BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig749
         (1449 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AJ870305_1815093 Cucumis sativus mRNA for putative serine-thr...   592   e-168   
pir|T50501|T50501 serine/threonine protein kinase - Arabidopsis ...   592   e-168   Arabidopsis thaliana [mouse-ear cress]
gb:AY088294_1573314 Arabidopsis thaliana clone 5323 mRNA, comple...   590   e-167   
gb:AP005867_1859294 Oryza sativa (japonica cultivar-group) genom...   538   e-152   
gb:AP005745_1857041 Oryza sativa (japonica cultivar-group) genom...   464   e-129   
gb:BC074528_2558023 Xenopus tropicalis MGC69350 protein, mRNA (c...   183   9e-45   
gb:BC082377_2562614 Xenopus laevis MGC81705 protein, mRNA (cDNA ...   180   6e-44   
gb:BT019585_1991140 Homo sapiens serine/threonine kinase 16 mRNA...   180   6e-44   
gb:D86220_2112480 Rattus norvegicus mRNA for F52, complete cds.       179   2e-43   
sp|P57760|STKG_RAT|STKG_RAT Serine/threonine-protein kinase 16 (EC 2.7.1....   179   2e-43   Rattus norvegicus [brown rat]
gb:AB020739_1865325 Homo sapiens mRNA for F5-2, complete cds.>gb...   178   3e-43   
sp|O75716|STKG_HUMAN|STKG_HUMAN Serine/threonine-protein kinase 16 (EC 2.7....   178   3e-43   Homo sapiens [man]
gb:AY335661_2144879 Synthetic construct Homo sapiens serine/thre...   177   5e-43   
gb:AB017197_2043964 Mus musculus mRNA for EDPK, complete cds.>gb...   177   5e-43   
gb:BC002618_1968263 Homo sapiens serine/threonine kinase 16, tra...   177   5e-43   
sp|O88697|STKG_MOUSE|STKG_MOUSE Serine/threonine-protein kinase 16 (EC 2.7....   177   5e-43   Mus musculus [mouse]
gb:AF060798_1879838 Homo sapiens myristilated and palmitylated s...   176   8e-43   
gb:AK032162_1162776 Mus musculus adult male olfactory brain cDNA...   176   8e-43   
gb:AK030404_1161990 Mus musculus adult male pituitary gland cDNA...   176   1e-42   
gb:HSAJ5791_2010410 Homo sapiens mRNA for PKL12 protein.              175   2e-42   
gb:AF062076_2052907 Mus musculus palmitylated serine/threonine k...   175   2e-42   
gb:AB022285_2044212 Mus musculus F5-2 gene, complete cds.             174   4e-42   
gb:AB022179_2044208 Mus musculus mRNA for F5-2, complete cds.         174   4e-42   
gb:HSAJ10872_2010192 Homo sapiens mRNA for serine/threonine kinase.   173   9e-42   
gb:CR382128_1660533 Yarrowia lipolytica chromosome B of strain C...   157   4e-37   
gb:AE017342_1754951 Cryptococcus neoformans var. neoformans JEC2...   155   2e-36   
gb:CR382136_1669057 Debaryomyces hansenii chromosome D of strain...   145   2e-33   
gb:AE014297_1138308 Drosophila melanogaster chromosome 3R, compl...   144   5e-33   
sp|Q10078|KAND_SCHPO|KAND_SCHPO Putative serine/threonine-protein kinase C3...   135   3e-30   Schizosaccharomyces pombe
gb:AC114263_1205606 Dictyostelium discoideum chromosome 2 map 21...   123   8e-27   
gb:AP005874_1859454 Oryza sativa (japonica cultivar-group) genom...   120   5e-26   
gb:AP005594_1854688 Oryza sativa (japonica cultivar-group) genom...   120   7e-26   
gb:AX040954_1457750 Sequence 1 from Patent WO0065040.                 119   1e-25   
gb:AP005874_1859455 Oryza sativa (japonica cultivar-group) genom...   116   1e-24   
pir|S61028|S61028 hypothetical protein YPL236c - yeast (Saccharo...   114   4e-24   Saccharomyces cerevisiae [brewer's yeast]
gb:BT001103_1635358 Arabidopsis thaliana clone C104878 (D) putat...   113   9e-24   
gb:AC003033_1531008 Arabidopsis thaliana chromosome 2 BAC T21L14...   113   9e-24   
gb:AY072202_1567090 Arabidopsis thaliana putative serine/threoni...   113   1e-23   
pir|T01122|T01122 probable serine/threonine protein kinase [impo...   112   3e-23   Arabidopsis thaliana [mouse-ear cress]
gb:BX004825_2566967 Zebrafish DNA sequence from clone DKEYP-1E8 ...   111   4e-23   
pir|T40643|T40643 probable serine threonine-protein kinase - fis...   109   1e-22   Schizosaccharomyces pombe
gb:SCU24167_1710052 Saccharomyces cerevisiae PAK1 mRNA, complete...   109   2e-22   
sp|P40494|KIJ5_YEAST|KIJ5_YEAST Probable serine/threonine-protein kinase YI...   109   2e-22   Saccharomyces cerevisiae [brewer's yeast]
gb:CR380953_1650729 Candida glabrata strain CBS138 chromosome G ...   107   8e-22   
gb:BC002695_1968330 Homo sapiens AP2 associated kinase 1, mRNA (...   106   1e-21   
gb:AB028971_1865827 Homo sapiens mRNA for KIAA1048 protein, part...   106   1e-21   
gb:CR857994_1182185 Pongo pygmaeus mRNA; cDNA DKFZp469F1313 (fro...   106   1e-21   
gb:CR380954_1651500 Candida glabrata strain CBS138 chromosome H ...   105   2e-21   
gb:BC060622_2104098 Mus musculus cyclin G associated kinase, mRN...   105   2e-21   
sp|P97874|GAK_RAT|GAK_RAT Cyclin G-associated kinase (EC 2.7.1.-).>pir|T...   105   2e-21   Rattus norvegicus [brown rat]
gb:BC065052_2105487 Mus musculus cyclin G associated kinase, mRN...   105   3e-21   
gb:D88435_1995423 Homo sapiens mRNA for HsGAK, complete cds.          104   4e-21   
gb:AX710518_1473626 Sequence 10 from Patent WO03018626.>gb:AE016...   104   4e-21   
sp|O14976|GAK_HUMAN|GAK_HUMAN Cyclin G-associated kinase (EC 2.7.1.-).          104   4e-21   Homo sapiens [man]
gb:AF083800_1767030 Arabidopsis thaliana clone sps916 unknown mRNA.   103   7e-21   
gb:CR382125_1657592 Kluyveromyces lactis strain NRRL Y-1140 chro...   103   9e-21   
gb:AY118655_1300377 Drosophila melanogaster SD07306 full insert ...   102   2e-20   
gb:AF197910_1249987 Drosophila melanogaster Numb-associated kina...   102   2e-20   
gb:AE014134_1129667 Drosophila melanogaster chromosome 2L, compl...   102   2e-20   
gb:AE014134_1129665 Drosophila melanogaster chromosome 2L, compl...   102   2e-20   
gb:AE016817_1747167 Ashbya gossypii (= Eremothecium gossypii) AT...   101   3e-20   
pir|T50369|T50369 probable serine/threonine-protein kinase [impo...   100   6e-20   Schizosaccharomyces pombe
sp|P53974|KNC0_YEAST|KNC0_YEAST Probable serine/threonine-protein kinase YN...    98   4e-19   Saccharomyces cerevisiae [brewer's yeast]
gb:CR380957_1653025 Candida glabrata strain CBS138 chromosome K ...    98   5e-19   
gb:CR380956_1652128 Candida glabrata strain CBS138 chromosome J ...    98   5e-19   
gb:AK046752_1167901 Mus musculus 4 days neonate thymus cDNA, RIK...    97   6e-19   
sp|P38080|KBQ9_YEAST|KBQ9_YEAST Probable serine/threonine-protein kinase YB...    97   6e-19   Saccharomyces cerevisiae [brewer's yeast]
sp|Q91Z96|BM2K_MOUSE|BM2K_MOUSE BMP-2 inducible protein kinase (EC 2.7.1.37...    97   6e-19   Mus musculus [mouse]
gb:CR382135_1668495 Debaryomyces hansenii chromosome C of strain...    94   5e-18   
gb:HSM801970_2017391 Homo sapiens mRNA; cDNA DKFZp434P0116 (from...    94   9e-18   
gb:BC036021_1981799 Homo sapiens BMP2 inducible kinase, transcri...    94   9e-18   
gb:AX282120_1465179 Sequence 3 from Patent WO0177150.                  94   9e-18   
pir|T46364|T46364 hypothetical protein DKFZp434P0116.1 - human (...    94   9e-18   Homo sapiens [man]
sp|Q9NSY1|BM2K_HUMAN|BM2K_HUMAN BMP-2 inducible protein kinase (EC 2.7.1.37...    94   9e-18   Homo sapiens [man]
pir|T41681|T41681 probable serine/threonine-protein kinase - fis...    91   8e-17   Schizosaccharomyces pombe
gb:AE017342_1754990 Cryptococcus neoformans var. neoformans JEC2...    89   2e-16   
gb:BC086712_2564929 Danio rerio zgc:101641, mRNA (cDNA clone MGC...    89   2e-16   
gb:AE014297_1137765 Drosophila melanogaster chromosome 3R, compl...    89   2e-16   
gb:CR382138_1670967 Debaryomyces hansenii chromosome F of strain...    89   3e-16   
gb:CR382126_1659178 Kluyveromyces lactis strain NRRL Y-1140 chro...    87   7e-16   
pir|T21800|T21800 hypothetical protein F35G12.3a - Caenorhabditi...    86   1e-15   Caenorhabditis elegans [roundworm]
pir|T21806|T21806 hypothetical protein F35G12.3b - Caenorhabditi...    86   1e-15   Caenorhabditis elegans [roundworm]
gb:AE014188_968261 Plasmodium falciparum 3D7 chromosome 12, comp...    86   3e-15   
gb:CR380954_1651099 Candida glabrata strain CBS138 chromosome H ...    81   6e-14   
gb:AF052296_1236741 Drosophila heteroneura putative serine/threo...    80   1e-13   
gb:CED2045_1361802 Caenorhabditis elegans cosmid D2045, complete...    79   2e-13   
pir|T20367|T20367 hypothetical protein D2045.7 - Caenorhabditis ...    79   2e-13   Caenorhabditis elegans [roundworm]
gb:CR382126_1659376 Kluyveromyces lactis strain NRRL Y-1140 chro...    79   2e-13   
gb:BC005411_2089843 Mus musculus NIMA (never in mitosis gene a)-...    79   3e-13   
gb:BC085005_1989906 Homo sapiens cyclin G associated kinase, mRN...    78   4e-13   
gb:AL646068_547085 Ralstonia solanacearum GMI1000 chromosome, co...    77   9e-13   
gb:AF099066_2054433 Mus musculus serine/threonine-protein kinase...    76   2e-12   
sp|Q9R0A5|NEK3_MOUSE|NEK3_MOUSE Serine/threonine-protein kinase Nek3 (EC 2....    76   2e-12   Mus musculus [mouse]
gb:AB073313_1197459 Asterina pectinifera sfRSK mRNA for p90 ribo...    75   3e-12   
gb:BX294154_771774 Pirellula sp. strain 1 complete genome; segme...    75   3e-12   
gb:AB062881_1197050 Mytilus galloprovincialis mRNA for twitchin,...    75   3e-12   
gb:AB042565_1195632 Mytilus galloprovincialis mRNA for twitchin,...    75   3e-12   
gb:AB008202_1193127 Mytilus galloprovincialis mRNA for twitchin-...    75   3e-12   
gb:EHU48386_1384548 Entamoeba histolytica putative serine/threon...    75   4e-12   
sp|Q8R9T6|PKN1_THETN|PKN1_THETN Probable serine/threonine-protein kinase Sp...    75   4e-12   
gb:BC072363_2556612 Xenopus laevis hypothetical protein MGC83541...    74   6e-12   
gb:BC012964_2091679 Mus musculus ribosomal protein S6 kinase, po...    74   1e-11   
gb:HSA247087_2001447 Homo sapiens mRNA for myosin light chain ki...    74   1e-11   
gb:SCCMK2_1707353 S. cerevisiae CMK2 gene for calmodulin-depende...    74   1e-11   
gb:AK052858_1170225 Mus musculus 16 days neonate heart cDNA, RIK...    74   1e-11   
sp|P22517|KCC2_YEAST|KCC2_YEAST Calcium/calmodulin-dependent protein kinase...    74   1e-11   Saccharomyces cerevisiae [brewer's yeast]
sp|Q9Z2B9|K6A4_MOUSE|K6A4_MOUSE Ribosomal protein S6 kinase alpha 4 (EC 2.7...    74   1e-11   Mus musculus [mouse]
pir|E96949|E96949 serine/threonine protein kinase fused to TPR r...    73   1e-11   Clostridium acetobutylicum
pir|T16373|T16373 hypothetical protein F46G11.3 - Caenorhabditis...    73   1e-11   Caenorhabditis elegans [roundworm]
gb:AF074715_1880992 Homo sapiens mitogen- and stress-activated p...    73   2e-11   
gb:AE017348_1758354 Cryptococcus neoformans var. neoformans JEC2...    73   2e-11   
gb:AX405633_1467561 Sequence 48 from Patent WO0222660.                 73   2e-11   
gb:A44422_1449149 Sequence 1 from Patent EP0653489.                    73   2e-11   
sp|O75676|K6A4_HUMAN|K6A4_HUMAN Ribosomal protein S6 kinase alpha 4 (EC 2.7...    73   2e-11   Homo sapiens [man]
gb:CR380952_1650427 Candida glabrata strain CBS138 chromosome F ...    72   2e-11   
gb:AL139082_1920218 Human DNA sequence from clone RP11-248G5 on ...    72   3e-11   
gb:AK131359_1917900 Homo sapiens cDNA FLJ16392 fis, clone TRACH2...    72   3e-11   
gb:AX803387_1475531 Sequence 49 from Patent WO03000901.                72   3e-11   
sp|P51956|NEK3_HUMAN|NEK3_HUMAN Serine/threonine-protein kinase Nek3 (EC 2....    72   3e-11   Homo sapiens [man]
sp|P10665|K6AA_XENLA|K6AA_XENLA Ribosomal protein S6 kinase II alpha (EC 2....    72   3e-11   Xenopus laevis [clawed frog]
gb:BC075119_2558233 Xenopus tropicalis NIMA (never in mitosis ge...    72   4e-11   
gb:LME293290_1387701 Leishmania mexicana MKK2 gene for putative ...    72   4e-11   
gb:LMFL6293_1388260 Leishmania major Friedlin chromosome 13 cosm...    71   5e-11   
gb:ETCDPK_1384939 E.tenella mRNA for calmodulin-domain protein k...    71   5e-11   
gb:CR857943_1182138 Pongo pygmaeus mRNA; cDNA DKFZp468H2010 (fro...    71   5e-11   
gb:AB072828_1871315 Homo sapiens NEK3 mRNA for NIMA-related prot...    71   6e-11   
gb:AB055927_1196749 Procambarus clarkii mRNA for projectin, comp...    71   6e-11   
gb:CER166_1366877 Caenorhabditis elegans cosmid R166, complete s...    70   8e-11   
gb:AY071017_1295102 Drosophila melanogaster RE09533 full length ...    70   8e-11   
pir|T13619|T13619 hypothetical protein 8D8.5 - fruit fly (Drosop...    70   8e-11   Drosophila melanogaster
pir|T24230|T24230 hypothetical protein R166.5 - Caenorhabditis e...    70   8e-11   Caenorhabditis elegans [roundworm]
gb:AY660551_1344359 Eimeria tenella strain GS calmodulin-domain ...    70   1e-10   
gb:AF333958_1263449 Toxoplasma gondii calmodulin-domain protein ...    70   1e-10   
gb:HSM805135_1187350 Homo sapiens mRNA; cDNA DKFZp434B079 (from ...    70   1e-10   
gb:CR382130_1662670 Yarrowia lipolytica chromosome D of strain C...    70   1e-10   
gb:AY047563_1289522 Drosophila melanogaster GH07636 full length ...    70   1e-10   
gb:AF047475_1236386 Drosophila melanogaster projectin (projectin...    70   1e-10   
gb:AE014135_1137696 Drosophila melanogaster chromosome 4, comple...    70   1e-10   
gb:AE014135_1137695 Drosophila melanogaster chromosome 4, comple...    70   1e-10   
gb:AE014135_1137694 Drosophila melanogaster chromosome 4, comple...    70   1e-10   
gb:AE014135_1137693 Drosophila melanogaster chromosome 4, comple...    70   1e-10   
gb:BX294150_770391 Pirellula sp. strain 1 complete genome; segme...    70   1e-10   
pir|T13931|T13931 projectin - fruit fly (Drosophila melanogaster...    70   1e-10   Drosophila melanogaster
sp|P27466|KCC1_YEAST|KCC1_YEAST Calcium/calmodulin-dependent protein kinase...    70   1e-10   Saccharomyces cerevisiae [brewer's yeast]
gb:BC070744_2555714 Xenopus laevis hypothetical protein MGC83745...    69   2e-10   
gb:AE017356_1760231 Cryptococcus neoformans var. neoformans JEC2...    69   2e-10   
gb:AF043629_1235900 Toxoplasma gondii protein kinase 4 (tpk4) mR...    69   2e-10   
gb:ACTWITCH_1208280 A.californica mRNA for twitchin-like protein.      69   2e-10   
pir|S49128|S49128 twitchin-like protein - California sea hare (f...    69   2e-10   Aplysia californica
sp|P18652|K6AA_CHICK|K6AA_CHICK Ribosomal protein S6 kinase II alpha (EC 2....    69   2e-10   Gallus gallus [bantam]
gb:CEZK617_1371674 Caenorhabditis elegans cosmid ZK617, complete...    69   2e-10   
gb:CEUNC22_1368692 Caenorhabditis elegans unc-22 gene for twitchin.    69   2e-10   
pir|T27935|T27935 hypothetical protein ZK617.1b - Caenorhabditis...    69   2e-10   Caenorhabditis elegans [roundworm]
pir|A88852|A88852 protein unc-22 [imported] - Caenorhabditis ele...    69   2e-10   Caenorhabditis elegans [roundworm]
pir|S57242|S57242 twitchin [similarity] - Caenorhabditis elegans...    69   2e-10   Caenorhabditis elegans [roundworm]
gb:BC066785_2554608 Xenopus tropicalis hypothetical protein MGC7...    69   3e-10   
gb:AY555067_1335209 Plasmodium berghei calcium dependent protein...    69   3e-10   
gb:AY389513_1324997 Eimeria tenella calmodulin-domain protein ki...    69   3e-10   
sp|Q7RJG2|CDP4_PLAYO|CDP4_PLAYO Calcium-dependent protein kinase 4 (EC 2.7....    69   3e-10   Plasmodium yoelii yoelii
sp|P62345|CDP4_PLABA|CDP4_PLABA Calcium-dependent protein kinase 4 (EC 2.7....    69   3e-10   Plasmodium berghei
gb:AF363966_2489444 Rana dybowskii 90-kDa ribosomal protein S6 k...    68   4e-10   
gb:BX294154_771605 Pirellula sp. strain 1 complete genome; segme...    68   4e-10   
gb:BX294148_769970 Pirellula sp. strain 1 complete genome; segme...    68   4e-10   
gb:AP008226_579051 Thermus thermophilus HB8 genomic DNA, complet...    68   4e-10   
gb:AE017305_436864 Thermus thermophilus HB27 section 5 of 7 of t...    68   4e-10   
sp|P38147|CHK1_YEAST|CHK1_YEAST Serine/threonine-protein kinase CHK1 (EC 2....    68   4e-10   Saccharomyces cerevisiae [brewer's yeast]
gb:BC071102_2555964 Xenopus laevis S6 kinase II beta, mRNA (cDNA...    68   5e-10   
gb:AE017348_1758391 Cryptococcus neoformans var. neoformans JEC2...    68   5e-10   
gb:AE016814_1745838 Ashbya gossypii (= Eremothecium gossypii) AT...    68   5e-10   
gb:EMCDPK_1384617 E.maxima mRNA for calmodulin-domain protein ki...    68   5e-10   
gb:AF453997_1272563 Tetrahymena thermophila protein tyrosine kin...    68   5e-10   
gb:PFMAL7P1_1191888 Plasmodium falciparum 3D7 chromosome 7, *** ...    68   5e-10   
pir|H75566|H75566 probable serine/threonine protein kinase - Dei...    68   5e-10   Deinococcus radiodurans
sp|P10666|K6AB_XENLA|K6AB_XENLA Ribosomal protein S6 kinase II beta (EC 2.7...    68   5e-10   Xenopus laevis [clawed frog]
sp|Q8IBS5|CDP4_PLAF7|CDP4_PLAF7 Calcium-dependent protein kinase 4 (EC 2.7....    68   5e-10   Plasmodium falciparum
gb:AB016838_1193639 Caenorhabditis elegans mRNA for Ca2+/calmodu...    67   7e-10   
gb:AP006618_558822 Nocardia farcinica IFM 10152 DNA, complete ge...    67   7e-10   
pir|T37317|T37317 probable Ca2+/calmodulin-dependent protein kin...    67   7e-10   Caenorhabditis elegans [roundworm]
gb:BC088802_2565895 Xenopus laevis hypothetical LOC496293, mRNA ...    67   9e-10   
gb:AE016818_1747944 Ashbya gossypii (= Eremothecium gossypii) AT...    67   9e-10   
gb:CEC54G4_1361613 Caenorhabditis elegans cosmid C54G4, complete...    67   9e-10   
gb:AL670399_2072641 Mouse DNA sequence from clone RP23-263M10 on...    67   1e-09   
gb:AB023658_2044286 Rattus norvegicus mRNA for Ca/calmodulin-dep...    67   1e-09   
gb:AL139082_1920216 Human DNA sequence from clone RP11-248G5 on ...    67   1e-09   
gb:LES297917_1684550 Lycopersicon esculentum mRNA for B2-type cy...    67   1e-09   
gb:CR382139_1672622 Debaryomyces hansenii chromosome G of strain...    67   1e-09   
gb:AX455761_1468851 Sequence 7 from Patent WO0220800.                  67   1e-09   
gb:MYCRRN1_152132 Mycoplasma gallisepticum strain A5969 genomic ...    67   1e-09   
pir|A57156|A57156 Ca2+/calmodulin-dependent protein kinase (EC 2...    67   1e-09   Rattus norvegicus [brown rat]
gb:AL627313_1931080 Human DNA sequence from clone RP11-492M19 on...    66   2e-09   
gb:AF009561_1231593 Paramecium tetraurelia calcium-dependent pro...    66   2e-09   
pir|I51901|I51901 ribosomal protein S6 kinase 2 (EC 2.7.1.-) 1 -...    66   2e-09   Homo sapiens [man]
sp|Q15418|K6A1_HUMAN|K6A1_HUMAN Ribosomal protein S6 kinase alpha 1 (EC 2.7...    66   2e-09   Homo sapiens [man]
gb:BC086026_2564619 Xenopus laevis hypothetical LOC495572, mRNA ...    66   2e-09   
gb:BC049076_2099898 Mus musculus ribosomal protein S6 kinase pol...    66   2e-09   
gb:AF458700_1801554 Medicago sativa putative ankyrin-kinase (apk...    66   2e-09   
gb:AF458699_1801553 Medicago truncatula ankyrin-kinase mRNA, com...    66   2e-09   
gb:SCCMK1_1707352 S. cerevisiae CMK1 gene for Ca2+/calmodulin-de...    66   2e-09   
gb:AY364644_1602840 Chlamydomonas reinhardtii NIMA-related kinas...    66   2e-09   
gb:OCU38275_1442615 Oryctolagus cuniculus skeletal and cardiac m...    66   2e-09   
gb:AE014298_1124695 Drosophila melanogaster chromosome X, comple...    66   2e-09   
sp|P18653|K6A1_MOUSE|K6A1_MOUSE Ribosomal protein S6 kinase alpha 1 (EC 2.7...    66   2e-09   Mus musculus [mouse]
sp|P39009|DUN1_YEAST|DUN1_YEAST DNA damage response protein kinase DUN1 (EC...    66   2e-09   Saccharomyces cerevisiae [brewer's yeast]
gb:CHKCDK6G_2568867 Gallus gallus cyclin-dependent kinase (cdk6)...    65   3e-09   
gb:AF384863_2490827 Danio rerio myosin IIIA (myo3a) mRNA, comple...    65   3e-09   
gb:AF461701S6_2066523 Mus musculus calcium/calmodulin-dependent ...    65   3e-09   
gb:CR382121_1654590 Kluyveromyces lactis strain NRRL Y-1140 chro...    65   3e-09   
gb:CR548612_1375577 Paramecium tetraurelia macronuclear largest ...    65   3e-09   
gb:HSM801550_1186246 Homo sapiens mRNA; cDNA DKFZp761M0423 (from...    65   3e-09   
gb:BX294134_765349 Pirellula sp. strain 1 complete genome; segme...    65   3e-09   
gb:BA000030_703311 Streptomyces avermitilis MA-4680 genomic DNA,...    65   3e-09   
gb:AE016969_369907 Mycoplasma gallisepticum strain R section 3 o...    65   3e-09   
gb:AL714003_2504391 Zebrafish DNA sequence from clone BUSM1-167C...    65   4e-09   
gb:BVU309171_1643192 Beta vulgaris mRNA for putative phosphoenol...    65   4e-09   
gb:AK043543_1166622 Mus musculus 10 days neonate cortex cDNA, RI...    65   4e-09   
gb:BX294149_770228 Pirellula sp. strain 1 complete genome; segme...    65   4e-09   
sp|Q63531|K6A1_RAT|K6A1_RAT Ribosomal protein S6 kinase alpha 1 (EC 2.7.1...    65   4e-09   Rattus norvegicus [brown rat]
gb:AF034090_1762739 Neurospora crassa MAPKK kinase (nrc-1) gene,...    65   5e-09   
gb:D89662_1376520 Drosophila melanogaster mRNA for myosin light ...    65   5e-09   
gb:AB009878_1193174 Tetrahymena pyriformis mRNA for NRK-related ...    65   5e-09   
gb:CR933642_1185671 Homo sapiens mRNA; cDNA DKFZp686D06121 (from...    65   5e-09   
gb:AK054237_1170747 Mus musculus 2 days pregnant adult female ov...    65   5e-09   
gb:AK030042_1161799 Mus musculus adult male testis cDNA, RIKEN f...    65   5e-09   
gb:AF377950_505716 Myxococcus xanthus MglA (mglA), MglB (mglB), ...    65   5e-09   
gb:AE010186_260222 Pyrococcus furiosus DSM 3638, section 61 of 1...    65   5e-09   
gb:CR861243_1185252 Pongo pygmaeus mRNA; cDNA DKFZp459H053 (from...    64   6e-09   
gb:BX294151_770622 Pirellula sp. strain 1 complete genome; segme...    64   6e-09   
gb:AE016822_339352 Leifsonia xyli subsp. xyli str. CTCB07, compl...    64   6e-09   
sp|Q03145|EPA2_MOUSE|EPA2_MOUSE Ephrin type-A receptor 2 precursor (EC 2.7....    64   6e-09   Mus musculus [mouse]
gb:AC105363_1737956 Oryza sativa (japonica cultivar-group) chrom...    64   8e-09   
gb:AY143661_1583250 Glycine max phosphoenolpyruvate carboxylase ...    64   8e-09   
gb:D89663_1376521 Drosophila melanogaster mRNA for myosin light ...    64   8e-09   
gb:D89661_1376519 Drosophila melanogaster mRNA for myosin light ...    64   8e-09   
gb:AF255671_1256423 Drosophila melanogaster clone RTD3 Stretchin...    64   8e-09   
gb:AF255670_1256422 Drosophila melanogaster clone RTD42 Stretchi...    64   8e-09   
gb:AF255668_1256420 Drosophila melanogaster clone RTD6 Stretchin...    64   8e-09   
gb:AF039037_1235258 Caenorhabditis elegans cosmid R02C2, complet...    64   8e-09   
gb:CR857862_1182063 Pongo pygmaeus mRNA; cDNA DKFZp469A1729 (fro...    64   8e-09   
gb:AE013599_1132090 Drosophila melanogaster chromosome 2R, compl...    64   8e-09   
gb:AE013599_1132089 Drosophila melanogaster chromosome 2R, compl...    64   8e-09   
gb:AE013599_1132088 Drosophila melanogaster chromosome 2R, compl...    64   8e-09   
gb:AE013599_1132087 Drosophila melanogaster chromosome 2R, compl...    64   8e-09   
gb:AE013599_1132086 Drosophila melanogaster chromosome 2R, compl...    64   8e-09   
