, mRNA, complete cds.
          Length = 510

 Score =  115 bits (289), Expect(2) = 3e-27
 Identities = 57/123 (46%), Positives = 84/123 (68%), Gaps = 1/123 (0%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           +  Y DAL  ++ +F+ Q+SGKL  + +I+WR DSGL DGK+  +DL  G YDAGD +KF
Sbjct: 44  SHNYRDALAKSIIYFEGQRSGKLPSSQRITWRKDSGLSDGKAMGVDLVGGYYDAGDNVKF 103

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD 747
           GFPMA+T T+L+W+++E+G  M    +L  AK ++ W T+YL+ A    + +Y+QVGD  
Sbjct: 104 GFPMAFTTTMLSWSVIEFGGLMK--GELLNAKQAIGWATEYLLKATAHPDTIYVQVGDAG 161

Query: 748 LDH 756
            DH
Sbjct: 162 SDH 164



 Score = 28.9 bits (63), Expect(2) = 3e-27
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +I+ + P
Sbjct: 166 CWERPEDMDTPRSVYKIDKNTP 187



>gb:AF041405_1763460 Fragaria x ananassa putative cellulase mRNA,
           complete cds.
          Length = 496

 Score =  118 bits (296), Expect(2) = 3e-27
 Identities = 60/125 (48%), Positives = 84/125 (67%), Gaps = 1/125 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL+ ++ FF+ Q+SGKL  D ++ WR DS L DG +A +DL+ G YDAGD +KFGFP
Sbjct: 36  YHDALRKSILFFEGQRSGKLPPDQRLKWRRDSALHDGSTAGVDLTGGYYDAGDNVKFGFP 95

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+LAW+I+++G  M    +   A  +L+W TDYL+ A     V+++QVGDP  DH
Sbjct: 96  MAFTTTLLAWSIIDFGRVMGT--EQRNAVKALRWGTDYLLKATAVPGVVFVQVGDPYSDH 153

Query: 757 KMLAK 771
               K
Sbjct: 154 NCWEK 158



 Score = 26.2 bits (56), Expect(2) = 3e-27
 Identities = 9/22 (40%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW++PEDM   R + +I+ + P
Sbjct: 155 CWEKPEDMDTRRTVYKIDHNNP 176



>gb:AF148497_1245134 Cherax quadricarinatus beta 1,4-endoglucanase
           (EG) mRNA, complete cds.
          Length = 469

 Score =  115 bits (287), Expect(2) = 3e-27
 Identities = 55/120 (45%), Positives = 76/120 (63%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y  AL ++  F++ Q+SGKL  D +++WRGDS L DG     DL+ G YDAGD +KFGFP
Sbjct: 40  YSQALCMSYVFYEAQRSGKLPGDQRVTWRGDSALNDGSDVGHDLTGGYYDAGDHVKFGFP 99

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+TAT+LAW  +++ +  +   Q      +LKW TDY + AH   N  Y QVG+ + DH
Sbjct: 100 MAFTATMLAWGQIDFANGHSKAGQTSYGHAALKWATDYFLKAHTATNEFYGQVGEGNTDH 159



 Score = 29.6 bits (65), Expect(2) = 3e-27
 Identities = 13/21 (61%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT SRP  +I+ S P
Sbjct: 162 WGRPEDMTMSRPSYKIDQSRP 182



>gb:AY176645_1306834 Cherax quadricarinatus cellulase GHF9 (EG)
           gene, EG-A allele, partial cds.
          Length = 461

 Score =  115 bits (287), Expect(2) = 3e-27
 Identities = 55/120 (45%), Positives = 76/120 (63%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y  AL ++  F++ Q+SGKL  D +++WRGDS L DG     DL+ G YDAGD +KFGFP
Sbjct: 32  YSQALCMSYVFYEAQRSGKLPGDQRVTWRGDSALNDGSDVGHDLTGGYYDAGDHVKFGFP 91

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+TAT+LAW  +++ +  +   Q      +LKW TDY + AH   N  Y QVG+ + DH
Sbjct: 92  MAFTATMLAWGQIDFANGHSKAGQTSYGHAALKWATDYFLKAHTATNEFYGQVGEGNTDH 151



 Score = 29.6 bits (65), Expect(2) = 3e-27
 Identities = 13/21 (61%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT SRP  +I+ S P
Sbjct: 154 WGRPEDMTMSRPSYKIDQSRP 174



>gb:AB013273_1193450 Nasutitermes walkeri mRNA for NwEG, complete
           cds.
          Length = 448

 Score =  115 bits (287), Expect(2) = 4e-27
 Identities = 53/120 (44%), Positives = 76/120 (63%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y   L+ ++ F++ Q+SG+L  D K++WR DS L D      DL+ G +DAGD +KFGFP
Sbjct: 20  YKQVLRDSLLFYEAQRSGRLPADQKVTWRKDSALNDQGEQGQDLTGGYFDAGDFVKFGFP 79

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAYTATVLAW ++++    +    L+  + ++KW TDY + AH   N  Y QVG  D+DH
Sbjct: 80  MAYTATVLAWGLIDFEAGYSSAGALDDGRKAVKWATDYFIKAHTSQNEFYGQVGQGDVDH 139



 Score = 29.3 bits (64), Expect(2) = 4e-27
 Identities = 12/21 (57%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT +RP  +I+ S P
Sbjct: 142 WGRPEDMTMARPAYKIDTSRP 162



>gb:AP004885_1846620 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0575F10.
          Length = 503

 Score =  116 bits (290), Expect(2) = 5e-27
 Identities = 59/136 (43%), Positives = 85/136 (62%), Gaps = 16/136 (11%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL  A+ FF+ Q+SGKL    +++WR DSGL DG +  +DL+ G YDAGD +KFG P
Sbjct: 25  YADALDKAILFFEAQRSGKLPPGQRVAWRADSGLSDGSADGVDLAGGYYDAGDNVKFGLP 84

Query: 577 MAYTATVLAWTILEYGDQMAV--------------VKQLEPAKGSLKWITDYLVN-AHPD 711
           MA+T T+L+W+++E+GD M                V QL+ A+ +++W  DYL+  A   
Sbjct: 85  MAFTVTMLSWSVIEFGDMMPARRSSFLGGIFGGGGVAQLDNARAAVRWGADYLLKAATAT 144

Query: 712 DNVLYIQVGDPDLDHK 759
            + LY+QV DP  DH+
Sbjct: 145 PDTLYVQVADPYQDHR 160



 Score = 27.7 bits (60), Expect(2) = 5e-27
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           +CW+RPEDM   R + ++    P
Sbjct: 160 RCWERPEDMDTPRSVYKVTPQSP 182



>gb:AF357589_1790799 Fragaria x ananassa endo-1,4-beta-glucanase
           isoform 03 (Cel1) mRNA, complete cds.
          Length = 496

 Score =  116 bits (291), Expect(2) = 5e-27
 Identities = 58/120 (48%), Positives = 82/120 (68%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL+ ++ FF+ Q+SGKL  D ++ WR DS L DG +A +DL+ G YDAGD +KFGFP
Sbjct: 36  YHDALRKSILFFEGQRSGKLPPDQRLKWRRDSALHDGSTAGVDLTGGYYDAGDNVKFGFP 95

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+L W+I+++G  M    +   A  +L+W TDYL+ A     V+++QVGDP  DH
Sbjct: 96  MAFTTTLLTWSIIDFGRVMGT--EQRNAVKALRWGTDYLLKATAVPGVVFVQVGDPYSDH 153



 Score = 27.3 bits (59), Expect(2) = 5e-27
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +I+ + P
Sbjct: 155 CWERPEDMDTRRTVYKIDHNNP 176



>gb:AY445620_618147 Bacillus licheniformis strain GXN151 cellulase
           (cel9A) gene, complete cds.
          Length = 633

 Score =  122 bits (307), Expect = 6e-27
 Identities = 57/120 (47%), Positives = 83/120 (69%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y + L+ ++ F++ Q+SG+L +N +++WRGDSGL+DGK   LDL+ G YDAGD +KFG P
Sbjct: 22  YAELLQKSLLFYEAQRSGRLPENSRLNWRGDSGLEDGKDVGLDLTGGWYDAGDHVKFGLP 81

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAY+A +L+W++ EY D      QL+ A  ++KW TDY + AH     L+ QVG+  LDH
Sbjct: 82  MAYSAAILSWSVYEYRDAYKESGQLDAALDNIKWATDYFLKAHTAPYELWGQVGNGALDH 141



>gb:AF206716_488401 Bacillus pumilus endoglucanase gene, complete
           cds.
          Length = 659

 Score =  122 bits (307), Expect = 6e-27
 Identities = 57/120 (47%), Positives = 80/120 (66%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y + L+ ++ F++ Q+SGKL + N+++WRGDSGL+DGK    DL+ G YDAGD +KFG P
Sbjct: 49  YVEVLQKSILFYEAQRSGKLPESNRLNWRGDSGLEDGKDVGHDLTGGWYDAGDHVKFGLP 108

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAY+A VLAWT+ EY +     + L+     +KW TDY + AH   N  + QVGD + DH
Sbjct: 109 MAYSAAVLAWTVYEYREAYEEAELLDDMLDQIKWATDYFLKAHTGPNEFWAQVGDGNADH 168



>gb:AE017333_447737 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_857542 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 654

 Score =  122 bits (307), Expect = 6e-27
 Identities = 57/120 (47%), Positives = 83/120 (69%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y + L+ ++ F++ Q+SG+L +N +++WRGDSGL+DGK   LDL+ G YDAGD +KFG P
Sbjct: 43  YAELLQKSLLFYEAQRSGRLPENSRLNWRGDSGLEDGKDVGLDLTGGWYDAGDHVKFGLP 102

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAY+A +L+W++ EY D      QL+ A  ++KW TDY + AH     L+ QVG+  LDH
Sbjct: 103 MAYSAAILSWSVYEYRDAYKESGQLDAALDNIKWATDYFLKAHTAPYELWGQVGNGALDH 162



>pir|I40807|I40807 cellulase (EC 3.2.1.4) engC - Clostridium
           cellulovorans
          Length = 553

 Score =  122 bits (307), Expect = 6e-27
 Identities = 57/120 (47%), Positives = 80/120 (66%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y + L+ ++ F++ Q+SGKL + N+++WRGDSGL+DGK    DL+ G YDAGD +KFG P
Sbjct: 49  YVEVLQKSILFYEAQRSGKLPESNRLNWRGDSGLEDGKDVGHDLTGGWYDAGDHVKFGLP 108

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAY+A VLAWT+ EY +     + L+     +KW TDY + AH   N  + QVGD + DH
Sbjct: 109 MAYSAAVLAWTVYEYREAYEEAELLDDMLDQIKWATDYFLKAHTGPNEFWAQVGDGNADH 168



>sp|P26225|GUNB_CELFI Endoglucanase B precursor (EC 3.2.1.4)
           (Endo-1,4-beta-glucanase B) (Cellulase
           B).>pir|A39199|A39199 endoglucanase B (EC 3.2.1.-) -
           Cellulomonas fimi>gb:CFICENBAA_845923 C.fimi cenB gene,
           complete cds.
          Length = 1045

 Score =  122 bits (307), Expect = 6e-27
 Identities = 65/147 (44%), Positives = 87/147 (59%), Gaps = 1/147 (0%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           T  Y +AL+ +M F+  Q+SG L  D  +SWRGDSGL DG     DL+ G YDAGD +KF
Sbjct: 36  TYNYAEALQKSMFFYQAQRSGDLPADFPVSWRGDSGLTDGADVGKDLTGGWYDAGDHVKF 95

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD 747
           GFPMA++AT+LAW  +E     +    L+  K +L++++DY V AH   N LY+QVGD +
Sbjct: 96  GFPMAFSATMLAWGAIESPTGYSKAGSLDELKDNLRFVSDYFVKAHTAPNELYVQVGDGE 155

Query: 748 LDHKMLAKA*RHD*IEASYPN*RFCPG 828
            DHK    A        S+     CPG
Sbjct: 156 ADHKWWGPAEVMTMARPSHKISASCPG 182



>sp|P28622|GUN4_BACS5 Endoglucanase 4 precursor (EC 3.2.1.4)
           (Endo-1,4-beta-glucanase 4) (Cellulase 4)
           (EG-IV).>pir|JC5874|JC5874 cellulase (EC 3.2.1.4)
           precursor - Bacillus sp.>gb:AB004098_688 Bacillus sp.
           KSM-522 gene for endo-1,4-beta-glucanase, complete cds.
          Length = 636

 Score =  122 bits (307), Expect = 6e-27
 Identities = 57/120 (47%), Positives = 80/120 (66%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y + L+ ++ F++ Q+SGKL + N+++WRGDSGL+DGK    DL+ G YDAGD +KFG P
Sbjct: 30  YVEVLQKSILFYEAQRSGKLPESNRLNWRGDSGLEDGKDVGHDLTGGWYDAGDHVKFGLP 89

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAY+A VLAWT+ EY +     + L+     +KW TDY + AH   N  + QVGD + DH
Sbjct: 90  MAYSAAVLAWTVYEYREAYEEAELLDDMLDQIKWATDYFLKAHTGPNEFWAQVGDGNADH 149



>gb:AB013272_1193449 Nasutitermes takasagoensis mRNA for
           endo-b-1,4-glucanase, complete cds.>gb:AB019146_1193844
           Nasutitermes takasagoensis NtEG gene for cellulase NtEG,
           complete cds.
          Length = 448

 Score =  114 bits (285), Expect(2) = 7e-27
 Identities = 53/120 (44%), Positives = 75/120 (62%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y   L+ ++ F++ Q+SG+L  D K++WR DS L D      DL+ G +DAGD +KFGFP
Sbjct: 20  YKQVLRDSLLFYEAQRSGRLPADQKVTWRKDSALNDQGDQGQDLTGGYFDAGDFVKFGFP 79

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAYTATVLAW ++++    +    L+  + ++KW TDY + AH   N  Y QVG  D DH
Sbjct: 80  MAYTATVLAWGLIDFEAGYSSAGALDDGRKAVKWATDYFIKAHTSQNEFYGQVGQGDADH 139



 Score = 29.3 bits (64), Expect(2) = 7e-27
 Identities = 12/21 (57%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT +RP  +I+ S P
Sbjct: 142 WGRPEDMTMARPAYKIDTSRP 162



>gb:AB019095_1193812 Reticulitermes speratus mRNA for Endoglucanase
           2, complete cds.
          Length = 448

 Score =  112 bits (279), Expect(2) = 1e-26
 Identities = 55/120 (45%), Positives = 74/120 (61%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y   L  ++ F++ Q+SGKL  D K++WR DS L D      DL+ G YDAGD +KFGFP
Sbjct: 20  YKTVLSNSLLFYEAQRSGKLPSDQKVTWRKDSALNDKGQKGEDLTGGYYDAGDFVKFGFP 79

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAYT TVLAW +++Y    +    L+  + +LK+ TDY + AH   N  Y QVG  D+DH
Sbjct: 80  MAYTVTVLAWGVIDYESAYSAAGALDSGRKALKYGTDYFLKAHTAANEFYGQVGQGDVDH 139



 Score = 30.8 bits (68), Expect(2) = 1e-26
 Identities = 13/21 (61%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT SRP  +I+ S P
Sbjct: 142 WGRPEDMTMSRPAYKIDTSKP 162



>gb:AB008778_1193141 Reticulitermes speratus RsEG mRNA for salivary
           cellulase, complete cds.
          Length = 448

 Score =  112 bits (279), Expect(2) = 1e-26
 Identities = 55/120 (45%), Positives = 74/120 (61%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y   L  ++ F++ Q+SGKL  D K++WR DS L D      DL+ G YDAGD +KFGFP
Sbjct: 20  YKTVLSNSLLFYEAQRSGKLPSDQKVTWRKDSALNDKGQKGEDLTGGYYDAGDFVKFGFP 79

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAYT TVLAW +++Y    +    L+  + +LK+ TDY + AH   N  Y QVG  D+DH
Sbjct: 80  MAYTVTVLAWGVIDYESAYSAAGALDSGRKALKYGTDYFLKAHTAANEFYGQVGQGDVDH 139



 Score = 30.8 bits (68), Expect(2) = 1e-26
 Identities = 13/21 (61%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT SRP  +I+ S P
Sbjct: 142 WGRPEDMTMSRPAYKIDTSKP 162



>gb:AY572862_1178679 Reticulitermes flavipes endogenous cellulase
           mRNA, complete cds.
          Length = 355

 Score =  112 bits (279), Expect(2) = 1e-26
 Identities = 55/120 (45%), Positives = 74/120 (61%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y   L  ++ F++ Q+SGKL  D K++WR DS L D      DL+ G YDAGD +KFGFP
Sbjct: 20  YKTVLSNSLLFYEAQRSGKLPSDQKVTWRKDSALNDKGQKGEDLTGGYYDAGDFVKFGFP 79

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAYT TVLAW +++Y    +    L+  + +LK+ TDY + AH   N  Y QVG  D+DH
Sbjct: 80  MAYTVTVLAWGVIDYESAYSAAGALDSGRKALKYGTDYFLKAHTAANEFYGQVGQGDVDH 139



 Score = 30.8 bits (68), Expect(2) = 1e-26
 Identities = 13/21 (61%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT SRP  +I+ S P
Sbjct: 142 WGRPEDMTMSRPAYKIDTSKP 162



>gb:CTH275974_119538 Clostridium thermocellum ORF1 (partial), celI
           gene, ORF3, ORF4, celN gene, celP gene and ORF7
           (partial), strain F7.
          Length = 887

 Score =  121 bits (304), Expect = 1e-26
 Identities = 56/121 (46%), Positives = 78/121 (64%), Gaps = 2/121 (1%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN--KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF 573
           YG+AL+ A+ F++ Q+SGKL  +  +++WRGDSGL DGK A +DL+ G YDAGD +KF  
Sbjct: 78  YGEALQKAIFFYECQRSGKLDPSTLRLNWRGDSGLDDGKDAGIDLTGGWYDAGDHVKFNL 137

Query: 574 PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD 753
           PM+Y+A +L W + EY D      Q      ++KW  DY +  HP+ +V Y QVGD   D
Sbjct: 138 PMSYSAAMLGWAVYEYEDAFKQSGQYNHILNNIKWACDYFIKCHPEKDVYYYQVGDGHAD 197

Query: 754 H 756
           H
Sbjct: 198 H 198



>sp|Q02934|GUNI_CLOTM Endoglucanase I precursor (EC 3.2.1.4) (EGI)
           (Endo-1,4-beta-glucanase) (Cellulase
           I).>pir|A47704|A47704 endoglucanase I (EC 3.2.1.-) CelI
           - Clostridium thermocellum>gb:CLOFEEGASE_848599
           Clostridium thermocellum (clone RV 1.6) endo-1,
           3-beta-glucanase (CMC) gene, complete cds.
          Length = 879

 Score =  121 bits (304), Expect = 1e-26
 Identities = 56/121 (46%), Positives = 78/121 (64%), Gaps = 2/121 (1%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN--KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF 573
           YG+AL+ A+ F++ Q+SGKL  +  +++WRGDSGL DGK A +DL+ G YDAGD +KF  
Sbjct: 78  YGEALQKAIFFYECQRSGKLDPSTLRLNWRGDSGLDDGKDAGIDLTGGWYDAGDHVKFNL 137

Query: 574 PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD 753
           PM+Y+A +L W + EY D      Q      ++KW  DY +  HP+ +V Y QVGD   D
Sbjct: 138 PMSYSAAMLGWAVYEYEDAFKQSGQYNHILNNIKWACDYFIKCHPEKDVYYYQVGDGHAD 197

Query: 754 H 756
           H
Sbjct: 198 H 198



>gb:AP005619_1855021 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0624H09.
          Length = 497

