BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig859
         (531 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:BA000040_728574 Bradyrhizobium japonicum USDA 110 DNA, comple...    33   2.0     
pir|T44659|T44659 nitrous oxide reductase expression regulator N...    33   2.0     Bradyrhizobium japonicum
gb:AY543070_1502022 Bacteriophage T5, complete genome.>gb:AY6922...    33   3.5     
sp|P23207|TPB5_BPT5|TPB5_BPT5 Tail protein PB5.>pir|A38181|ZYBPT5 tail pro...    33   3.5     Escherichia virus T5
gb:CR380953_1650653 Candida glabrata strain CBS138 chromosome G ...    32   4.6     
pir|T45946|T45946 probable protein-kinase - Arabidopsis thaliana...    32   6.0     Arabidopsis thaliana [mouse-ear cress]
sp|P24453|CP12_MESAU|CP12_MESAU Cytochrome P450 1A2 (EC 1.14.14.1) (CYPIA2)...    32   6.0     Mesocricetus auratus [Syrian golden hamster]
gb:AF184144_1775016 Arabidopsis thaliana ARF GAP-like zinc finge...    32   7.8     
gb:AY088913_1573921 Arabidopsis thaliana clone 99519 mRNA, compl...    32   7.8     
gb:AB010695_1511176 Arabidopsis thaliana genomic DNA, chromosome...    32   7.8     
pir|D75103|D75103 hypothetical protein PAB0810 - Pyrococcus abys...    32   7.8     Pyrococcus abyssi


>gb:BA000040_728574 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 779

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 14/23 (60%), Positives = 16/23 (69%)
 Frame = -1

Query: 453 TAKSFPAAKPSSTSPKTEEDPSW 385
           TAKS PAA P +  P T+EDP W
Sbjct: 416 TAKSSPAAAPEARVPTTDEDPLW 438



>pir|T44659|T44659 nitrous oxide reductase expression regulator NosR
           [imported] - Bradyrhizobium japonicum>gb:BJAJ2531_748771
           Bradyrhizobium japonicum nosRZDFYLX gene cluster for
           nitrous-oxide reduction.
          Length = 779

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 14/23 (60%), Positives = 16/23 (69%)
 Frame = -1

Query: 453 TAKSFPAAKPSSTSPKTEEDPSW 385
           TAKS PAA P +  P T+EDP W
Sbjct: 416 TAKSSPAAAPEARVPTTDEDPLW 438



>gb:AY543070_1502022 Bacteriophage T5, complete
           genome.>gb:AY692264_1503122 Bacteriophage T5 strain st0
           deletion mutant, complete genome.
          Length = 640

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 19/78 (24%), Positives = 32/78 (41%)
 Frame = +2

Query: 182 QSTSQVCYSIESPLNPTPHFTASRNCVCQYSFRFFSSNPSLDSEESEFSNADASASGHWA 361
           +S ++V Y +E P   T       +     +F +  SNP        F+ AD +   +W 
Sbjct: 225 RSCNRVLYGMEGPNYTTGGAVQGASSSGALNFTYNPSNPESPKYSVGFARADPTNYAYWE 284

Query: 362 SAFDEEKSQDGSSSVFGE 415
           S  D   S +G   ++ E
Sbjct: 285 SMGDPNDSANGPIGIYSE 302



>sp|P23207|TPB5_BPT5 Tail protein PB5.>pir|A38181|ZYBPT5 tail
           protein pb5 - phage T5>gb:PT5OAD_1507608 Bacteriophage
           T5 tail protein pb5 (oad) gene, complete cds and
           putative sciB gene, 5' end.
          Length = 640

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 19/78 (24%), Positives = 32/78 (41%)
 Frame = +2

Query: 182 QSTSQVCYSIESPLNPTPHFTASRNCVCQYSFRFFSSNPSLDSEESEFSNADASASGHWA 361
           +S ++V Y +E P   T       +     +F +  SNP        F+ AD +   +W 
Sbjct: 225 RSCNRVLYGMEGPNYTTGGAVQGASSSGALNFTYNPSNPESPKYSVGFARADPTNYAYWE 284

Query: 362 SAFDEEKSQDGSSSVFGE 415
           S  D   S +G   ++ E
Sbjct: 285 SMGDPNDSANGPIGIYSE 302



>gb:CR380953_1650653 Candida glabrata strain CBS138 chromosome G
           complete sequence.
          Length = 722

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 18/36 (50%), Positives = 20/36 (55%), Gaps = 1/36 (2%)
 Frame = -1

Query: 480 TTNGTSPFS-TAKSFPAAKPSSTSPKTEEDPSWDFS 376
           TT  T+PFS     F   KP+STS  TE  PS  FS
Sbjct: 410 TTTKTNPFSGNTSGFSFGKPASTSNTTESKPSISFS 445



>pir|T45946|T45946 probable protein-kinase - Arabidopsis
           thaliana>gb:ATF7J8_1550985 Arabidopsis thaliana DNA
           chromosome 5, BAC clone F7J8 (ESSA project).
          Length = 499