pir|F88924|F88924 protein R02C2.2 [imported] - Caenorhabditis el...    64   8e-09   Caenorhabditis elegans [roundworm]
sp|Q64261|CDK6_MOUSE|CDK6_MOUSE Cell division protein kinase 6 (EC 2.7.1.37...    64   8e-09   Mus musculus [mouse]
gb:BC045856_2549375 Danio rerio zgc:56006, mRNA (cDNA clone MGC:...    64   1e-08   
gb:AE016819_1748695 Ashbya gossypii (= Eremothecium gossypii) AT...    64   1e-08   
gb:TCU69958_1399927 Trypanosoma cruzi cdc2-related protein kinas...    64   1e-08   
gb:AE013599_1133332 Drosophila melanogaster chromosome 2R, compl...    64   1e-08   
gb:BA000033_711395 Staphylococcus aureus subsp. aureus MW2 DNA, ...    64   1e-08   
gb:SAPKNB_171763 Staphylococcus aureus pknB gene.                      64   1e-08   
pir|G89894|G89894 protein kinase [imported] - Staphylococcus aur...    64   1e-08   Staphylococcus aureus subsp. aureus Mu50
sp|P42818|KPK1_ARATH|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6...    64   1e-08   Arabidopsis thaliana [mouse-ear cress]
gb:BC070834_2555803 Xenopus laevis hypothetical protein LOC43182...    63   1e-08   
gb:AY341881_2083916 Mus musculus ribosomal protein S6 kinase spl...    63   1e-08   
gb:AF203479_1776553 Glycine max phosphoenolpyruvate carboxylase ...    63   1e-08   
gb:CR382132_1666070 Yarrowia lipolytica chromosome F of strain C...    63   1e-08   
gb:AK054168_1170725 Mus musculus 2 days pregnant adult female ov...    63   1e-08   
gb:AK032316_1162853 Mus musculus adult male olfactory brain cDNA...    63   1e-08   
pir|H84653|H84653 probable protein kinase [imported] - Arabidops...    63   1e-08   Arabidopsis thaliana [mouse-ear cress]
gb:BC077360_2560073 Xenopus laevis death-associated protein kina...    63   2e-08   
gb:AY335697_2144915 Synthetic construct Homo sapiens serine/thre...    63   2e-08   
gb:RATMLCK_2132979 Rat skeletal muscle myosin light chain kinase...    63   2e-08   
gb:BC053516_2101534 Mus musculus expressed sequence BB049667, mR...    63   2e-08   
gb:AB067488_1870796 Homo sapiens mRNA for KIAA1901 protein, part...    63   2e-08   
gb:AC091811_1735133 Oryza sativa chromosome 3 BAC OSJNBa0069E14 ...    63   2e-08   
gb:U00065_1401597 Caenorhabditis elegans cosmid D1044, complete ...    63   2e-08   
gb:AK032672_1163024 Mus musculus 10 days neonate cerebellum cDNA...    63   2e-08   
pir|A28798|A28798 myosin-light-chain kinase (EC 2.7.1.117), skel...    63   2e-08   Rattus norvegicus [brown rat]
pir|T15881|T15881 hypothetical protein D1044.3 - Caenorhabditis ...    63   2e-08   Caenorhabditis elegans [roundworm]
sp|P41951|YLK3_CAEEL|YLK3_CAEEL Putative serine/threonine-protein kinase D1...    63   2e-08   Caenorhabditis elegans [roundworm]
sp|Q9UEE5|S17A_HUMAN|S17A_HUMAN Serine/threonine-protein kinase 17A (EC 2.7...    63   2e-08   Homo sapiens [man]
sp|Q10697|PKNJ_MYCTU|PKNJ_MYCTU Probable serine/threonine-protein kinase pk...    63   2e-08   Mycobacterium tuberculosis
sp|Q96PY6|NEK1_HUMAN|NEK1_HUMAN Serine/threonine-protein kinase Nek1 (EC 2....    63   2e-08   Homo sapiens [man]
sp|P20689|KML2_RAT|KML2_RAT Myosin light chain kinase 2, skeletal/cardiac...    63   2e-08   Rattus norvegicus [brown rat]
gb:BC072206_2556465 Xenopus laevis hypothetical protein MGC81183...    62   2e-08   
gb:AF003249_2468144 Morone saxatilis myosin heavy chain FM3A (FM...    62   2e-08   
gb:BC054113_2101635 Mus musculus ribosomal protein S6 kinase pol...    62   2e-08   
gb:AL139082_1920217 Human DNA sequence from clone RP11-248G5 on ...    62   2e-08   
gb:AB051552_1868064 Homo sapiens mRNA for KIAA1765 protein, part...    62   2e-08   
gb:AE017348_1758303 Cryptococcus neoformans var. neoformans JEC2...    62   2e-08   
gb:AY364648_1602844 Chlamydomonas reinhardtii NIMA-related kinas...    62   2e-08   
gb:AX803389_1475532 Sequence 51 from Patent WO03000901.                62   2e-08   
gb:AF118100_1242666 Toxoplasma gondii protein kinase 5 (tpk5) mR...    62   2e-08   
gb:AE016822_340573 Leifsonia xyli subsp. xyli str. CTCB07, compl...    62   2e-08   
gb:CP000029_81397 Staphylococcus epidermidis RP62A, complete gen...    62   2e-08   
sp|P54736|PKN2_MYXXA|PKN2_MYXXA Serine/threonine-protein kinase pkn2 (EC 2....    62   2e-08   
sp|Q39030|KP19_ARATH|KP19_ARATH Serine/threonine-protein kinase AtPK19 (EC ...    62   2e-08   
sp|P43637|KGS9_YEAST|KGS9_YEAST Probable serine/threonine-protein kinase YG...    62   2e-08   
sp|O75582|K6A5_HUMAN|K6A5_HUMAN Ribosomal protein S6 kinase alpha 5 (EC 2.7...    62   2e-08   
sp|O88764|DAK3_RAT|DAK3_RAT Death-associated protein kinase 3 (EC 2.7.1.3...    62   2e-08   
sp|O54784|DAK3_MOUSE|DAK3_MOUSE Death-associated protein kinase 3 (EC 2.7.1...    62   2e-08   
gb:AL928906_2504718 Zebrafish DNA sequence from clone RP71-34G2 ...    62   3e-08   
gb:AY335729_2144947 Synthetic construct Homo sapiens cyclin-depe...    62   3e-08   
gb:AY335598_2144816 Synthetic construct Homo sapiens oxidative-s...    62   3e-08   
gb:HSTITINC3_2021098 H.sapiens mRNA titin (subclone C37).              62   3e-08   
gb:HSTITIN2B_2021096 H.sapiens mRNA for titin protein (clone hh1...    62   3e-08   
gb:HSTITIN_2021094 H.sapiens mRNA for titin.                           62   3e-08   
gb:HSNEK3R_2019088 H.sapiens nek3 mRNA for protein kinase.             62   3e-08   
gb:HSA277892_2002256 Homo sapiens partial TTN gene for titin.          62   3e-08   
gb:HSA277892_2002255 Homo sapiens partial TTN gene for titin.          62   3e-08   
gb:AF140507_1885859 Homo sapiens Ca2+/calmodulin-dependent prote...    62   3e-08   
gb:AB017642_1864871 Homo sapiens mRNA for oxidative-stress respo...    62   3e-08   
gb:AP004126_1837992 Oryza sativa (japonica cultivar-group) genom...    62   3e-08   
gb:CR382125_1657282 Kluyveromyces lactis strain NRRL Y-1140 chro...    62   3e-08   
gb:AY496080_1609090 Zea mays tousled-like kinase 2 (TLK2) mRNA, ...    62   3e-08   
gb:AC011560_1537245 Arabidopsis thaliana chromosome 3 BAC F13M14...    62   3e-08   
gb:U41994_1404265 Caenorhabditis elegans cosmid F59A6, complete ...    62   3e-08   
gb:DME577475_1379464 Drosophila melanogaster mRNA for polo kinas...    62   3e-08   
gb:AY466386_1329827 Cryptosporidium parvum calcium-dependent pro...    62   3e-08   
gb:CR861361_1185360 Pongo pygmaeus mRNA; cDNA DKFZp459B042 (from...    62   3e-08   
gb:AK049349_1168746 Mus musculus ES cells cDNA, RIKEN full-lengt...    62   3e-08   
gb:AE014296_1136396 Drosophila melanogaster chromosome 3L, compl...    62   3e-08   
gb:AE013599_1133764 Drosophila melanogaster chromosome 2R, compl...    62   3e-08   
gb:AE013599_1133761 Drosophila melanogaster chromosome 2R, compl...    62   3e-08   
gb:BA000028_695896 Oceanobacillus iheyensis HTE831 DNA, complete...    62   3e-08   
pir|T16511|T16511 hypothetical protein F59A6.1 - Caenorhabditis ...    62   3e-08   
pir|I38344|I38344 titin, cardiac muscle [validated] - human            62   3e-08   
sp|Q9GM70|S17A_RABIT|S17A_RABIT Serine/threonine-protein kinase 17A (EC 2.7...    62   3e-08   
sp|O34507|PKN2_BACSU|PKN2_BACSU Probable serine/threonine-protein kinase yl...    62   3e-08   
sp|P33973|PKN1_MYXXA|PKN1_MYXXA Serine/threonine-protein kinase pkn1 (EC 2....    62   3e-08   
sp|Q00534|CDK6_HUMAN|CDK6_HUMAN Cell division protein kinase 6 (EC 2.7.1.37...    62   3e-08   
gb:BC055634_2551495 Danio rerio cyclin-dependent kinase 9 (CDC2-...    62   4e-08   
gb:AJ719290_2501477 Gallus gallus mRNA for hypothetical protein,...    62   4e-08   
gb:AY335738_2144956 Synthetic construct Homo sapiens death-assoc...    62   4e-08   
gb:AL451042_1928105 Human DNA sequence from clone RP11-276H7 on ...    62   4e-08   
gb:AL138876_1920043 Human DNA sequence from clone RP11-145H9 on ...    62   4e-08   
gb:AL138876_1920042 Human DNA sequence from clone RP11-145H9 on ...    62   4e-08   
gb:AF321388_1896652 Homo sapiens CaMKK beta 1 isoform mRNA, comp...    62   4e-08   
gb:AF321386_1896650 Homo sapiens CaMKK beta 1 isoform mRNA, comp...    62   4e-08   
gb:AF321385_1896649 Homo sapiens CaMKK beta 2 isoform mRNA, comp...    62   4e-08   
gb:AB081337_1871785 Homo sapiens Camkk beta-3x mRNA for Ca2+/cal...    62   4e-08   
gb:AK175188_1817176 Arabidopsis thaliana mRNA for putative prote...    62   4e-08   
gb:NTU38446_1691829 Nicotiana tabacum calcium/calmodulin depende...    62   4e-08   
gb:AY084935_1570017 Arabidopsis thaliana clone 122224 mRNA, comp...    62   4e-08   
gb:AB065100_1522444 Flaveria trinervia PEPC-PK mRNA for phosphoe...    62   4e-08   
gb:AX958797_1484321 Sequence 3 from Patent WO03100046.                 62   4e-08   
gb:AX958795_1484320 Sequence 1 from Patent WO03100046.                 62   4e-08   
gb:AX880020_1478091 Sequence 14925 from Patent EP1074617.              62   4e-08   
gb:AP006618_560649 Nocardia farcinica IFM 10152 DNA, complete ge...    62   4e-08   
pir|A35021|A35021 myosin-light-chain kinase (EC 2.7.1.117), skel...    62   4e-08   
sp|P49071|MKK2_DROME|MKK2_DROME MAP kinase-activated protein kinase 2 (EC 2...    62   4e-08   
sp|P07313|KML2_RABIT|KML2_RABIT Myosin light chain kinase 2, skeletal/cardi...    62   4e-08   
sp|P29317|EPA2_HUMAN|EPA2_HUMAN Ephrin type-A receptor 2 precursor (EC 2.7....    62   4e-08   
sp|O43293|DAK3_HUMAN|DAK3_HUMAN Death-associated protein kinase 3 (EC 2.7.1...    62   4e-08   
gb:BC070022_2555499 Danio rerio zgc:66101, mRNA (cDNA clone MGC:...    61   5e-08   
gb:BC056316_2551756 Danio rerio zgc:66101, mRNA (cDNA clone MGC:...    61   5e-08   
gb:MMDAPK_2114700 M.musculus mRNA for death associated protein k...    61   5e-08   
gb:BC057317_2102698 Mus musculus death associated protein kinase...    61   5e-08   
gb:BC055331_2101988 Mus musculus ribosomal protein S6 kinase, po...    61   5e-08   
gb:AY245541_2080557 Mus musculus death-associated protein kinase...    61   5e-08   
gb:AY245540_2080556 Mus musculus death-associated protein kinase...    61   5e-08   
gb:AL645808_2071912 Mouse DNA sequence from clone RP23-427P14 on...    61   5e-08   
gb:AK173292_2070226 Mus musculus mRNA for mKIAA1901 protein.           61   5e-08   
gb:AF117384_2055097 Mus musculus calcium/calmodulin dependent pr...    61   5e-08   
gb:AF491997_1804885 Pisum sativum SYM19 mRNA, complete cds.            61   5e-08   
gb:SPWIS4GEN_1722341 S.pombe wis4+ gene.                               61   5e-08   
gb:SPWAK1_1722337 S.pombe wak1 gene.                                   61   5e-08   
gb:PSA418375_1701990 Pisum sativum mRNA for nodulation receptor ...    61   5e-08   
gb:AY271356_1428156 Sus scrofa oxidative-stress responsive 1 mRN...    61   5e-08   
gb:AF498649_1277186 Entamoeba histolytica small heat shock prote...    61   5e-08   
gb:AK050312_1169230 Mus musculus adult male liver tumor cDNA, RI...    61   5e-08   
gb:AK034754_1163867 Mus musculus 12 days embryo embryonic body b...    61   5e-08   
gb:AK031330_1162393 Mus musculus 13 days embryo male testis cDNA...    61   5e-08   
gb:AK019881_1160231 Mus musculus 11 days pregnant adult female o...    61   5e-08   
gb:AP006618_561067 Nocardia farcinica IFM 10152 DNA, complete ge...    61   5e-08   
gb:AE016746_322545 Staphylococcus epidermidis ATCC 12228, sectio...    61   5e-08   
gb:SCO939121_178451 Streptomyces coelicolor A3(2) complete genom...    61   5e-08   
pir|S51603|S51603 receptor-like tyrosine kinase Ehk-1 - rat            61   5e-08   
pir|S51604|S51604 receptor-like tyrosine kinase Ehk-1 - rat            61   5e-08   
sp|O14299|WIS4_SCHPO|WIS4_SCHPO MAP kinase kinase kinase wis4 (EC 2.7.1.-) ...    61   5e-08   
sp|P51954|NEK1_MOUSE|NEK1_MOUSE Serine/threonine-protein kinase Nek1 (EC 2....    61   5e-08   
sp|Q9WUT3|K6A2_MOUSE|K6A2_MOUSE Ribosomal protein S6 kinase alpha 2 (EC 2.7...    61   5e-08   
sp|P54757|EPA5_RAT|EPA5_RAT Ephrin type-A receptor 5 precursor (EC 2.7.1....    61   5e-08   
sp|Q80YE7|DAK1_MOUSE|DAK1_MOUSE Death-associated protein kinase 1 (EC 2.7.1...    61   5e-08   
gb:AF100165_2473636 Xenopus laevis polo-like kinase kinase 1 (xP...    61   7e-08   
gb:MMSEK2_2117320 M.musculus Sek-2 mRNA.                               61   7e-08   
gb:CR382127_1659777 Yarrowia lipolytica chromosome A of strain C...    61   7e-08   
gb:BX842628_1643892 Neurospora crassa DNA linkage group I BAC cl...    61   7e-08   
gb:AY053387_1290845 Ancylostoma caninum serine-threonine protein...    61   7e-08   
pir|I48759|I48759 protein-tyrosine kinase (EC 2.7.1.112) sek-2 -...    61   7e-08   
pir|T20232|T20232 hypothetical protein C54G4.1 - Caenorhabditis ...    61   7e-08   
gb:AF512506_2498734 Morone saxatilis class IIIB myosin short iso...    60   9e-08   
gb:BT007780_2150712 Synthetic construct Homo sapiens death-assoc...    60   9e-08   
gb:HSDAPK_2011832 H.sapiens DAP-kinase mRNA.                           60   9e-08   
gb:BT006935_1990373 Homo sapiens death-associated protein kinase...    60   9e-08   
gb:AL160279_1921864 Human DNA sequence from clone RP11-65B23 on ...    60   9e-08   
gb:AE016817_1747216 Ashbya gossypii (= Eremothecium gossypii) AT...    60   9e-08   
gb:NTCCAMK2_1691506 Nicotiana tabacum calcium/calmodulin-depende...    60   9e-08   
gb:CR380957_1652606 Candida glabrata strain CBS138 chromosome K ...    60   9e-08   
gb:AX239867_1464570 Sequence 7 from Patent WO0164905.>gb:AF32554...    60   9e-08   
gb:CEF49C5_1364163 Caenorhabditis elegans cosmid F49C5, complete...    60   9e-08   
gb:CR749834_1181292 Homo sapiens mRNA; cDNA DKFZp781I035 (from c...    60   9e-08   
gb:BX294136_766120 Pirellula sp. strain 1 complete genome; segme...    60   9e-08   
pir|T22427|T22427 hypothetical protein F49C5.4 - Caenorhabditis ...    60   9e-08   
sp|Q9XBQ0|PKN3_MYXXA|PKN3_MYXXA Serine/threonine-protein kinase pkn3 (EC 2....    60   9e-08   
sp|Q9H1R3|KML2_HUMAN|KML2_HUMAN Myosin light chain kinase 2, skeletal/cardi...    60   9e-08   
sp|P53355|DAK1_HUMAN|DAK1_HUMAN Death-associated protein kinase 1 (EC 2.7.1...    60   9e-08   
sp|Q7RAH3|CDP1_PLAYO|CDP1_PLAYO Calcium-dependent protein kinase 1 (EC 2.7....    60   9e-08   
sp|P54665|CC22_TRYBB|CC22_TRYBB Cell division control protein 2 homolog 2 (...    60   9e-08   
gb:BC089174_2566096 Xenopus laevis ephrin receptor EphA2 (tyrosi...    60   1e-07   
gb:BC068849_2555347 Xenopus laevis cDNA clone MGC:81509 IMAGE:66...    60   1e-07   
gb:H010868S18_1996021 Homo sapiens Ca2+/calmodulin-dependent pro...    60   1e-07   
gb:H010868S17_1996020 Homo sapiens Ca2+/calmodulin-dependent pro...    60   1e-07   
gb:AF321387_1896651 Homo sapiens CaMKK beta 1 isoform mRNA, comp...    60   1e-07   
gb:AF287631_1895058 Homo sapiens calcium/calmodulin-dependent pr...    60   1e-07   
gb:AF287630_1895057 Homo sapiens calcium/calmodulin-dependent pr...    60   1e-07   
gb:AB081336_1871784 Homo sapiens Camkk beta-3 mRNA for Ca2+/calm...    60   1e-07   
gb:AB018330_1864973 Homo sapiens mRNA for KIAA0787 protein, part...    60   1e-07   
gb:AP004332_1840332 Oryza sativa (japonica cultivar-group) genom...    60   1e-07   
gb:CR382137_1670066 Debaryomyces hansenii chromosome E of strain...    60   1e-07   
gb:CR548612_1375386 Paramecium tetraurelia macronuclear largest ...    60   1e-07   
gb:CEU44902_1368548 Caenorhabditis elegans serine/threonine kina...    60   1e-07   
gb:AC116982_1207200 Dictyostelium discoideum chromosome 2 map 36...    60   1e-07   
gb:AC024770_1204484 Caenorhabditis elegans cosmid Y39H10A, compl...    60   1e-07   
gb:AF551762_1188194 Mus musculus strain 129/SvJ chromosome 17 cl...    60   1e-07   
gb:AP008231_580123 Synechococcus elongatus PCC 6301 DNA, complet...    60   1e-07   
gb:AP006618_558821 Nocardia farcinica IFM 10152 DNA, complete ge...    60   1e-07   
gb:AP006618_557249 Nocardia farcinica IFM 10152 DNA, complete ge...    60   1e-07   
pir|JC5669|JC5669 Ca2+/calmodulin-dependent protein kinase kinas...    60   1e-07   
pir|JE0191|JE0191 calcium/calmodulin-dependent protein kinase ki...    60   1e-07   
sp|Q8C050|K6A5_MOUSE|K6A5_MOUSE Ribosomal protein S6 kinase alpha 5 (EC 2.7...    60   1e-07   
sp|O35280|CHK1_MOUSE|CHK1_MOUSE Serine/threonine-protein kinase Chk1 (EC 2....    60   1e-07   
gb:AF165162_2477944 Xenopus laevis Rsk-2 (RSK2) mRNA, complete c...    60   1e-07   
gb:BC060645_2104112 Mus musculus oxidative-stress responsive 1, ...    60   1e-07   
gb:BC028587_1979282 Homo sapiens NIMA (never in mitosis gene a)-...    60   1e-07   
gb:AB071997_1871217 Homo sapiens nek11S mRNA for NIMA-related ki...    60   1e-07   
gb:AB071996_1871216 Homo sapiens nek11L mRNA for NIMA-related ki...    60   1e-07   
gb:AE017346_1757157 Cryptococcus neoformans var. neoformans JEC2...    60   1e-07   
gb:CR380959_1653810 Candida glabrata strain CBS138 chromosome M ...    60   1e-07   
gb:CAC38F10_1644790 C.albicans cosmid Ca38F10.                         60   1e-07   
gb:AY206665_1589527 Emericella nidulans polo-like kinase (plkA) ...    60   1e-07   
gb:AY144182_1583508 Glycine max phosphoenolpyruvate carboxylase ...    60   1e-07   
gb:AY143660_1583249 Glycine max phosphoenolpyruvate carboxylase ...    60   1e-07   
gb:AY062754_1565410 Arabidopsis thaliana Unknown protein (T12C24...    60   1e-07   
gb:AF023484_1233748 Drosophila melanogaster putative KP78 protei...    60   1e-07   
gb:HSM804785_1187262 Homo sapiens mRNA; cDNA DKFZp686L0617 (from...    60   1e-07   
gb:AK048694_1168472 Mus musculus 0 day neonate cerebellum cDNA, ...    60   1e-07   
gb:AE014297_1139073 Drosophila melanogaster chromosome 3R, compl...    60   1e-07   
gb:AE014297_1139072 Drosophila melanogaster chromosome 3R, compl...    60   1e-07   
gb:AE013599_1132684 Drosophila melanogaster chromosome 2R, compl...    60   1e-07   
pir|D86260|D86260 protein T12C24.22 [imported] - Arabidopsis tha...    60   1e-07   
pir|I48974|I48974 receptor-protein tyrosine kinase - mouse>gb:MM...    60   1e-07   
pir|I37275|I37275 death-associated protein kinase (EC 2.7.1.-) -...    60   1e-07   
gb:AL772356_2504520 Zebrafish DNA sequence from clone BUSM1-258D...    59   2e-07   
gb:AB009568_2460527 Oryzias latipes mRNA for OlGRK-C, complete cds.    59   2e-07   
gb:AF132482_2055810 Mus musculus strain C57BL/6J cyclin-dependen...    59   2e-07   
gb:AK098832_1915234 Homo sapiens cDNA FLJ25966 fis, clone TST05207.    59   2e-07   
gb:AP003250_1826285 Oryza sativa (japonica cultivar-group) genom...    59   2e-07   
gb:AF391151_1795227 Cryptococcus neoformans var. neoformans PAK1...    59   2e-07   
gb:SCPROKIN_1709201 S.cerevisiae gene for protein-kinase.              59   2e-07   
gb:PSA418367_1701989 Pisum sativum mRNA for nodulation receptor ...    59   2e-07   
gb:CR382138_1671066 Debaryomyces hansenii chromosome F of strain...    59   2e-07   
gb:CR382133_1666652 Debaryomyces hansenii chromosome A of strain...    59   2e-07   
gb:AY693219_1623266 Saccharomyces cerevisiae clone FLH113021.01X...    59   2e-07   
gb:AY187634_1588168 Lycopersicon esculentum phosphoenolpyruvate ...    59   2e-07   
gb:AY144184_1583510 Glycine max phosphoenolpyruvate carboxylase ...    59   2e-07   
gb:AY034100_1559581 Arabidopsis thaliana CBL-interacting protein...    59   2e-07   
gb:AB011482_1511487 Arabidopsis thaliana genomic DNA, chromosome...    59   2e-07   
gb:AX803373_1475524 Sequence 35 from Patent WO03000901.                59   2e-07   
gb:U28929_1402593 Caenorhabditis elegans cosmid F09C12, complete...    59   2e-07   
gb:AC117081_1207946 Dictyostelium discoideum chromosome 2 map 58...    59   2e-07   
gb:AK044660_1167069 Mus musculus adult retina cDNA, RIKEN full-l...    59   2e-07   
gb:AK011258_1156288 Mus musculus 10 days embryo whole body cDNA,...    59   2e-07   
gb:AE014297_1138984 Drosophila melanogaster chromosome 3R, compl...    59   2e-07   
gb:CP000023_875286 Streptococcus thermophilus LMG 18311, complet...    59   2e-07   
pir|S68463|S68463 protein kinase ATPK19 (EC 2.7.1.-) - Arabidops...    59   2e-07   
pir|AD1674|AD1674 probable serine/threonine-specific protein kin...    59   2e-07   
pir|T27522|T27522 hypothetical protein ZC373.4 - Caenorhabditis ...    59   2e-07   
pir|T50259|T50259 probable serine/threonine protein kinase [impo...    59   2e-07   
pir|T15983|T15983 hypothetical protein F09C12.2 - Caenorhabditis...    59   2e-07   
pir|S58882|S58882 protein kinase Cds1 (EC 2.7.1.-) [validated] -...    59   2e-07   
sp|Q12469|SKM1_YEAST|SKM1_YEAST Serine/threonine-protein kinase SKM1 (EC 2....    59   2e-07   
gb:BC073108_2557013 Xenopus laevis MGC83604 protein, mRNA (cDNA ...    59   3e-07   
gb:AB018002_2044049 Mus musculus mRNA for Death-associated prote...    59   3e-07   
gb:AB064997_1869657 Macaca fascicularis mRNA, similar to human h...    59   3e-07   
gb:AP003629_1831742 Oryza sativa (japonica cultivar-group) genom...    59   3e-07   
gb:AF491998_1804886 Medicago truncatula SYMRK mRNA, complete cds.      59   3e-07   
gb:MTR418371_1687643 Medicago truncatula mRNA for nodulation rec...    59   3e-07   
gb:MTR418369_1687641 Medicago truncatula mRNA for nodulation rec...    59   3e-07   
gb:MSA418368_1687040 Medicago sativa mRNA for nodulation recepto...    59   3e-07   
gb:MAL428991_1685575 Melilotus albus mRNA for nodulation recepto...    59   3e-07   
gb:AY439096_1606298 Glycine max cyclin-dependent kinases CDKB mR...    59   3e-07   
gb:AY091096_1574321 Arabidopsis thaliana unknown protein (At4g24...    59   3e-07   
gb:AY056151_1563482 Arabidopsis thaliana unknown protein (At2g40...    59   3e-07   
gb:AY054686_1563340 Arabidopsis thaliana SNF1 related protein ki...    59   3e-07   
gb:ATAC002343_1542774 Arabidopsis thaliana chromosome IV BAC T19...    59   3e-07   
gb:U58749_1405308 Caenorhabditis elegans cosmid B0496, complete ...    59   3e-07   
gb:U58749_1405307 Caenorhabditis elegans cosmid B0496, complete ...    59   3e-07   
gb:LMCRK3_1387674 Leishmania mexicana crk3 gene.                       59   3e-07   
gb:AY069806_1294536 Drosophila melanogaster SD04681 full length ...    59   3e-07   
gb:AY060835_1292640 Drosophila melanogaster GM01879 full length ...    59   3e-07   
gb:AF419336_1269469 Leishmania donovani cdk-related kinase CRK m...    59   3e-07   
gb:AF073381_1238891 Leishmania major cdc2-related kinase (CRK3) ...    59   3e-07   
gb:AE014296_1137370 Drosophila melanogaster chromosome 3L, compl...    59   3e-07   
gb:AE014296_1137369 Drosophila melanogaster chromosome 3L, compl...    59   3e-07   
pir|T13824|T13824 LK6 protein kinase - fruit fly (Drosophila mel...    59   3e-07   
pir|T29253|T29253 hypothetical protein B0496.3 - Caenorhabditis ...    59   3e-07   
pir|S47489|S47489 receptor tyrosine kinase - rat>gb:RNEHK1_21347...    59   3e-07   
pir|S54788|S54788 calcium-stimulated protein kinase - Chlamydomo...    59   3e-07   