 Score =  114 bits (284), Expect(2) = 2e-26
 Identities = 54/120 (45%), Positives = 80/120 (66%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL  ++ FF+ Q+SG+L  D ++ WR DS L DG +A +DL+ G YDAGD +KFGFP
Sbjct: 25  YSDALHKSILFFEGQRSGRLPPDQRLRWRRDSALNDGATAGVDLTGGYYDAGDNVKFGFP 84

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+TAT+++W ++++G           A+ +++W TDYL+ A    N +Y+QVGD   DH
Sbjct: 85  MAFTATLMSWGLIDFGRSFGA--HAAEAREAVRWATDYLMKATATPNTVYVQVGDAFRDH 142



 Score = 28.5 bits (62), Expect(2) = 2e-26
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +++ S P
Sbjct: 144 CWERPEDMDTPRTVYKVDPSHP 165



>sp|P22503|GUN_PHAVU Endoglucanase precursor (EC 3.2.1.4)
           (Endo-1,4-beta-glucanase) (Abscission
           cellulase).>pir|T11783|T11783 cellulase (EC 3.2.1.4)
           precursor - kidney bean>gb:PHVCEL_1700228 Phaseolus
           vulgaris cellulase precursor, mRNA, complete cds.
          Length = 496

 Score =  112 bits (280), Expect(2) = 2e-26
 Identities = 52/120 (43%), Positives = 80/120 (66%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL  A+ FF+ Q+SGKL  + ++ WR DS L DGK  +++L  G YDAGD +KFG+P
Sbjct: 41  YADALAKAILFFEGQRSGKLPSSQRVKWREDSALSDGKLQNVNLMGGYYDAGDNVKFGWP 100

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA++ ++L+W  +EY  +++ V QL   + +++W  D+++ AH     LY QVGD + DH
Sbjct: 101 MAFSTSLLSWAAVEYESEISSVNQLGYLQSAIRWGADFMLRAHTSPTTLYTQVGDGNADH 160



 Score = 30.0 bits (66), Expect(2) = 2e-26
 Identities = 11/22 (50%), Positives = 16/22 (72%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +I+A+ P
Sbjct: 162 CWERPEDMDTPRTVYKIDANSP 183



>gb:ATX98544_1557455 A.thaliana mRNA for endo-1,4-beta-glucanase.
          Length = 492

 Score =  121 bits (303), Expect = 2e-26
 Identities = 65/144 (45%), Positives = 91/144 (63%), Gaps = 1/144 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL+ ++ FF+ Q+SGKL  D ++ WR DS L+DG SA +DLS G YDAGD +KFGFP
Sbjct: 29  YRDALRKSILFFEGQRSGKLPPDQRLKWRRDSALRDGSSAGVDLSGGYYDAGDNIKFGFP 88

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+L+W+I+++G  M    +L  A  ++KW TDYL+ A     V+++QVGD   DH
Sbjct: 89  MAFTTTMLSWSIIDFGKTMG--PELRNAVKAVKWGTDYLLKATAIPGVVFVQVGDAYSDH 146

Query: 757 KMLAKA*RHD*IEASYPN*RFCPG 828
               +    D +   Y   R  PG
Sbjct: 147 NCWERPEDMDTLRTVYKIDRAHPG 170



>pir|E96731|E96731 endo-1,4-beta-glucanase, 41628-45234 [imported] -
           Arabidopsis thaliana>gb:AE005173_894655 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC011663_1537317 Arabidopsis thaliana
           chromosome 1 BAC F5A18 genomic sequence, complete
           sequence.>gb:AY048283_1561744 Arabidopsis thaliana
           At1g70710/F5A18_11 mRNA, complete
           cds.>gb:AY074552_1567592 Arabidopsis thaliana
           At1g70710/F5A18_11 mRNA, complete cds.
          Length = 492

 Score =  121 bits (303), Expect = 2e-26
 Identities = 65/144 (45%), Positives = 91/144 (63%), Gaps = 1/144 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL+ ++ FF+ Q+SGKL  D ++ WR DS L+DG SA +DLS G YDAGD +KFGFP
Sbjct: 29  YRDALRKSILFFEGQRSGKLPPDQRLKWRRDSALRDGSSAGVDLSGGYYDAGDNIKFGFP 88

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+L+W+I+++G  M    +L  A  ++KW TDYL+ A     V+++QVGD   DH
Sbjct: 89  MAFTTTMLSWSIIDFGKTMG--PELRNAVKAVKWGTDYLLKATAIPGVVFVQVGDAYSDH 146

Query: 757 KMLAKA*RHD*IEASYPN*RFCPG 828
               +    D +   Y   R  PG
Sbjct: 147 NCWERPEDMDTLRTVYKIDRAHPG 170



>gb:PVU34754_1703013 Phaseolus vulgaris cellulase gene, complete
           cds.
          Length = 496

 Score =  112 bits (279), Expect(2) = 2e-26
 Identities = 52/120 (43%), Positives = 80/120 (66%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL  A+ FF+ Q+SGKL  + ++ WR DS L DGK  +++L  G YDAGD +KFG+P
Sbjct: 41  YADALAKAILFFEGQRSGKLPSSQRVKWREDSALSDGKLQNVNLIGGYYDAGDNVKFGWP 100

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA++ ++L+W  +EY  +++ V QL   + +++W  D+++ AH     LY QVGD + DH
Sbjct: 101 MAFSTSLLSWAAVEYESEISSVNQLGYLQSAIRWGADFMLRAHTSPTTLYTQVGDGNADH 160



 Score = 30.0 bits (66), Expect(2) = 2e-26
 Identities = 11/22 (50%), Positives = 16/22 (72%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +I+A+ P
Sbjct: 162 CWERPEDMDTPRTVYKIDANSP 183



>pir|F97012|F97012 hypothetical protein CAC0913 [imported] -
           Clostridium acetobutylicum>gb:AE007607_228250
           Clostridium acetobutylicum ATCC 824 section 95 of 356 of
           the complete genome.>gb:AE001437_1091205 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 712

 Score =  120 bits (302), Expect = 2e-26
 Identities = 56/121 (46%), Positives = 79/121 (65%), Gaps = 1/121 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG+AL+ ++ F++ ++SGKL  D + +WRGDSGL DGK   LDL+ G YDAGD +KF  P
Sbjct: 41  YGEALQKSLMFYEFERSGKLPQDKRDNWRGDSGLDDGKDVGLDLTGGWYDAGDHVKFNLP 100

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
            +YT T+L W++ +  D      QL+     +KW +D+L+  HP  +V Y QVGD  LDH
Sbjct: 101 ASYTLTMLGWSLYQNRDSYEKSGQLKYLTSDMKWCSDFLMKCHPAPDVFYYQVGDSGLDH 160

Query: 757 K 759
           K
Sbjct: 161 K 161



>pir|T06350|T06350 cellulase (EC 3.2.1.4) Cel2 precursor -
           tomato>gb:LEU13055_1684701 Lycopersicon esculentum
           endo-1,4-beta-glucanase precursor (Cel2) mRNA, complete
           cds.
          Length = 489

 Score =  112 bits (280), Expect(2) = 3e-26
 Identities = 57/120 (47%), Positives = 83/120 (69%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL+ ++ F++ Q+SGKL  D +I WR DS L DG SA +DL+ G YDAGD +KF FP
Sbjct: 28  YHDALRKSILFYEGQRSGKLPPDQRIKWRRDSALHDGASAGVDLTGGYYDAGDNVKFVFP 87

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+L+W+I+++  +  +  +L  A  ++KW TD+L+ A   D V+Y+QVGD   DH
Sbjct: 88  MAFTTTLLSWSIIDF--KRNIGNELGNAVKAVKWGTDFLLKATARDGVIYVQVGDAFSDH 145



 Score = 29.3 bits (64), Expect(2) = 3e-26
 Identities = 11/22 (50%), Positives = 16/22 (72%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +I+A+ P
Sbjct: 147 CWERPEDMDTLRTVYKIDANNP 168



>gb:AP004463_1841398 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0456B03.
          Length = 529

 Score =  109 bits (273), Expect(2) = 3e-26
 Identities = 54/120 (45%), Positives = 74/120 (61%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y  AL   + +F+ Q+SG L  N ++ WRG SGL DG    +DL  G YDAGD +KFG P
Sbjct: 37  YKKALHSGLLYFEAQRSGHLPYNQRVRWRGHSGLADGLQQGVDLVGGYYDAGDNVKFGLP 96

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+L+W   E+ D++A   +      ++KW TDYLV AH   + L+ +VGD D DH
Sbjct: 97  MAFTMTMLSWAAAEFWDEIAAAGERRHVLEAIKWGTDYLVKAHTAADELWAEVGDGDTDH 156



 Score = 31.6 bits (70), Expect(2) = 3e-26
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CWQRPEDMT SR   +++   P
Sbjct: 158 CWQRPEDMTTSRQAYKVDRDNP 179



>gb:AF362948_1791509 Nicotiana tabacum endo-beta-1,4-glucanase
           precursor (Cel2) mRNA, complete cds.
          Length = 500

 Score =  114 bits (284), Expect(2) = 3e-26
 Identities = 57/120 (47%), Positives = 84/120 (70%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL+ ++ FF+ Q+SGKL  D +I WR DS L DG SA +DL+ G YDAGD +KF FP
Sbjct: 40  YRDALRKSILFFEGQRSGKLPPDQRIKWRKDSALYDGASAGVDLTGGYYDAGDNVKFVFP 99

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+L+W+I+++  +  + ++L  A  ++KW TD+L+ A   + V+Y+QVGD   DH
Sbjct: 100 MAFTTTLLSWSIIDF--KRNIGRELGNAVKAVKWATDFLLKATAKEGVIYVQVGDAFSDH 157



 Score = 27.3 bits (59), Expect(2) = 3e-26
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +I+ + P
Sbjct: 159 CWERPEDMDTLRTVYKIDQNHP 180



>gb:ATZ86105_583506 A.thermophilum celA gene and manA pseudogene.
          Length = 1711

 Score =  120 bits (300), Expect = 4e-26
 Identities = 57/120 (47%), Positives = 76/120 (63%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG+AL+ A+ F++ Q SGKL +  + +WRGDS LKDG+   LDL+ G +DAGD +KF  P
Sbjct: 5   YGEALQKAIMFYEFQMSGKLPNWVRNNWRGDSALKDGQDNGLDLTGGWFDAGDHVKFNLP 64

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           M+YT T+L+W + EY D      QLE     ++W+ DY V  HP   V Y QVGD   DH
Sbjct: 65  MSYTGTMLSWAVYEYKDAFVKSGQLEHILNQIEWVNDYFVKCHPSKYVYYYQVGDGSKDH 124



>pir|T31337|T31337 1,4-beta-glucanase (EC 3.2.1.-) - Anaerocellum
           thermophilum  (fragment)
          Length = 1711

 Score =  120 bits (300), Expect = 4e-26
 Identities = 57/120 (47%), Positives = 76/120 (63%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG+AL+ A+ F++ Q SGKL +  + +WRGDS LKDG+   LDL+ G +DAGD +KF  P
Sbjct: 5   YGEALQKAIMFYEFQMSGKLPNWVRNNWRGDSALKDGQDNGLDLTGGWFDAGDHVKFNLP 64

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           M+YT T+L+W + EY D      QLE     ++W+ DY V  HP   V Y QVGD   DH
Sbjct: 65  MSYTGTMLSWAVYEYKDAFVKSGQLEHILNQIEWVNDYFVKCHPSKYVYYYQVGDGSKDH 124



>gb:AP006453_1861899 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC
           clone:B1339H09.>gb:AP007149_1863179 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9,
           fosmid clone:OSJNOa018M17.
          Length = 532

 Score =  109 bits (272), Expect(2) = 4e-26
 Identities = 51/119 (42%), Positives = 76/119 (63%), Gaps = 1/119 (0%)
 Frame = +1

Query: 403 GDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM 579
           G+AL+ ++ +F+ Q+SG+L    +++WRG SGL DG    +DL  G YDAGD +KFG PM
Sbjct: 33  GEALEKSLLYFEAQRSGRLPYSQRVTWRGHSGLTDGLQQGVDLVGGYYDAGDHVKFGLPM 92

Query: 580 AYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           A+T T+L+W  +++   +A   +   A  ++KW TDY V AH    V + +VGD D DH
Sbjct: 93  AFTVTMLSWGAIDFAADIAAAGEWRHALEAIKWGTDYFVKAHTHPFVYWAEVGDGDTDH 151



 Score = 31.6 bits (70), Expect(2) = 4e-26
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CWQRPEDMT SR   +++   P
Sbjct: 153 CWQRPEDMTTSRQAYRVDRDNP 174



>gb:ATX98543_1557454 A.thaliana endo-1,4-beta-glucanase gene.
          Length = 493

 Score =  119 bits (298), Expect = 7e-26
 Identities = 64/144 (44%), Positives = 91/144 (63%), Gaps = 1/144 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL+ ++ FF+ Q+SGKL  D ++ WR DS L+DG SA ++LS G YDAGD +KFGFP
Sbjct: 29  YRDALRKSILFFEGQRSGKLPPDQRLKWRRDSALRDGSSAGVNLSGGYYDAGDNIKFGFP 88

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+T T+L+W+I+++G  M    +L  A  ++KW TDYL+ A     V+++QVGD   DH
Sbjct: 89  MAFTTTMLSWSIIDFGKTMG--PELRNAVKAVKWGTDYLLKATAIPGVVFVQVGDAYSDH 146

Query: 757 KMLAKA*RHD*IEASYPN*RFCPG 828
               +    D +   Y   R  PG
Sbjct: 147 NCWERPEDMDTLRTVYKIDRAHPG 170



>gb:AP005657_1855604 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0427G12.
          Length = 523

 Score =  110 bits (275), Expect(2) = 8e-26
 Identities = 56/122 (45%), Positives = 81/122 (66%), Gaps = 2/122 (1%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL  ++ FF+ Q+SGKL   N++ WR DSGL DG   ++DL  G YDAGD +KFG P
Sbjct: 55  YADALAKSIIFFEGQRSGKLPPGNRMPWRADSGLTDGAQYNVDLVGGYYDAGDNVKFGLP 114

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVN-AHPDDNVLYIQVGDPDLD 753
           MA++ T+LAW++L++G  M    +L  A+ +++W  DYL+  A      LY+QV DP+ D
Sbjct: 115 MAFSTTMLAWSVLDFGKFMGA--ELPNARAAVRWGADYLLKAATATPGALYVQVADPNQD 172

Query: 754 HK 759
           H+
Sbjct: 173 HR 174



 Score = 29.6 bits (65), Expect(2) = 8e-26
 Identities = 10/23 (43%), Positives = 15/23 (65%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           +CW+RPEDM   R + ++ A  P
Sbjct: 174 RCWERPEDMDTPRSVYRVTADKP 196



>gb:OSJN00002_1693088 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0018M05, complete sequence.
          Length = 625

 Score =  115 bits (287), Expect(2) = 1e-25
 Identities = 54/120 (45%), Positives = 76/120 (63%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDNK-ISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y  A    + FF+ Q+SGKL D++ + WRGDS L DG S  +DL  G YD+GD +KFG P
Sbjct: 39  YAGAFDKCLLFFEAQRSGKLPDDRLVRWRGDSALTDGFSQGVDLVGGYYDSGDHVKFGLP 98

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAY  T+L+W ++E+  +M    +L     +++W T+Y V AH   N L++QVGD D DH
Sbjct: 99  MAYAVTMLSWGVVEFEKEMVDGNKLHRVLDAIRWGTNYFVKAHTQHNALWVQVGDGDSDH 158



 Score = 24.6 bits (52), Expect(2) = 1e-25
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+R EDM+  R   +I+ + P
Sbjct: 160 CWERAEDMSTPRTAFKIDINNP 181



>gb:AY205300_1589136 Lilium longiflorum endo-1,4-beta-glucanase
           (Cel1) mRNA, complete cds.
          Length = 490

 Score =  109 bits (273), Expect(2) = 1e-25
 Identities = 54/124 (43%), Positives = 88/124 (70%), Gaps = 4/124 (3%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDNK-ISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL  ++ FF+ Q+SGKL  N+ ++WR +S L DG + ++DL+ G YDAGD +KFGFP
Sbjct: 27  YKDALSKSIIFFEGQRSGKLPPNQTLTWRANSALSDGAADNVDLTGGYYDAGDNVKFGFP 86

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLV---NAHPDDNVLYIQVGDPD 747
           MA++ T+L+W+++E+G    +   ++ A+ +++W TDYL+   +A PD   +Y+QVGDP 
Sbjct: 87  MAFSVTMLSWSVIEFG--KLIPADIDKAREAIRWGTDYLLKACSALPD--AIYVQVGDPT 142

Query: 748 LDHK 759
            +H+
Sbjct: 143 SEHQ 146



 Score = 29.6 bits (65), Expect(2) = 1e-25
 Identities = 12/28 (42%), Positives = 18/28 (64%)
 Frame = +2

Query: 743 PT*TIKCWQRPEDMTESRPLTQINASVP 826
           PT   +CW+RPE+M+  R + +I  S P
Sbjct: 141 PTSEHQCWERPENMSTQRSVYKITPSNP 168



>pir|T06770|T06770 cellulase (EC 3.2.1.4) precursor - garden
           pea>gb:PEAEGP1_1699676 Pisum sativum
           endo-1,4-beta-glucanase (EGL1) gene, complete cds.
          Length = 486

 Score =  110 bits (276), Expect(2) = 1e-25
 Identities = 56/122 (45%), Positives = 82/122 (67%), Gaps = 2/122 (1%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y +AL  ++ FF  Q+SGKL  D +I WR +SGL DG   ++DLS G YDAGD +KF FP
Sbjct: 28  YREALAKSLLFFQGQRSGKLPPDQQIKWRSNSGLSDGLQDNVDLSGGYYDAGDNVKFNFP 87

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVN-AHPDDNVLYIQVGDPDLD 753
           MA+T T+L+W+ +EYG +M    Q++ A+ ++++  DY +  A      LY+ VGDP++D
Sbjct: 88  MAFTTTMLSWSTIEYGKRMG--PQMKEARAAIRYAADYFLKCATSTPGRLYVGVGDPNVD 145

Query: 754 HK 759
           HK
Sbjct: 146 HK 147



 Score = 28.5 bits (62), Expect(2) = 1e-25
 Identities = 10/23 (43%), Positives = 15/23 (65%)
 Frame = +2

Query: 758 KCWQRPEDMTESRPLTQINASVP 826
           KCW+RPEDM   R +  +++  P
Sbjct: 147 KCWERPEDMDTVRTVYYVSSKNP 169



>sp|P22534|GUNA_CALSA Endoglucanase A precursor (EC 3.2.1.4)
           (Endo-1,4-beta-glucanase A) (Cellulase
           A).>pir|T17120|T17120 cellulase (EC 3.2.1.-) precursor,
           thermoactive - Caldocellum
           saccharolyticum>gb:CDCCELA_845737 Caldocellum
           saccharolyticum cellulase (celA) gene, complete cds.
          Length = 1742

 Score =  118 bits (295), Expect = 2e-25
 Identities = 57/120 (47%), Positives = 75/120 (62%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG+AL+ A+ F++ Q SGKL +  + +WRGDS LKDG+   LDL+ G +DAGD +KF  P
Sbjct: 28  YGEALQKAIMFYEFQMSGKLPNWVRNNWRGDSALKDGQDNGLDLTGGWFDAGDHVKFNLP 87

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           M+YT T+L+W   EY D      QLE     ++W+ DY V  HP   V Y QVGD   DH
Sbjct: 88  MSYTGTMLSWAAYEYKDAFVKSGQLEHILNQIEWVNDYFVKCHPSKYVYYYQVGDGGKDH 147



>gb:AC084414_1733641 Arabidopsis thaliana chromosome 1 BAC F27K7
           genomic sequence, complete sequence.
          Length = 623