 Score = 32.0 bits (71), Expect = 6.0
 Identities = 26/81 (32%), Positives = 37/81 (45%), Gaps = 6/81 (7%)
 Frame = +2

Query: 257 CVCQYSFRFFSSNPSL------DSEESEFSNADASASGHWASAFDEEKSQDGSSSVFGEV 418
           C+C  S+R  SS+PS+      D E     +AD    GH+   F E   +    +     
Sbjct: 3   CICFKSWRRSSSSPSITSTVIDDLENVREYDADDDG-GHYPLIFREFSLEQLRIAT---- 57

Query: 419 DDGFAAGNDFAVENGEVPFVV 481
            DGF+AGN  +  N  VP +V
Sbjct: 58  -DGFSAGNIVSEHNDSVPNIV 77



>sp|P24453|CP12_MESAU Cytochrome P450 1A2 (EC 1.14.14.1) (CYPIA2)
           (P450-MC4) (Hepatic cytochrome
           P-450MC1).>pir|JX0190|JX0190 cytochrome P450 1A2 -
           golden hamster>gb:HAMHG5_2113088 Mesocricetus auratus
           gene for cytochrome P-450IA2, complete
           cds.>gb:HAMP45IA2_2113110 Mesocricetus auratus mRNA for
           pulmonary cytochrome P-450MC1, complete cds.
          Length = 513

 Score = 32.0 bits (71), Expect = 6.0
 Identities = 19/62 (30%), Positives = 28/62 (45%)
 Frame = +3

Query: 225 TQLHISLLLGTAFANTRLGFSRQIRHSIPKNLSFPTQTPPRLVIGPALSMRKNPRMGLPL 404
           T L   L+L TA        +R +R  +PK L  P       ++G  L++ KNP + L  
Sbjct: 7   TSLSTELVLATAIFCIVFWVARALRTQVPKGLKTPPGPWGLPILGHVLTLGKNPHLSLTK 66

Query: 405 FS 410
            S
Sbjct: 67  LS 68



>gb:AF184144_1775016 Arabidopsis thaliana ARF GAP-like zinc
           finger-containing protein ZIGA3 mRNA, partial cds.
          Length = 477

 Score = 31.6 bits (70), Expect = 7.8
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 2/36 (5%)
 Frame = -1

Query: 474 NGTSPFSTAK--SFPAAKPSSTSPKTEEDPSWDFSS 373
           NG +P ST K  S  A +P+ST+P ++    +DFSS
Sbjct: 433 NGMTPNSTGKPQSSSATQPTSTTPSSQSGKDFDFSS 468



>gb:AY088913_1573921 Arabidopsis thaliana clone 99519 mRNA, complete
           sequence.
          Length = 483

 Score = 31.6 bits (70), Expect = 7.8
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 2/36 (5%)
 Frame = -1

Query: 474 NGTSPFSTAK--SFPAAKPSSTSPKTEEDPSWDFSS 373
           NG +P ST K  S  A +P+ST+P ++    +DFSS
Sbjct: 439 NGMTPNSTGKPQSSSATQPTSTTPSSQSGKDFDFSS 474



>gb:AB010695_1511176 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MDK4.>gb:AY099716_1576741 Arabidopsis thaliana
           unknown protein (At5g54310) mRNA, complete
           cds.>gb:BT000287_1634565 Arabidopsis thaliana unknown
           protein (At5g54310) mRNA, complete cds.
          Length = 483

 Score = 31.6 bits (70), Expect = 7.8
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 2/36 (5%)
 Frame = -1

Query: 474 NGTSPFSTAK--SFPAAKPSSTSPKTEEDPSWDFSS 373
           NG +P ST K  S  A +P+ST+P ++    +DFSS
Sbjct: 439 NGMTPNSTGKPQSSSATQPTSTTPSSQSGKDFDFSS 474



>pir|D75103|D75103 hypothetical protein PAB0810 - Pyrococcus abyssi
           (strain Orsay)>gb:CNSPAX04_849981 Pyrococcus abyssi
           complete genome; segment 4/6.
          Length = 548

 Score = 31.6 bits (70), Expect = 7.8
 Identities = 21/61 (34%), Positives = 31/61 (50%)
 Frame = +2

Query: 302 LDSEESEFSNADASASGHWASAFDEEKSQDGSSSVFGEVDDGFAAGNDFAVENGEVPFVV 481
           L S +S F++       + +S FD E+    +  V G++DDG    N   V+NGE  FV 
Sbjct: 60  LSSAKSTFNSIKLDVEEYGSSIFDNEEIV-ATVKVLGKIDDGELVPNRVPVKNGE--FVY 116

Query: 482 K 484
           K
Sbjct: 117 K 117


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 486,699,907
Number of Sequences: 1806583
Number of extensions: 8820488
Number of successful extensions: 31204
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 30034
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31166
length of database: 581,917,975
effective HSP length: 116
effective length of database: 372,354,347
effective search space used: 22341260820
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)