>gb:AJ870305_1815093 Cucumis sativus mRNA for putative
            serine-threonine protein kinase (se4a11 gene).
          Length = 344

 Score =  592 bits (1527), Expect = e-168
 Identities = 289/346 (83%), Positives = 318/346 (91%), Gaps = 3/346 (0%)
 Frame = +1

Query: 154  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP---GV 324
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFA+V+LVKE+++D + P   G+
Sbjct: 1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAFVFLVKEVVSDSSSPSGGGL 60

Query: 325  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA 504
            +KK KDPS  S +GTYA+KKVLIQ+SEQL+LV+EEIR+SSLFSHPNLLPLLDHA+IAVK+
Sbjct: 61   AKKLKDPSRLSGDGTYALKKVLIQSSEQLELVREEIRISSLFSHPNLLPLLDHAIIAVKS 120

Query: 505  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP 684
            SEG S KHEAYLLFPVH+DGTLLDNA  MKAKKE FST DVL+IFRQLCAGLKHMH+ EP
Sbjct: 121  SEG-SVKHEAYLLFPVHLDGTLLDNAQTMKAKKEFFSTLDVLEIFRQLCAGLKHMHSNEP 179

Query: 685  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPF 864
             YAHNDVKPGNVLLTHRKG  PLAILMDFGS RPARK+IRSRSEALQLQEWASEH SAPF
Sbjct: 180  PYAHNDVKPGNVLLTHRKGMSPLAILMDFGSTRPARKEIRSRSEALQLQEWASEHCSAPF 239

Query: 865  RAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWP 1044
            RAPELWDCPSHADIDERTDIWSLGCTLYAIMYG++PFEYALGESGGSLQLAIVNAQ+KWP
Sbjct: 240  RAPELWDCPSHADIDERTDIWSLGCTLYAIMYGLTPFEYALGESGGSLQLAIVNAQIKWP 299

Query: 1045 TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFSH 1182
             G  +P YP+ALHQF+ WMLQPQA VRP IDDIVIHVDKLI+KFS+
Sbjct: 300  AG-PNPPYPDALHQFIKWMLQPQAAVRPQIDDIVIHVDKLIAKFSN 344



>pir|T50501|T50501 serine/threonine protein kinase - Arabidopsis
            thaliana>gb:ATT22D6_1555227 Arabidopsis thaliana DNA
            chromosome 5, BAC clone T22D6 (ESSA
            project).>gb:ATU97568_1557434 Arabidopsis thaliana
            serine/threonine protein kinase mRNA, complete
            cds.>gb:AF083801_1767031 Arabidopsis thaliana clone
            sps916-2 unknown mRNA.>gb:AF325057_1786511 Arabidopsis
            thaliana AT5g08160 (AT5g08160/T22D6_100) mRNA, complete
            cds.
          Length = 347

 Score =  592 bits (1526), Expect = e-168
 Identities = 286/346 (82%), Positives = 312/346 (90%), Gaps = 4/346 (1%)
 Frame = +1

Query: 154  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP----G 321
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFA+V+LVKEI+AD +      G
Sbjct: 1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAFVFLVKEIVADASSAASGGG 60

Query: 322  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK 501
            ++KK KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK
Sbjct: 61   LAKKVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVK 120

Query: 502  ASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFE 681
              +  +WKHEA+LLFPVH+DGTLLDN T MKAKKE+FST+DVL IFRQLC GLKHMH+ E
Sbjct: 121  DGQEGAWKHEAFLLFPVHLDGTLLDNFTLMKAKKETFSTTDVLHIFRQLCDGLKHMHSLE 180

Query: 682  PSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAP 861
            P YAHNDVKPGNVLLT RKGQPPLAILMDFGSARP+RKQIRSR EALQLQEW SEH SAP
Sbjct: 181  PPYAHNDVKPGNVLLTRRKGQPPLAILMDFGSARPSRKQIRSRQEALQLQEWTSEHCSAP 240

Query: 862  FRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKW 1041
            FRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQ+KW
Sbjct: 241  FRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQIKW 300

Query: 1042 PTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS 1179
            P       YPEALHQFVTWMLQPQA VRP IDDI+IHVDKLI+KF+
Sbjct: 301  PNTGPKASYPEALHQFVTWMLQPQAAVRPRIDDIIIHVDKLIAKFT 346



>gb:AY088294_1573314 Arabidopsis thaliana clone 5323 mRNA, complete
            sequence.
          Length = 347

 Score =  590 bits (1521), Expect = e-167
 Identities = 285/346 (82%), Positives = 312/346 (90%), Gaps = 4/346 (1%)
 Frame = +1

Query: 154  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP----G 321
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFA+V+LVKEI+AD +      G
Sbjct: 1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAFVFLVKEIVADASSAASGGG 60

Query: 322  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK 501
            ++KK KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK
Sbjct: 61   LAKKVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVK 120

Query: 502  ASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFE 681
              +  +WKHEA+LLFPVH+DGTLLDN T MKAKKE+FST+DVL IFRQLC GLKHMH+ E
Sbjct: 121  DGQEGAWKHEAFLLFPVHLDGTLLDNFTLMKAKKETFSTTDVLHIFRQLCDGLKHMHSLE 180

Query: 682  PSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAP 861
            P YAH+DVKPGNVLLT RKGQPPLAILMDFGSARP+RKQIRSR EALQLQEW SEH SAP
Sbjct: 181  PPYAHDDVKPGNVLLTRRKGQPPLAILMDFGSARPSRKQIRSRQEALQLQEWTSEHCSAP 240

Query: 862  FRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKW 1041
            FRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQ+KW
Sbjct: 241  FRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQIKW 300

Query: 1042 PTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS 1179
            P       YPEALHQFVTWMLQPQA VRP IDDI+IHVDKLI+KF+
Sbjct: 301  PNTGPKASYPEALHQFVTWMLQPQAAVRPRIDDIIIHVDKLIAKFT 346



>gb:AP005867_1859294 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, PAC clone:P0599F09.
          Length = 337

 Score =  538 bits (1387), Expect = e-152
 Identities = 259/342 (75%), Positives = 298/342 (87%)
 Frame = +1

Query: 154  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK 333
            MGCS SGLNALYDA  GGGDVWIN+ RFR++RQ+GEGGFA+VYLV+E  A       + +
Sbjct: 1    MGCSISGLNALYDAATGGGDVWINERRFRVLRQIGEGGFAFVYLVREHQASAD----AAR 56

Query: 334  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG 513
             + PS AS++GTYAMKKVLIQ+ EQLDLVKEEIRVSSLF+HPNLLPLLDHAVIAVK  +G
Sbjct: 57   GRSPSLASEDGTYAMKKVLIQSKEQLDLVKEEIRVSSLFNHPNLLPLLDHAVIAVKNQQG 116

Query: 514  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA 693
              W HEAYLLFPV++DGTL DNA  M+++KE +ST DVL+IF+QLC GLKHMH+F+P YA
Sbjct: 117  D-WNHEAYLLFPVYIDGTLFDNAKVMQSRKEFYSTIDVLRIFQQLCEGLKHMHSFDPPYA 175

Query: 694  HNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAP 873
            HNDVK GNVL+THRKGQ PLA LMDFGSARPARK+IRSR+EAL+LQEWA+EH SAP+RAP
Sbjct: 176  HNDVKTGNVLITHRKGQAPLATLMDFGSARPARKEIRSRAEALRLQEWAAEHCSAPYRAP 235

Query: 874  ELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGL 1053
            ELWDCPSHADIDERTDIWSLGCTLYAIMY VSPFEYALGESGGSLQLAIVN  +KWP G 
Sbjct: 236  ELWDCPSHADIDERTDIWSLGCTLYAIMYNVSPFEYALGESGGSLQLAIVNCTLKWPAGP 295