 Score =  109 bits (272), Expect(2) = 2e-25
 Identities = 54/120 (45%), Positives = 74/120 (61%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG AL     FF+ Q+SGKL    ++ WRG SGLKDG    L    G YDAGD +KFG P
Sbjct: 31  YGSALDKTFLFFEAQRSGKLPAAQRVKWRGPSGLKDG----LAQGGGYYDAGDHVKFGLP 86

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MA+  T+L+W  ++   +++   Q++    S++W TDY + AHP  NVL+ QVGD + DH
Sbjct: 87  MAFAVTMLSWAAVDNRKELSSSNQMQQTLWSIRWGTDYFIKAHPQPNVLWGQVGDGESDH 146



 Score = 29.3 bits (64), Expect(2) = 2e-25
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDMT SR   +++   P
Sbjct: 148 CWERPEDMTTSRTAYKLDPYHP 169



>gb:AF180561_486131 Myxobacter sp. AL-1 thermophilic extracellular
           endocellulase (egltA) gene, complete cds.
          Length = 651

 Score =  117 bits (293), Expect = 3e-25
 Identities = 54/123 (43%), Positives = 81/123 (65%), Gaps = 1/123 (0%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           +Q Y + L+ ++ F++ Q+SGKL ++ +++WRGDS L+DGK    DL+ G YDAGD +KF
Sbjct: 31  SQNYAELLQKSILFYEAQRSGKLPESSRLNWRGDSALEDGKDVGHDLTGGWYDAGDHVKF 90

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD 747
           G PMAY+A VL+W++ EY D      QL+    +++W TDY + AH D    + QVG+  
Sbjct: 91  GLPMAYSAAVLSWSVYEYRDAYEAAGQLDAILDNIRWATDYFIKAHTDRYEFWGQVGNGA 150

Query: 748 LDH 756
            DH
Sbjct: 151 QDH 153



>pir|T06348|T06348 cellulase (EC 3.2.1.4) Cel1 precursor -
           tomato>gb:LEU13054_1684700 Lycopersicon esculentum
           endo-1,4-beta-glucanase precursor (Cel1) mRNA, complete
           cds.
          Length = 501

 Score =  117 bits (292), Expect = 3e-25
 Identities = 56/123 (45%), Positives = 81/123 (65%), Gaps = 1/123 (0%)
 Frame = +1

Query: 394 QKYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG 570
           Q Y D+L  A+ FF+ Q+SGKL V  ++ WRGDS L DG    ++L  G YDAGD +KFG
Sbjct: 25  QDYNDSLGKAILFFEGQRSGKLPVSQRVKWRGDSALIDGIIEHVNLIGGYYDAGDNVKFG 84

Query: 571 FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL 750
           +PMAY+ T+L+W  +EY  Q++   QL   + +++W T++L+ AH     LY QVGD + 
Sbjct: 85  WPMAYSLTLLSWAAIEYQTQISSTNQLVHLQNAIRWGTNFLIRAHTSSTTLYTQVGDGNA 144

Query: 751 DHK 759
           DH+
Sbjct: 145 DHQ 147



>gb:CCU34793_845663 Clostridium cellulovorans exoglucanase S (exgS)
           and endoglucanase H (engH) genes, complete cds.
          Length = 715

 Score =  116 bits (291), Expect = 4e-25
 Identities = 63/145 (43%), Positives = 83/145 (57%), Gaps = 3/145 (2%)
 Frame = +1

Query: 334 GGGSSEPDXXXXXXXXXXXTQKYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGK 510
           G  S  P            T  YG+AL+ ++ F++ Q+SGKL  D + +WRGDSG KDG 
Sbjct: 19  GATSFTPAVLVKGETTATPTFNYGEALQKSIMFYEFQRSGKLPTDIRSNWRGDSGTKDGS 78

Query: 511 SASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVK--QLEPAKGSLKWIT 684
              +DL+ G YDAGD +KF  PM+YT  +LAW++ E  D+ A  K  QL+     +KW T
Sbjct: 79  DVGVDLTGGWYDAGDHVKFNLPMSYTVAMLAWSLSE--DKAAYEKSGQLDYLVKEIKWAT 136

Query: 685 DYLVNAHPDDNVLYIQVGDPDLDHK 759
           DYL+  H   N  Y QVGD   DHK
Sbjct: 137 DYLMKCHTAPNEYYYQVGDGGADHK 161



>gb:CACCEL1_1644853 C.annuum mRNA for endo-beta-1,4-glucanase,
           ccel1.
          Length = 506

 Score =  115 bits (289), Expect = 8e-25
 Identities = 55/123 (44%), Positives = 82/123 (66%), Gaps = 1/123 (0%)
 Frame = +1

Query: 394 QKYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG 570
           Q Y DAL  ++ FF+ Q+SG+L V  ++ WRGDS L DGK   ++L  G YDAGD +KFG
Sbjct: 24  QDYKDALGKSILFFEGQRSGRLPVSQRVKWRGDSALIDGKIEHVNLIGGYYDAGDNVKFG 83

Query: 571 FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL 750
           +PMA++ T+L+W  +EY  Q++   QL   + +++W T++L+ AH     LY QVGD + 
Sbjct: 84  WPMAFSLTLLSWAAIEYPTQISSANQLPHLQRAIRWGTNFLIRAHTSTTTLYTQVGDGNA 143

Query: 751 DHK 759
           DH+
Sbjct: 144 DHQ 146



 Score = 32.7 bits (73), Expect = 8.5
 Identities = 21/68 (30%), Positives = 30/68 (44%), Gaps = 11/68 (16%)
 Frame = +2

Query: 656 PPKVRSNGSLTTLSTRILMTTSFTFRWVIPT*TI-----------KCWQRPEDMTESRPL 802
           P ++ S   L  L   I   T+F  R    T T+           +CW+RPEDM   R L
Sbjct: 101 PTQISSANQLPHLQRAIRWGTNFLIRAHTSTTTLYTQVGDGNADHQCWERPEDMDTPRTL 160

Query: 803 TQINASVP 826
            +I ++ P
Sbjct: 161 YKITSNSP 168



>pir|S57663|S57663 cellulase (EC 3.2.1.4) 3D precursor -
           pepper>gb:CARNACEL1_1645455 C.annuum mRNA
           beta-1,4-endoglycanohydrolase.
          Length = 506

 Score =  115 bits (289), Expect = 8e-25
 Identities = 55/123 (44%), Positives = 82/123 (66%), Gaps = 1/123 (0%)
 Frame = +1

Query: 394 QKYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG 570
           Q Y DAL  ++ FF+ Q+SG+L V  ++ WRGDS L DGK   ++L  G YDAGD +KFG
Sbjct: 24  QDYKDALGKSILFFEGQRSGRLPVSQRVKWRGDSALIDGKIEHVNLIGGYYDAGDNVKFG 83

Query: 571 FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL 750
           +PMA++ T+L+W  +EY  Q++   QL   + +++W T++L+ AH     LY QVGD + 
Sbjct: 84  WPMAFSLTLLSWAAIEYPTQISSANQLPHLQRAIRWGTNFLIRAHTSTTTLYTQVGDGNA 143

Query: 751 DHK 759
           DH+
Sbjct: 144 DHQ 146



 Score = 32.7 bits (73), Expect = 8.5
 Identities = 21/68 (30%), Positives = 30/68 (44%), Gaps = 11/68 (16%)
 Frame = +2

Query: 656 PPKVRSNGSLTTLSTRILMTTSFTFRWVIPT*TI-----------KCWQRPEDMTESRPL 802
           P ++ S   L  L   I   T+F  R    T T+           +CW+RPEDM   R L
Sbjct: 101 PTQISSANQLPHLQRAIRWGTNFLIRAHTSTTTLYTQVGDGNADHQCWERPEDMDTPRTL 160

Query: 803 TQINASVP 826
            +I ++ P
Sbjct: 161 YKITSNSP 168



>gb:AY059825_1564669 Arabidopsis thaliana putative endo-1,
           4-beta-glucanase (At4g39010; F19H22.110) mRNA, complete
           cds.
          Length = 497

 Score =  105 bits (263), Expect(2) = 3e-24
 Identities = 53/121 (43%), Positives = 84/121 (69%), Gaps = 2/121 (1%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL  ++ FF+ Q+SG L  D +++WR +SGL DG + ++DL+ G YDAGD +KF FP
Sbjct: 30  YSDALSKSILFFEGQRSGYLPNDQRMTWRRNSGLSDGWTHNIDLTGGYYDAGDNVKFNFP 89

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPD-DNVLYIQVGDPDLD 753
           MA+T T+LAW+++E+G+ M    +L  +  +L+W ++YL+ +     N +++QVGDP  D
Sbjct: 90  MAFTTTMLAWSVIEFGEFMP-SSELRNSLVALRWSSNYLLKSVSQLPNRIFVQVGDPIAD 148

Query: 754 H 756
           H
Sbjct: 149 H 149



 Score = 28.9 bits (63), Expect(2) = 3e-24
 Identities = 11/22 (50%), Positives = 13/22 (59%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R    +NA  P
Sbjct: 151 CWERPEDMDTPRTAYAVNAPNP 172



>pir|T06061|T06061 cellulase (EC 3.2.1.4) F19H22.110 - Arabidopsis
           thaliana>gb:ATCHRIV90_1547885 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           90.>gb:ATF19H22_1549323 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F19H22 (ESSA
           project).>gb:BT002204_1635807 Arabidopsis thaliana
           putative endo-1, 4-beta-glucanase (At4g39010) mRNA,
           complete cds.
          Length = 475

 Score =  105 bits (263), Expect(2) = 3e-24
 Identities = 53/121 (43%), Positives = 84/121 (69%), Gaps = 2/121 (1%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL  ++ FF+ Q+SG L  D +++WR +SGL DG + ++DL+ G YDAGD +KF FP
Sbjct: 8   YSDALSKSILFFEGQRSGYLPNDQRMTWRRNSGLSDGWTHNIDLTGGYYDAGDNVKFNFP 67

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPD-DNVLYIQVGDPDLD 753
           MA+T T+LAW+++E+G+ M    +L  +  +L+W ++YL+ +     N +++QVGDP  D
Sbjct: 68  MAFTTTMLAWSVIEFGEFMP-SSELRNSLVALRWSSNYLLKSVSQLPNRIFVQVGDPIAD 126

Query: 754 H 756
           H
Sbjct: 127 H 127



 Score = 28.9 bits (63), Expect(2) = 3e-24
 Identities = 11/22 (50%), Positives = 13/22 (59%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R    +NA  P
Sbjct: 129 CWERPEDMDTPRTAYAVNAPNP 150



>gb:AB118800_1200830 Odontotermes formosanus OfEG1 mRNA for putative
           endo-beta-1,4-glucanase OfEG1, partial cds.
          Length = 343

 Score =  102 bits (254), Expect(2) = 4e-24
 Identities = 48/98 (48%), Positives = 62/98 (63%)
 Frame = +1

Query: 463 DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVV 642
           D K++WR DS L D     +DL+ G YDAGD +KFGFPMA TATVLAW +++Y       
Sbjct: 5   DQKVTWRKDSALNDKGQNGVDLTGGYYDAGDYVKFGFPMAATATVLAWGLVDYAAGYTSA 64

Query: 643 KQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
             L+  + ++KW TDY + AH     LY QVG+ DLDH
Sbjct: 65  GALDDGRKAVKWATDYFLKAHAAPTELYGQVGEGDLDH 102



 Score = 32.0 bits (71), Expect(2) = 4e-24
 Identities = 14/21 (66%), Positives = 16/21 (76%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT SRP  +I+AS P
Sbjct: 105 WGRPEDMTMSRPAFKIDASNP 125



>gb:AY094488_1575780 Phanerochaete chrysosporium family 9 glycosyl
           hydrolase (cel9) mRNA, complete cds.
          Length = 590

 Score =  112 bits (281), Expect = 6e-24
 Identities = 52/116 (44%), Positives = 73/116 (62%), Gaps = 1/116 (0%)
 Frame = +1

Query: 412 LKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYT 588
           L+  + F++ Q+SGKL V N++ WR DS   DG+   LDLS G YDAGD +K+ FPM+++
Sbjct: 56  LENTLYFYEEQRSGKLPVTNRVPWRNDSATDDGRDVGLDLSGGYYDAGDYIKYTFPMSFS 115

Query: 589 ATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
              + W  L+YG    +  Q       L+W  D+L+ AHPD N LY+QVGD DLD+
Sbjct: 116 VMSICWGALDYGKGYDLANQTAYLDDMLRWSLDWLMKAHPDPNTLYVQVGDADLDN 171



>gb:AB118802_1200832 Odontotermes formosanus OfEG3 mRNA for putative
           endo-beta-1,4-glucanase OfEG3, partial cds.
          Length = 411

 Score =  100 bits (250), Expect(2) = 1e-23
 Identities = 48/98 (48%), Positives = 61/98 (62%)
 Frame = +1

Query: 463 DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVV 642
           D K++WR DS L D      DL+ G YDAGD +KFGFPMA TATVLAW +++Y       
Sbjct: 5   DQKVTWRKDSALNDKGQNGEDLTGGYYDAGDYVKFGFPMAATATVLAWGLVDYAAGYTSA 64

Query: 643 KQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
             L+  + ++KW TDY + AH     LY QVG+ DLDH
Sbjct: 65  GALDDGRKAVKWATDYFLKAHTAPTELYGQVGEGDLDH 102



 Score = 32.0 bits (71), Expect(2) = 1e-23
 Identities = 14/21 (66%), Positives = 16/21 (76%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT SRP  +I+AS P
Sbjct: 105 WGRPEDMTMSRPAFKIDASNP 125



>gb:AB118804_1200834 Sinocapritermes mushae SmEG1 mRNA for putative
           endo-beta-1,4-glucanase SmEG1, partial cds.
          Length = 361

 Score =  103 bits (258), Expect(2) = 1e-23
 Identities = 50/98 (51%), Positives = 62/98 (63%)
 Frame = +1

Query: 463 DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVV 642
           D K++WR DS L D      DL+ G YDAGD +KFGFPMAYT TVLAW +++Y    +  
Sbjct: 5   DQKVTWRKDSALNDKGEQGEDLTGGYYDAGDFVKFGFPMAYTTTVLAWGMVDYEVGYSSA 64

Query: 643 KQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
             L+  + +LKW TDYL+ AH    V Y QVG  DLDH
Sbjct: 65  GALDDGRKALKWATDYLLKAHIAPTVFYGQVGRADLDH 102



 Score = 28.9 bits (63), Expect(2) = 1e-23
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT  RP  +I+ S P
Sbjct: 105 WGRPEDMTMERPAYKIDTSHP 125



>gb:AB118801_1200831 Odontotermes formosanus OfEG2 mRNA for putative
           endo-beta-1,4-glucanase OfEG2, partial cds.
          Length = 343

 Score =  100 bits (250), Expect(2) = 1e-23
 Identities = 48/98 (48%), Positives = 61/98 (62%)
 Frame = +1

Query: 463 DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVV 642
           D K++WR DS L D      DL+ G YDAGD +KFGFPMA TATVLAW +++Y       
Sbjct: 5   DQKVTWRKDSALNDKGQNGEDLTGGYYDAGDYVKFGFPMAATATVLAWGLVDYAAGYTSA 64

Query: 643 KQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
             L+  + ++KW TDY + AH     LY QVG+ DLDH
Sbjct: 65  GALDDGRKAVKWATDYFLKAHTAPTELYGQVGEGDLDH 102



 Score = 32.0 bits (71), Expect(2) = 1e-23
 Identities = 14/21 (66%), Positives = 16/21 (76%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT SRP  +I+AS P
Sbjct: 105 WGRPEDMTMSRPAFKIDASNP 125



>gb:AY651250_1344147 Biomphalaria glabrata beta-1,4-endoglucanase
           (GH9) mRNA, partial cds.
          Length = 288

 Score =  110 bits (276), Expect = 2e-23
 Identities = 57/120 (47%), Positives = 71/120 (59%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDNK-ISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y D L+ ++ F++ Q+SGKL  NK I WR DS L D   A  DL+ G YDAGD +KF FP
Sbjct: 11  YNDVLQKSILFYEAQRSGKLPTNKRIPWRFDSALGDKGEAGEDLTGGWYDAGDHVKFNFP 70

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAY+ T+L W+ L Y D      Q +     +KW  DYL+  H   N LYIQVGD   DH
Sbjct: 71  MAYSTTILTWSYLLYADAYESAGQTDSMLDCIKWPLDYLLKCHVKPNELYIQVGDGGQDH 130



>gb:AY449462_1327414 Oikopleura dioica clone BACOIKO006 3xn11,
           complete sequence.
          Length = 1000

 Score =  110 bits (276), Expect = 2e-23
 Identities = 52/119 (43%), Positives = 73/119 (61%), Gaps = 1/119 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y  ALK+  +FF  Q SGKL  D+ + WRGDS L DGK   +DLS G YD G  +K+ FP
Sbjct: 54  YTKALKLCYKFFYAQMSGKLPEDHPLEWRGDSALNDGKDNGVDLSGGYYDGGGFIKYNFP 113

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD 753
           MA+  T++AW+ + Y   +  V + + A  +L+W  DYL+  HP++ V Y+QV D   D
Sbjct: 114 MAFATTMMAWSTIHYWRTLKDVGETKAALETLRWGADYLMKCHPENGVFYVQVSDKTAD 172



 Score = 66.2 bits (160), Expect(2) = 2e-10
 Identities = 34/102 (33%), Positives = 60/102 (58%), Gaps = 1/102 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y  AL+ ++ F+  Q++G++ +   I WR ++ ++D      DL+ G ++ G  MK+ FP
Sbjct: 534 YYHALQKSLLFYHAQRAGEIPEEFPIVWRKNATMQDIDGDETDLTGGYFNGGGTMKYSFP 593

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNA 702
           MAY+ T+LAW+++EY       + LE  K  +K   D+L N+
Sbjct: 594 MAYSITILAWSVIEYPSSYG--EHLEEVKDIIKHGADWLHNS 633



 Score = 21.6 bits (44), Expect(2) = 2e-10
 Identities = 8/19 (42%), Positives = 10/19 (52%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINAS 820
           W R EDM   RP+  +  S
Sbjct: 653 WGRAEDMKADRPIYSVTDS 671



>gb:AB118798_1200828 Neotermes koshunensis NkEG2 mRNA for putative
           endo-beta-1,4-glucanase NkEG2, partial cds.
          Length = 408

 Score =  101 bits (251), Expect(2) = 2e-23
 Identities = 48/98 (48%), Positives = 62/98 (63%)
 Frame = +1

Query: 463 DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVV 642
           D K++WR DS L D      DL+ G YDAGD +KFGFPMAYTATVLAW +++Y    +  
Sbjct: 5   DQKVTWRKDSALNDKGQNGEDLTGGNYDAGDYVKFGFPMAYTATVLAWGLVDYQAGYSAA 64

Query: 643 KQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
             L+  + ++KW TDY + AH   N LY QVG+   DH
Sbjct: 65  GALDDGRKAVKWATDYFLKAHVSANELYGQVGEGGPDH 102



 Score = 30.4 bits (67), Expect(2) = 2e-23
 Identities = 13/21 (61%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT SRP  +I+ S P
Sbjct: 105 WGRPEDMTMSRPAYKIDTSHP 125



>sp|P37700|GUNG_CLOCE Endoglucanase G precursor (EC 3.2.1.4)
           (Endo-1,4-beta-glucanase G) (Cellulase G)
           (EGCCG).>pir|JC1300|JC1300 endo-beta-1,4-glucanase (EC
           3.2.1.-) CelCCG precursor - Clostridium
           cellulolyticum>gb:CLOCELCGE_848566 Clostridium
           cellulolyticum cellulase gene cluster, complete
           sequence.
          Length = 725

 Score =  110 bits (275), Expect = 3e-23
 Identities = 52/123 (42%), Positives = 74/123 (60%), Gaps = 1/123 (0%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           T  YG+AL+ ++ F++ Q+SG L  D + +WR DSG+KDG    +DL+ G YDAGD +KF
Sbjct: 38  TYNYGEALQKSIMFYEFQRSGDLPADKRDNWRDDSGMKDGSDVGVDLTGGWYDAGDHVKF 97

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD 747
             PM+YT+ +LAW++ E  D      Q +     +KW  DY +  +P   V Y QVGD  
Sbjct: 98  NLPMSYTSAMLAWSLYEDKDAYDKSGQTKYIMDGIKWANDYFIKCNPTPGVYYYQVGDGG 157

Query: 748 LDH 756
            DH
Sbjct: 158 KDH 160



>gb:AB118806_1200836 Sinocapritermes mushae SmEG3 mRNA for putative
           endo-beta-1,4-glucanase SmEG3, partial cds.
          Length = 364

 Score =  102 bits (253), Expect(2) = 3e-23
 Identities = 47/98 (47%), Positives = 61/98 (62%)
 Frame = +1

Query: 463 DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVV 642
           D K++WR DS L D      DL+ G YDAGD +KFGFPMAYT TVL+W +++Y    +  
Sbjct: 5   DQKVTWRKDSALNDRGQNGEDLTGGYYDAGDFVKFGFPMAYTTTVLSWGLVDYEGAFSSA 64

Query: 643 KQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
             L+  + ++KW TDY + AH   N  Y QVG  DLDH
Sbjct: 65  GCLDDGRKAVKWATDYFLKAHTAPNEFYGQVGQGDLDH 102



 Score = 29.3 bits (64), Expect(2) = 3e-23
 Identities = 12/21 (57%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT +RP  +I+ S P
Sbjct: 105 WGRPEDMTMARPAYKIDTSNP 125



>gb:AB118805_1200835 Sinocapritermes mushae SmEG2 mRNA for putative
           endo-beta-1,4-glucanase SmEG2, partial cds.
          Length = 346

 Score =  101 bits (251), Expect(2) = 6e-23
 Identities = 47/98 (47%), Positives = 61/98 (62%)
 Frame = +1

Query: 463 DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVV 642
           D K++WR DS L D      DL+ G YDAGD +KFGFPMAYT TVL+W +++Y    +  
Sbjct: 5   DQKVTWRKDSALNDRGQNGEDLTGGYYDAGDFVKFGFPMAYTTTVLSWGLVDYEGAFSSA 64

Query: 643 KQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
             L+  + ++KW TDY + AH   N  Y QVG  DLDH
Sbjct: 65  GCLDDGRKAVKWATDYXLKAHTAPNEXYGQVGQGDLDH 102



 Score = 29.3 bits (64), Expect(2) = 6e-23
 Identities = 12/21 (57%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT +RP  +I+ S P
Sbjct: 105 WGRPEDMTMARPAYKIDTSNP 125



>gb:AB118796_1200826 Hodotermopsis sjoestedti HsEG4 mRNA for
           putative endo-beta-1,4-glucanase HsEG4, partial cds.
          Length = 387

 Score =  101 bits (251), Expect(2) = 7e-23
 Identities = 48/98 (48%), Positives = 59/98 (60%)
 Frame = +1

Query: 463 DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVV 642
           D K+ WR DS L D      DL+ G YDAGD +KFGFPMAYT TVLAW  L+        
Sbjct: 5   DQKVKWRKDSALNDKGQNGEDLTGGYYDAGDFVKFGFPMAYTVTVLAWGALDQEAGYTKA 64

Query: 643 KQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
             L+  + ++KW TDY + AH   N LY QVG+ D+DH
Sbjct: 65  NALDDVRKAIKWGTDYFIKAHVSQNELYGQVGNGDVDH 102



 Score = 28.9 bits (63), Expect(2) = 7e-23
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT  RP  +I+ S P
Sbjct: 105 WGRPEDMTMDRPAYKIDTSHP 125



>gb:AB118794_1200824 Hodotermopsis sjoestedti HsEG2 mRNA for
           putative endo-beta-1,4-glucanase HsEG2, partial cds.
          Length = 335

 Score =  101 bits (251), Expect(2) = 7e-23
 Identities = 47/93 (50%), Positives = 59/93 (63%)
 Frame = +1

Query: 478 WRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEP 657
           WR DS L D      DL+ G YDAGD +KFGFPMAYTAT +AW I++          L  
Sbjct: 1   WRKDSALNDKGQNGEDLTGGYYDAGDYVKFGFPMAYTATTIAWGIIDQEAGYNSASALAD 60

Query: 658 AKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           A+ ++KW TDY + AH   NVLY+QVG+ D+DH
Sbjct: 61  ARKAVKWATDYFIKAHVSQNVLYVQVGNGDVDH 93



 Score = 28.9 bits (63), Expect(2) = 7e-23
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT  RP  +I+ S P
Sbjct: 96  WGRPEDMTMDRPAYKIDTSHP 116



>gb:AF132735_481976 Clostridium cellulovorans endoglucanase K
           (engK), hydrophobic protein A (hbpA), endoglucanase L
           (engL), mannanase A (manA), endoglucanase M (engM),
           endoglucanase N (engN), and transposase (trp) genes,
           complete cds; and malate permease (mln) gene, partial
           cds.
          Length = 522

 Score =  108 bits (271), Expect = 9e-23
 Identities = 53/119 (44%), Positives = 68/119 (57%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM 579
           Y DA   ++ F++   SGK+ +N+  WRGD+ LKDG    LDLS G +DAGD +KFG P 
Sbjct: 32  YSDAFGKSIMFYEANWSGKVENNRFDWRGDAFLKDGADVGLDLSGGFFDAGDHVKFGLPQ 91

Query: 580 AYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           AY A+ L W    + D      Q       LK  TDY +  +PD+N  Y QVGD DLDH
Sbjct: 92  AYAASTLGWGYFAFKDAYKSNGQDAYMLKILKHFTDYFLKCYPDNNTFYYQVGDGDLDH 150



>gb:BNA242807_1633273 Brassica napus Cel16 gene for
           endo-1,4-beta-D-glucanase (cellulase).
          Length = 621

 Score = 99.0 bits (245), Expect(2) = 1e-22
 Identities = 58/127 (45%), Positives = 77/127 (60%), Gaps = 9/127 (7%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSAS----LDLSKGMYDAGDLMK 564
           Y  AL  A++FF+ QKSGKL   N +SWRG+SGL+DGK  S     DL  G YDAGD +K
Sbjct: 109 YTIALHKALKFFNAQKSGKLPRHNNVSWRGNSGLQDGKGDSGSFYKDLVGGYYDAGDAIK 168

Query: 565 FGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLV---NAHPDD-NVLYIQ 732
           F FPMAY  T+L+W+++EY  +     +L   K  +KW TDY +   N+  D  + L  Q
Sbjct: 169 FNFPMAYAMTMLSWSVIEYSAKYEAAGELVHVKELIKWGTDYFLKTFNSTADSIDDLVSQ 228

Query: 733 VGDPDLD 753
           VG  + D
Sbjct: 229 VGSGNTD 235



 Score = 30.4 bits (67), Expect(2) = 1e-22
 Identities = 11/18 (61%), Positives = 12/18 (66%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQIN 814
           CW RPEDM   RP+T  N
Sbjct: 246 CWMRPEDMDYKRPVTTCN 263



>gb:BT002221_1635824 Arabidopsis thaliana At5g49720/K2I5_8 mRNA,
           complete cds.
          Length = 621

 Score = 98.6 bits (244), Expect(2) = 2e-22
 Identities = 57/127 (44%), Positives = 77/127 (60%), Gaps = 9/127 (7%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSAS----LDLSKGMYDAGDLMK 564
           Y  AL  A++FF+ QKSGKL   N +SWRG+SGL+DGK  +     DL  G YDAGD +K
Sbjct: 109 YTIALHKALKFFNAQKSGKLPKHNNVSWRGNSGLQDGKGETGSFYKDLVGGYYDAGDAIK 168

Query: 565 FGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLV---NAHPDD-NVLYIQ 732
           F FPMAY  T+L+W+++EY  +     +L   K  +KW TDY +   N+  D  + L  Q
Sbjct: 169 FNFPMAYAMTMLSWSVIEYSAKYEAAGELTHVKELIKWGTDYFLKTFNSTADSIDDLVSQ 228

Query: 733 VGDPDLD 753
           VG  + D
Sbjct: 229 VGSGNTD 235



 Score = 30.4 bits (67), Expect(2) = 2e-22
 Identities = 11/18 (61%), Positives = 12/18 (66%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQIN 814
           CW RPEDM   RP+T  N
Sbjct: 246 CWMRPEDMDYKRPVTTCN 263



>gb:AY086165_1571221 Arabidopsis thaliana clone 21922 mRNA, complete
           sequence.
          Length = 621

 Score = 98.6 bits (244), Expect(2) = 2e-22
 Identities = 57/127 (44%), Positives = 77/127 (60%), Gaps = 9/127 (7%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSAS----LDLSKGMYDAGDLMK 564
           Y  AL  A++FF+ QKSGKL   N +SWRG+SGL+DGK  +     DL  G YDAGD +K
Sbjct: 109 YTIALHKALKFFNAQKSGKLPKHNNVSWRGNSGLQDGKGETGSFYKDLVGGYYDAGDAIK 168

Query: 565 FGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLV---NAHPDD-NVLYIQ 732
           F FPMAY  T+L+W+++EY  +     +L   K  +KW TDY +   N+  D  + L  Q
Sbjct: 169 FNFPMAYAMTMLSWSVIEYSAKYEAAGELTHVKELIKWGTDYFLKTFNSTADSIDDLVSQ 228

Query: 733 VGDPDLD 753
           VG  + D
Sbjct: 229 VGSGNTD 235



 Score = 30.4 bits (67), Expect(2) = 2e-22
 Identities = 11/18 (61%), Positives = 12/18 (66%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQIN 814
           CW RPEDM   RP+T  N
Sbjct: 246 CWMRPEDMDYKRPVTTCN 263



>gb:AY037218_1560112 Arabidopsis thaliana AT5g49720/K2I5_8 mRNA,
           complete cds.
          Length = 621

 Score = 98.6 bits (244), Expect(2) = 2e-22
 Identities = 57/127 (44%), Positives = 77/127 (60%), Gaps = 9/127 (7%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSAS----LDLSKGMYDAGDLMK 564
           Y  AL  A++FF+ QKSGKL   N +SWRG+SGL+DGK  +     DL  G YDAGD +K
Sbjct: 109 YTIALHKALKFFNAQKSGKLPKHNNVSWRGNSGLQDGKGETGSFYKDLVGGYYDAGDAIK 168

Query: 565 FGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLV---NAHPDD-NVLYIQ 732
           F FPMAY  T+L+W+++EY  +     +L   K  +KW TDY +   N+  D  + L  Q
Sbjct: 169 FNFPMAYAMTMLSWSVIEYSAKYEAAGELTHVKELIKWGTDYFLKTFNSTADSIDDLVSQ 228

Query: 733 VGDPDLD 753
           VG  + D
Sbjct: 229 VGSGNTD 235



 Score = 30.4 bits (67), Expect(2) = 2e-22
 Identities = 11/18 (61%), Positives = 12/18 (66%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQIN 814
           CW RPEDM   RP+T  N
Sbjct: 246 CWMRPEDMDYKRPVTTCN 263



>pir|S71215|S71215 cellulase (EC 3.2.1.4) KOR, membrane-anchored
           [validated] - Arabidopsis thaliana>gb:AB025613_1516367
           Arabidopsis thaliana genomic DNA, chromosome 5, TAC
           clone:K2I5.>gb:ATU37702_1556946 Arabidopsis thaliana
           cellulase (OR16pep) mRNA, complete
           cds.>gb:AF073875_1765939 Arabidopsis thaliana
           endo-1,4-beta-D-glucanase KORRIGAN (KOR) gene, KOR-1
           allele, complete cds.>gb:AF074092_1765951 Arabidopsis
           thaliana cellulase (DEC) gene, complete
           cds.>gb:AF074375_1766100 Arabidopsis thaliana cellulase
           (DEC) mRNA, complete cds.
          Length = 621

 Score = 98.6 bits (244), Expect(2) = 2e-22
 Identities = 57/127 (44%), Positives = 77/127 (60%), Gaps = 9/127 (7%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSAS----LDLSKGMYDAGDLMK 564
           Y  AL  A++FF+ QKSGKL   N +SWRG+SGL+DGK  +     DL  G YDAGD +K
Sbjct: 109 YTIALHKALKFFNAQKSGKLPKHNNVSWRGNSGLQDGKGETGSFYKDLVGGYYDAGDAIK 168

Query: 565 FGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLV---NAHPDD-NVLYIQ 732
           F FPMAY  T+L+W+++EY  +     +L   K  +KW TDY +   N+  D  + L  Q
Sbjct: 169 FNFPMAYAMTMLSWSVIEYSAKYEAAGELTHVKELIKWGTDYFLKTFNSTADSIDDLVSQ 228

Query: 733 VGDPDLD 753
           VG  + D
Sbjct: 229 VGSGNTD 235



 Score = 30.4 bits (67), Expect(2) = 2e-22
 Identities = 11/18 (61%), Positives = 12/18 (66%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQIN 814
           CW RPEDM   RP+T  N
Sbjct: 246 CWMRPEDMDYKRPVTTCN 263



>gb:AB118797_1200827 Neotermes koshunensis NkEG1 mRNA for putative
           endo-beta-1,4-glucanase NkEG1, partial cds.
          Length = 388

 Score = 98.2 bits (243), Expect(2) = 2e-22
 Identities = 47/98 (47%), Positives = 61/98 (62%)
 Frame = +1

Query: 463 DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVV 642
           D K++WR DS L D      DL+ G YDAGD +KFGFPMAYTATVLAW +++Y    +  
Sbjct: 5   DQKVTWRKDSALNDKGQNGEDLTGGYYDAGDHVKFGFPMAYTATVLAWGLVDYQAGYSAA 64

Query: 643 KQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
              +  + ++KW TDY + AH   N LY QVG+   DH
Sbjct: 65  GAPDDGRKAVKWATDYFLKAHVSANELYGQVGEGGPDH 102



 Score = 30.4 bits (67), Expect(2) = 2e-22
 Identities = 13/21 (61%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT SRP  +I+ S P
Sbjct: 105 WGRPEDMTMSRPAYKIDTSHP 125



>gb:AB118803_1200833 Nasutitermes takasagoensis NtEG2 mRNA for
           putative endo-beta-1,4-glucanase NtEG2, partial cds.
          Length = 374

 Score =  100 bits (248), Expect(2) = 2e-22
 Identities = 48/99 (48%), Positives = 61/99 (61%)
 Frame = +1

Query: 463 DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVV 642
           D K++WR DS L D      DL+ G YDAGD MK GFPMA+TATVLAW +++Y       
Sbjct: 5   DQKVTWRKDSALNDRGQNGEDLTGGYYDAGDHMKCGFPMAFTATVLAWGLVDYEAGYTAA 64

Query: 643 KQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHK 759
             L+  + ++KW TDY + AH    V Y QVG  DLDH+
Sbjct: 65  GALDDGRKAVKWATDYFLKAHTAPTVFYGQVGRMDLDHE 103



 Score = 28.5 bits (62), Expect(2) = 2e-22
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT  RP  +I+ S P
Sbjct: 105 WGRPEDMTLERPAYKIDTSHP 125



>gb:AB118795_1200825 Hodotermopsis sjoestedti HsEG3 mRNA for
           putative endo-beta-1,4-glucanase HsEG3, partial cds.
          Length = 335

 Score = 97.8 bits (242), Expect(2) = 8e-22
 Identities = 46/93 (49%), Positives = 59/93 (63%)
 Frame = +1

Query: 478 WRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEP 657
           WR DS L D      DL+ G YDAGD +KF FPMAYTAT +AW I++          L  
Sbjct: 1   WRKDSALNDKGQNGEDLTGGYYDAGDYVKFLFPMAYTATTIAWGIIDQEAGYNSASALAD 60

Query: 658 AKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           A+ +LKW TD+++ AH   NVLY+QVG+ D+DH
Sbjct: 61  ARKALKWATDFIIKAHVSQNVLYVQVGNGDVDH 93



 Score = 28.9 bits (63), Expect(2) = 8e-22
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT  RP  +I+ S P
Sbjct: 96  WGRPEDMTMDRPAYKIDTSHP 116



>gb:AB118662_1200798 Hodotermopsis sjoestedti mRNA for putative
           endo-beta-1,4-glucanase HsEG1, partial cds.
          Length = 335

 Score = 97.8 bits (242), Expect(2) = 8e-22
 Identities = 46/93 (49%), Positives = 59/93 (63%)
 Frame = +1

Query: 478 WRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEP 657
           WR DS L D      DL+ G YDAGD +KF FPMAYTAT +AW I++          L  
Sbjct: 1   WRKDSALNDKGQNGEDLTGGYYDAGDYVKFLFPMAYTATTIAWGIIDQEAGYNSASALAD 60

Query: 658 AKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           A+ +LKW TD+++ AH   NVLY+QVG+ D+DH
Sbjct: 61  ARKALKWATDFIIKAHVSQNVLYVQVGNGDVDH 93



 Score = 28.9 bits (63), Expect(2) = 8e-22
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT  RP  +I+ S P
Sbjct: 96  WGRPEDMTMDRPAYKIDTSHP 116



>gb:FXA223387_1679530 Fragaria x ananassa partial mRNA for
           endo-beta-1,4-glucanase, clone pCR14.
          Length = 170

 Score = 95.1 bits (235), Expect(2) = 8e-22
 Identities = 41/74 (55%), Positives = 56/74 (75%)
 Frame = +1

Query: 535 GMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDD 714
           G YDAGD +KFG PMA+T T+++W+I+EYG QMA + +L  A  ++KW TDY + AHP+ 
Sbjct: 1   GYYDAGDNVKFGLPMAFTVTMMSWSIIEYGKQMASIGELGHALDAVKWGTDYFIKAHPEP 60

Query: 715 NVLYIQVGDPDLDH 756
           NVLY +VGD + DH
Sbjct: 61  NVLYGEVGDGNTDH 74



 Score = 31.6 bits (70), Expect(2) = 8e-22
 Identities = 13/22 (59%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CWQRPEDMT  R   +I+ S P
Sbjct: 76  CWQRPEDMTTDRRAYKISPSNP 97



>gb:AE017348_1758419 Cryptococcus neoformans var. neoformans JEC21
           chromosome 8, complete sequence.
          Length = 590

 Score =  105 bits (261), Expect = 1e-21
 Identities = 50/124 (40%), Positives = 77/124 (62%), Gaps = 4/124 (3%)
 Frame = +1

Query: 397 KYGDALKIAMQFFDVQKSGKLVD----NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMK 564
           ++ + L  ++ F+D Q+SG+L +    N++ WR DS L+DG    LDL  G YDAGD +K
Sbjct: 44  QWSNILGNSLWFYDAQRSGRLDEGTYGNRVDWRNDSALEDGSDWGLDLVGGWYDAGDYIK 103

Query: 565 FGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDP 744
             FP+++T   L+W  L +G    +  Q     G+L+W  D+L+ AHP D+VL+IQVG  
Sbjct: 104 ATFPLSFTLFALSWGALTHGQGYGLANQTAYLDGTLRWGFDWLMKAHPSDDVLFIQVGSG 163

Query: 745 DLDH 756
           D+D+
Sbjct: 164 DVDN 167



>pir|B96681|B96681 F5I14.14 protein [imported] - Arabidopsis
           thaliana>gb:AE005173_894212 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:F5I14_1678391 Sequence of BAC F5I14 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 623

 Score = 96.3 bits (238), Expect(2) = 2e-21
 Identities = 54/119 (45%), Positives = 74/119 (62%), Gaps = 6/119 (5%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLD-LSKGMYDAGDLMKFGF 573
           Y  AL  A+QFFD QKSGKL   NK+SWRGDSG KDG    +  L  G YD G  +KF F
Sbjct: 117 YTLALHKALQFFDAQKSGKLPKKNKVSWRGDSGTKDGLPDVVGGLVGGYYDGGSNVKFHF 176