Query: 1054 SDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS 1179
            S P YP+ALHQF+TWMLQPQ  +RPHIDDI++HV+KL+ K+S
Sbjct: 296  S-PPYPDALHQFITWMLQPQPAMRPHIDDIILHVEKLMEKYS 336



>gb:AP005745_1857041 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC clone:OSJNBa0017O03.
          Length = 358

 Score =  464 bits (1195), Expect = e-129
 Identities = 237/358 (66%), Positives = 280/358 (78%), Gaps = 16/358 (4%)
 Frame = +1

Query: 154  MGCSFSGLNALYDAVNGGG-DVWINDNRFRIVRQLGEGGFA--YVYLVKEILADP----- 309
            MGCSFSGLNALYD V GGG D+W+ND RFR+VR+LG+ G A  +V+LVKE++A       
Sbjct: 1    MGCSFSGLNALYDTVGGGGGDIWVNDYRFRVVRRLGDAGPAGSFVFLVKEVVAAATASDG 60

Query: 310  ---AKPGVS----KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLL 468
               A PG S    KK  DPSH S +GTYA+KKVLIQN + L+ V++EIRVSS FSHPNLL
Sbjct: 61   TGGAVPGASGLAKKKGIDPSHISADGTYALKKVLIQNEQHLEQVRQEIRVSSQFSHPNLL 120

Query: 469  PLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQL 648
            PLL++A+IAVK  +  S  HEAYLLFPVH+DGTL D    M  KKE F T  +LQIFRQL
Sbjct: 121  PLLENAIIAVKGVQDGSQNHEAYLLFPVHLDGTLQDINKNMLEKKEYFPTISILQIFRQL 180

Query: 649  CAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQL 828
            CAGLKHMH+F+P Y+HN VKP NVL+T RK QP LAILMDF SARPAR  IRS+++A+QL
Sbjct: 181  CAGLKHMHSFDPPYSHNGVKPDNVLITQRKDQPHLAILMDFESARPARIAIRSQADAMQL 240

Query: 829  QEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGG-S 1005
            QEWASEH SA +RAPELW+CP+HADIDERTDIWSLGC LYA+MYG SPF+Y L E+ G S
Sbjct: 241  QEWASEHCSAHYRAPELWECPTHADIDERTDIWSLGCCLYAMMYGKSPFDYELDEAAGES 300

Query: 1006 LQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS 1179
            LQ    +AQ+KWPT  + P YP++L QFVTWMLQP   VRPHIDDI+IHVDKLI+K+S
Sbjct: 301  LQSVTKSAQIKWPTE-AGPSYPDSLRQFVTWMLQPHPAVRPHIDDIIIHVDKLIAKYS 357



>gb:BC074528_2558023 Xenopus tropicalis MGC69350 protein, mRNA (cDNA
            clone MGC:69350 IMAGE:5309199), complete cds.
          Length = 305

 Score =  183 bits (464), Expect = 9e-45
 Identities = 107/319 (33%), Positives = 172/319 (53%)
 Frame = +1

Query: 208  GDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKV 387
            G + I + R+  V +LGEGGF+YV LV+ +                    D   YA+K++
Sbjct: 11   GSITIENKRYFFVHKLGEGGFSYVDLVEGV-------------------QDGRFYALKRI 51

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
            L  + E     + E+ +  LF+HPN+LPL+ H++I     +G  W  EA+LL P    GT
Sbjct: 52   LCHDREDRKEAQHEVEMHRLFNHPNVLPLVAHSII----EKGPKW--EAWLLLPFVKGGT 105

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            L +    ++ +    S   ++ I   +C GLK +H  +  YAH D+KP NVLL       
Sbjct: 106  LWNQVEVLRDRNSFLSEDRIVHILHGICLGLKAIH--DRGYAHRDLKPTNVLLE----DD 159

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
               +LMD GS   AR +++   +A+ +Q+WA++  +  +RAPEL++  S   IDERTDIW
Sbjct: 160  DRPLLMDLGSMNQARMEVKDSRQAMAVQDWAAQRCTISYRAPELFNVSSDCVIDERTDIW 219

Query: 928  SLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQ 1107
            SLGC L+++M+G  P++  + + G S+ LA+ N  +  P   ++ +Y + L   +  M+ 
Sbjct: 220  SLGCVLFSMMFGEGPYD-MIFQKGDSVALAVQN-NITVP---ANERYSQGLQTLLCSMMV 274

Query: 1108 PQATVRPHIDDIVIHVDKL 1164
              +  RP I  I+ HV+ L
Sbjct: 275  VNSQERPFISTIISHVEAL 293



>gb:BC082377_2562614 Xenopus laevis MGC81705 protein, mRNA (cDNA clone
            MGC:81705 IMAGE:6864956), complete cds.
          Length = 305

 Score =  180 bits (457), Expect = 6e-44
 Identities = 108/319 (33%), Positives = 169/319 (52%)
 Frame = +1

Query: 208  GDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKV 387
            G + I + R+  V++LGEGGF+YV LV+ +                    D   YA+K++
Sbjct: 11   GSITIENKRYFFVQKLGEGGFSYVDLVEGV-------------------HDGRFYALKRI 51

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
            L  + E     + E+ +  LF+HPN+L L+ H +I     +G  W  EA+LL P    GT
Sbjct: 52   LCHDREDRKEAQHEVEMHRLFNHPNILSLVAHCII----EKGPKW--EAWLLLPFVKGGT 105

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            L +    ++ K        ++ I  ++C GLK +H  +  YAH D+KP NVLL       
Sbjct: 106  LWNQVETLRDKNNFLPEDRIVHILHRICLGLKAIH--DRGYAHRDLKPTNVLLE----DD 159

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
               +LMD GS   AR +++   +A+ +Q+WAS+  +  +RAPEL+   S   IDERTDIW
Sbjct: 160  DRPLLMDLGSMNQARIEVKDSRQAMAVQDWASQRCTISYRAPELFHVRSDCVIDERTDIW 219

Query: 928  SLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQ 1107
            SLGC LY++M+G  P++  + + G S+ LA+ N  +  P   ++ +Y + L   +  M+ 
Sbjct: 220  SLGCVLYSMMFGEGPYD-MIFQKGDSVALAVQN-NISVP---ANERYSQGLQSLLCSMMV 274

Query: 1108 PQATVRPHIDDIVIHVDKL 1164
                 RP I  I+ HV+ L
Sbjct: 275  VNHQERPFISTIINHVEAL 293



>gb:BT019585_1991140 Homo sapiens serine/threonine kinase 16 mRNA,
            complete cds.
          Length = 310

 Score =  180 bits (457), Expect = 6e-44
 Identities = 110/319 (34%), Positives = 170/319 (53%)
 Frame = +1

Query: 208  GDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKV 387
            G V I++ R+  +++LGEGGF+YV LV+ +                    D   YA+K++
Sbjct: 11   GTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFYALKRI 51

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
            L    + L+  + E  +  LF+HPN+L L+ + +        +  KHEA+LL P    GT
Sbjct: 52   LCHEQQDLEEAQREADMHRLFNHPNILRLVAYCL------RERGAKHEAWLLLPFFKRGT 105

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            L +    +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL   +GQP
Sbjct: 106  LWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD-EGQP 162

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
               +LMD GS   A   +    +AL LQ+WA++  +  +RAPEL+   SH  IDERTD+W
Sbjct: 163  ---VLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISYRAPELFSVQSHCVIDERTDVW 219

Query: 928  SLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQ 1107
            SLGC LYA+M+G  P++    + G S+ LA+ N Q+  P     P++  AL Q +  M+ 
Sbjct: 220  SLGCVLYAMMFGEGPYDMVF-QKGDSVALAVQN-QLSIP---QSPRHSSALRQLLNSMMT 274

Query: 1108 PQATVRPHIDDIVIHVDKL 1164
                 RPHI  ++  ++ L
Sbjct: 275  VDPHQRPHIPLLLSQLEAL 293



>gb:D86220_2112480 Rattus norvegicus mRNA for F52, complete cds.
          Length = 305

 Score =  179 bits (453), Expect = 2e-43
 Identities = 109/319 (34%), Positives = 170/319 (53%)
 Frame = +1

Query: 208  GDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKV 387
            G V I++ R+  V++LGEGGF+YV LV+ +                    D   YA+K++
Sbjct: 11   GTVIIDNKRYLFVQKLGEGGFSYVDLVEGL-------------------HDGHFYALKRI 51

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
            L    +  +  + E  +  LF HPN+L L+ +++      + +  KHEA+LL P    GT
Sbjct: 52   LCHEQQDQEEAQREADMHRLFQHPNILRLMAYSL------KERGAKHEAWLLLPFFKRGT 105

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            L +    +K +    +   +L +   +C GL+ +H     YAH D+KP N+LL   +GQP
Sbjct: 106  LWNEIERLKDQGNFLTEDQILPLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD-EGQP 162

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
               +LMD GS   A  Q+    +AL LQ+WA++  +  +RAPEL+   SH  IDERTD+W
Sbjct: 163  ---VLMDLGSMNQACIQVEGSRQALALQDWAAQRCTISYRAPELFSVQSHCVIDERTDVW 219

Query: 928  SLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQ 1107
            SLGC LYA+M+G  P++    + G S+ LA+ N  +  P     P++  AL Q +  M+ 
Sbjct: 220  SLGCVLYAMMFGEGPYDMVF-QKGDSVALAVQN-DLSIP---QSPRHSSALRQLLASMMT 274

Query: 1108 PQATVRPHIDDIVIHVDKL 1164
                 RPHI  ++  ++ L
Sbjct: 275  VDPQQRPHIPVLLSQLEAL 293



>sp|P57760|STKG_RAT Serine/threonine-protein kinase 16 (EC 2.7.1.37)
            (Protein kinase PKL12) (Myristoylated and palmitoylated
            serine/threonine kinase) (MPSK) (TGF-beta stimulated
            factor 1) (TSF-1).
          Length = 304

 Score =  179 bits (453), Expect = 2e-43
 Identities = 109/319 (34%), Positives = 170/319 (53%)
 Frame = +1

Query: 208  GDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKV 387
            G V I++ R+  V++LGEGGF+YV LV+ +                    D   YA+K++
Sbjct: 10   GTVIIDNKRYLFVQKLGEGGFSYVDLVEGL-------------------HDGHFYALKRI 50

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
            L    +  +  + E  +  LF HPN+L L+ +++      + +  KHEA+LL P    GT
Sbjct: 51   LCHEQQDQEEAQREADMHRLFQHPNILRLMAYSL------KERGAKHEAWLLLPFFKRGT 104

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            L +    +K +    +   +L +   +C GL+ +H     YAH D+KP N+LL   +GQP
Sbjct: 105  LWNEIERLKDQGNFLTEDQILPLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD-EGQP 161

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
               +LMD GS   A  Q+    +AL LQ+WA++  +  +RAPEL+   SH  IDERTD+W
Sbjct: 162  ---VLMDLGSMNQACIQVEGSRQALALQDWAAQRCTISYRAPELFSVQSHCVIDERTDVW 218

Query: 928  SLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQ 1107
            SLGC LYA+M+G  P++    + G S+ LA+ N  +  P     P++  AL Q +  M+ 
Sbjct: 219  SLGCVLYAMMFGEGPYDMVF-QKGDSVALAVQN-DLSIP---QSPRHSSALRQLLASMMT 273

Query: 1108 PQATVRPHIDDIVIHVDKL 1164
                 RPHI  ++  ++ L
Sbjct: 274  VDPQQRPHIPVLLSQLEAL 292



>gb:AB020739_1865325 Homo sapiens mRNA for F5-2, complete
            cds.>gb:AF203910_1889882 Homo sapiens serine/threonine
            kinase KRCT mRNA, complete cds.>gb:BC053998_1985127 Homo
            sapiens serine/threonine kinase 16, mRNA (cDNA clone
            MGC:61516 IMAGE:5760866), complete cds.
          Length = 305

 Score =  178 bits (451), Expect = 3e-43
 Identities = 109/319 (34%), Positives = 169/319 (52%)
 Frame = +1

Query: 208  GDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKV 387
            G V I++ R+  +++LGEGGF+YV LV+ +                    D   YA+K++
Sbjct: 11   GTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFYALKRI 51

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
            L    +  +  + E  +  LF+HPN+L L+ + +        +  KHEA+LL P    GT
Sbjct: 52   LCHEQQDREEAQREADMHRLFNHPNILRLVAYCL------RERGAKHEAWLLLPFFKRGT 105

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            L +    +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL   +GQP
Sbjct: 106  LWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD-EGQP 162

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
               +LMD GS   A   +    +AL LQ+WA++  +  +RAPEL+   SH  IDERTD+W
Sbjct: 163  ---VLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISYRAPELFSVQSHCVIDERTDVW 219

Query: 928  SLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQ 1107
            SLGC LYA+M+G  P++    + G S+ LA+ N Q+  P     P++  AL Q +  M+ 
Sbjct: 220  SLGCVLYAMMFGEGPYDMVF-QKGDSVALAVQN-QLSIP---QSPRHSSALRQLLNSMMT 274

Query: 1108 PQATVRPHIDDIVIHVDKL 1164
                 RPHI  ++  ++ L
Sbjct: 275  VDPHQRPHIPLLLSQLEAL 293



>sp|O75716|STKG_HUMAN Serine/threonine-protein kinase 16 (EC 2.7.1.37)
            (Protein kinase PKL12) (Myristoylated and palmitoylated
            serine/threonine kinase) (MPSK) (TGF-beta stimulated
            factor 1) (TSF-1) (hPSK).
          Length = 304

 Score =  178 bits (451), Expect = 3e-43
 Identities = 109/319 (34%), Positives = 169/319 (52%)
 Frame = +1

Query: 208  GDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKV 387
            G V I++ R+  +++LGEGGF+YV LV+ +                    D   YA+K++
Sbjct: 10   GTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFYALKRI 50

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
            L    +  +  + E  +  LF+HPN+L L+ + +        +  KHEA+LL P    GT
Sbjct: 51   LCHEQQDREEAQREADMHRLFNHPNILRLVAYCL------RERGAKHEAWLLLPFFKRGT 104

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            L +    +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL   +GQP
Sbjct: 105  LWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD-EGQP 161

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
               +LMD GS   A   +    +AL LQ+WA++  +  +RAPEL+   SH  IDERTD+W
Sbjct: 162  ---VLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISYRAPELFSVQSHCVIDERTDVW 218

Query: 928  SLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQ 1107
            SLGC LYA+M+G  P++    + G S+ LA+ N Q+  P     P++  AL Q +  M+ 
Sbjct: 219  SLGCVLYAMMFGEGPYDMVF-QKGDSVALAVQN-QLSIP---QSPRHSSALRQLLNSMMT 273

Query: 1108 PQATVRPHIDDIVIHVDKL 1164
                 RPHI  ++  ++ L
Sbjct: 274  VDPHQRPHIPLLLSQLEAL 292



>gb:AY335661_2144879 Synthetic construct Homo sapiens serine/threonine
            kinase 16 (STK16) mRNA, partial cds.
          Length = 306

 Score =  177 bits (449), Expect = 5e-43
 Identities = 109/319 (34%), Positives = 169/319 (52%)
 Frame = +1

Query: 208  GDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKV 387
            G V I++ R+  +++LGEGGF+YV LV+ +                    D   YA+K++
Sbjct: 11   GTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFYALKRI 51

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
            L    +  +  + E  +  LF+HPN+L L+ + +        +  KHEA+LL P    GT
Sbjct: 52   LCHEQQDREEAQREADMHRLFNHPNILRLVAYCL------RERGAKHEAWLLLPFFKRGT 105

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            L +    +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL   +GQP
Sbjct: 106  LWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD-EGQP 162

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
               +LMD GS   A   +    +AL LQ+WA++  +  +RAPEL+   SH  IDERTD+W
Sbjct: 163  ---VLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISYRAPELFSVQSHCVIDERTDVW 219

Query: 928  SLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQ 1107
            SLGC LYA+M+G  P++    + G S+ LA+ N Q+  P     P++  AL Q +  M+ 
Sbjct: 220  SLGCVLYAMMFGEGPYDMVF-QKGDSVALAVQN-QLSIP---QSPRHSSALWQLLNSMMT 274

Query: 1108 PQATVRPHIDDIVIHVDKL 1164
                 RPHI  ++  ++ L
Sbjct: 275  VDPHQRPHIPLLLSQLEAL 293



>gb:AB017197_2043964 Mus musculus mRNA for EDPK, complete
            cds.>gb:AF089869_2054059 Mus musculus serine/threonine
            kinase 16 (Stk16) mRNA, complete cds.>gb:BC028999_2096427
            Mus musculus serine/threonine kinase 16, mRNA (cDNA clone
            MGC:31004 IMAGE:5250877), complete
            cds.>gb:MMAJ5790_2114088 Mus musculus mRNA for PKL12
            protein.
          Length = 305

 Score =  177 bits (449), Expect = 5e-43
 Identities = 108/319 (33%), Positives = 171/319 (53%)
 Frame = +1

Query: 208  GDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKV 387
            G V I++ R+  V++LGEGGF+YV LV+ +                    D   YA+K++
Sbjct: 11   GTVIIDNKRYLFVQKLGEGGFSYVDLVEGL-------------------HDGHFYALKRI 51

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
            L    +  +  + E  +  LF HPN+L L+ +++      + +  KHEA+LL P    GT
Sbjct: 52   LCHEQQDQEEAQREAEMHRLFQHPNILRLMAYSL------KERGAKHEAWLLLPFFKKGT 105

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            L +    +K +    +   +L +   +  GL+ +H     YAH D+KP N+LL   +GQP
Sbjct: 106  LWNEIERLKDQGSFLTEDQILPLLLGISRGLEAIH--AKGYAHRDLKPTNILLGD-EGQP 162

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
               +LMD GS   A  Q+    +AL LQ+WA++  +  +RAPEL+   SH  IDERTD+W
Sbjct: 163  ---VLMDLGSMNQACIQVEGSRQALALQDWAAQRCTISYRAPELFSVQSHCVIDERTDVW 219

Query: 928  SLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQ 1107
            SLGC LYA+M+G  P++    + G S+ LA+ N ++  P     P++  AL Q ++ M+ 
Sbjct: 220  SLGCVLYAMMFGEGPYDMVF-QKGDSVALAVQN-ELSIP---QSPRHSSALRQLLSSMMT 274

Query: 1108 PQATVRPHIDDIVIHVDKL 1164
                 RPHI  ++  ++ L
Sbjct: 275  VDPQQRPHIPVLLSQLEAL 293



>gb:BC002618_1968263 Homo sapiens serine/threonine kinase 16,
            transcript variant 2, mRNA (cDNA clone MGC:1953
            IMAGE:3143105), complete cds.>gb:CR407675_1992529 Homo
            sapiens full open reading frame cDNA clone RZPDo834C043D
            for gene STK16, serine/threonine kinase 16 complete cds,
            without stopcodon.
          Length = 305

 Score =  177 bits (449), Expect = 5e-43
 Identities = 109/319 (34%), Positives = 169/319 (52%)
 Frame = +1

Query: 208  GDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKV 387
            G V I++ R+  +++LGEGGF+YV LV+ +                    D   YA+K++
Sbjct: 11   GTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFYALKRI 51

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
            L    +  +  + E  +  LF+HPN+L L+ + +        +  KHEA+LL P    GT
Sbjct: 52   LCHEQQDREEAQREADMHRLFNHPNILRLVAYCL------RERGAKHEAWLLLPFFKRGT 105

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            L +    +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL   +GQP
Sbjct: 106  LWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD-EGQP 162

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
               +LMD GS   A   +    +AL LQ+WA++  +  +RAPEL+   SH  IDERTD+W
Sbjct: 163  ---VLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISYRAPELFSVQSHCVIDERTDVW 219

Query: 928  SLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQ 1107
            SLGC LYA+M+G  P++    + G S+ LA+ N Q+  P     P++  AL Q +  M+ 
Sbjct: 220  SLGCVLYAMMFGEGPYDMVF-QKGDSVALAVQN-QLSIP---QSPRHSSALWQLLNSMMT 274

Query: 1108 PQATVRPHIDDIVIHVDKL 1164
                 RPHI  ++  ++ L
Sbjct: 275  VDPHQRPHIPLLLSQLEAL 293



>sp|O88697|STKG_MOUSE Serine/threonine-protein kinase 16 (EC 2.7.1.37)
            (Protein kinase PKL12) (Myristoylated and palmitoylated
            serine/threonine kinase) (MPSK) (TGF-beta stimulated
            factor 1) (TSF-1) (Protein kinase Krct).
          Length = 304

 Score =  177 bits (449), Expect = 5e-43
 Identities = 108/319 (33%), Positives = 171/319 (53%)
 Frame = +1

Query: 208  GDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKV 387
            G V I++ R+  V++LGEGGF+YV LV+ +                    D   YA+K++
Sbjct: 10   GTVIIDNKRYLFVQKLGEGGFSYVDLVEGL-------------------HDGHFYALKRI 50

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
            L    +  +  + E  +  LF HPN+L L+ +++      + +  KHEA+LL P    GT
Sbjct: 51   LCHEQQDQEEAQREAEMHRLFQHPNILRLMAYSL------KERGAKHEAWLLLPFFKKGT 104

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            L +    +K +    +   +L +   +  GL+ +H     YAH D+KP N+LL   +GQP
Sbjct: 105  LWNEIERLKDQGSFLTEDQILPLLLGISRGLEAIH--AKGYAHRDLKPTNILLGD-EGQP 161

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
               +LMD GS   A  Q+    +AL LQ+WA++  +  +RAPEL+   SH  IDERTD+W
Sbjct: 162  ---VLMDLGSMNQACIQVEGSRQALALQDWAAQRCTISYRAPELFSVQSHCVIDERTDVW 218

Query: 928  SLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQ 1107
            SLGC LYA+M+G  P++    + G S+ LA+ N ++  P     P++  AL Q ++ M+ 
Sbjct: 219  SLGCVLYAMMFGEGPYDMVF-QKGDSVALAVQN-ELSIP---QSPRHSSALRQLLSSMMT 273

Query: 1108 PQATVRPHIDDIVIHVDKL 1164
                 RPHI  ++  ++ L
Sbjct: 274  VDPQQRPHIPVLLSQLEAL 292



>gb:AF060798_1879838 Homo sapiens myristilated and palmitylated
            serine-threonine kinase MPSK (MPSK1) mRNA, complete cds.
          Length = 305

 Score =  176 bits (447), Expect = 8e-43
 Identities = 108/319 (33%), Positives = 168/319 (52%)
 Frame = +1

Query: 208  GDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKV 387
            G V I++ R+  +++LGEGGF+YV LV+ +                    D   YA+K++
Sbjct: 11   GTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFYALKRI 51

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
            L    +  +  + E  +  LF+HPN+L L+ + +        +  KHEA+LL P    GT
Sbjct: 52   LCHEQQDREEAQREADMHRLFNHPNILRLVAYCL------RERGAKHEAWLLLPFFKRGT 105

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            L +    +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL   +GQP
Sbjct: 106  LWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD-EGQP 162

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
               +LMD GS   A   +    +AL LQ+WA++  +  +RAPEL+   SH  IDERTD+W
Sbjct: 163  ---VLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISYRAPELFSVQSHCVIDERTDVW 219

Query: 928  SLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQ 1107
            S GC LYA+M+G  P++    + G S+ LA+ N Q+  P     P++  AL Q +  M+ 
Sbjct: 220  SFGCVLYAMMFGEGPYDMVF-QKGDSVALAVQN-QLSIP---QSPRHSSALRQLLNSMMT 274

Query: 1108 PQATVRPHIDDIVIHVDKL 1164
                 RPHI  ++  ++ L
Sbjct: 275  VDPHQRPHIPLLLSQLEAL 293



>gb:AK032162_1162776 Mus musculus adult male olfactory brain cDNA,
            RIKEN full-length enriched library, clone:6430404J21
            product:serine/threonine kinase 16, full insert sequence.
          Length = 305

 Score =  176 bits (447), Expect = 8e-43
 Identities = 108/319 (33%), Positives = 171/319 (53%)
 Frame = +1

Query: 208  GDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKV 387
            G V I++ R+  V++LGEGGF+YV LV+ +                    D   YA+K++
Sbjct: 11   GTVIIDNKRYLFVQKLGEGGFSYVDLVEGL-------------------HDGHFYALKRI 51

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
            L    +  +  + E  +  LF HPN+L L+ +++      + +  KHEA+LL P    GT
Sbjct: 52   LCHEQQDQEEAQREAEMHRLFQHPNILRLMAYSL------KERGAKHEAWLLLPFFKKGT 105

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            L +    +K +    +   +L +   +  GL+ +H     YAH D+KP N+LL   +GQP
Sbjct: 106  LWNEIERLKDQGSFLTERQILPLLLGISRGLEAIH--AKGYAHRDLKPTNILLGD-EGQP 162

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
               +LMD GS   A  Q+    +AL LQ+WA++  +  +RAPEL+   SH  IDERTD+W
Sbjct: 163  ---VLMDLGSMNQACIQVERSRQALALQDWAAQRCTISYRAPELFSVQSHCVIDERTDVW 219

Query: 928  SLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQ 1107
            SLGC LYA+M+G  P++    + G S+ LA+ N ++  P     P++  AL Q ++ M+ 
Sbjct: 220  SLGCVLYAMMFGEGPYDMVF-QKGDSVALAVQN-ELSIP---QSPRHSSALRQLLSSMMT 274

Query: 1108 PQATVRPHIDDIVIHVDKL 1164
                 RPHI  ++  ++ L
Sbjct: 275  VDPQQRPHIPVLLSQLEAL 293



>gb:AK030404_1161990 Mus musculus adult male pituitary gland cDNA,
            RIKEN full-length enriched library, clone:5330407I02
            product:serine/threonine kinase 16, full insert sequence.
          Length = 305

 Score =  176 bits (445), Expect = 1e-42
 Identities = 107/319 (33%), Positives = 170/319 (53%)
 Frame = +1

Query: 208  GDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKV 387
            G V I++ R+  V++LGEGGF+YV LV+ +                    D   YA+K++
Sbjct: 11   GTVIIDNKRYLFVQKLGEGGFSYVDLVEGL-------------------HDGHFYALKRI 51

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
            L    +  +  + E  +  LF HPN+L L+ +++      + +  KHEA+LL P    GT
Sbjct: 52   LCHEQQDQEEAQREAEMHRLFQHPNILRLMAYSL------KERGAKHEAWLLLPFFKKGT 105

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            L +    +K +    +   +L +   +  GL+ +H     Y H D+KP N+LL   +GQP
Sbjct: 106  LWNEIERLKDQGSFLTEDQILPLLLGISRGLEAIH--AKGYTHRDLKPTNILLGD-EGQP 162

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
               +LMD GS   A  Q+    +AL LQ+WA++  +  +RAPEL+   SH  IDERTD+W
Sbjct: 163  ---VLMDLGSMNQACIQVEGSRQALALQDWAAQRCTISYRAPELFSVQSHCVIDERTDVW 219

Query: 928  SLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQ 1107
            SLGC LYA+M+G  P++    + G S+ LA+ N ++  P     P++  AL Q ++ M+ 
Sbjct: 220  SLGCVLYAMMFGEGPYDMVF-QKGDSVALAVQN-ELSIP---QSPRHSSALRQLLSSMMT 274

Query: 1108 PQATVRPHIDDIVIHVDKL 1164
                 RPHI  ++  ++ L
Sbjct: 275  VDPQQRPHIPVLLSQLEAL 293



>gb:HSAJ5791_2010410 Homo sapiens mRNA for PKL12 protein.
          Length = 310

 Score =  175 bits (444), Expect = 2e-42
 Identities = 108/319 (33%), Positives = 168/319 (52%)
 Frame = +1

Query: 208  GDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKV 387
            G V I++ R+  +++LGEGGF+YV LV+ +                    D   YA+K++
Sbjct: 11   GTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFYALKRI 51

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
            L    +  +  + E  +  LF+HPN+L L+ + +        +  KHEA+LL P    GT
Sbjct: 52   LCHEQQDREEAQREADMHRLFNHPNILRLVAYCL------RERGAKHEAWLLLPFFKRGT 105

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            L +    +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL   +GQP
Sbjct: 106  LWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD-EGQP 162

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
               +LMD GS   A   +    +AL LQ+WA++  +  +RAPEL+   SH  I ERTD+W
Sbjct: 163  ---VLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISYRAPELFSVQSHCVIGERTDVW 219

Query: 928  SLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQ 1107
            SLGC LYA+M+G  P++    + G S+ LA+ N Q+  P     P++  AL Q +  M+ 
Sbjct: 220  SLGCVLYAMMFGEGPYDMVF-QKGDSVALAVQN-QLSIP---QSPRHSSALRQLLNSMMT 274

Query: 1108 PQATVRPHIDDIVIHVDKL 1164
                 RPHI  ++  ++ L
Sbjct: 275  VDPHQRPHIPLLLSQLEAL 293



>gb:AF062076_2052907 Mus musculus palmitylated serine/threonine kinase
            (Psk) mRNA, complete cds.
          Length = 305

 Score =  175 bits (443), Expect = 2e-42
 Identities = 107/319 (33%), Positives = 170/319 (53%)
 Frame = +1

Query: 208  GDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKV 387
            G V I++ R+  V++LGEGGF+YV LV+ +                    D   YA+K++
Sbjct: 11   GTVIIDNKRYLFVQKLGEGGFSYVDLVEGL-------------------HDGHFYALKRI 51

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
            L    +  +  + E  +  LF HPN+L L+ +++      + +  KHEA+LL P    GT
Sbjct: 52   LCHEQQDQEEAQREAEMHRLFQHPNILRLMAYSL------KERGAKHEAWLLLPFFKKGT 105

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            L +    +K +    +   +L +   +  GL+ +H     YAH D+KP N+LL   +GQP
Sbjct: 106  LWNEIERLKDQGSFLTEDQILPLLLGISRGLEAIH--AKGYAHRDLKPTNILLGD-EGQP 162

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
               +LMD GS   A  Q+    +AL LQ+WA++  +  +RAPEL+   SH  IDERTD+W
Sbjct: 163  ---VLMDLGSMNQACIQVEGSRQALALQDWAAQRCTISYRAPELFSVQSHCVIDERTDVW 219

Query: 928  SLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQ 1107
            SLGC LYA+M+G  P++    + G S+ LA+ N ++  P     P++  AL   ++ M+ 
Sbjct: 220  SLGCVLYAMMFGEGPYDMVF-QKGDSVALAVQN-ELSIP---QSPRHSSALRHVLSSMMT 274

Query: 1108 PQATVRPHIDDIVIHVDKL 1164
                 RPHI  ++  ++ L
Sbjct: 275  VDPQQRPHIPVLLSQLEAL 293



>gb:AB022285_2044212 Mus musculus F5-2 gene, complete cds.
          Length = 305

 Score =  174 bits (441), Expect = 4e-42
 Identities = 106/319 (33%), Positives = 170/319 (53%)
 Frame = +1

Query: 208  GDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKV 387
            G V I++ R+  V+++G GGF+YV LV+ +                    D   YA+K++
Sbjct: 11   GTVIIDNKRYLFVQEIGGGGFSYVDLVEGL-------------------HDGHFYALKRI 51

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
            L    +  +  + E  +  LF HPN+L L+ +++      + +  KHEA+LL P    GT
Sbjct: 52   LCHEQQDQEEAQREAEMHRLFQHPNILRLMAYSL------KERGAKHEAWLLLPFFKKGT 105

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            L +    +K +    +   +L +   +  GL+ +H     YAH D+KP N+LL   +GQP
Sbjct: 106  LWNEIERLKDQGSFLTEDQILPLLLGISRGLEAIH--AKGYAHRDLKPTNILLGD-EGQP 162

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
               +LMD GS   A  Q+    +AL LQ+WA++  +  +RAPEL+   SH  IDERTD+W
Sbjct: 163  ---VLMDLGSMNQACIQVEGSRQALALQDWAAQRCTISYRAPELFSVQSHCVIDERTDVW 219

Query: 928  SLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQ 1107
            SLGC LYA+M+G  P++    + G S+ LA+ N ++  P     P++  AL Q ++ M+ 
Sbjct: 220  SLGCVLYAMMFGEGPYDMVF-QKGDSVALAVQN-ELSIP---QSPRHSSALRQLLSSMMT 274

Query: 1108 PQATVRPHIDDIVIHVDKL 1164
                 RPHI  ++  ++ L
Sbjct: 275  VDPQQRPHIPVLLSQLEAL 293



>gb:AB022179_2044208 Mus musculus mRNA for F5-2, complete cds.
          Length = 305

 Score =  174 bits (441), Expect = 4e-42
 Identities = 106/319 (33%), Positives = 170/319 (53%)
 Frame = +1

Query: 208  GDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKV 387
            G V I++ R+  V+++G GGF+YV LV+ +                    D   YA+K++
Sbjct: 11   GTVIIDNKRYLFVQEIGGGGFSYVDLVEGL-------------------HDGHFYALKRI 51

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
            L    +  +  + E  +  LF HPN+L L+ +++      + +  KHEA+LL P    GT
Sbjct: 52   LCHEQQDQEEAQREAEMHRLFQHPNILRLMAYSL------KERGAKHEAWLLLPFFKKGT 105

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            L +    +K +    +   +L +   +  GL+ +H     YAH D+KP N+LL   +GQP
Sbjct: 106  LWNEIERLKDQGSFLTEDQILPLLLGISRGLEAIH--AKGYAHRDLKPTNILLGD-EGQP 162

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
               +LMD GS   A  Q+    +AL LQ+WA++  +  +RAPEL+   SH  IDERTD+W
Sbjct: 163  ---VLMDLGSMNQACIQVEGSRQALALQDWAAQRCAISYRAPELFSVQSHCVIDERTDVW 219

Query: 928  SLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQ 1107
            SLGC LYA+M+G  P++    + G S+ LA+ N ++  P     P++  AL Q ++ M+ 
Sbjct: 220  SLGCVLYAMMFGEGPYDMVF-QKGDSVALAVQN-ELSIP---QSPRHSSALRQLLSSMMT 274

Query: 1108 PQATVRPHIDDIVIHVDKL 1164
                 RPHI  ++  ++ L
Sbjct: 275  VDPQQRPHIPVLLSQLEAL 293



>gb:HSAJ10872_2010192 Homo sapiens mRNA for serine/threonine kinase.
          Length = 305

 Score =  173 bits (438), Expect = 9e-42
 Identities = 107/319 (33%), Positives = 167/319 (52%)
 Frame = +1

Query: 208  GDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKV 387
            G V I++ R+  +++LGEGGF+YV LV+ +                    D   YA+K++
Sbjct: 11   GTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFYALKRI 51

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
            L    +  +  + E  +  LF+HPN+L L+ + +        +  KHEA+LL P    GT
Sbjct: 52   LCHEQQDREEAQREADMHRLFNHPNILRLVAYCL------RERGAKHEAWLLLPFFKRGT 105

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            L +    +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL   +GQP
Sbjct: 106  LWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD-EGQP 162

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
               +LMD GS   A   +    +AL LQ+WA++  +  +RAPEL+   SH  I ERTD+W
Sbjct: 163  ---VLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISYRAPELFSVQSHCVIGERTDVW 219

Query: 928  SLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQ 1107
            SL C LYA+M+G  P++    + G S+ LA+ N Q+  P     P++  AL Q +  M+ 
Sbjct: 220  SLSCVLYAMMFGEGPYDMVF-QKGDSVALAVQN-QLSIP---QSPRHSSALRQLLNSMMT 274

Query: 1108 PQATVRPHIDDIVIHVDKL 1164
                 RPHI  ++  ++ L
Sbjct: 275  VDPHQRPHIPLLLSQLEAL 293



>gb:CR382128_1660533 Yarrowia lipolytica chromosome B of strain CLIB99
            of Yarrowia lipolytica.
          Length = 357

 Score =  157 bits (398), Expect = 4e-37
 Identities = 109/354 (30%), Positives = 159/354 (44%), Gaps = 45/354 (12%)
 Frame = +1

Query: 220  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQ- 396
            IN+  F+I + LGEGGFA+VYLV+                          +A+KK+    
Sbjct: 26   INNRSFKIRKLLGEGGFAFVYLVE--------------------TRGQELFALKKIRCPF 65

Query: 397  NSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD 576
              E +     E+     F  P ++  +D +V      +        Y+L P   +G L D
Sbjct: 66   GPESVQTAMREVDAYKTFDSPYIIKYVDSSV-----EQEADGSKSVYILLPYLKNGNLQD 120

Query: 577  NATAMKAKKESFSTSDVLQIFRQLCAGLKHMH---------------------------- 672
                       FS  +++ +  ++C  +K +H                            
Sbjct: 121  AINDHVMNGTHFSEEELMALVVEICHAIKTLHQHRIGGDVSTTTTVPQSSYRLGDDEEQG 180

Query: 673  -----------NFEP-----SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIR 804
                       N  P      YAH D+KP N++L+   G+P   ILMD GS   AR  + 
Sbjct: 181  LVAADELNNSANATPLSELVPYAHRDIKPANIMLSDN-GRP---ILMDLGSCSRARIDVS 236

Query: 805  SRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA 984
            SR +AL+LQ+ A+E  S P+RAPEL+D  + A+IDER D+WSLGCT+Y +MY  SPFE+ 
Sbjct: 237  SRQKALELQDMAAEQCSMPYRAPELFDVKTGANIDERVDVWSLGCTIYTLMYFTSPFEHQ 296

Query: 985  LGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIV 1146
              E+G SL LAI+N     P   + P+Y + L   V   L      RP IDD++
Sbjct: 297  TNETGASLNLAIMNGHFTMP---ASPEYSDQLKGLVKKCLIVDPQERPFIDDVL 347



>gb:AE017342_1754951 Cryptococcus neoformans var. neoformans JEC21
            chromosome 2, complete sequence.
          Length = 354

 Score =  155 bits (393), Expect = 2e-36
 Identities = 104/344 (30%), Positives = 162/344 (47%), Gaps = 36/344 (10%)
 Frame = +1

Query: 220  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN 399
            IN   ++I + LGEGGF++VYL++++ +D                     YA+KK+L+ +
Sbjct: 37   INGRSYKIEKLLGEGGFSFVYLIRDLSSDRL-------------------YALKKILVTS 77

Query: 400  SEQ-LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD 576
             ++ +     E+     F HPN++ +LD AV+  ++ +G+      YL  P +  G L D
Sbjct: 78   GQEGVKEAMREVEAYRRFRHPNIIRILDSAVVQDESGDGKI----IYLFLPYYSKGNLQD 133

Query: 577  NATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNF-------------EP----------- 684
                     +      +L+IF   C    H +               EP           
Sbjct: 134  AMANASVTGQRIPERKLLEIFHGTCLAAMHQYRLPNISASYPPTREDEPLVGETVFDHDE 193

Query: 685  -----------SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQ 831
                        YAH D+KP N++++  + +P   ILMDFGS   AR  + +R +AL  Q
Sbjct: 194  ELTQEDRGELVPYAHRDIKPANIMISD-EDEP---ILMDFGSTIKARITVETRQQALLEQ 249

Query: 832  EWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQ 1011
            + A EH S P+RAPEL+D  +   +DE+ DIWSLGCTLYA+ YG SPFE      G S+ 
Sbjct: 250  DIAGEHSSMPYRAPELFDVKTGRTLDEKCDIWSLGCTLYAVAYGHSPFEV----DGQSIA 305

Query: 1012 LAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDI 1143
            +A+ + + + P+G     Y +   Q +  ML      RP I  +
Sbjct: 306  MAVGSGRYRHPSG-----YSQDFVQLIDSMLVVDPEHRPDIQKV 344



>gb:CR382136_1669057 Debaryomyces hansenii chromosome D of strain
            CBS767 of Debaryomyces hansenii.
          Length = 359

 Score =  145 bits (367), Expect = 2e-33
 Identities = 110/358 (30%), Positives = 170/358 (47%), Gaps = 47/358 (13%)
 Frame = +1

Query: 214  VWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGT-YAMKKVL 390
            V IN+ +++I+R LGEGGF+YVYLV                   SH S+N + YA+KK+ 
Sbjct: 23   VSINNAKYKIIRLLGEGGFSYVYLV-------------------SHKSNNNSQYALKKIR 63

Query: 391  I---QNSEQLDLVKEEIRVSSLFSH---PNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV 552
                 + E      +EI+    FS+   P ++  +D  +I    +E    K   Y+L P 
Sbjct: 64   CPFGSDDETFKNAMKEIKNYHRFSNSKTPYIIQSIDETII----NENDGSK-TIYILLP- 117

Query: 553  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPS--------------- 687
            + + +L D  T       +    ++L+IF  +C GL+ MH F+ +               
Sbjct: 118  YFENSLQDIITYNVLNDLTMDEDEILKIFIGVCRGLQAMHKFKRTGRTHSTANDEEEEDL 177

Query: 688  -------------------------YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPAR 792
                                     +AH D+KP NV+L+  +G P   +L+D GS   A 
Sbjct: 178  LLPAASDDEDGVSASNGTELQELTPFAHRDIKPANVMLS-AEGLP---VLVDLGSCSKAN 233

Query: 793  KQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSP 972
              I++R +AL L ++A EH + P+RAPEL D  ++ +I E+TDIWSLGC LYA  +G SP
Sbjct: 234  FSIKNRQQALTLTDFAQEHCTLPYRAPELLDVATNTEITEKTDIWSLGCLLYACCFGFSP 293

Query: 973  FEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIV 1146
            FE    E G +L LAI       P   ++  Y + L   +   L   +  RP +D+++
Sbjct: 294  FEKLEIEQGANLNLAISQGNYSIPQ--NNKGYSDELISLIKDCLVLDSLKRPSVDELL 349



>gb:AE014297_1138308 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003672_1220212 Drosophila melanogaster
            chromosome 3R, section 12 of 118 of the complete
            sequence.>gb:AY069451_1294181 Drosophila melanogaster
            LD17053 full length cDNA.
          Length = 320

 Score =  144 bits (363), Expect = 5e-33
 Identities = 101/342 (29%), Positives = 170/342 (49%), Gaps = 1/342 (0%)
 Frame = +1

Query: 151  KMGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSK 330
            K GC FS      + +N      IN +R+ I  +L  GGF+ + L +             
Sbjct: 11   KRGCLFS---CRKETLN------INGSRYTIRERLATGGFSLIDLGE------------- 48

Query: 331  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE 510
                  +AS   +YA+K++   + +  ++   EI         N++ ++D+ +   +A  
Sbjct: 49   ------NASTRRSYAIKRITCHSIDDQNIALREIENCRKIDSENVIRVVDYELKG-QADI 101

Query: 511  GQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP-S 687
              +     +++ P +  G+L D+      K++    + +LQIF  +C GLK +H   P  
Sbjct: 102  VINTTSTLFIVLPYYKHGSLADHLQLRSRKQDHMPEAQILQIFLGVCEGLKAIHEAMPVP 161

Query: 688  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR 867
             AH D+K  N+ L+    +P   I++D GS   AR QI  +++A +LQ+ A E  S  +R
Sbjct: 162  LAHRDLKTANICLSD-SFEP---IIVDLGSMTEARLQIVGQTDAQRLQDEAEERSSIVYR 217

Query: 868  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPT 1047
            APEL+   ++  IDERTDIWSLGC LYA+ Y  SP++  + E G S+ LA+++  +  P 
Sbjct: 218  APELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPYD-PIYERGDSVALAVLSGNINIP- 275