Query: 574 PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLV----NAHPDDNVLYIQVG 738
           PMA++ T+L+W+++EY  +   + + +  +  LKW TDYL+    N+    + +Y QVG
Sbjct: 177 PMAFSMTMLSWSLIEYSHKYKAIDEYDHMRDVLKWGTDYLLLTFNNSATRLDHIYTQVG 235



 Score = 29.3 bits (64), Expect(2) = 2e-21
 Identities = 10/16 (62%), Positives = 13/16 (81%)
 Frame = +2

Query: 755 IKCWQRPEDMTESRPL 802
           I CWQ+PEDM+  RP+
Sbjct: 247 IYCWQKPEDMSYDRPV 262



>pir|T06059|T06059 cellulase (EC 3.2.1.4) F19H22.90 - Arabidopsis
           thaliana>gb:ATCHRIV90_1547883 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           90.>gb:ATF19H22_1549321 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F19H22 (ESSA project).
          Length = 494

 Score = 97.1 bits (240), Expect(2) = 2e-21
 Identities = 50/122 (40%), Positives = 80/122 (65%), Gaps = 2/122 (1%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL  ++ FF+ Q+SG L  + +++WR +S L DGK+ ++DL  G YDAGD +KF FP
Sbjct: 24  YSDALTKSILFFEGQRSGYLPREQRMTWRHNSALNDGKNLNVDLVGGYYDAGDNIKFHFP 83

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPD-DNVLYIQVGDPDLD 753
           MA+T T+LAW+ +++G  M+    L     +L+W ++YL+       N +++QVG+P  D
Sbjct: 84  MAFTTTMLAWSAIDFGSYMSPA-DLRDNLVALRWGSNYLLKTVSQLPNRIFVQVGEPTPD 142

Query: 754 HK 759
           H+
Sbjct: 143 HQ 144



 Score = 28.5 bits (62), Expect(2) = 2e-21
 Identities = 12/28 (42%), Positives = 15/28 (53%)
 Frame = +2

Query: 743 PT*TIKCWQRPEDMTESRPLTQINASVP 826
           PT   +CW+RPEDM   R    + A  P
Sbjct: 139 PTPDHQCWERPEDMDTPRTAYALEAPKP 166



>gb:AF316823_499255 Clostridium cellulolyticum cellulase gene
           cluster, complete sequence.
          Length = 737

 Score =  104 bits (260), Expect = 2e-21
 Identities = 51/123 (41%), Positives = 75/123 (60%), Gaps = 4/123 (3%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKL----VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           YG+AL+ ++ F++ Q+SG L    +  ++ WRGD+ L DG+   LDL+ G  DAGD +KF
Sbjct: 38  YGEALQKSVLFYEAQRSGSLSTSNIPTRLLWRGDAQLTDGQKEGLDLTGGWVDAGDNIKF 97

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD 747
           G   AYT ++LA+  +EY D      Q++  +  LKWI DY +  HP+ NV + QVG   
Sbjct: 98  GITCAYTTSLLAFGAIEYKDAYEKSGQMKWLQNQLKWINDYFIKCHPEPNVFWAQVGMTA 157

Query: 748 LDH 756
            DH
Sbjct: 158 NDH 160



>gb:AB162804_1201928 Haliotis discus discus celhdd mRNA for
           cellulase, complete cds.
          Length = 594

 Score =  101 bits (252), Expect(2) = 4e-21
 Identities = 55/127 (43%), Positives = 73/127 (57%), Gaps = 2/127 (1%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG+AL  ++ F+D Q+SGKL  +N I WRGDS L D      DL+ G YDAGD +KF  P
Sbjct: 151 YGEALGKSILFYDAQRSGKLPANNPIKWRGDSALGDKGDNGEDLTGGWYDAGDHVKFSLP 210

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAH-PDDNVLYIQVGDPDLD 753
           M+ T+TVL W  L++ D  A  KQ +     +KW  DY +    P    LY QVG+ + D
Sbjct: 211 MSSTSTVLLWGYLQWRDAYATTKQTDMFFDMIKWPLDYFLKCWIPKSQTLYAQVGEGNDD 270

Query: 754 HKMLAKA 774
           H    +A
Sbjct: 271 HHFWGRA 277



 Score = 22.7 bits (47), Expect(2) = 4e-21
 Identities = 9/21 (42%), Positives = 12/21 (57%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W R EDM  +RP  ++  S P
Sbjct: 274 WGRAEDMKMARPAYKLTPSKP 294



>gb:AB125892_1201207 Haliotis discus hannai Hdcel gene for
           cellulase, complete cds.
          Length = 594

 Score =  101 bits (252), Expect(2) = 4e-21
 Identities = 55/127 (43%), Positives = 73/127 (57%), Gaps = 2/127 (1%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG+AL  ++ F+D Q+SGKL  +N I WRGDS L D      DL+ G YDAGD +KF  P
Sbjct: 151 YGEALGKSILFYDAQRSGKLPANNPIKWRGDSALGDKGDNGEDLTGGWYDAGDHVKFSLP 210

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAH-PDDNVLYIQVGDPDLD 753
           M+ T+TVL W  L++ D  A  KQ +     +KW  DY +    P    LY QVG+ + D
Sbjct: 211 MSSTSTVLLWGYLQWKDAYATTKQTDMFFDMIKWPLDYFLKCWIPKSQTLYAQVGEGNDD 270

Query: 754 HKMLAKA 774
           H    +A
Sbjct: 271 HHFWGRA 277



 Score = 22.7 bits (47), Expect(2) = 4e-21
 Identities = 9/21 (42%), Positives = 12/21 (57%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W R EDM  +RP  ++  S P
Sbjct: 274 WGRAEDMKMARPAYKLTPSKP 294



>gb:AB092978_1198905 Haliotis discus hdcel-1 mRNA for cellulase,
           complete cds.
          Length = 594

 Score =  101 bits (252), Expect(2) = 4e-21
 Identities = 55/127 (43%), Positives = 73/127 (57%), Gaps = 2/127 (1%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG+AL  ++ F+D Q+SGKL  +N I WRGDS L D      DL+ G YDAGD +KF  P
Sbjct: 151 YGEALGKSILFYDAQRSGKLPANNPIKWRGDSALGDKGDNGEDLTGGWYDAGDHVKFSLP 210

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAH-PDDNVLYIQVGDPDLD 753
           M+ T+TVL W  L++ D  A  KQ +     +KW  DY +    P    LY QVG+ + D
Sbjct: 211 MSSTSTVLLWGYLQWKDAYATTKQTDMFFDMIKWPLDYFLKCWIPKSQTLYAQVGEGNDD 270

Query: 754 HKMLAKA 774
           H    +A
Sbjct: 271 HHFWGRA 277



 Score = 22.7 bits (47), Expect(2) = 4e-21
 Identities = 9/21 (42%), Positives = 12/21 (57%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W R EDM  +RP  ++  S P
Sbjct: 274 WGRAEDMKMARPAYKLTPSKP 294



>gb:MIN505608_1686348 Mangifera indica partial mRNA for putative
           endo-1,4-beta-glucanase (cel gene), cultivar Alphonso,
           isoform 2.>gb:MIN505609_1686349 Mangifera indica partial
           mRNA for putative endo-1,4-beta-glucanase (cel gene),
           cultivar Totapuri.
          Length = 174

 Score = 91.3 bits (225), Expect(2) = 8e-21
 Identities = 40/74 (54%), Positives = 54/74 (72%)
 Frame = +1

Query: 535 GMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDD 714
           G YDAGD +KFG PMA+T T+L+W+++E+ DQ+A   +LE A  ++KW TDY V AH   
Sbjct: 2   GYYDAGDHVKFGLPMAFTVTMLSWSVIEFRDQIAEAGELEHALEAIKWGTDYFVKAHTSP 61

Query: 715 NVLYIQVGDPDLDH 756
           NVL+ +VGD D DH
Sbjct: 62  NVLWAEVGDGDTDH 75



 Score = 32.0 bits (71), Expect(2) = 8e-21
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CWQRPEDMT SR   +I+ + P
Sbjct: 77  CWQRPEDMTTSRHAYKIDENNP 98



>gb:AF220594_1252367 Mastotermes darwiniensis beta-1,4-glucanase 2
           (EG2) mRNA, partial cds.
          Length = 270

 Score = 93.6 bits (231), Expect(2) = 1e-20
 Identities = 43/78 (55%), Positives = 55/78 (70%)
 Frame = +1

Query: 523 DLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNA 702
           DL+ G YDAGD +KFGFPMAYTATVLAW ++++    +    L+  + +LKW+TDYL+ A
Sbjct: 9   DLTGGYYDAGDYVKFGFPMAYTATVLAWGLVDHPAGYSSAGVLDDGRKALKWVTDYLIKA 68

Query: 703 HPDDNVLYIQVGDPDLDH 756
           H   N LY QVGD D DH
Sbjct: 69  HVSKNELYGQVGDGDADH 86



 Score = 29.3 bits (64), Expect(2) = 1e-20
 Identities = 12/21 (57%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT +RP  +I+ S P
Sbjct: 89  WGRPEDMTMARPAYKIDTSRP 109



>gb:AF155197_483997 Acetivibrio cellulolyticus cellulosomal
           scaffoldin precursor (cipV) gene, complete cds.
          Length = 1915

 Score =  101 bits (252), Expect = 1e-20
 Identities = 53/124 (42%), Positives = 68/124 (54%), Gaps = 2/124 (1%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGK--LVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMK 564
           TQ Y  AL  A+QFFD  K G     DN  SWRG     D   +  DL+ G +DAGD +K
Sbjct: 31  TQDYDKALDYAIQFFDANKCGPDAASDNVFSWRGACHTSDKGPSGEDLTGGYHDAGDHVK 90

Query: 565 FGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDP 744
           FG P AY+A +L W + EYG+ M           +LK+ +DYL+  HP  N+ Y QVG+ 
Sbjct: 91  FGLPQAYSAFMLGWALYEYGNVMDSTGNKTKILSTLKYFSDYLLKCHPSANIFYHQVGEG 150

Query: 745 DLDH 756
             DH
Sbjct: 151 GPDH 154



>pir|T06060|T06060 cellulase (EC 3.2.1.4) F19H22.100 - Arabidopsis
           thaliana>gb:ATCHRIV90_1547884 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           90.>gb:ATF19H22_1549322 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F19H22 (ESSA project).
          Length = 493

 Score = 94.7 bits (234), Expect(2) = 2e-20
 Identities = 50/121 (41%), Positives = 76/121 (62%), Gaps = 2/121 (1%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL+ ++ FF+ Q+SG+L    +++WR +S L DGK+   DL  G YDAGD +KF FP
Sbjct: 26  YSDALRKSILFFEGQRSGRLPKQQRMAWRRNSALNDGKNLKTDLVGGYYDAGDNVKFHFP 85

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPD-DNVLYIQVGDPDLD 753
           MA+TAT+LAW+ +++G  M+          ++KW TDYL+       N +++ VG+   D
Sbjct: 86  MAFTATMLAWSSVDFGRYMS-QHDFRHNLVAVKWATDYLLKTVSQLPNRIFVHVGEVQPD 144

Query: 754 H 756
           H
Sbjct: 145 H 145



 Score = 27.3 bits (59), Expect(2) = 2e-20
 Identities = 10/22 (45%), Positives = 13/22 (59%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R    ++A  P
Sbjct: 147 CWERPEDMDTPRTAFALDAPYP 168



>gb:AF220593_1252366 Mastotermes darwiniensis beta-1,4-glucanase 1
           (EG1) mRNA, partial cds.
          Length = 269

 Score = 92.0 bits (227), Expect(2) = 3e-20
 Identities = 42/78 (53%), Positives = 55/78 (70%)
 Frame = +1

Query: 523 DLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNA 702
           DL+   YDAGD +KFGFPMAYTATVLAW ++++    +    L+  + +LKW+TDYL+ A
Sbjct: 9   DLTGDYYDAGDYVKFGFPMAYTATVLAWGLVDHPAGYSSAGLLDDGRKALKWVTDYLIKA 68

Query: 703 HPDDNVLYIQVGDPDLDH 756
           H  +N LY QVGD D DH
Sbjct: 69  HVSENELYGQVGDGDADH 86



 Score = 29.3 bits (64), Expect(2) = 3e-20
 Identities = 12/21 (57%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT +RP  +I+ S P
Sbjct: 89  WGRPEDMTMARPAYKIDTSNP 109



>gb:MIN505607_1686347 Mangifera indica partial mRNA for putative
           endo-1,4-beta-glucanase (cel gene), cultivar Alphonso,
           isoform 1.
          Length = 204

 Score =  100 bits (249), Expect = 3e-20
 Identities = 45/98 (45%), Positives = 68/98 (69%)
 Frame = +1

Query: 463 DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVV 642
           D  ++WR +SGL DG + + +L  G YDAGD +KF FPMA+T T+L+W+I+E+GD M   
Sbjct: 7   DQSMTWRSNSGLSDGYTYNTNLVGGYYDAGDNVKFNFPMAFTTTLLSWSIIEFGDLMP-P 65

Query: 643 KQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
            +L  A  +++W TDYL+      N +++QVGDP++DH
Sbjct: 66  NELRNALVAIRWATDYLLMTVSQPNRIFVQVGDPNIDH 103



>pir|T07612|T07612 cellulase (EC 3.2.1.4) Cel3, membrane-anchored -
           tomato>gb:LEU78526_1684765 Lycopersicon esculentum
           endo-1,4-beta-glucanase (Cel3) mRNA, complete cds.
          Length = 617

 Score = 93.2 bits (230), Expect(2) = 4e-20
 Identities = 47/104 (45%), Positives = 67/104 (64%), Gaps = 5/104 (4%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSK----GMYDAGDLMK 564
           Y  AL+ A+ FF+ QKSGKL   N +SWRG+S L+DGKS    + K    G YDAGD +K
Sbjct: 109 YTLALRKALMFFNAQKSGKLPKHNNVSWRGNSCLQDGKSDDSTMFKNLVGGYYDAGDAIK 168

Query: 565 FGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLV 696
           F FP ++  T+L+W+++EY  +     +L   K ++KW TDYL+
Sbjct: 169 FNFPQSFALTMLSWSVIEYSAKYEAAGELAHVKDTIKWGTDYLL 212



 Score = 27.7 bits (60), Expect(2) = 4e-20
 Identities = 9/16 (56%), Positives = 13/16 (81%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQ 808
           CW RPED+  +RP+T+
Sbjct: 246 CWVRPEDIDYARPVTE 261



>gb:AF220592_1252365 Hodotermopsis japonica beta-1,4-glucanase (EG)
           mRNA, partial cds.
          Length = 270

 Score = 91.7 bits (226), Expect(2) = 5e-20
 Identities = 41/78 (52%), Positives = 53/78 (67%)
 Frame = +1

Query: 523 DLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNA 702
           DL+ G YDAGD +KFGFPMAYTAT +AW I++          L  A+ ++KW TDY + A
Sbjct: 9   DLTGGYYDAGDYVKFGFPMAYTATTIAWGIIDQEAGYNSASALADARKAVKWATDYFIKA 68

Query: 703 HPDDNVLYIQVGDPDLDH 756
           H   NVLY+QVG+ D+DH
Sbjct: 69  HVSQNVLYVQVGNGDVDH 86



 Score = 28.9 bits (63), Expect(2) = 5e-20
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT  RP  +I+ S P
Sbjct: 89  WGRPEDMTMDRPAYKIDTSHP 109



>sp|P22699|GUN6_DICDI Endoglucanase precursor (EC 3.2.1.4)
           (Endo-1,4-beta-glucanase) (Spore germination protein
           270-6) (Cellulase).>pir|A35621|A35621 spore germination
           protein 270-6 - slime mold (Dictyostelium
           discoideum)>gb:DDISGSPB_1377177 Dictyostelium discoideum
           spore germination-specific protein gene, complete cds.
          Length = 705

 Score = 95.1 bits (235), Expect(2) = 9e-20
 Identities = 50/126 (39%), Positives = 73/126 (57%), Gaps = 7/126 (5%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASL-------DLSKGMYDAGDL 558
           Y   L+ A+ F+ + ++G+L DN I WRG+S L D    S        +LS G +DAGD 
Sbjct: 27  YCSLLENALMFYKMNRAGRLPDNDIPWRGNSALNDASPNSAKDANGDGNLSGGYFDAGDG 86

Query: 559 MKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVG 738
           +KFG PMAY+ T+L W+ +EY   +A          ++K+ TD+L+ AH  DN    QVG
Sbjct: 87  VKFGLPMAYSMTMLGWSFIEYESNIAQCGLTSLYLDTIKYGTDWLIAAHTADNEFAGQVG 146

Query: 739 DPDLDH 756
           D ++DH
Sbjct: 147 DGNVDH 152



 Score = 24.6 bits (52), Expect(2) = 9e-20
 Identities = 9/21 (42%), Positives = 11/21 (52%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W  PEDMT +RP   +    P
Sbjct: 155 WGPPEDMTMARPTYMLTTEAP 175



>gb:AB040769_1519643 Hordeum vulgare mRNA for
           endo-1,4-beta-glucanase Cel1, complete cds.
          Length = 621

 Score = 93.2 bits (230), Expect(2) = 1e-19
 Identities = 46/104 (44%), Positives = 68/104 (65%), Gaps = 4/104 (3%)
 Frame = +1

Query: 397 KYGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDG---KSASLDLSKGMYDAGDLMK 564
           +Y  AL  A+ FF+ Q+SG L   N +SWRG+SG+KDG    +    L  G YDAGD +K
Sbjct: 110 QYTLALHKALMFFNAQRSGHLPKHNGVSWRGNSGMKDGLPDSTVKKSLVGGFYDAGDAIK 169

Query: 565 FGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLV 696
           F FPMA++ T+L+WT++EY  +   + +L+  K  +KW TDY++
Sbjct: 170 FNFPMAWSMTMLSWTVIEYRAKYEAIGELDHVKEIIKWGTDYML 213



 Score = 26.2 bits (56), Expect(2) = 1e-19
 Identities = 8/19 (42%), Positives = 13/19 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINA 817
           CW RPED+   RP+ + ++
Sbjct: 246 CWMRPEDIDYKRPVIECHS 264



>gb:AY574906_1615878 Gossypium hirsutum membrane-anchored
           endo-1,4-beta-glucanase (CEL) mRNA, complete cds.
          Length = 619

 Score = 94.0 bits (232), Expect(2) = 1e-19
 Identities = 48/104 (46%), Positives = 67/104 (64%), Gaps = 5/104 (4%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKS----ASLDLSKGMYDAGDLMK 564
           Y  AL  A+ FF+ Q+SGKL   N +SWRG+SGL+DGKS       DL  G YDAGD +K
Sbjct: 110 YTLALHKALMFFNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDAGDAIK 169

Query: 565 FGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLV 696
           F FP +++ T+L+W+++EY  +     +L   K  +KW TDYL+
Sbjct: 170 FNFPASFSMTMLSWSVIEYSAKYEAAGELNHVKEIIKWGTDYLL 213



 Score = 25.4 bits (54), Expect(2) = 1e-19
 Identities = 8/19 (42%), Positives = 13/19 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINA 817
           CW RPED+   RP+ + ++
Sbjct: 247 CWMRPEDIDYPRPVYECHS 265



>gb:AY253447_1592991 Gossypium hirsutum endo-1,4-beta-glucanase
           mRNA, complete cds.
          Length = 619

 Score = 94.0 bits (232), Expect(2) = 1e-19
 Identities = 48/104 (46%), Positives = 67/104 (64%), Gaps = 5/104 (4%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKS----ASLDLSKGMYDAGDLMK 564
           Y  AL  A+ FF+ Q+SGKL   N +SWRG+SGL+DGKS       DL  G YDAGD +K
Sbjct: 110 YTLALHKALMFFNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDAGDAIK 169

Query: 565 FGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLV 696
           F FP +++ T+L+W+++EY  +     +L   K  +KW TDYL+
Sbjct: 170 FNFPASFSMTMLSWSVIEYSAKYEAAGELNHVKEIIKWGTDYLL 213



 Score = 25.4 bits (54), Expect(2) = 1e-19
 Identities = 8/19 (42%), Positives = 13/19 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINA 817
           CW RPED+   RP+ + ++
Sbjct: 247 CWMRPEDIDYPRPVYECHS 265



>gb:AY387483_1604279 Oryza sativa (japonica cultivar-group) BAC
           OSJNBa0084L17, complete sequence.>gb:AC118133_1739451
           Oryza sativa chromosome 3 BAC OSJNBb0016H12 genomic
           sequence, complete sequence.
          Length = 620

 Score = 90.9 bits (224), Expect(2) = 1e-19
 Identities = 46/104 (44%), Positives = 68/104 (65%), Gaps = 4/104 (3%)
 Frame = +1

Query: 397 KYGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASL---DLSKGMYDAGDLMK 564
           +Y  AL  A+ FF+ Q+SG L   N +SWRG+S +KDG S S     L  G YDAGD +K
Sbjct: 109 QYTQALHKALMFFNAQRSGPLPKHNGVSWRGNSCMKDGLSDSTVRKSLVGGFYDAGDAIK 168

Query: 565 FGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLV 696
           F +PMA++ T+L+W+++EY  +   + +L+  K  +KW TDYL+
Sbjct: 169 FNYPMAWSMTMLSWSVIEYKAKYEAIGELDHVKELIKWGTDYLL 212



 Score = 28.1 bits (61), Expect(2) = 1e-19
 Identities = 9/19 (47%), Positives = 14/19 (73%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINA 817
           CW RPED+   RP+T+ ++
Sbjct: 246 CWMRPEDIDYPRPVTECHS 264



>gb:AK117850_1815860 Arabidopsis thaliana At4g39000 mRNA for
           putative endo-1,4-beta-glucanase, complete cds, clone:
           RAFL19-01-E16.
          Length = 309

 Score = 91.7 bits (226), Expect(2) = 1e-19
 Identities = 50/121 (41%), Positives = 76/121 (62%), Gaps = 2/121 (1%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DAL+ ++ FF+ Q+SG+L    +++WR +S L DGK+   DL  G YDAGD +KF FP
Sbjct: 26  YSDALRKSILFFEGQRSGRLPKQQRMAWRRNSALNDGKNLKTDLVGGYYDAGDNVKFHFP 85

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPD-DNVLYIQVGDPDLD 753
           MA+TAT+LAW++ ++G  M+          ++KW TDYL+       N +++ VG+   D
Sbjct: 86  MAFTATMLAWSV-DFGRYMS-QHDFRHNLVAVKWATDYLLKTVSQLPNRIFVHVGEVQPD 143

Query: 754 H 756
           H
Sbjct: 144 H 144



 Score = 27.3 bits (59), Expect(2) = 1e-19
 Identities = 10/22 (45%), Positives = 13/22 (59%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R    ++A  P
Sbjct: 146 CWERPEDMDTPRTAFALDAPYP 167



>gb:AB084463_1524341 Pyrus communis PC-EG1 mRNA for
           endo-1,4-beta-D-glucanase, encodes membrane-spanning
           domain, complete cds.
          Length = 621

 Score = 90.5 bits (223), Expect(2) = 2e-19
 Identities = 49/121 (40%), Positives = 73/121 (60%), Gaps = 8/121 (6%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASL---DLSKGMYDAGDLMKF 567
           Y  AL+ ++ FF+ Q+SGKL   N +SWRG+S L+DG   S    DL+ G YDAGD +KF
Sbjct: 112 YTLALRKSLMFFNAQRSGKLPKHNNVSWRGNSCLRDGNDPSTTFKDLAGGFYDAGDAIKF 171

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNA--HPDDNV--LYIQV 735
            FP ++  T+L+W+++EY  +     +L   K  +KW +DY +    H  D++  L  QV
Sbjct: 172 NFPASFAMTMLSWSVIEYSAKYEAAGELSHVKEIIKWGSDYFLKTFNHSADSIDRLVAQV 231

Query: 736 G 738
           G
Sbjct: 232 G 232



 Score = 28.1 bits (61), Expect(2) = 2e-19
 Identities = 9/19 (47%), Positives = 14/19 (73%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINA 817
           CW RPED+   RP++Q ++
Sbjct: 248 CWMRPEDIDYQRPVSQCHS 266



>pir|T09889|T09889 cellulase homolog T22A6.90 - Arabidopsis
           thaliana>gb:ATCHRIV61_1546309 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 61.>gb:ATT22A6_1555175
           Arabidopsis thaliana DNA chromosome 4, BAC clone T22A6
           (ESSA project).
          Length = 620

 Score = 93.6 bits (231), Expect(2) = 2e-19
 Identities = 52/121 (42%), Positives = 74/121 (61%), Gaps = 9/121 (7%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDN--KISWRGDSGLKDGKS----ASLDLSKGMYDAGDLM 561
           Y  AL+ A++FF+ Q+SGKL  N   +SWR DS L+DGK        DL  G YDAGD +
Sbjct: 109 YTIALRTALKFFNAQQSGKLPKNIYNVSWRHDSCLQDGKGDPGQCYKDLVGGYYDAGDSI 168

Query: 562 KFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLV---NAHPDDNVLYIQ 732
           KF FPM+Y  T+L+W+++EY  +     +LE  K  +KW TDY +   N+  D+  +Y+ 
Sbjct: 169 KFNFPMSYAMTMLSWSVIEYSAKYQAAGELEHVKELIKWGTDYFLKTFNSSADN--IYVM 226

Query: 733 V 735
           V
Sbjct: 227 V 227



 Score = 25.0 bits (53), Expect(2) = 2e-19
 Identities = 9/20 (45%), Positives = 13/20 (65%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINAS 820
           CW RPED+   R ++Q  +S
Sbjct: 247 CWMRPEDIHYKRTVSQCYSS 266



>gb:OSJN00052_1693942 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0067K08, complete sequence.
          Length = 623

 Score = 90.9 bits (224), Expect(2) = 2e-19
 Identities = 53/123 (43%), Positives = 75/123 (60%), Gaps = 9/123 (7%)
 Frame = +1

Query: 397 KYGDALKIAMQFFDVQKSGKLVDNK-ISWRGDSGLKDGKSASL---DLSKGMYDAGDLMK 564
           +Y DAL  A+ FF+ QKSG+L  N  I WRG+SGL DG   +     L  G YDAGD +K
Sbjct: 110 QYTDALHKALLFFNAQKSGRLPKNNGIKWRGNSGLSDGSDLTDVKGGLVGGYYDAGDNIK 169

Query: 565 FGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLV-----NAHPDDNVLYI 729
           F FP+A++ T+L+W+++EY  +   V + +  +  +KW TDYL+     +A   D V Y 
Sbjct: 170 FHFPLAFSMTMLSWSVIEYSAKYKAVGEYDHVRELIKWGTDYLLLTFNSSASTIDKV-YS 228

Query: 730 QVG 738
           QVG
Sbjct: 229 QVG 231



 Score = 27.3 bits (59), Expect(2) = 2e-19
 Identities = 12/22 (54%), Positives = 13/22 (59%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW RPEDM   RP+ Q   S P
Sbjct: 245 CWNRPEDMAYPRPV-QTAGSAP 265



>gb:AF459453_1801722 Piromyces sp. E2 cellulase Cel9A precursor
           (cel9A) mRNA, complete cds.
          Length = 778

 Score = 96.7 bits (239), Expect = 5e-19
 Identities = 50/123 (40%), Positives = 70/123 (56%), Gaps = 1/123 (0%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           +Q Y   +++++ F++ Q+SGKL +N +I WR DS L  G    +DL+ G YDAGD +KF
Sbjct: 23  SQDYARHIELSLLFYEAQRSGKLPENNRIYWRHDSMLDAGADNKVDLTGGYYDAGDNVKF 82

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD 747
            FP A   T+LAW+   Y D      Q E    +++W  DY V  H   N LY+QVG   
Sbjct: 83  NFPQAAALTLLAWSGWYYADGYKEAGQWEYILDAVRWGADYFVKCHTGKNELYVQVGKGA 142

Query: 748 LDH 756
            DH
Sbjct: 143 TDH 145



>gb:AF459452_1801721 Piromyces sp. E2 cellulase Cel9A precursor
           (cel9A) gene, partial cds.
          Length = 771

 Score = 96.7 bits (239), Expect = 5e-19
 Identities = 50/123 (40%), Positives = 70/123 (56%), Gaps = 1/123 (0%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           +Q Y   +++++ F++ Q+SGKL +N +I WR DS L  G    +DL+ G YDAGD +KF
Sbjct: 16  SQDYARHIELSLLFYEAQRSGKLPENNRIYWRHDSMLDAGADNKVDLTGGYYDAGDNVKF 75

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD 747
            FP A   T+LAW+   Y D      Q E    +++W  DY V  H   N LY+QVG   
Sbjct: 76  NFPQAAALTLLAWSGWYYADGYKEAGQWEYILDAVRWGADYFVKCHTGKNELYVQVGKGA 135

Query: 748 LDH 756
            DH
Sbjct: 136 TDH 138



>gb:CTH275974_119541 Clostridium thermocellum ORF1 (partial), celI
           gene, ORF3, ORF4, celN gene, celP gene and ORF7
           (partial), strain F7.
          Length = 742

 Score = 96.7 bits (239), Expect = 5e-19
 Identities = 48/122 (39%), Positives = 68/122 (55%), Gaps = 1/122 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDNKI-SWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           YG+AL+ A+ F+   + G L D+ I  +R D+ + DG+   LDL+ G  DAGD +KF  P
Sbjct: 51  YGEALQKAILFYKANRLGDLPDDYILPYRADAAMTDGQDVGLDLTGGWADAGDGIKFTHP 110

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           M+Y A  L W + EY         L+     +KW TD+ + AHP+ NVLY   G  D DH
Sbjct: 111 MSYAAGQLGWAVYEYRQAFEKAGLLDDILDEIKWATDFFIKAHPEPNVLYYMCGYNDSDH 170

Query: 757 KM 762
            +
Sbjct: 171 SV 172



>gb:AB072270_9573 Eubacterium cellulosolvens cbpe1 gene for
           cellulose-binding protein E1, complete cds.
          Length = 1151

 Score = 96.7 bits (239), Expect = 5e-19
 Identities = 50/126 (39%), Positives = 70/126 (55%), Gaps = 3/126 (2%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVD---NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG 570
           YGDAL  ++ F+ +Q+SGKL +   ++ +WR D+ + DG+   +DLS G  DAGD +KF 
Sbjct: 44  YGDALAKSLLFYQLQESGKLSEETKSRCNWRDDACVNDGQPYGIDLSGGWNDAGDNVKFN 103

Query: 571 FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL 750
            P AYT  +LAW+ L          Q +     LKW+ DY V  +PD    + Q GD  L
Sbjct: 104 LPAAYTGMMLAWSYLNNPKAYETSGQEKWMLHDLKWVNDYFVKCNPDSKTYWYQCGDGGL 163

Query: 751 DHKMLA 768
           DH   A
Sbjct: 164 DHNYWA 169



>gb:AF500793_1806441 Piromyces sp. E2 cellulosomal glycoside
           hydrolase family 9 endoglucanase Cel9B gene, partial
           cds.
          Length = 661

 Score = 96.3 bits (238), Expect = 6e-19
 Identities = 54/123 (43%), Positives = 73/123 (59%), Gaps = 1/123 (0%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKLVDNK-ISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           TQ Y   L++++ F++ Q+SGKL +N  I WR DS +  GK  ++DL+ G YDAGD +KF
Sbjct: 1   TQDYARHLELSILFYEAQRSGKLPENNGIFWRHDSMVDAGKDNNVDLTGG-YDAGDNVKF 59

Query: 568 GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD 747
            FP A   T+LA+   ++ D      Q E  K  LKW  DY +  H D  VLY QVG+  
Sbjct: 60  NFPQASALTILAYGAYKWKDGYKQAGQWEYMKDLLKWGMDYFLKCHTDKYVLYGQVGNGS 119

Query: 748 LDH 756
           LDH
Sbjct: 120 LDH 122



>gb:AF220591_1252364 Neotermes koshunensis beta-1,4-glucanase (EG)
           mRNA, partial cds.
          Length = 270

 Score = 86.3 bits (212), Expect(2) = 7e-19
 Identities = 40/78 (51%), Positives = 52/78 (66%)
 Frame = +1

Query: 523 DLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNA 702
           DL+ G YDAGD +KFGFPMAYTATVLAW +++Y    +    L+  + ++KW TDY + A
Sbjct: 9   DLTGGYYDAGDYVKFGFPMAYTATVLAWGLVDYQAGYSAAGALDDGRKAVKWATDYFLKA 68

Query: 703 HPDDNVLYIQVGDPDLDH 756
           H   N LY QVG+   DH
Sbjct: 69  HVSANELYGQVGEGGPDH 86



 Score = 30.4 bits (67), Expect(2) = 7e-19
 Identities = 13/21 (61%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT SRP  +I+ S P
Sbjct: 89  WGRPEDMTMSRPAYKIDTSHP 109



>pir|S75712|S75712 cellulase (EC 3.2.1.4) - Synechocystis sp. (strain
            PCC 6803)>gb:BA000022_689836 Synechocystis sp. PCC 6803
            DNA, complete genome.
          Length = 1070

 Score = 93.2 bits (230), Expect(2) = 1e-18
 Identities = 53/143 (37%), Positives = 80/143 (55%), Gaps = 22/143 (15%)
 Frame = +1

Query: 400  YGDALKIAMQFFDVQKSGKLVDN--KISWRGDSGLKDGKSA---------------SLDL 528
            YG+AL+ +  F++  +SG L ++  +I WRGDSGL+DG+                 SLDL
Sbjct: 590  YGEALQKSFLFYEANRSGDLDESTKRIDWRGDSGLRDGRDGIYFGGQSSGNLQAGLSLDL 649

Query: 529  SKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAH- 705
            + G +DAGD  KFG P+A T T LAW  +E+ D      Q++    +++W TDYL+ AH 
Sbjct: 650  TGGYHDAGDHGKFGLPLASTLTTLAWGGVEFTDGYQTSGQMDDLLATIRWGTDYLLKAHV 709

Query: 706  ---PDDNVLYI-QVGDPDLDHKM 762
                 + V ++ QVG+   DH +
Sbjct: 710  TNANGETVFFVAQVGNASADHSL 732



 Score = 22.7 bits (47), Expect(2) = 1e-18
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W  PE  T +RP   + A+ P
Sbjct: 733 WSAPESQTIARPAMAVTANKP 753



>gb:AF316823_499258 Clostridium cellulolyticum cellulase gene
           cluster, complete sequence.
          Length = 526

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 45/124 (36%), Positives = 64/124 (51%), Gaps = 2/124 (1%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKLV--DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMK 564
           T  Y  ALK ++ FFD  K G     +N   WRG     DG    +DL+ G +DAGD +K
Sbjct: 33  THDYSTALKDSIIFFDANKCGPQAGENNVFDWRGACHTTDGSDVGVDLTGGYHDAGDHVK 92

Query: 565 FGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDP 744
           FG P  Y+A +L W++ E+ +              LK+ TDY + +HP+    Y QVG+ 
Sbjct: 93  FGLPQGYSAAILGWSLYEFKESFDATGNTTKMLQQLKYFTDYFLKSHPNSTTFYYQVGEG 152

Query: 745 DLDH 756
           + DH
Sbjct: 153 NADH 156



>gb:AF220590_1252363 Cryptocercus clevelandi beta-1,4-glucanase 1
           (EG1) mRNA, partial cds.
          Length = 270

 Score = 86.3 bits (212), Expect(2) = 2e-18
 Identities = 43/86 (50%), Positives = 52/86 (60%)
 Frame = +1

Query: 499 KDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKW 678
           KD      DL+ G YDAGD +KFGFPMAYTATVLAW I+++         L   + ++KW
Sbjct: 1   KDKGQNGEDLTGGYYDAGDFVKFGFPMAYTATVLAWGIVDHTAGYNKANALADGRKAVKW 60

Query: 679 ITDYLVNAHPDDNVLYIQVGDPDLDH 756
            TDY + AH   NVLY QVG    DH
Sbjct: 61  ATDYFIKAHVSANVLYGQVGQGGPDH 86



 Score = 28.9 bits (63), Expect(2) = 2e-18
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT  RP  +I+ S P
Sbjct: 89  WGRPEDMTMDRPAYKIDTSHP 109



>gb:AF220595_1252368 Blattella germanica beta-1,4-glucanase (EG)
           mRNA, partial cds.
          Length = 270

 Score = 85.1 bits (209), Expect(2) = 5e-18
 Identities = 39/78 (50%), Positives = 51/78 (65%)
 Frame = +1

Query: 523 DLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNA 702
           DL+ G YDAGD +KFG PMAYT TVL+W +L+Y +       +E A+ ++KW TDY + A
Sbjct: 9   DLTGGYYDAGDFVKFGLPMAYTITVLSWGLLDYTNGYTKAGAVEEARKAIKWGTDYFLKA 68

Query: 703 HPDDNVLYIQVGDPDLDH 756
           H   N LY QVG+   DH
Sbjct: 69  HVSQNTLYGQVGNGGTDH 86



 Score = 28.9 bits (63), Expect(2) = 5e-18
 Identities = 12/21 (57%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT  RP  +I++S P
Sbjct: 89  WGRPEDMTMYRPAYKIDSSSP 109



>gb:AY308955_1597859 Medicago truncatula cellulase mRNA, complete
           cds.
          Length = 601

 Score = 93.2 bits (230), Expect = 5e-18
 Identities = 49/115 (42%), Positives = 71/115 (61%), Gaps = 5/115 (4%)
 Frame = +1

Query: 409 ALKIAMQFFDVQKSGKLVDNK-ISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAY 585
           A+  A+ F+D QKSG    N  + +RGDSGLKDG SA  +L  G YD+G+ +KF F  AY
Sbjct: 111 AINQALTFYDAQKSGNYPRNSPVKYRGDSGLKDGNSAKTNLIGGYYDSGNNIKFTFTTAY 170

Query: 586 TATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYL----VNAHPDDNVLYIQVG 738
           T T+L+WT +EY  + A + +L+  +  ++W TDYL    +  +  +  LY QVG
Sbjct: 171 TMTLLSWTAMEYQSKYADIDELDHVRDIIRWGTDYLHEVFIPPNGSNLTLYSQVG 225



 Score = 33.9 bits (76), Expect = 3.8
 Identities = 20/49 (40%), Positives = 27/49 (55%)
 Frame = +2

Query: 674 NGSLTTLSTRILMTTSFTFRWVIPT*TIKCWQRPEDMTESRPLTQINAS 820
           NGS  TL +++  T S       P   I CWQRPEDM+  RP++  + S
Sbjct: 214 NGSNLTLYSQVGSTISTNHE---PN-DISCWQRPEDMSYGRPVSVCDGS 258



>gb:AY660967_1620403 Populus tremula x Populus tremuloides Cel9A
           mRNA, complete cds.
          Length = 619

 Score = 84.7 bits (208), Expect(2) = 8e-18
 Identities = 50/125 (40%), Positives = 71/125 (56%), Gaps = 9/125 (7%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASL----DLSKGMYDAGDLMK 564
           Y  AL  A+ FF+ Q+SGKL   N +SWRG S L DGK   +    DL  G YDAGD +K
Sbjct: 110 YTLALHKALMFFNGQRSGKLPKHNNVSWRGSSCLSDGKGKQVSFYKDLVGGYYDAGDAIK 169