Query: 1048 GLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISK 1173
               D  Y E +H+ + +ML+     RP +  ++     LI K
Sbjct: 276  --EDSIYTEDMHELIKYMLRTDPMERPFVFSVIERTHDLIQK 315



>sp|Q10078|KAND_SCHPO Putative serine/threonine-protein kinase C3H1.13
            (EC 2.7.1.37).>pir|T38745|T38745 serine/threonine protein
            kinase - fission yeast  (Schizosaccharomyces
            pombe)>gb:SPAC3H1_1717875 S. pombe chromosome I cosmid
            c3H1.
          Length = 344

 Score =  135 bits (339), Expect = 3e-30
 Identities = 106/351 (30%), Positives = 158/351 (45%), Gaps = 31/351 (8%)
 Frame = +1

Query: 214  VWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLI 393
            V IN+ R+RI + LGEGGFA+VYLV+ +                   S+   YA+KK+  
Sbjct: 25   VCINNERYRIQKLLGEGGFAFVYLVQNV-------------------SNEKLYALKKIKC 65

Query: 394  Q-NSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTL 570
               ++ +    +E      F    LL    H +  VK ++G  +    Y+LFP    G++
Sbjct: 66   SFGNKGIKKAMKEADYHRKFKSNYLLKSYTHQL--VKEADGSEF---VYILFPYFAKGSV 120

Query: 571  LDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMH-------------------------- 672
                     +    S   +L     LC  L+++H                          
Sbjct: 121  AQVIRNCDIEGSYISEKRILVWCSCLCKALQYLHENVAGDSPKQPEVNDLIMFDEPQVPQ 180

Query: 673  ----NFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWA 840
                N   SY H D+KP N+LL     +    +L DFGS         + SEA+ +Q+ A
Sbjct: 181  NTSNNNLVSYIHGDIKPDNLLLHENSRE---IVLTDFGSICLVPIFASNNSEAIAIQDKA 237

Query: 841  SEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAI 1020
            SE+ + PFRAPEL+   + + I E+ DIWS GCTLY IM+  SPFE  + + GGSL LA+
Sbjct: 238  SENCTMPFRAPELFHVKAGSTITEKADIWSFGCTLYTIMFHASPFEREVSQ-GGSLALAV 296

Query: 1021 VNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISK 1173
             NAQ  +P       Y   L + V   LQ +   RP   +++  +D  I++
Sbjct: 297  CNAQYSFP---RKHPYSTLLCEIVEACLQREPNKRPSARELLSKIDLQINQ 344



>gb:AC114263_1205606 Dictyostelium discoideum chromosome 2 map
            215673-367476 strain AX4, complete sequence.
          Length = 798

 Score =  123 bits (309), Expect = 8e-27
 Identities = 97/328 (29%), Positives = 161/328 (49%), Gaps = 5/328 (1%)
 Frame = +1

Query: 196  VNGG--GDVW-INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNG 366
            + GG  G V+ IN  R   V+ + EGGF +VYLV++                      N 
Sbjct: 38   ITGGRVGQVYDINGRRVTEVKLVAEGGFGFVYLVRD--------------------DYNN 77

Query: 367  TYAMKKVLIQNSEQLDLVKEEIRV-SSLFSHPNLLPLLDHAVIAVKASEGQSWKH-EAYL 540
             YA+K++ IQ  E+L+ +K EI V   L ++PN++ L        K +E ++ +  E  +
Sbjct: 78   MYALKRMFIQERERLEAMKNEIDVMQKLRNNPNIVKLE-----GFKINENRNTRETEVLM 132

Query: 541  LFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNV 720
            L      G++LD   A + +       ++L IF  +C G+  MH  +P  AH D+K  NV
Sbjct: 133  LMEYCSGGSVLDIMNA-RGEFTRLEEREILAIFSDVCNGVLAMHQQQPPIAHRDLKIENV 191

Query: 721  LLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHA 900
            L      +  L    DFGS+    K   + +E  + ++  +   +  +RAPE+ D     
Sbjct: 192  LYCEHSNRYKLC---DFGSS--TIKTFNTATERGKAEDDINMFTTLFYRAPEMVDLYRGQ 246

Query: 901  DIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEAL 1080
             IDE+ D+W+LGC L+ + + V PF+      GGSLQ  I+N   K P    + KY    
Sbjct: 247  IIDEKVDVWALGCLLFKMAFYVDPFD------GGSLQ--IINNNYKIP---DNSKYSNNF 295

Query: 1081 HQFVTWMLQPQATVRPHIDDIVIHVDKL 1164
            H+ + ++L    T RP I+D++ +++++
Sbjct: 296  HKLIQFILVADPTQRPSINDLLNYLNEI 323



>gb:AP005874_1859454 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OSJNBa0016G10.
          Length = 667

 Score =  120 bits (302), Expect = 5e-26
 Identities = 95/323 (29%), Positives = 148/323 (45%), Gaps = 2/323 (0%)
 Frame = +1

Query: 205  GGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKK 384
            G  + + + +  +   + +GGF+ VYL  + +  P+K                  YAMK 
Sbjct: 17   GRTIDVGNIKITVRNAIAQGGFSCVYLASDAM-HPSKQ-----------------YAMKH 58

Query: 385  VLIQNSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMD 561
            ++  +SE LDLV EEI+V +L   HPN++ L+ H V  +  ++      EA L+    M+
Sbjct: 59   IICNDSELLDLVMEEIQVMNLLKGHPNVVTLVAHDVFDMGRTK------EALLV----ME 108

Query: 562  GTLLDNATAMKAKKESF-STSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRK 738
                   +AM+++   +      L I R +C  +  MH   P  AH D+K  NVLL    
Sbjct: 109  FCEKSLVSAMESRGTGYYEEKKALLILRDVCNAVFAMHGQSPPIAHRDLKAENVLL---- 164

Query: 739  GQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERT 918
            G      L DFGS     K      E    ++   +H +  +RAPE+WD      I E+ 
Sbjct: 165  GLDGAWKLCDFGSTSTNHKCFDRPEEMGIEEDIIRKHTTPAYRAPEMWDLYRREVISEKV 224

Query: 919  DIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTW 1098
            DIW+LGC LY I Y  S F+       G  +L I+N   + P     PKY  A+ + +  
Sbjct: 225  DIWALGCLLYRICYFKSAFD-------GESKLQILNGNYRIP---EQPKYSAAVTKLIKD 274

Query: 1099 MLQPQATVRPHIDDIVIHVDKLI 1167
            ML+     RP +  +   V++L+
Sbjct: 275  MLEASPNDRPDVTQVWFRVNELL 297



>gb:AP005594_1854688 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, PAC clone:P0701E06.
          Length = 703

 Score =  120 bits (301), Expect = 7e-26
 Identities = 98/316 (31%), Positives = 148/316 (46%), Gaps = 2/316 (0%)
 Frame = +1

Query: 205  GGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKK 384
            G  V + + R  +   + EGGF+ VYL ++  A+PAK                  YA+K 
Sbjct: 18   GRTVDVGNVRVHVREPVAEGGFSCVYLARDA-ANPAKQ-----------------YALKH 59

Query: 385  VLIQNSEQLDLVKEEIRVS-SLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMD 561
            V+IQ+ E LDLV++EI V  SL  HPN++ L+ HAV+       ++      LL     +
Sbjct: 60   VVIQDEESLDLVRKEIMVMRSLKGHPNVVALVAHAVLDTGGRAREA------LLVMEFCE 113

Query: 562  GTLLDNATAMKAKKES-FSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRK 738
             +L+    A++++  + F    V  IFR +C  +  MH   P  AH D+K  N+LL    
Sbjct: 114  KSLV---AALESRGAAHFDEQQVALIFRDVCNAVFAMHCQTPPIAHRDLKAENILL---- 166

Query: 739  GQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERT 918
            G      L DFGS     K      E    ++   +H +  +RAPE+WD      I E+ 
Sbjct: 167  GGGGAWKLCDFGSVSTNHKCFDKPEEMGIEEDNIRKHTTPAYRAPEMWDLYRREVISEKV 226

Query: 919  DIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTW 1098
            DIW+LGC LY I Y  S F+       G  +L I+N   + P     PKY   +   +  
Sbjct: 227  DIWALGCLLYRICYLKSAFD-------GESKLQILNGNYRIP---ELPKYSSPITSLIKD 276

Query: 1099 MLQPQATVRPHIDDIV 1146
            MLQ    V   +++++
Sbjct: 277  MLQSSPDVWFRVNELL 292



>gb:AX040954_1457750 Sequence 1 from Patent WO0065040.
          Length = 524

 Score =  119 bits (299), Expect = 1e-25
 Identities = 94/323 (29%), Positives = 148/323 (45%), Gaps = 2/323 (0%)
 Frame = +1

Query: 205  GGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKK 384
            G  + + + +  +   + +GGF+ VYL  + +  P+K                  YA+K 
Sbjct: 17   GRTIDVGNLKITVQNAIAQGGFSCVYLACDTV-HPSK-----------------MYALKH 58

Query: 385  VLIQNSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMD 561
            ++  +SE LDLV +EI+V +L   HPN++ L+ H V  +  ++      EA L+    M+
Sbjct: 59   IICNDSESLDLVMKEIQVMNLLKGHPNVVTLVAHDVFDMGRTK------EALLV----ME 108

Query: 562  GTLLDNATAMKAKKESF-STSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRK 738
                   +AM+++   +     VL IFR +C     MH   P  AH D+K  NVLL    
Sbjct: 109  FCEKSLVSAMESRGSGYYEEKKVLLIFRDVCNAAFAMHGQSPPIAHRDLKAENVLL---- 164

Query: 739  GQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERT 918
            G   +  + DFGS     K      E    ++   +H +  +R PE+WD      I E+ 
Sbjct: 165  GCDGVWKICDFGSTSTNHKCFNKPEEMGIEEDVIRKHTTPAYRPPEMWDLYRREVISEKV 224

Query: 919  DIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTW 1098
            DIW+LGC LY I Y  S F+       G  +L I+N   + P     PKY  A+   +  
Sbjct: 225  DIWALGCLLYKICYFKSAFD-------GESKLQILNGNYRIP---EQPKYSTAVTGLIKD 274

Query: 1099 MLQPQATVRPHIDDIVIHVDKLI 1167
            ML+     RP I  +   V++L+
Sbjct: 275  MLEASPNSRPDITQVWFRVNELL 297



>gb:AP005874_1859455 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OSJNBa0016G10.
          Length = 308

 Score =  116 bits (291), Expect = 1e-24
 Identities = 93/312 (29%), Positives = 142/312 (45%), Gaps = 2/312 (0%)
 Frame = +1

Query: 205  GGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKK 384
            G  + + + +  +   + +GGF+ VYL  + +  P+K                  YAMK 
Sbjct: 17   GRTIDVGNIKITVRNAIAQGGFSCVYLASDAM-HPSKQ-----------------YAMKH 58

Query: 385  VLIQNSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMD 561
            ++  +SE LDLV EEI+V +L   HPN++ L+ H V  +  ++      EA L+    M+
Sbjct: 59   IICNDSELLDLVMEEIQVMNLLKGHPNVVTLVAHDVFDMGRTK------EALLV----ME 108

Query: 562  GTLLDNATAMKAKKESF-STSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRK 738
                   +AM+++   +      L I R +C  +  MH   P  AH D+K  NVLL    
Sbjct: 109  FCEKSLVSAMESRGTGYYEEKKALLILRDVCNAVFAMHGQSPPIAHRDLKAENVLL---- 164

Query: 739  GQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERT 918
            G      L DFGS     K      E    ++   +H +  +RAPE+WD      I E+ 
Sbjct: 165  GLDGAWKLCDFGSTSTNHKCFDRPEEMGIEEDIIRKHTTPAYRAPEMWDLYRREVISEKV 224

Query: 919  DIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTW 1098
            DIW+LGC LY I Y  S F+       G  +L I+N   + P     PKY  A+ + +  
Sbjct: 225  DIWALGCLLYRICYFKSAFD-------GESKLQILNGNYRIP---EQPKYSAAVTKLIKD 274

Query: 1099 MLQPQATVRPHI 1134
            ML+     RP +
Sbjct: 275  MLEASPNDRPDV 286



>pir|S61028|S61028 hypothetical protein YPL236c - yeast (Saccharomyces
            cerevisiae)>gb:SC38KCXVI_1705205 S.cerevisiae DNA
            (chromosome XVI; 38 kb).>gb:SCYPL236C_1714757
            S.cerevisiae chromosome XVI reading frame ORF YPL236c.
          Length = 364

 Score =  114 bits (286), Expect = 4e-24
 Identities = 91/352 (25%), Positives = 147/352 (41%), Gaps = 49/352 (13%)
 Frame = +1

Query: 220  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGT-----YAMKK 384
            +ND R+RI R LGEGG ++VYLV+          +SK     S   DNG      YA+KK
Sbjct: 25   VNDKRYRIQRLLGEGGMSFVYLVQ----------LSKN----SLIIDNGIATPELYALKK 70

Query: 385  VLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDG 564
            ++  + E +     EI     F  P ++  +D  V+  K           Y++ P +  G
Sbjct: 71   IICPSVESISNGMREIENYKRFQSPYVIKSIDSQVMQEKDGS-----KTIYIVLPYYSLG 125

Query: 565  TLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP-------------------- 684
            +L D+      +    S ++ ++I   +  GL  +H+                       
Sbjct: 126  SLQDSINRRLLEGTFVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSD 185

Query: 685  ------------------------SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPAR 792
                                    +YAH D+ P N+L +       L ++ D GS   A 
Sbjct: 186  ETAMLLEDTPLEMDMLSSNSAGSIAYAHRDITPSNILFS----SDGLPVIGDLGSCSQAD 241

Query: 793  KQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSP 972
              I +R +  +LQEW +++ + P+  PEL +   +  +  + DIWSLGCT Y +M+G+SP
Sbjct: 242  ITIENRHQLSELQEWVNDNCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISP 301

Query: 973  FEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRP 1128
            FE      G SL  AI   +  +P    + ++ E L   +   +Q     RP
Sbjct: 302  FEREEQIHGASLTYAINTGKYSFP---RNSRFSEGLLSVIKKCIQVDPIQRP 350



>gb:BT001103_1635358 Arabidopsis thaliana clone C104878 (D) putative
            serine/threonine protein kinase (At2g32850) mRNA,
            complete cds.
          Length = 670

 Score =  113 bits (283), Expect = 9e-24
 Identities = 94/316 (29%), Positives = 146/316 (46%), Gaps = 2/316 (0%)
 Frame = +1

Query: 220  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN 399
            I + + ++   + EGGF+ VYL +++                +HAS    YA+K ++  +
Sbjct: 22   IGNLKVQVRNVIAEGGFSSVYLAQDV----------------NHASKQ--YALKHMICND 63

Query: 400  SEQLDLVKEEIRV-SSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD 576
             E L+LV +EI V  SL  HPN++ L  H ++ +  ++ ++       L  +   G  L 
Sbjct: 64   EESLELVMKEISVLKSLKGHPNVVTLYAHGILDMGRNKKEA-------LLAMDFCGKSLV 116

Query: 577  NATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLA 756
            +    +     F     L IFR +C  +  MH   P  AH D+K  N+LL+   GQ  L 
Sbjct: 117  DVLENRGAGY-FEEKQALTIFRDVCNAVFAMHCQSPRIAHRDLKAENLLLSS-DGQWKLC 174

Query: 757  ILMDFGSARPARKQIRSRSEALQLQEWASEHVSAP-FRAPELWDCPSHADIDERTDIWSL 933
               DFGS     K I  R+E + ++E      + P +RAPE+WD      I E+ DIW+L
Sbjct: 175  ---DFGSVSTNHK-IFERAEEMGIEEDNIRKYTTPTYRAPEMWDLFRREMISEKVDIWAL 230

Query: 934  GCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQ 1113
            GC L+ I Y  + F+       G  +L I+N   + P     PKY   +   +  MLQ  
Sbjct: 231  GCLLFRICYFKNAFD-------GESKLQILNGNYRIP---ESPKYSVFITDLIKEMLQAS 280

Query: 1114 ATVRPHIDDIVIHVDK 1161
               RP I  I   V++
Sbjct: 281  PDERPDITQIWFRVNE 296



>gb:AC003033_1531008 Arabidopsis thaliana chromosome 2 BAC T21L14
            genomic sequence, complete sequence.>gb:AC003974_1531243
            Arabidopsis thaliana chromosome 2 clone F24L7 map TEn5,
            complete sequence.>gb:AY085829_1570894 Arabidopsis
            thaliana clone 18783 mRNA, complete
            sequence.>gb:AY150416_1584981 Arabidopsis thaliana
            putative serine/threonine kinase (At2g32850) mRNA,
            complete cds.
          Length = 650

 Score =  113 bits (283), Expect = 9e-24
 Identities = 94/316 (29%), Positives = 146/316 (46%), Gaps = 2/316 (0%)
 Frame = +1

Query: 220  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN 399
            I + + ++   + EGGF+ VYL +++                +HAS    YA+K ++  +
Sbjct: 22   IGNLKVQVRNVIAEGGFSSVYLAQDV----------------NHASKQ--YALKHMICND 63

Query: 400  SEQLDLVKEEIRV-SSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD 576
             E L+LV +EI V  SL  HPN++ L  H ++ +  ++ ++       L  +   G  L 
Sbjct: 64   EESLELVMKEISVLKSLKGHPNVVTLYAHGILDMGRNKKEA-------LLAMDFCGKSLV 116

Query: 577  NATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLA 756
            +    +     F     L IFR +C  +  MH   P  AH D+K  N+LL+   GQ  L 
Sbjct: 117  DVLENRGAGY-FEEKQALTIFRDVCNAVFAMHCQSPRIAHRDLKAENLLLSS-DGQWKLC 174

Query: 757  ILMDFGSARPARKQIRSRSEALQLQEWASEHVSAP-FRAPELWDCPSHADIDERTDIWSL 933
               DFGS     K I  R+E + ++E      + P +RAPE+WD      I E+ DIW+L
Sbjct: 175  ---DFGSVSTNHK-IFERAEEMGIEEDNIRKYTTPTYRAPEMWDLFRREMISEKVDIWAL 230

Query: 934  GCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQ 1113
            GC L+ I Y  + F+       G  +L I+N   + P     PKY   +   +  MLQ  
Sbjct: 231  GCLLFRICYFKNAFD-------GESKLQILNGNYRIP---ESPKYSVFITDLIKEMLQAS 280

Query: 1114 ATVRPHIDDIVIHVDK 1161
               RP I  I   V++
Sbjct: 281  PDERPDITQIWFRVNE 296



>gb:AY072202_1567090 Arabidopsis thaliana putative serine/threonine
            protein kinase (At2g32850) mRNA, complete cds.
          Length = 650

 Score =  113 bits (282), Expect = 1e-23
 Identities = 93/316 (29%), Positives = 146/316 (46%), Gaps = 2/316 (0%)
 Frame = +1

Query: 220  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN 399
            I + + ++   + EGGF+ VYL +++                +HAS    YA+K ++  +
Sbjct: 22   IGNLKVQVRNVIAEGGFSSVYLAQDV----------------NHASKQ--YALKHMICND 63

Query: 400  SEQLDLVKEEIRV-SSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD 576
             E L+LV +EI V  SL  HPN++ L  H ++ +  ++ ++       L  +   G  L 
Sbjct: 64   EESLELVMKEISVLKSLKGHPNVVTLYAHGILDMGRNKKEA-------LLAMDFCGKSLV 116

Query: 577  NATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLA 756
            +    +     F     L IFR +C  +  MH   P  AH D+K  N+LL+   GQ  L 
Sbjct: 117  DVLENRGAGY-FEEKQALTIFRDVCNAVFAMHCQSPRIAHRDLKAENLLLSS-DGQWKLC 174

Query: 757  ILMDFGSARPARKQIRSRSEALQLQEWASEHVSAP-FRAPELWDCPSHADIDERTDIWSL 933
               DFGS     K I  R+E + ++E      + P +RAPE+WD      I E+ DIW+L
Sbjct: 175  ---DFGSVSTNHK-IFERAEEMGIEEDNIRKYTTPTYRAPEMWDLFRREMISEKVDIWAL 230

Query: 934  GCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQ 1113
            GC L+ I Y  + F+       G  +L I+N   + P     PKY   +   +  MLQ  
Sbjct: 231  GCLLFRICYFKNAFD-------GESKLQILNGNYRIP---ESPKYSVFITDLIKEMLQAS 280

Query: 1114 ATVRPHIDDIVIHVDK 1161
               RP +  I   V++
Sbjct: 281  PDERPDVTQIWFRVNE 296



>pir|T01122|T01122 probable serine/threonine protein kinase [imported]
            - Arabidopsis thaliana
          Length = 693

 Score =  112 bits (279), Expect = 3e-23
 Identities = 92/310 (29%), Positives = 143/310 (46%), Gaps = 2/310 (0%)
 Frame = +1

Query: 220  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN 399
            I + + ++   + EGGF+ VYL +++                +HAS    YA+K ++  +
Sbjct: 22   IGNLKVQVRNVIAEGGFSSVYLAQDV----------------NHASKQ--YALKHMICND 63

Query: 400  SEQLDLVKEEIRV-SSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD 576
             E L+LV +EI V  SL  HPN++ L  H ++ +  ++ ++       L  +   G  L 
Sbjct: 64   EESLELVMKEISVLKSLKGHPNVVTLYAHGILDMGRNKKEA-------LLAMDFCGKSLV 116

Query: 577  NATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLA 756
            +    +     F     L IFR +C  +  MH   P  AH D+K  N+LL+   GQ  L 
Sbjct: 117  DVLENRGAGY-FEEKQALTIFRDVCNAVFAMHCQSPRIAHRDLKAENLLLSS-DGQWKLC 174