Query: 565 FGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLV---NAHPDD-NVLYIQ 732
           F FP +++ T+L+W+++EY  +     +L   K  +KW  DY +   N+  D  + +  Q
Sbjct: 170 FHFPASFSMTMLSWSVIEYSAKYEAAGELNHVKELIKWGADYFLKTFNSSADTIDRIVAQ 229

Query: 733 VGDPD 747
           VG  D
Sbjct: 230 VGSGD 234



 Score = 28.5 bits (62), Expect(2) = 8e-18
 Identities = 9/19 (47%), Positives = 14/19 (73%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINA 817
           CW RPED+   RP+T+ ++
Sbjct: 247 CWMRPEDIDYDRPVTECSS 265



>gb:AF220583_1252356 Polyphaga aegyptiaca beta-1,4-glucanase 3 (EG3)
           mRNA, partial cds.
          Length = 270

 Score = 88.6 bits (218), Expect(2) = 1e-17
 Identities = 40/78 (51%), Positives = 52/78 (66%)
 Frame = +1

Query: 523 DLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNA 702
           DL+ G YDAGD +KFGFPMAYTATVLAW ++ + +       +  A+ ++KW TDY + A
Sbjct: 9   DLTGGYYDAGDFVKFGFPMAYTATVLAWGVIAHPNAFNKAGAMNDARKAVKWATDYFLKA 68

Query: 703 HPDDNVLYIQVGDPDLDH 756
           H  DN LY QVG   +DH
Sbjct: 69  HVSDNKLYGQVGQGSVDH 86



 Score = 24.3 bits (51), Expect(2) = 1e-17
 Identities = 10/21 (47%), Positives = 12/21 (57%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDM   RP   I+ + P
Sbjct: 89  WGRPEDMKMQRPAWYIDQNNP 109



>gb:AF220587_1252360 Periplaneta americana beta-1,4-glucanase 2
           (EG2) mRNA, partial cds.
          Length = 267

 Score = 82.4 bits (202), Expect(2) = 1e-17
 Identities = 39/79 (49%), Positives = 49/79 (62%)
 Frame = +1

Query: 523 DLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNA 702
           DL+ G YDAGDL+KFGFPMAYTATVL+W I+ +         L  A+ ++KW TDY +  
Sbjct: 9   DLTGGYYDAGDLVKFGFPMAYTATVLSWGIISHESGYKKANALTDARKAVKWATDYFLKC 68

Query: 703 HPDDNVLYIQVGDPDLDHK 759
           H   N  Y QVG    DH+
Sbjct: 69  HISANEFYGQVGRSHADHE 87



 Score = 30.4 bits (67), Expect(2) = 1e-17
 Identities = 12/21 (57%), Positives = 16/21 (76%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT +RP ++I+ S P
Sbjct: 89  WGRPEDMTMARPASKIDTSHP 109



>gb:AY535003_1612308 Populus tremuloides endo-1,4-beta-glucanase
           (Kor1) mRNA, complete cds.
          Length = 619

 Score = 84.0 bits (206), Expect(2) = 1e-17
 Identities = 51/125 (40%), Positives = 71/125 (56%), Gaps = 9/125 (7%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGK----SASLDLSKGMYDAGDLMK 564
           Y  AL  A+ FF+ Q+SGKL   N +SWRG S L DGK    S   DL  G YDAGD +K
Sbjct: 110 YTLALHKALMFFNGQRSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDAGDAIK 169

Query: 565 FGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLV---NAHPDD-NVLYIQ 732
           F FP +++ T+L+W+++EY  +     +L   K  +KW  DY +   N+  D  + +  Q
Sbjct: 170 FHFPASFSMTMLSWSVIEYNAKYEAAGELNHVKELIKWGADYFLKTFNSSADTIDRIVAQ 229

Query: 733 VGDPD 747
           VG  D
Sbjct: 230 VGSGD 234



 Score = 28.5 bits (62), Expect(2) = 1e-17
 Identities = 9/19 (47%), Positives = 14/19 (73%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINA 817
           CW RPED+   RP+T+ ++
Sbjct: 247 CWMRPEDIDYDRPVTECSS 265



>gb:AF220585_1252358 Polyphaga aegyptiaca beta-1,4-glucanase 2 (EG2)
           mRNA, partial cds.
          Length = 270

 Score = 84.3 bits (207), Expect(2) = 2e-17
 Identities = 37/78 (47%), Positives = 53/78 (67%)
 Frame = +1

Query: 523 DLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNA 702
           DL+ G +DAGD +KFGFPMA+T T+L+W ++ +         +  A+ ++KW TDYL+ A
Sbjct: 9   DLTGGYFDAGDFVKFGFPMAFTVTMLSWGMIYHAYGYNKANAMSDAQKTVKWATDYLLKA 68

Query: 703 HPDDNVLYIQVGDPDLDH 756
           H   N LY+QVGD +LDH
Sbjct: 69  HVSANKLYVQVGDGNLDH 86



 Score = 27.7 bits (60), Expect(2) = 2e-17
 Identities = 12/21 (57%), Positives = 13/21 (61%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT  RP   I+ S P
Sbjct: 89  WGRPEDMTMQRPAYYIDQSRP 109



>gb:D83704_120517 Clostridium thermocellum DNA for endoglucanase,
           complete cds.
          Length = 168

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 49/126 (38%), Positives = 74/126 (58%), Gaps = 1/126 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y +AL+ A+ F++ Q++G L + N++ WRGD+ + D      ++  G YDAGD +KF  P
Sbjct: 33  YAEALQKAIYFYECQQAGPLPEWNRVEWRGDATMND------EVLGGWYDAGDHVKFNLP 86

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAY+A +L W + EYGD +    Q    + +L +  DYLV     D+V+Y Q+GD   DH
Sbjct: 87  MAYSAAMLGWALYEYGDDIEASGQRLHLERNLAFALDYLVACDRGDSVVY-QIGDGAADH 145

Query: 757 KMLAKA 774
           K    A
Sbjct: 146 KWWGSA 151



>gb:AB047845_7211 Clostridium thermocellum celQ gene for
           endoglucanase Q, complete cds.
          Length = 710

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 49/126 (38%), Positives = 74/126 (58%), Gaps = 1/126 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y +AL+ A+ F++ Q++G L + N++ WRGD+ + D      ++  G YDAGD +KF  P
Sbjct: 33  YAEALQKAIYFYECQQAGPLPEWNRVEWRGDATMND------EVLGGWYDAGDHVKFNLP 86

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           MAY+A +L W + EYGD +    Q    + +L +  DYLV     D+V+Y Q+GD   DH
Sbjct: 87  MAYSAAMLGWALYEYGDDIEASGQRLHLERNLAFALDYLVACDRGDSVVY-QIGDGAADH 145

Query: 757 KMLAKA 774
           K    A
Sbjct: 146 KWWGSA 151



>gb:AF220589_1252362 Cryptocercus clevelandi beta-1,4-glucanase 2
           (EG2) mRNA, partial cds.
          Length = 270

 Score = 84.3 bits (207), Expect(2) = 2e-17
 Identities = 38/78 (48%), Positives = 53/78 (67%)
 Frame = +1

Query: 523 DLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNA 702
           DL+ G YDAGD +KFGF MAYT TVL+W ++++ +  +    L+ A+ ++KW TDY + A
Sbjct: 9   DLTGGYYDAGDFVKFGFAMAYTTTVLSWGVVDHANGYSKAGALDDARKAIKWATDYFLKA 68

Query: 703 HPDDNVLYIQVGDPDLDH 756
           H   NVLY QVG  D D+
Sbjct: 69  HVSANVLYGQVGQGDPDY 86



 Score = 27.3 bits (59), Expect(2) = 2e-17
 Identities = 11/21 (52%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDM  +RP  +I+A+ P
Sbjct: 89  WGRPEDMKMARPAYKIDAAHP 109



>gb:AY091512_1574658 Triticum aestivum endo-1,4-beta-glucanase mRNA,
           complete cds.
          Length = 620

 Score = 85.1 bits (209), Expect(2) = 3e-17
 Identities = 44/104 (42%), Positives = 66/104 (63%), Gaps = 4/104 (3%)
 Frame = +1

Query: 397 KYGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASL---DLSKGMYDAGDLMK 564
           +Y  AL  A+ FF+ Q+SG L   N +  RG+SG+KDG S S     L  G YDAGD +K
Sbjct: 110 QYTLALHKALMFFNAQRSGHLPKHNGVXGRGNSGMKDGLSDSTVKKSLVGGFYDAGDAIK 169

Query: 565 FGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLV 696
           F +PMA++  +L+WT++EY  +   + +L+  K  +KW TDY++
Sbjct: 170 FNYPMAWSMNMLSWTVIEYRAKYEAIGELDHVKEIIKWGTDYML 213



 Score = 26.2 bits (56), Expect(2) = 3e-17
 Identities = 8/19 (42%), Positives = 13/19 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINA 817
           CW RPED+   RP+ + ++
Sbjct: 246 CWMRPEDIDYKRPVIECHS 264



>gb:TAE577371_1724478 Triticum aestivum partial mRNA for putative
           endo-1,3(4)-beta-glucanase.
          Length = 170

 Score = 81.6 bits (200), Expect(2) = 3e-17
 Identities = 36/79 (45%), Positives = 57/79 (72%)
 Frame = +1

Query: 520 LDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVN 699
           +DL+ G YDAGD +KFGFP+A+++T+LAW++LE+G  M    +L+ A+ +++W  DYL+ 
Sbjct: 5   VDLTGGYYDAGDNVKFGFPLAFSSTMLAWSVLEFGGMMK--GELQHARDAVRWGADYLLK 62

Query: 700 AHPDDNVLYIQVGDPDLDH 756
           A    + +Y+QVGD   DH
Sbjct: 63  ATAHPDTVYVQVGDAGKDH 81



 Score = 29.6 bits (65), Expect(2) = 3e-17
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +++ S P
Sbjct: 83  CWERPEDMDTPRTVYKVDPSTP 104



>gb:AF220586_1252359 Periplaneta americana beta-1,4-glucanase 1
           (EG1) mRNA, partial cds.
          Length = 269

 Score = 82.0 bits (201), Expect(2) = 4e-17
 Identities = 39/78 (50%), Positives = 47/78 (60%)
 Frame = +1

Query: 523 DLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNA 702
           DL+ G YDAGD +KFGFPMAYTATVLAW I+ +         L  A+ ++KW TDY +  
Sbjct: 9   DLTGGYYDAGDFVKFGFPMAYTATVLAWGIISHESGYNKANALTDARKAVKWATDYFLKC 68

Query: 703 HPDDNVLYIQVGDPDLDH 756
           H   N  Y QVG    DH
Sbjct: 69  HISANEFYGQVGQGQADH 86



 Score = 28.9 bits (63), Expect(2) = 4e-17
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT  RP  +I+ S P
Sbjct: 89  WGRPEDMTMDRPAYKIDTSHP 109



>pir|B97013|B97013 and cellulose-binding endoglucanase family 9,
           CelL ortholog, dockerin domain [imported] - Clostridium
           acetobutylicum>gb:AE007607_228254 Clostridium
           acetobutylicum ATCC 824 section 95 of 356 of the
           complete genome.>gb:AE001437_1091209 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 537

 Score = 90.1 bits (222), Expect = 5e-17
 Identities = 45/120 (37%), Positives = 63/120 (52%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DA   ++ F++    G    +N++ WR      DGK   LDL+ G +DAGD +KFG P
Sbjct: 34  YVDAFSKSIMFYEANWCGADAGNNRLKWRSGCHENDGKDVGLDLTGGFHDAGDHVKFGLP 93

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
            AY+A+ L W   E+ D      Q +     LK  TDY +  +PD+N  Y Q GD + DH
Sbjct: 94  QAYSASTLGWAYYEFKDTFVKKGQDKYMLNILKHFTDYFLKCYPDNNTFYYQCGDGNTDH 153



>gb:AF220584_1252357 Polyphaga aegyptiaca beta-1,4-glucanase 1 (EG1)
           mRNA, partial cds.
          Length = 270

 Score = 83.6 bits (205), Expect(2) = 6e-17
 Identities = 39/78 (50%), Positives = 49/78 (62%)
 Frame = +1

Query: 523 DLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNA 702
           DL+ G YDAGD +KFGFPMAYTATVLAW ++ + +       L   + ++KW TDY + A
Sbjct: 9   DLTGGYYDAGDFVKFGFPMAYTATVLAWGVINHENGYNKANALSDGRKAVKWATDYFLKA 68

Query: 703 HPDDNVLYIQVGDPDLDH 756
           H   N LY QVG    DH
Sbjct: 69  HVSQNKLYGQVGLGQADH 86



 Score = 26.6 bits (57), Expect(2) = 6e-17
 Identities = 11/21 (52%), Positives = 13/21 (61%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT  RP   I+ + P
Sbjct: 89  WGRPEDMTMERPAYYIDENHP 109



>gb:AF220588_1252361 Cryptocercus clevelandi beta-1,4-glucanase 3
           (EG3) mRNA, partial cds.
          Length = 270

 Score = 79.7 bits (195), Expect(2) = 1e-16
 Identities = 37/78 (47%), Positives = 49/78 (62%)
 Frame = +1

Query: 523 DLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNA 702
           DL+ G YDAGD +KFGFPMA++ TVLAW +++Y    +    L  A+ ++KW TDY + A
Sbjct: 9   DLTGGYYDAGDHVKFGFPMAFSTTVLAWGVVDYEAGYSSANALTDARKAIKWATDYFIKA 68

Query: 703 HPDDNVLYIQVGDPDLDH 756
           H   N  Y QVG    DH
Sbjct: 69  HVSTNEFYGQVGLGQPDH 86



 Score = 29.3 bits (64), Expect(2) = 1e-16
 Identities = 12/21 (57%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT +RP  +I+ S P
Sbjct: 89  WGRPEDMTMARPAFKIDTSHP 109



>pir|A97013|A97013 hypothetical protein CAC0916 [imported] -
           Clostridium acetobutylicum>gb:AE007607_228253
           Clostridium acetobutylicum ATCC 824 section 95 of 356 of
           the complete genome.>gb:AE001437_1091208 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 692

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 44/120 (36%), Positives = 60/120 (50%), Gaps = 1/120 (0%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP 576
           Y DA   ++ F++    G    +N++ WRG     DGK   LDL+ G +DAGD +KFG P
Sbjct: 34  YVDAFSKSILFYEANWCGPDAGNNRLKWRGPCHEDDGKDVGLDLTGGFHDAGDHVKFGLP 93

Query: 577 MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
            AY A+ L W   E+ D      Q +     LK  TDY +  +P+    Y Q GD   DH
Sbjct: 94  QAYAASTLGWAYYEFKDSFVKKGQDKYMLNILKHFTDYFLKCYPNKTTFYYQCGDGTTDH 153



>gb:FXA223386_1679529 Fragaria x ananassa partial mRNA for
           endo-beta-1,4-glucanase, clone pCR15.
          Length = 169

 Score = 77.8 bits (190), Expect(2) = 2e-15
 Identities = 37/74 (50%), Positives = 51/74 (68%)
 Frame = +1

Query: 535 GMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDD 714
           G YDAGD +KFGFPMA+T T+LAW+I+++G  M    +   A  +L+W TDYL+ A    
Sbjct: 1   GYYDAGDNVKFGFPMAFTTTLLAWSIIDFGRVMGT--EQRNAVKALRWGTDYLLKATAVP 58

Query: 715 NVLYIQVGDPDLDH 756
            V+++QVGDP  DH
Sbjct: 59  GVVFVQVGDPYSDH 72



 Score = 27.3 bits (59), Expect(2) = 2e-15
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +I+ + P
Sbjct: 74  CWERPEDMDTRRTVYKIDHNNP 95



>gb:CACCX3_1644860 C.annuum mRNA for endo-1,4-beta-glucanase (ccx3
           gene).
          Length = 325

 Score = 77.0 bits (188), Expect(2) = 3e-15
 Identities = 36/74 (48%), Positives = 52/74 (70%)
 Frame = +1

Query: 535 GMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDD 714
           G YDAGD +KF FPMA+TAT+L+W+I+++   M    +L  A  ++KW TD+L+ A   +
Sbjct: 2   GYYDAGDNVKFVFPMAFTATLLSWSIIDFKRNMG--SELGNAVKAVKWATDFLLKATAKE 59

Query: 715 NVLYIQVGDPDLDH 756
            V+Y+QVGDP  DH
Sbjct: 60  GVVYVQVGDPFSDH 73



 Score = 27.3 bits (59), Expect(2) = 3e-15
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +I+ + P
Sbjct: 75  CWERPEDMDTLRTVYKIDQNHP 96



>pir|S61447|S61447 cellulase (EC 3.2.1.4) CX3 - pepper (fragment)
          Length = 324

 Score = 77.0 bits (188), Expect(2) = 3e-15
 Identities = 36/74 (48%), Positives = 52/74 (70%)
 Frame = +1

Query: 535 GMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDD 714
           G YDAGD +KF FPMA+TAT+L+W+I+++   M    +L  A  ++KW TD+L+ A   +
Sbjct: 2   GYYDAGDNVKFVFPMAFTATLLSWSIIDFKRNMG--SELGNAVKAVKWATDFLLKATAKE 59

Query: 715 NVLYIQVGDPDLDH 756
            V+Y+QVGDP  DH
Sbjct: 60  GVVYVQVGDPFSDH 73



 Score = 27.3 bits (59), Expect(2) = 3e-15
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +I+ + P
Sbjct: 75  CWERPEDMDTLRTVYKIDQNHP 96



>gb:LES505749_1684606 Lycopersicon esculentum partial mRNA for
           putative endo-1,4,-beta-glucanase (cel gene).
          Length = 172

 Score = 71.6 bits (174), Expect(2) = 3e-14
 Identities = 34/74 (45%), Positives = 51/74 (68%)
 Frame = +1

Query: 535 GMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDD 714
           G YDAGD +KF FPMA+T T+L+W+I+++  +  +  +L  A  ++KW TD+L+ A   D
Sbjct: 2   GYYDAGDNVKFVFPMAFTTTLLSWSIIDF--KRNIGNELGNAVKAVKWGTDFLLKATARD 59

Query: 715 NVLYIQVGDPDLDH 756
            V+Y+QVGD   DH
Sbjct: 60  GVIYVQVGDAFSDH 73



 Score = 29.3 bits (64), Expect(2) = 3e-14
 Identities = 11/22 (50%), Positives = 16/22 (72%)
 Frame = +2

Query: 761 CWQRPEDMTESRPLTQINASVP 826
           CW+RPEDM   R + +I+A+ P
Sbjct: 75  CWERPEDMDTLRTVYKIDANNP 96



>gb:AK095918_1914460 Homo sapiens cDNA FLJ38599 fis, clone
           HEART2003432, weakly similar to ENDOGLUCANASE Z
           PRECURSOR (EC 3.2.1.4).
          Length = 660

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 41/113 (36%), Positives = 62/113 (54%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM 579
           Y + L  +  F+  QKSG L   +++WR DS          DLS+G Y+A + MK+G P+
Sbjct: 53  YAEVLHKSYLFYHAQKSGVLPYQRMAWRSDSCKVCVGDFGEDLSRGWYEAANTMKWGLPL 112

Query: 580 AYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVG 738
            +T T LA+ I+ + D M  V +L      LKW  D++ NAH +D  +  Q+G
Sbjct: 113 GWTVTQLAFNIMMFEDSMNSVDELAEGLELLKWGADFITNAHYNDTYIVGQLG 165



>gb:AF077340_1766216 Lycopersicon esculentum endo-1,4-beta-glucanase
           (cel5) gene, partial cds.
          Length = 103

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 37/71 (52%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF 567
           +Q Y +AL  +++FF+ Q+SGKL  N ++ WR DSGL DG    +DL  G YDAGD +KF
Sbjct: 33  SQDYSNALDKSIRFFEGQRSGKLPANQRLKWRADSGLSDGSGYHVDLVGGYYDAGDNVKF 92