Query: 757  ILMDFGSARPARKQIRSRSEALQLQEWASEHVSAP-FRAPELWDCPSHADIDERTDIWSL 933
               DFGS     K I  R+E + ++E      + P +RAPE+WD      I E+ DIW+L
Sbjct: 175  ---DFGSVSTNHK-IFERAEEMGIEEDNIRKYTTPTYRAPEMWDLFRREMISEKVDIWAL 230

Query: 934  GCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQ 1113
            GC L+ I Y  + F+       G  +L I+N   + P     PKY   +   +  MLQ  
Sbjct: 231  GCLLFRICYFKNAFD-------GESKLQILNGNYRIP---ESPKYSVFITDLIKEMLQAS 280

Query: 1114 ATVRPHIDDI 1143
               RP I  +
Sbjct: 281  PDERPDITQV 290



>gb:BX004825_2566967 Zebrafish DNA sequence from clone DKEYP-1E8
            Contains the gene for a novel protein similar to
            vertebrate cyclin G associated kinase (GAK), the gene for
            a novel protein similar to vertebrate lymphocyte adaptor
            protein (LNK), a novel gene and six CpG islands, complete
            sequence.
          Length = 845

 Score =  111 bits (277), Expect = 4e-23
 Identities = 92/325 (28%), Positives = 154/325 (47%), Gaps = 5/325 (1%)
 Frame = +1

Query: 205  GGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKK 384
            G  V + + + RI R + EGGFA+VY  +++                     N  YA+K+
Sbjct: 30   GQVVELGELKLRIKRVIAEGGFAFVYEAQDL-------------------GSNKDYALKR 70

Query: 385  VLIQNSEQLDLVKEEIR-VSSLFSHPNLLPLLDHAVIAVKASE-GQSWKHEAYLLFPVHM 558
            +L    E+   + +E+  +  L  HPN++     A I+ + S+ GQ+     +L+     
Sbjct: 71   LLSNEEEKNKAIIQEVCFMKKLSGHPNVVQFCSAASISKEESDTGQA----EFLILTELC 126

Query: 559  DGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRK 738
             G L+D    ++ +K   S   VL+IF Q C  ++HMH   P+  H D+K  N+L++H+ 
Sbjct: 127  RGQLVDFVKKVE-QKGPMSCDTVLKIFYQSCRAVQHMHKQSPAVIHRDLKIENLLISHQG 185

Query: 739  GQPPLAILMDFGSARPARKQIR---SRSEALQLQEWASEHVSAPFRAPELWDCPSHADID 909
                   L DFGSA           S  +   +++  + + +  +R PE+ D  S+  I+
Sbjct: 186  ----TIKLCDFGSATTLAHYPDYSWSAHKRSMVEDEITRNTTPAYRTPEMIDLYSNYPIN 241

Query: 910  ERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQF 1089
            E+ DIW+LGC LY + +   PF     E G  LQ  IVN +   P   +D KY    HQ 
Sbjct: 242  EKQDIWALGCILYLLCFKQHPF-----EEGAKLQ--IVNGKYSIPQ--NDTKY-TVFHQL 291

Query: 1090 VTWMLQPQATVRPHIDDIVIHVDKL 1164
            +  ML+     R  I+++V  + ++
Sbjct: 292  IRSMLKINPEERLSINELVNQLQEI 316



>pir|T40643|T40643 probable serine threonine-protein kinase - fission
            yeast  (Schizosaccharomyces pombe)>gb:SPBC6B1_1720362
            S.pombe chromosome II cosmid c6B1.
          Length = 953

 Score =  109 bits (273), Expect = 1e-22
 Identities = 85/318 (26%), Positives = 144/318 (45%), Gaps = 1/318 (0%)
 Frame = +1

Query: 184  LYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDN 363
            L+  +  G  + +  +   I R L EGGF++VYL    L +  KP               
Sbjct: 40   LFSKIPAGTKIQVGSHSVIIQRYLSEGGFSHVYLA---LLENEKP--------------- 81

Query: 364  GTYAMKKVLIQNSEQLDLVKEEIR-VSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYL 540
              + +K++ + +   L LV  EI  +  L  H +++  +D + +  K+      ++E YL
Sbjct: 82   --FVLKRIYVPDKTALQLVHGEIETMKRLKGHRHIVNYIDSSALYSKSEN----RYEVYL 135

Query: 541  LFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNV 720
            L      G L+D        +   +  ++L+I   +C  +  MH  +P   H D+K  NV
Sbjct: 136  LMEFCAGGGLIDFMNTRLQHR--LTEGEILKILADVCDAVAAMHYLDPPLIHRDLKIENV 193

Query: 721  LLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHA 900
            LL      P    L DFGSA        +    + L++  + + +  +RAPE+ D     
Sbjct: 194  LLV----APNSYKLCDFGSACEPLAPATTPDTIMFLEQNIAAYTTPQYRAPEMIDINRRQ 249

Query: 901  DIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEAL 1080
             IDE++DIW++G   Y + Y  +PFE  +G S      AI+ A   +P     P+Y + +
Sbjct: 250  GIDEKSDIWAIGVLAYKLCYYTTPFE-QVGNS------AILKASFSFP---PFPRYSDRM 299

Query: 1081 HQFVTWMLQPQATVRPHI 1134
             +F+   LQ Q + RP+I
Sbjct: 300  KRFIATCLQEQPSHRPNI 317



>gb:SCU24167_1710052 Saccharomyces cerevisiae PAK1 mRNA, complete cds.
          Length = 810

 Score =  109 bits (272), Expect = 2e-22
 Identities = 85/320 (26%), Positives = 152/320 (47%), Gaps = 2/320 (0%)
 Frame = +1

Query: 220  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN 399
            +  +  +I++ L  GGFA VY              + +   P   S+     +K+V++ +
Sbjct: 17   VGSHHAKIIKYLTSGGFAQVY--------------TAEISPPDPYSNANIACLKRVIVPH 62

Query: 400  SEQLDLVKEEIRVSSLF-SHPNLLPLLD-HAVIAVKASEGQSWKHEAYLLFPVHMDGTLL 573
             + L+ ++ E+    L  ++ +++  +D HA  +V         +E ++L      G L+
Sbjct: 63   KQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSVNGIA-----YEVFVLMEFCERGGLI 117

Query: 574  DNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPL 753
            D        +     S++L+I  Q   G+  MH  +P   H D+K  NVL++H      L
Sbjct: 118  DFMNTRLQNR--LQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISH----DGL 171

Query: 754  AILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSL 933
              + DFGS     +  R+  E   +Q     + +A +R+PE+ D      IDE++DIW+L
Sbjct: 172  YKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWAL 231

Query: 934  GCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQ 1113
            G  LY I Y  +PFE + GE+G      I++A+ ++P   S P+Y + L   +  ML   
Sbjct: 232  GVFLYKICYYTTPFEKS-GEAG------ILHARYQYP---SFPQYSDRLKNLIRLMLMEA 281

Query: 1114 ATVRPHIDDIVIHVDKLISK 1173
             + RP+I  ++  V +L +K
Sbjct: 282  PSQRPNICQVLEEVSRLQNK 301



>sp|P40494|KIJ5_YEAST Probable serine/threonine-protein kinase YIL095W
            (EC 2.7.1.37).>pir|S50889|S50889 PRK1 protein - yeast
            (Saccharomyces cerevisiae)>gb:SC9910_1706260 S.cerevisiae
            chromosome IX cosmid 9910.
          Length = 810

 Score =  109 bits (272), Expect = 2e-22
 Identities = 85/320 (26%), Positives = 152/320 (47%), Gaps = 2/320 (0%)
 Frame = +1

Query: 220  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN 399
            +  +  +I++ L  GGFA VY              + +   P   S+     +K+V++ +
Sbjct: 17   VGSHHAKIIKYLTSGGFAQVY--------------TAEISPPDPYSNANIACLKRVIVPH 62

Query: 400  SEQLDLVKEEIRVSSLF-SHPNLLPLLD-HAVIAVKASEGQSWKHEAYLLFPVHMDGTLL 573
             + L+ ++ E+    L  ++ +++  +D HA  +V         +E ++L      G L+
Sbjct: 63   KQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSVNGIA-----YEVFVLMEFCERGGLI 117

Query: 574  DNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPL 753
            D        +     S++L+I  Q   G+  MH  +P   H D+K  NVL++H      L
Sbjct: 118  DFMNTRLQNR--LQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISH----DGL 171

Query: 754  AILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSL 933
              + DFGS     +  R+  E   +Q     + +A +R+PE+ D      IDE++DIW+L
Sbjct: 172  YKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWAL 231

Query: 934  GCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQ 1113
            G  LY I Y  +PFE + GE+G      I++A+ ++P   S P+Y + L   +  ML   
Sbjct: 232  GVFLYKICYYTTPFEKS-GEAG------ILHARYQYP---SFPQYSDRLKNLIRLMLMEA 281

Query: 1114 ATVRPHIDDIVIHVDKLISK 1173
             + RP+I  ++  V +L +K
Sbjct: 282  PSQRPNICQVLEEVSRLQNK 301



>gb:CR380953_1650729 Candida glabrata strain CBS138 chromosome G
            complete sequence.
          Length = 688

 Score =  107 bits (266), Expect = 8e-22
 Identities = 87/326 (26%), Positives = 154/326 (47%), Gaps = 1/326 (0%)
 Frame = +1

Query: 190  DAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGT 369
            D +N G  + +  +  +I++ L  GGFA +Y V EIL+     G             +  
Sbjct: 7    DRINVGTQLTVGTHSVKILKYLTSGGFAQIYAV-EILSMGLFNG-------------SNV 52

Query: 370  YAMKKVLIQNSEQLDLVKEEIRVSSLFSH-PNLLPLLDHAVIAVKASEGQSWKHEAYLLF 546
              +K+V + +   L++++ E+    L ++  +++  +D        ++G    +E +LL 
Sbjct: 53   ACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGT---YEVFLLM 109

Query: 547  PVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLL 726
                 G L+D        +   +  ++L I  Q   G+  MH   P   H D+K  NVLL
Sbjct: 110  EYCEGGGLIDFMNTRLQNR--LTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLL 167

Query: 727  THRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADI 906
            +  KG   +  + DFGS     +  R++ E L +Q    ++ +A +R PE+ D      I
Sbjct: 168  S--KGG--IYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPI 223

Query: 907  DERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQ 1086
            DE+ DIW+LG  LY + Y  +PFE  LGE       AI++A+ ++P   S P Y + L  
Sbjct: 224  DEKADIWALGVFLYKLCYYTTPFE-KLGEP------AILHARFQFP---SFPNYSDRLKN 273

Query: 1087 FVTWMLQPQATVRPHIDDIVIHVDKL 1164
             +  ML+   + RP++  ++  V ++
Sbjct: 274  LIKSMLREHPSDRPNVCQVLEEVSRM 299



>gb:BC002695_1968330 Homo sapiens AP2 associated kinase 1, mRNA (cDNA
            clone MGC:3535 IMAGE:3607681), complete cds.
          Length = 474

 Score =  106 bits (265), Expect = 1e-21
 Identities = 93/341 (27%), Positives = 153/341 (44%), Gaps = 2/341 (0%)
 Frame = +1

Query: 157  GCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKF 336
            G S SGL + Y     G    I   +  +   L EGGFA V+LV+               
Sbjct: 24   GGSTSGLGSGYI----GRVFGIGRQQVTVDEVLAEGGFAIVFLVR--------------- 64

Query: 337  KDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVS-SLFSHPNLLPLLDHAVIAVKASEG 513
                  S+    A+K++ + N   L + K EI++   L  H N++  +D ++  V  S G
Sbjct: 65   -----TSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNV--SSG 117

Query: 514  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA 693
              W  E  +L      G +++     +  +  F+ ++VLQIF   C  +  +H  +    
Sbjct: 118  DVW--EVLILMDFCRGGQVVNLMN--QRLQTGFTENEVLQIFCDTCEAVARLHQCKTPII 173

Query: 694  HNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQ-LQEWASEHVSAPFRA 870
            H D+K  N+LL H +G     +L DFGSA    K    ++E +  +++   ++ +  +RA
Sbjct: 174  HRDLKVENILL-HDRGH---YVLCDFGSA--TNKFQNPQTEGVNAVEDEIKKYTTLSYRA 227

Query: 871  PELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTG 1050
            PE+ +  S   I  + DIW+LGC LY + Y   PF        G  Q+AI +     P  
Sbjct: 228  PEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPF--------GESQVAICDGNFTIP-- 277

Query: 1051 LSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISK 1173
              + +Y + +H  + +ML+P    RP I  +     KL+ K
Sbjct: 278  -DNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKK 317



>gb:AB028971_1865827 Homo sapiens mRNA for KIAA1048 protein, partial
            cds.
          Length = 897

 Score =  106 bits (265), Expect = 1e-21
 Identities = 93/341 (27%), Positives = 153/341 (44%), Gaps = 2/341 (0%)
 Frame = +1

Query: 157  GCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKF 336
            G S SGL + Y     G    I   +  +   L EGGFA V+LV+               
Sbjct: 58   GGSTSGLGSGYI----GRVFGIGRQQVTVDEVLAEGGFAIVFLVR--------------- 98

Query: 337  KDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVS-SLFSHPNLLPLLDHAVIAVKASEG 513
                  S+    A+K++ + N   L + K EI++   L  H N++  +D ++  V  S G
Sbjct: 99   -----TSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNV--SSG 151

Query: 514  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA 693
              W  E  +L      G +++     +  +  F+ ++VLQIF   C  +  +H  +    
Sbjct: 152  DVW--EVLILMDFCRGGQVVNLMN--QRLQTGFTENEVLQIFCDTCEAVARLHQCKTPII 207

Query: 694  HNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQ-LQEWASEHVSAPFRA 870
            H D+K  N+LL H +G     +L DFGSA    K    ++E +  +++   ++ +  +RA
Sbjct: 208  HRDLKVENILL-HDRGH---YVLCDFGSA--TNKFQNPQTEGVNAVEDEIKKYTTLSYRA 261

Query: 871  PELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTG 1050
            PE+ +  S   I  + DIW+LGC LY + Y   PF        G  Q+AI +     P  
Sbjct: 262  PEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPF--------GESQVAICDGNFTIP-- 311

Query: 1051 LSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISK 1173
              + +Y + +H  + +ML+P    RP I  +     KL+ K
Sbjct: 312  -DNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKK 351



>gb:CR857994_1182185 Pongo pygmaeus mRNA; cDNA DKFZp469F1313 (from
            clone DKFZp469F1313).
          Length = 1311

 Score =  106 bits (264), Expect = 1e-21
 Identities = 91/325 (28%), Positives = 146/325 (44%), Gaps = 5/325 (1%)
 Frame = +1

Query: 205  GGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKK 384
            G  V + D R R+ R L EGGFA+VY  +++                        YA+K+
Sbjct: 30   GQTVELGDLRLRVRRVLAEGGFAFVYEAQDV-------------------GSGREYALKR 70

Query: 385  VLIQNSEQLDLVKEEIR-VSSLFSHPNLLPLLDHAVIAVKASE-GQSWKHEAYLLFPVHM 558
            +L    E+   + +E+  +  L  HPN++     A I  + S+ GQ+     +LL     
Sbjct: 71   LLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA----EFLLLTELC 126

Query: 559  DGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRK 738
             G L++    M+++    S   VL+IF Q C  ++HMH  +P   H D+K  N+LL+++ 
Sbjct: 127  KGQLVEFLKKMESRGP-LSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQG 185

Query: 739  GQPPLAILMDFGSARPARKQIR---SRSEALQLQEWASEHVSAPFRAPELWDCPSHADID 909
                   L DFGSA           S      ++E  + + +  +R PE+ D  S+  I 
Sbjct: 186  ----TIKLCDFGSATAISHYPDYSWSAQRRALVEEEITRNTTPMYRTPEIIDLYSNFPIG 241

Query: 910  ERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQF 1089
            E+ DIW+LGC LY + +   PFE          +L IVN +   P    D +Y    H  
Sbjct: 242  EKQDIWALGCILYLLCFRQHPFE-------DGAKLRIVNGKYSIPP--HDTQY-TVFHSL 291

Query: 1090 VTWMLQPQATVRPHIDDIVIHVDKL 1164
            +  MLQ     R  I ++V  + ++
Sbjct: 292  IRAMLQVNPEERLSIAEVVHQLQEI 316



>gb:CR380954_1651500 Candida glabrata strain CBS138 chromosome H
            complete sequence.
          Length = 1027

 Score =  105 bits (263), Expect = 2e-21
 Identities = 83/323 (25%), Positives = 151/323 (46%), Gaps = 1/323 (0%)
 Frame = +1

Query: 205  GGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKK 384
            G  + +  +R  IV  L EGGFA +Y+VK +        +  K    S  +      +K+
Sbjct: 23   GQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSK----SAITVGDIACLKR 78

Query: 385  VLIQNSEQLDLVKEEIRV-SSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMD 561
            V++ +   L+ ++ E+ V   L S PN++   D    A + ++G+    E  LL  +  +
Sbjct: 79   VIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSN--ASRRTDGKPG-FEVLLLMELCPN 135

Query: 562  GTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKG 741
             +LLD     +  K   S S++L+I   +  G+ +MH  +    H D+K  NVL+     
Sbjct: 136  KSLLDYMN--QRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNN 193

Query: 742  QPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTD 921
                  L D GS       + S  +   + +    H +  +RAPE+ D   +  I+E++D
Sbjct: 194  FK----LCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSD 249

Query: 922  IWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWM 1101
            IW+LG  LY +++  +PFE        + Q+AI++++  +P      KY   +   +  M
Sbjct: 250  IWALGIFLYKLLFYTTPFEI-------TGQMAILHSKYDFPPN----KYSSKIINLIIIM 298

Query: 1102 LQPQATVRPHIDDIVIHVDKLIS 1170
            L     +RP+I  +V H+  +++
Sbjct: 299  LAENPNLRPNIFQVVYHICSIMN 321



>gb:BC060622_2104098 Mus musculus cyclin G associated kinase, mRNA
            (cDNA clone MGC:79211 IMAGE:6826081), complete cds.
          Length = 1305

 Score =  105 bits (262), Expect = 2e-21
 Identities = 88/325 (27%), Positives = 148/325 (45%), Gaps = 5/325 (1%)
 Frame = +1

Query: 205  GGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKK 384
            G  V + + R R+ R L EGGFA+VY  +++                        YA+K+
Sbjct: 30   GQTVELGELRLRVRRVLAEGGFAFVYEAQDL-------------------GSGREYALKR 70

Query: 385  VLIQNSEQLDLVKEEIR-VSSLFSHPNLLPLLDHAVIAVKASE-GQSWKHEAYLLFPVHM 558
            +L    E+   + +E+  +  L  HPN++     A I  + S+ GQ+     +LL     
Sbjct: 71   LLSNEEEKNRAIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA----EFLLLTELC 126

Query: 559  DGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRK 738
             G L++    ++ K    S   +L+IF Q C  ++HMH  +P   H D+K  N+LL+++ 
Sbjct: 127  KGQLVEFLKRVECKGP-LSCDSILKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQG 185

Query: 739  GQPPLAILMDFGSARPARKQIR---SRSEALQLQEWASEHVSAPFRAPELWDCPSHADID 909
                   L DFGSA           S  +   ++E  + + +  +R PE+ D  S+  I 
Sbjct: 186  ----TIKLCDFGSATTISHYPDYSWSAQKRAMVEEEITRNTTPMYRTPEIVDLYSNFPIG 241

Query: 910  ERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQF 1089
            E+ DIW+LGC LY + +   PFE          +L IVN +   P  ++D +Y    H  
Sbjct: 242  EKQDIWALGCILYLLCFRQHPFE-------DGAKLRIVNGKYSIP--VNDTRY-TVFHDL 291

Query: 1090 VTWMLQPQATVRPHIDDIVIHVDKL 1164
            +  ML+     R  I ++V  + ++
Sbjct: 292  IRAMLKVNPVERLSIAEVVRQLQEI 316



>sp|P97874|GAK_RAT Cyclin G-associated kinase (EC
            2.7.1.-).>pir|T31096|T31096 cyclin G-associated kinase
            GAK - rat>gb:D38560_2112186 Rattus norvegicus mRNA for
            cyclinG-associated kinase, complete cds.
          Length = 1305

 Score =  105 bits (262), Expect = 2e-21
 Identities = 88/325 (27%), Positives = 148/325 (45%), Gaps = 5/325 (1%)
 Frame = +1

Query: 205  GGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKK 384
            G  V + + R R+ R L EGGFA+VY  +++                        YA+K+
Sbjct: 30   GQTVELGELRLRVRRVLAEGGFAFVYEAQDL-------------------GSGREYALKR 70

Query: 385  VLIQNSEQLDLVKEEIR-VSSLFSHPNLLPLLDHAVIAVKASE-GQSWKHEAYLLFPVHM 558
            +L    E+   + +E+  +  L  HPN++     A I  + S+ GQ+     +LL     
Sbjct: 71   LLSNEEEKNRAIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA----EFLLLTELC 126

Query: 559  DGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRK 738
             G L++    ++ K    S   +L+IF Q C  ++HMH  +P   H D+K  N+LL+++ 
Sbjct: 127  KGQLVEFLRRVECKGP-LSCDSILKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQG 185

Query: 739  GQPPLAILMDFGSARPARKQIR---SRSEALQLQEWASEHVSAPFRAPELWDCPSHADID 909
                   L DFGSA           S  +   ++E  + + +  +R PE+ D  S+  I 
Sbjct: 186  ----TIKLCDFGSATTISHYPDYSWSAQKRAMVEEEITRNTTPMYRTPEIVDLYSNFPIG 241