Query: 568 GFPMAYTATVL 600
           G PMA+T T+L
Sbjct: 93  GLPMAFTTTLL 103



>gb:VREBGPA_1727341 V.radiata gene for endo-1,4-beta-glucanase
           (partial).
          Length = 84

 Score = 70.9 bits (172), Expect(2) = 2e-12
 Identities = 34/76 (44%), Positives = 51/76 (67%), Gaps = 2/76 (2%)
 Frame = +1

Query: 535 GMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHP-- 708
           G YDAGD +KFGFPMA+T T+L+W+++++   M    +L  A  +++W TDYL+ A    
Sbjct: 2   GYYDAGDNIKFGFPMAFTTTMLSWSVIDFEKSMGA--ELGNALKAVRWGTDYLLKATAKI 59

Query: 709 DDNVLYIQVGDPDLDH 756
              V+++QVGDP  DH
Sbjct: 60  GSGVVFVQVGDPYSDH 75



 Score = 23.9 bits (50), Expect(2) = 2e-12
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = +2

Query: 761 CWQRPEDM 784
           CW+RPEDM
Sbjct: 77  CWERPEDM 84



>pir|T10907|T10907 cellulase (EC 3.2.1.4) cel1 - mung bean
           (fragment)
          Length = 84

 Score = 70.9 bits (172), Expect(2) = 2e-12
 Identities = 34/76 (44%), Positives = 51/76 (67%), Gaps = 2/76 (2%)
 Frame = +1

Query: 535 GMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHP-- 708
           G YDAGD +KFGFPMA+T T+L+W+++++   M    +L  A  +++W TDYL+ A    
Sbjct: 2   GYYDAGDNIKFGFPMAFTTTMLSWSVIDFEKSMGA--ELGNALKAVRWGTDYLLKATAKI 59

Query: 709 DDNVLYIQVGDPDLDH 756
              V+++QVGDP  DH
Sbjct: 60  GSGVVFVQVGDPYSDH 75



 Score = 23.9 bits (50), Expect(2) = 2e-12
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = +2

Query: 761 CWQRPEDM 784
           CW+RPEDM
Sbjct: 77  CWERPEDM 84



>gb:VREBGPB_1727342 V.radiata gene for endo-1,4-beta-glucanase
           (partial).
          Length = 82

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 32/74 (43%), Positives = 50/74 (67%)
 Frame = +1

Query: 535 GMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDD 714
           G YDAGD +KF FPMA++ T+LAW+++E+G  M     L+ A  +++W+T+Y + A    
Sbjct: 2   GYYDAGDNVKFNFPMAFSTTMLAWSVIEFGKFMG--PDLKHALDAIRWVTEYFLKATSIP 59

Query: 715 NVLYIQVGDPDLDH 756
            +++ QVGDP  DH
Sbjct: 60  GIVFAQVGDPYADH 73



>pir|T10934|T10934 cellulase (EC 3.2.1.4) cel1 - mung bean
           (fragment)
          Length = 82

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 32/74 (43%), Positives = 50/74 (67%)
 Frame = +1

Query: 535 GMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDD 714
           G YDAGD +KF FPMA++ T+LAW+++E+G  M     L+ A  +++W+T+Y + A    
Sbjct: 2   GYYDAGDNVKFNFPMAFSTTMLAWSVIEFGKFMG--PDLKHALDAIRWVTEYFLKATSIP 59

Query: 715 NVLYIQVGDPDLDH 756
            +++ QVGDP  DH
Sbjct: 60  GIVFAQVGDPYADH 73



>gb:AF316823_499256 Clostridium cellulolyticum cellulase gene
           cluster, complete sequence.
          Length = 753

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 44/155 (28%), Positives = 67/155 (43%), Gaps = 36/155 (23%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGK-LVDNKISWRGDSGLKDGK---------------------- 510
           Y +A + ++ F+D +K G  +   K+ WRGD  ++D +                      
Sbjct: 40  YAEAFQKSLYFYDAEKCGPGVTGGKLEWRGDCHVEDCELPLIPMKDYVGTNMSQAFIDKN 99

Query: 511 --------SASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKG 666
                   + SLDL  G +DAGD +KFG P  YT + L W   E+ D    + + +  + 
Sbjct: 100 KAFLDPDGNGSLDLHGGFHDAGDHVKFGLPQGYTISTLGWGFYEFKDSFTQINEEDHIRD 159

Query: 667 SLKWITDYLVNAHPDDN-----VLYIQVGDPDLDH 756
            LKW  DY + +   DN         QVGD  +DH
Sbjct: 160 ILKWGNDYFLRSTFMDNKGEVVAFCFQVGDGTVDH 194



>gb:VREBGPC_1727343 V.radiata gene for endo-1,4-beta-glucanase
           (partial).
          Length = 125

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 31/67 (46%), Positives = 49/67 (73%)
 Frame = +1

Query: 535 GMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDD 714
           G YDAGD +KFGFPMA+T T+L+W+++E+G  M    +L+ A+ +++W TDYL+ A    
Sbjct: 2   GYYDAGDNVKFGFPMAFTTTMLSWSVIEFGGVMK--GELQNAREAIRWGTDYLLKATAHP 59

Query: 715 NVLYIQV 735
           + +Y+QV
Sbjct: 60  DTIYVQV 66



>pir|T10936|T10936 cellulase (EC 3.2.1.4) cel1 - mung bean
           (fragment)
          Length = 125

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 31/67 (46%), Positives = 49/67 (73%)
 Frame = +1

Query: 535 GMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDD 714
           G YDAGD +KFGFPMA+T T+L+W+++E+G  M    +L+ A+ +++W TDYL+ A    
Sbjct: 2   GYYDAGDNVKFGFPMAFTTTMLSWSVIEFGGVMK--GELQNAREAIRWGTDYLLKATAHP 59

Query: 715 NVLYIQV 735
           + +Y+QV
Sbjct: 60  DTIYVQV 66



>gb:AB044407_6780 Clostridium thermocellum celT gene for
           endoglucanase, complete cds.
          Length = 611

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 48/152 (31%), Positives = 67/152 (44%), Gaps = 33/152 (21%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDNK--ISWRGDSGLKDGK--------------------- 510
           Y  AL+ +M F+D    G  VD    +SWRGD  + D +                     
Sbjct: 40  YAKALQYSMFFYDANMCGTGVDENSLLSWRGDCHVYDARLPLDSQNTNMSDGFISSNRSV 99

Query: 511 -----SASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLK 675
                   +D+S G +DAGD +KFG P AY A+ + W   E+ DQ     Q   A+  L+
Sbjct: 100 LDPDGDGKVDVSGGFHDAGDHVKFGLPEAYAASTVGWGYYEFKDQFRATGQAVHAEVILR 159

Query: 676 WITDYLVNAHPDD---NVLYI--QVGDPDLDH 756
           +  DY +     D   NV+    QVGD D+DH
Sbjct: 160 YFNDYFMRCTFRDASGNVVAFCHQVGDGDIDH 191



>gb:VREBGPD_1727344 V.radiata gene for endo-1,4-beta-glucanase
           (partial).
          Length = 72

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 26/66 (39%), Positives = 43/66 (65%)
 Frame = +1

Query: 535 GMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDD 714
           G YDAGD +KFG+PMA+  ++L+W  +EY  +++ V QL   + +++W  D+++ AH   
Sbjct: 2   GYYDAGDNVKFGWPMAFATSLLSWAAVEYESEISSVNQLGYLQSAIRWGADFILRAHASP 61

Query: 715 NVLYIQ 732
             LY Q
Sbjct: 62  TTLYTQ 67



>pir|T10937|T10937 cellulase (EC 3.2.1.4) cel1 - mung bean
           (fragment)
          Length = 72

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 26/66 (39%), Positives = 43/66 (65%)
 Frame = +1

Query: 535 GMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDD 714
           G YDAGD +KFG+PMA+  ++L+W  +EY  +++ V QL   + +++W  D+++ AH   
Sbjct: 2   GYYDAGDNVKFGWPMAFATSLLSWAAVEYESEISSVNQLGYLQSAIRWGADFILRAHASP 61

Query: 715 NVLYIQ 732
             LY Q
Sbjct: 62  TTLYTQ 67



>gb:AB028321_4597 Ruminococcus albus cel5D, cel9A genes for
           beta-1,4-endoglucanase VII, cellulase VI, complete cds.
          Length = 936

 Score = 56.6 bits (135), Expect = 6e-07
 Identities = 31/85 (36%), Positives = 47/85 (55%), Gaps = 5/85 (5%)
 Frame = +1

Query: 517 SLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLV 696
           +LDL+ G +DAGD +KFG P +Y+A+ + W   E+ D    +   +  +  L WI DY +
Sbjct: 154 TLDLTGGWHDAGDHVKFGLPGSYSASTVGWGYYEFRDSYKELGLDKHVEDELHWINDYFM 213

Query: 697 NA---HPDDNVL--YIQVGDPDLDH 756
                  DDNV+    QVG+ + DH
Sbjct: 214 KVTFMDDDDNVIAYCYQVGEGNNDH 238



>gb:AB118799_1200829 Neotermes koshunensis NkEG3 mRNA for putative
           endo-beta-1,4-glucanase NkEG3, partial cds.
          Length = 323

 Score = 38.9 bits (89), Expect(2) = 6e-05
 Identities = 17/36 (47%), Positives = 22/36 (61%)
 Frame = +1

Query: 649 LEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH 756
           L   + ++KW TDY + AH   NVLY QVG+   DH
Sbjct: 2   LNDGRKAVKWATDYFLKAHVSANVLYGQVGEGGPDH 37



 Score = 30.4 bits (67), Expect(2) = 6e-05
 Identities = 13/21 (61%), Positives = 15/21 (71%)
 Frame = +2

Query: 764 WQRPEDMTESRPLTQINASVP 826
           W RPEDMT SRP  +I+ S P
Sbjct: 40  WGRPEDMTMSRPAYKIDTSHP 60



>gb:SLU59308_1715416 Stellaria longipes endo 1,4-glucanase (SLEG.1)
           gene, partial cds.
          Length = 57

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 18/51 (35%), Positives = 32/51 (62%)
 Frame = +1

Query: 583 YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQV 735
           +T T+L+WT +E+   ++  KQL   + +++W +D++  AH D   LY QV
Sbjct: 1   FTTTLLSWTAIEHESGLSSAKQLAYLRQAIRWGSDFISQAHTDPTTLYTQV 51



>gb:FSU05897_136258 Fibrobacter succinogenes S85 endoglucanase E
           (celE) and endoglucanase D (celD) gene, complete cds.
          Length = 668

 Score = 37.7 bits (86), Expect = 0.27
 Identities = 30/130 (23%), Positives = 58/130 (44%), Gaps = 18/130 (13%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGKLVDNKIS--WRGDSGLKD---------GKSASLDLSKG 537
           +Q Y D +K ++++F  Q++   ++++ +  W   +G  +         G S +++ SKG
Sbjct: 112 SQTYEDIVKASIKWFYYQRASMALESQYAGKWARAAGHTNPTAELHNSTGASGTINSSKG 171

Query: 538 MYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSL-------KWITDYLV 696
            YDAGD  ++      T   L      +      +K   PA+GSL       K+  D+++
Sbjct: 172 WYDAGDYGRYIVNSGITTYTLLSLYEHFPQYFKTLKWNIPAEGSLPDLLAEIKYNLDWML 231

Query: 697 NAHPDDNVLY 726
                D  +Y
Sbjct: 232 TMQASDGGVY 241



>gb:FIBE14B_136000 Fibrobacter succinogenes
           endo-1,4-beta-D-glucanase gene, complete cds,
           endo-1,4-beta-D-glucanase gene, 5' end of cds.
          Length = 620

 Score = 37.7 bits (86), Expect = 0.27
 Identities = 28/127 (22%), Positives = 56/127 (44%), Gaps = 18/127 (14%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDNKIS--WRGDSGLKD---------GKSASLDLSKGMYD 546
           + D  K +++++  Q++   ++   +  W+ D+G  +         G S ++  SKG YD
Sbjct: 115 FEDVTKASLKWYYYQRASMALEETYAGLWKRDAGHMNATVDLHKSTGASGTIQSSKGWYD 174

Query: 547 AGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSL-------KWITDYLVNAH 705
           AGD  ++      T   L      + D    +K   PA+G+L       K+  D+++   
Sbjct: 175 AGDYGRYIVNSGITTFTLLSLYEHFPDYFKTLKWNIPAEGTLPDLLAEIKYNLDWMLTMQ 234

Query: 706 PDDNVLY 726
             D ++Y
Sbjct: 235 AADGMVY 241



>gb:FMU81184_136020 Fusobacterium mortiferum
           phospho-beta-glucosidase (pbgA) gene and putative
           endoglucanase (pbgB) gene, partial cds.
          Length = 550

 Score = 37.4 bits (85), Expect = 0.35
 Identities = 31/127 (24%), Positives = 53/127 (41%), Gaps = 22/127 (17%)
 Frame = +1

Query: 400 YGDALKIAMQFFDVQKSGKLVDNK----ISWRGDSGLKDGKSASL----------DLSKG 537
           Y   L+   +++ +Q+  ++++ K    +  RG+ GL   +S  L          D+S G
Sbjct: 213 YKPLLEDITKYYYLQRGNEIIEEKYVGKLFARGE-GLPQDRSVPLNSQRESSKRYDVSGG 271

Query: 538 MYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGS--------LKWITDYL 693
            YDAGD  K+    A   T L W    + +Q    K   P  G+        ++W  D+L
Sbjct: 272 WYDAGDYGKYTNAGATAVTELLWAYEMFPNQFRDKKDFIPESGNGVSDLLDEIRWELDFL 331

Query: 694 VNAHPDD 714
           +     D
Sbjct: 332 IKMQDKD 338



>pir|A39416|A39416 endo-glucanase (EC 3.2.1.-) family E -
           Fibrobacter succinogenes
          Length = 453

 Score = 37.0 bits (84), Expect = 0.45
 Identities = 40/151 (26%), Positives = 63/151 (41%), Gaps = 28/151 (18%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGK----LVD---NKISWRGDSGLKDGKSASLDLSKGMYDA 549
           T  Y +A  +  +FF  Q+SG+    ++D   N  S+  DS   +GK    D+S G +D 
Sbjct: 27  TDDYVEAAWMTTRFFGAQRSGQGPNWILDGTSNPTSFTKDS--YNGK----DVSGGWFDC 80

Query: 550 GDLMKFGFPMAYTATVLAWTILEYGDQMA----------------VVKQLEPAK-----G 666
           GD + +G    Y + VLA    E+ +                    +K  +P K      
Sbjct: 81  GDHVMYGQSQGYASYVLALAYAEFTEVSTTFILVTTPXXXXANNYTMKSGKPNKVRDLLE 140

Query: 667 SLKWITDYLVNAHPDDNVLYIQVGDPDLDHK 759
            L++  D+ V A  D N      GD + DH+
Sbjct: 141 ELRYEADFWVKAAIDGNNFVTVKGDGNADHQ 171



>sp|P23665|GUNA_FIBSU Endoglucanase A precursor (EC 3.2.1.4)
           (Endo-1,4-beta-glucanase) (Cellulase).
          Length = 453

 Score = 37.0 bits (84), Expect = 0.45
 Identities = 40/151 (26%), Positives = 63/151 (41%), Gaps = 28/151 (18%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGK----LVD---NKISWRGDSGLKDGKSASLDLSKGMYDA 549
           T  Y +A  +  +FF  Q+SG+    ++D   N  S+  DS   +GK    D+S G +D 
Sbjct: 27  TDDYVEAAWMTTRFFGAQRSGQGPNWILDGTSNPTSFTKDS--YNGK----DVSGGWFDC 80

Query: 550 GDLMKFGFPMAYTATVLAWTILEYGDQMAV----------------VKQLEPAK-----G 666
           GD + +G    Y + VLA    E+ +                    +K  +P K      
Sbjct: 81  GDHVMYGQSQGYASYVLALAYAEFTEVSTTFILVTTPTTRKPTTTPMKSGKPNKVRDLLE 140

Query: 667 SLKWITDYLVNAHPDDNVLYIQVGDPDLDHK 759
            L++  D+ V A  D N      GD + DH+
Sbjct: 141 ELRYEADFWVKAAIDGNNFVTVKGDGNADHQ 171



>gb:AE015942_320871 Clostridium tetani E88, section 7 of 10 of the
           complete genome.>gb:AE015927_963660 Clostridium tetani
           E88, complete genome.
          Length = 461

 Score = 35.4 bits (80), Expect = 1.3
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 6/57 (10%)
 Frame = +1

Query: 424 MQFFD-VQKSGKLVDNKISWRGDSGLKDGKSASL-----DLSKGMYDAGDLMKFGFP 576
           MQ FD + K+G +V    +++GD G+KDGK   +     D  K + DAGD  K+ FP
Sbjct: 1   MQNFDTIIKNGTIVTASDTYKGDIGIKDGKVVQIGLDLEDSGKKIIDAGD--KYIFP 55



>pir|T15153|T15153 hypothetical protein F35F10.2 - Caenorhabditis
           elegans
          Length = 261

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 14/29 (48%), Positives = 20/29 (68%)
 Frame = +3

Query: 57  DSPTVFLCPYQPYISPLLSPTFPFSTFKL 143
           D+  VFLC + P +S  + P FPFS+FK+
Sbjct: 226 DAANVFLCDFVPTVSNYVLPKFPFSSFKV 254



>gb:AF002198_1230697 Caenorhabditis elegans cosmid F35F10, complete
           sequence.
          Length = 300

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = +3

Query: 57  DSPTVFLCPYQPYISPLLSPTFPFSTFK 140
           D+  VFLC + P +S  + P FPFS+FK
Sbjct: 226 DAANVFLCDFVPTVSNYVLPKFPFSSFK 253



>gb:SCO939132_181249 Streptomyces coelicolor A3(2) complete genome;
           segment 29/29.
          Length = 633

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 33/120 (27%), Positives = 49/120 (40%), Gaps = 15/120 (12%)
 Frame = +1

Query: 424 MQFFDVQKSGKLVDNKISWRGDSGLKDGKS---------------ASLDLSKGMYDAGDL 558
           ++FF  Q+ G  V    + R  S L D ++                 +D+S G +DAGD 
Sbjct: 152 VRFFGTQRDGGDVLADATGREPSHLTDERARVYEPAGTGPPAEVGGPVDVSGGWFDAGDF 211

Query: 559 MKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVG 738
           +KF    +Y   V+A  +    D  AV    E A+  L W+         +   LY QVG
Sbjct: 212 LKFTHTTSY---VVAQMLTTVRDTPAVPGLREEARHGLTWLDRMW---DEETGTLYAQVG 265



>gb:FIBFSENDA_136007 F.succinogenes ORF 1 and
           endo-1,4-beta-glucanase (FSendA) gene, complete cds and
           3' end.
          Length = 126

 Score = 34.3 bits (77), Expect = 2.9
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 7/84 (8%)
 Frame = +1

Query: 391 TQKYGDALKIAMQFFDVQKSGK----LVD---NKISWRGDSGLKDGKSASLDLSKGMYDA 549
           T  Y +A  +  +FF  Q+SG+    ++D   N  S+  DS   +GK    D+S G +D 
Sbjct: 27  TDDYVEAAWMTTRFFGAQRSGQGPNWILDGTSNPTSFTKDS--YNGK----DVSGGWFDC 80

Query: 550 GDLMKFGFPMAYTATVLAWTILEY 621
           GD + +G    Y + VLA    E+
Sbjct: 81  GDHVMYGQSQGYASYVLALAYAEF 104


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 870,600,341
Number of Sequences: 1806583
Number of extensions: 17864812
Number of successful extensions: 46593
Number of sequences better than 10.0: 256
Number of HSP's better than 10.0 without gapping: 43656
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46204
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 54675656432
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)