Query: 910  ERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQF 1089
            E+ DIW+LGC LY + +   PFE          +L IVN +   P  ++D +Y    H  
Sbjct: 242  EKQDIWALGCILYLLCFRQHPFE-------DGAKLRIVNGKYSIP--VNDTRY-TVFHDL 291

Query: 1090 VTWMLQPQATVRPHIDDIVIHVDKL 1164
            +  ML+     R  I ++V  + ++
Sbjct: 292  IRGMLKVNPEERLSIAEVVRQLQEI 316



>gb:BC065052_2105487 Mus musculus cyclin G associated kinase, mRNA
            (cDNA clone MGC:86144 IMAGE:5705695), complete cds.
          Length = 1305

 Score =  105 bits (261), Expect = 3e-21
 Identities = 88/325 (27%), Positives = 148/325 (45%), Gaps = 5/325 (1%)
 Frame = +1

Query: 205  GGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKK 384
            G  V + + R R+ R L EGGFA+VY  +++                        YA+K+
Sbjct: 30   GQTVELGELRLRVRRVLAEGGFAFVYEAQDL-------------------GSGREYALKR 70

Query: 385  VLIQNSEQLDLVKEEIR-VSSLFSHPNLLPLLDHAVIAVKASE-GQSWKHEAYLLFPVHM 558
            +L    E+   + +E+  +  L  HPN++     A I  + S+ GQ+     +LL     
Sbjct: 71   LLSNEEEKNRAIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA----EFLLLTELC 126

Query: 559  DGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRK 738
             G L++    ++ K    S   +L+IF Q C  ++HMH  +P   H D+K  N+LL+++ 
Sbjct: 127  KGQLVEFLKRVECKGP-LSCDSILKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQG 185

Query: 739  GQPPLAILMDFGSARPARKQIR---SRSEALQLQEWASEHVSAPFRAPELWDCPSHADID 909
                   L DFGSA           S  +   ++E  + + +  +R PE+ D  S+  I 
Sbjct: 186  ----TIKLCDFGSATTISHYPDYSWSAQKRAMVEEEITRNTTPMYRTPEIVDLYSNFPIG 241

Query: 910  ERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQF 1089
            E+ DIW+LGC LY + +   PFE          +L IVN +   P  ++D +Y    H  
Sbjct: 242  EKQDIWALGCILYLLCFRQHPFE-------DGAKLRIVNGKYSIP--VNDTRY-TVFHDL 291

Query: 1090 VTWMLQPQATVRPHIDDIVIHVDKL 1164
            +  ML+     R  I ++V  + ++
Sbjct: 292  IRAMLKVNPEERLSIAEVVRQLQEI 316



>gb:D88435_1995423 Homo sapiens mRNA for HsGAK, complete cds.
          Length = 1311

 Score =  104 bits (260), Expect = 4e-21
 Identities = 90/325 (27%), Positives = 146/325 (44%), Gaps = 5/325 (1%)
 Frame = +1

Query: 205  GGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKK 384
            G  V + + R R+ R L EGGFA+VY  +++                        YA+K+
Sbjct: 30   GQTVELGELRLRVRRVLAEGGFAFVYEAQDV-------------------GSGREYALKR 70

Query: 385  VLIQNSEQLDLVKEEIR-VSSLFSHPNLLPLLDHAVIAVKASE-GQSWKHEAYLLFPVHM 558
            +L    E+   + +E+  +  L  HPN++     A I  + S+ GQ+     +LL     
Sbjct: 71   LLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA----EFLLLTELC 126

Query: 559  DGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRK 738
             G L++    M+++    S   VL+IF Q C  ++HMH  +P   H D+K  N+LL+++ 
Sbjct: 127  KGQLVEFLKKMESRGP-LSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQG 185

Query: 739  GQPPLAILMDFGSARPARKQIR---SRSEALQLQEWASEHVSAPFRAPELWDCPSHADID 909
                   L DFGSA           S      ++E  + + +  +R PE+ D  S+  I 
Sbjct: 186  ----TIKLCDFGSATTISHYPDYSWSAQRRALVEEEITRNTTPMYRTPEIIDLYSNFPIG 241

Query: 910  ERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQF 1089
            E+ DIW+LGC LY + +   PFE          +L IVN +   P    D +Y    H  
Sbjct: 242  EKQDIWALGCILYLLCFRQHPFE-------DGAKLRIVNGKYSIPP--HDTQY-TVFHSL 291

Query: 1090 VTWMLQPQATVRPHIDDIVIHVDKL 1164
            +  MLQ     R  I ++V  + ++
Sbjct: 292  IRAMLQVNPEERLSIAEVVHQLQEI 316



>gb:AX710518_1473626 Sequence 10 from Patent
            WO03018626.>gb:AE016820_1749980 Ashbya gossypii (=
            Eremothecium gossypii) ATCC 10895 chromosome VII,
            complete sequence.
          Length = 961

 Score =  104 bits (260), Expect = 4e-21
 Identities = 84/324 (25%), Positives = 146/324 (45%), Gaps = 2/324 (0%)
 Frame = +1

Query: 190  DAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNG- 366
            + +  G  V +  ++  ++  L EGGFA++Y V  +       G + +          G 
Sbjct: 27   EMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFV-------GYTNELDRQDRILQPGD 79

Query: 367  TYAMKKVLIQNSEQLDLVKEEIRV-SSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLL 543
            T  +K+V + +   L+ ++ E+ V   L +  N++   D    A +  +G+   +E  LL
Sbjct: 80   TVCLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSN--ASRLGDGKPG-YEVLLL 136

Query: 544  FPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVL 723
              +  +G+LLD      A K   S ++VL+I   +  GL HMH       H D+K  NVL
Sbjct: 137  MELCPNGSLLDYMNQRLATK--LSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVL 194

Query: 724  LTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHAD 903
            +           L DFGS  P    + S  E   L      H +  +R+PE+ D      
Sbjct: 195  VDADNNFK----LCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLP 250

Query: 904  IDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALH 1083
            I+E++DIW+LG  LY +++  +PFE        + Q AI++++ + P       +   L 
Sbjct: 251  INEKSDIWALGIFLYKLLFYTTPFEL-------TGQFAILHSKYEIPRN----SFSSKLI 299

Query: 1084 QFVTWMLQPQATVRPHIDDIVIHV 1155
              V  ML     +RP++  ++ H+
Sbjct: 300  NLVIIMLAENPYLRPNVYQVMYHI 323



>sp|O14976|GAK_HUMAN Cyclin G-associated kinase (EC 2.7.1.-).
          Length = 1311

 Score =  104 bits (260), Expect = 4e-21
 Identities = 90/325 (27%), Positives = 146/325 (44%), Gaps = 5/325 (1%)
 Frame = +1

Query: 205  GGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKK 384
            G  V + + R R+ R L EGGFA+VY  +++                        YA+K+
Sbjct: 30   GQTVELGELRLRVRRVLAEGGFAFVYEAQDV-------------------GSGREYALKR 70

Query: 385  VLIQNSEQLDLVKEEIR-VSSLFSHPNLLPLLDHAVIAVKASE-GQSWKHEAYLLFPVHM 558
            +L    E+   + +E+  +  L  HPN++     A I  + S+ GQ+     +LL     
Sbjct: 71   LLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA----EFLLLTELC 126

Query: 559  DGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRK 738
             G L++    M+++    S   VL+IF Q C  ++HMH  +P   H D+K  N+LL+++ 
Sbjct: 127  KGQLVEFLKKMESRGP-LSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQG 185

Query: 739  GQPPLAILMDFGSARPARKQIR---SRSEALQLQEWASEHVSAPFRAPELWDCPSHADID 909
                   L DFGSA           S      ++E  + + +  +R PE+ D  S+  I 
Sbjct: 186  ----TIKLCDFGSATTISHYPDYSWSAQRRALVEEEITRNTTPMYRTPEIIDLYSNFPIG 241

Query: 910  ERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQF 1089
            E+ DIW+LGC LY + +   PFE          +L IVN +   P    D +Y    H  
Sbjct: 242  EKQDIWALGCILYLLCFRQHPFE-------DGAKLRIVNGKYSIPP--HDTQY-TVFHSL 291

Query: 1090 VTWMLQPQATVRPHIDDIVIHVDKL 1164
            +  MLQ     R  I ++V  + ++
Sbjct: 292  IRAMLQVNPEERLSIAEVVHQLQEI 316



>gb:AF083800_1767030 Arabidopsis thaliana clone sps916 unknown mRNA.
          Length = 149

 Score =  103 bits (258), Expect = 7e-21
 Identities = 49/70 (70%), Positives = 58/70 (82%)
 Frame = +1

Query: 319 GVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAV 498
           G+ KK KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HP LLP LDHA+I+V
Sbjct: 79  GLPKKVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPXLLPXLDHAIISV 138

Query: 499 KASEGQSWKH 528
           K     +WKH
Sbjct: 139 KDGXXGAWKH 148



>gb:CR382125_1657592 Kluyveromyces lactis strain NRRL Y-1140
            chromosome E of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 777

 Score =  103 bits (257), Expect = 9e-21
 Identities = 83/317 (26%), Positives = 150/317 (47%), Gaps = 2/317 (0%)
 Frame = +1

Query: 220  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN 399
            +  ++ ++++ L  GGFA+VY V+    DP  P              +    +K+V++ +
Sbjct: 17   VGSHQVKVLKYLASGGFAHVYSVEISPPDPVCP--------------DNVACLKRVVVPD 62

Query: 400  SEQLDLVKEEI-RVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD 576
               L+ ++ E+  + +L  +  ++  +D        + G    +E YLL      G L+D
Sbjct: 63   KASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGM---YEVYLLMEYCSGGGLID 119

Query: 577  NA-TAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPL 753
               T ++ + + F   ++L I  Q+  G+  MH  +P   H D+K  NVLL+        
Sbjct: 120  FMNTRLQNRLQEF---EILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFK-- 174

Query: 754  AILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSL 933
              L DFGS     +  R+  E   +Q    ++ +A +R PE+ D      IDE++DIW+L
Sbjct: 175  --LCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWAL 232

Query: 934  GCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQ 1113
            G  LY   Y  +PFE   GES      AI+ ++ ++P   + P+Y + +   ++ ML+  
Sbjct: 233  GVFLYKTCYYTTPFE-KNGES------AILASKFEFP---AYPRYSDRVKNLISVMLRVD 282

Query: 1114 ATVRPHIDDIVIHVDKL 1164
               RP+I  +V  V ++
Sbjct: 283  PLKRPNICQVVEEVSRI 299



>gb:AY118655_1300377 Drosophila melanogaster SD07306 full insert cDNA.
          Length = 698

 Score =  102 bits (255), Expect = 2e-20
 Identities = 84/296 (28%), Positives = 130/296 (43%), Gaps = 2/296 (0%)
 Frame = +1

Query: 253  LGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEI 432
            L EGGFA V+L +                +   +S    YA+K++ + N   L++ K EI
Sbjct: 52   LAEGGFAMVFLARG---------------NGGGSSSATKYALKRMYVNNEHDLNVAKREI 96

Query: 433  RVSS-LFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKE- 606
            +++S L  H N++  +D ++       G     E  LL P      L      M A+   
Sbjct: 97   QIASNLSGHKNIIGYVDSSI--TPTGNGVC---EVLLLMPYCKHHML----AMMNARLHV 147

Query: 607  SFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP 786
             F+  +VL IF  +   +  +H  +    H D+K  N+L T         +L DFGSA  
Sbjct: 148  GFTEPEVLNIFCDIAEAVSRLHYCQTPIIHRDLKVENILQTDAGN----FVLCDFGSAT- 202

Query: 787  ARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGV 966
            A+     +     +QE   ++ +  +RAPE+ D      I  + DIW+LGC LY + +  
Sbjct: 203  AKTLNPQQHGVTVVQEEIQKYTTLSYRAPEMIDLYGGKSITTKADIWALGCMLYKLCFFS 262

Query: 967  SPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHI 1134
             PF        G   LAI N Q   P      KY + +HQ + +ML+P    RP+I
Sbjct: 263  LPF--------GESTLAIQNGQFSIP---DSSKYSKGMHQLIKYMLEPDMEKRPNI 307



>gb:AF197910_1249987 Drosophila melanogaster Numb-associated kinase
            (Nak) mRNA, complete cds.
          Length = 1490

 Score =  102 bits (255), Expect = 2e-20
 Identities = 84/296 (28%), Positives = 130/296 (43%), Gaps = 2/296 (0%)
 Frame = +1

Query: 253  LGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEI 432
            L EGGFA V+L +                +   +S    YA+K++ + N   L++ K EI
Sbjct: 52   LAEGGFAMVFLARG---------------NGGGSSSATKYALKRMYVNNEHDLNVAKREI 96

Query: 433  RVSS-LFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKE- 606
            +++S L  H N++  +D ++       G     E  LL P      L      M A+   
Sbjct: 97   QIASNLSGHKNIIGYVDSSI--TPTGNGVC---EVLLLMPYCKHHML----AMMNARLHV 147

Query: 607  SFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP 786
             F+  +VL IF  +   +  +H  +    H D+K  N+L T         +L DFGSA  
Sbjct: 148  GFTEPEVLNIFCDIAEAVSRLHYCQTPIIHRDLKVENILQTDAGN----FVLCDFGSAT- 202

Query: 787  ARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGV 966
            A+     +     +QE   ++ +  +RAPE+ D      I  + DIW+LGC LY + +  
Sbjct: 203  AKTLNPQQHGVTVVQEEIQKYTTLSYRAPEMIDLYGGKSITTKADIWALGCMLYKLCFFS 262

Query: 967  SPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHI 1134
             PF        G   LAI N Q   P      KY + +HQ + +ML+P    RP+I
Sbjct: 263  LPF--------GESTLAIQNGQFSIP---DSSKYSKGMHQLIKYMLEPDMEKRPNI 307



>gb:AE014134_1129667 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE003661_1219774 Drosophila melanogaster
            chromosome 2L, section 70 of 83 of the complete sequence.
          Length = 698

 Score =  102 bits (255), Expect = 2e-20
 Identities = 84/296 (28%), Positives = 130/296 (43%), Gaps = 2/296 (0%)
 Frame = +1

Query: 253  LGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEI 432
            L EGGFA V+L +                +   +S    YA+K++ + N   L++ K EI
Sbjct: 52   LAEGGFAMVFLARG---------------NGGGSSSATKYALKRMYVNNEHDLNVAKREI 96

Query: 433  RVSS-LFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKE- 606
            +++S L  H N++  +D ++       G     E  LL P      L      M A+   
Sbjct: 97   QIASNLSGHKNIIGYVDSSI--TPTGNGVC---EVLLLMPYCKHHML----AMMNARLHV 147

Query: 607  SFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP 786
             F+  +VL IF  +   +  +H  +    H D+K  N+L T         +L DFGSA  
Sbjct: 148  GFTEPEVLNIFCDIAEAVSRLHYCQTPIIHRDLKVENILQTDAGN----FVLCDFGSAT- 202

Query: 787  ARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGV 966
            A+     +     +QE   ++ +  +RAPE+ D      I  + DIW+LGC LY + +  
Sbjct: 203  AKTLNPQQHGVTVVQEEIQKYTTLSYRAPEMIDLYGGKSITTKADIWALGCMLYKLCFFS 262

Query: 967  SPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHI 1134
             PF        G   LAI N Q   P      KY + +HQ + +ML+P    RP+I
Sbjct: 263  LPF--------GESTLAIQNGQFSIP---DSSKYSKGMHQLIKYMLEPDMEKRPNI 307



>gb:AE014134_1129665 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE003661_1219772 Drosophila melanogaster
            chromosome 2L, section 70 of 83 of the complete sequence.
          Length = 1488

 Score =  102 bits (255), Expect = 2e-20
 Identities = 84/296 (28%), Positives = 130/296 (43%), Gaps = 2/296 (0%)
 Frame = +1

Query: 253  LGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEI 432
            L EGGFA V+L +                +   +S    YA+K++ + N   L++ K EI
Sbjct: 52   LAEGGFAMVFLARG---------------NGGGSSSATKYALKRMYVNNEHDLNVAKREI 96

Query: 433  RVSS-LFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKE- 606
            +++S L  H N++  +D ++       G     E  LL P      L      M A+   
Sbjct: 97   QIASNLSGHKNIIGYVDSSI--TPTGNGVC---EVLLLMPYCKHHML----AMMNARLHV 147

Query: 607  SFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP 786
             F+  +VL IF  +   +  +H  +    H D+K  N+L T         +L DFGSA  
Sbjct: 148  GFTEPEVLNIFCDIAEAVSRLHYCQTPIIHRDLKVENILQTDAGN----FVLCDFGSAT- 202

Query: 787  ARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGV 966
            A+     +     +QE   ++ +  +RAPE+ D      I  + DIW+LGC LY + +  
Sbjct: 203  AKTLNPQQHGVTVVQEEIQKYTTLSYRAPEMIDLYGGKSITTKADIWALGCMLYKLCFFS 262

Query: 967  SPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHI 1134
             PF        G   LAI N Q   P      KY + +HQ + +ML+P    RP+I
Sbjct: 263  LPF--------GESTLAIQNGQFSIP---DSSKYSKGMHQLIKYMLEPDMEKRPNI 307



>gb:AE016817_1747167 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome IV, complete sequence.
          Length = 750

 Score =  101 bits (252), Expect = 3e-20
 Identities = 81/326 (24%), Positives = 151/326 (46%), Gaps = 1/326 (0%)
 Frame = +1

Query: 190  DAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGT 369
            D +  G  + +  +  +I++ L  GGFA +Y  + +   P +  ++              
Sbjct: 7    DCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLA-------------- 52

Query: 370  YAMKKVLIQNSEQLDLVKEEI-RVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLF 546
              +K+V + +   L+ ++ E+  +  L  H +++  +D         +G    +E YLL 
Sbjct: 53   -CLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGT---YEVYLLM 108

Query: 547  PVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLL 726
               + G L+D   +    +   S  +VL+I   +  G+  MH   P   H D+K  NVL+
Sbjct: 109  EYCLRGGLIDFMNSRLQTR--LSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLI 166

Query: 727  THRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADI 906
            +   G     +  DFGS     +  ++  E   +Q    ++ +A +RAPE+ D      +
Sbjct: 167  S---GDGDFKVC-DFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPV 222

Query: 907  DERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQ 1086
            DE++DIW+LG  LY + Y  +PFE  +GE+      AI+ A+ ++P   S P+Y + L  
Sbjct: 223  DEKSDIWALGVFLYKVCYFTTPFE-KVGEN------AILQAKFQFP---SYPQYTDRLKN 272

Query: 1087 FVTWMLQPQATVRPHIDDIVIHVDKL 1164
             ++ ML      RP+I  ++  V ++
Sbjct: 273  LISVMLSEHPVQRPNICQVLEEVSRI 298



>pir|T50369|T50369 probable serine/threonine-protein kinase [imported]
            - fission yeast (Schizosaccharomyces
            pombe)>gb:SPBC557_1720243 S.pombe chromosome II cosmid
            c557.
          Length = 872

 Score =  100 bits (250), Expect = 6e-20
 Identities = 83/309 (26%), Positives = 139/309 (44%), Gaps = 1/309 (0%)
 Frame = +1

Query: 241  IVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLV 420
            I + + EGGF++VYLV+        P                T  +K++   +   L  V
Sbjct: 27   IEKYIAEGGFSHVYLVQTNSKTDGSPI---------------TAVLKRMYSPDENALRFV 71

Query: 421  KEEIRVSSLF-SHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKA 597
            K EI    L  S+P+++  +D  +  ++ + G +   E  LL      G L+D     + 
Sbjct: 72   KTEIETMELLKSNPHVVSYIDSCIFPLEKA-GVNTGFEILLLMEYCAGGGLIDFMN--QR 128

Query: 598  KKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGS 777
             +   S  +VL+I   +  G+  +H   P   H D+K  NVLL+    +     L DFGS
Sbjct: 129  LQTRLSEHEVLKIISDIVQGVASLHYLRPPLIHRDLKVENVLLSFNTFK-----LCDFGS 183

Query: 778  ARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIM 957
                     + SE   L++  +   +  +RAPE+ +  S   IDE++D+W+LG  LY + 
Sbjct: 184  VTEPMHAAENSSEIQALEKSINTFTTYQYRAPEMINLYSGLGIDEKSDMWALGVLLYKLC 243

Query: 958  YGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHID 1137
            Y  +PFE   G +      AI+ A   +P     P Y  +L   +  +LQP   +RP+I 
Sbjct: 244  YYTTPFE-TQGPN------AILTASYSFP---PFPPYSHSLKNVIIALLQPNPCLRPNIF 293

Query: 1138 DIVIHVDKL 1164
             ++  + +L
Sbjct: 294  QLMCEICRL 302



>sp|P53974|KNC0_YEAST Probable serine/threonine-protein kinase YNL020C
            (EC 2.7.1.37).>pir|S62932|S62932 hypothetical protein
            YNL020c - yeast (Saccharomyces
            cerevisiae)>gb:SCYNL020C_1713605 S.cerevisiae chromosome
            XIV reading frame ORF YNL020c.
          Length = 638

 Score = 98.2 bits (243), Expect = 4e-19
 Identities = 81/314 (25%), Positives = 141/314 (44%), Gaps = 2/314 (0%)
 Frame = +1

Query: 199  NGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAM 378
            N G  + +  ++  I++ L  GGFA VY              S     P   S++    +
Sbjct: 10   NVGTQLTVGSHQVEIIKYLTSGGFAQVY--------------SALINPPDPHSNSSVACL 55

Query: 379  KKVLIQNSEQLDLVKEEIRVSSLFSHPN-LLPLLDHAVIAVKASEGQSWKHEAYLLFPVH 555
            K+V++ +   L+ ++ E+    L  +   ++  +D          G    +E ++L    
Sbjct: 56   KRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGS---YEVFVLMEYC 112

Query: 556  MDGTLLDNA-TAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH 732
              G L+D   T ++ +   F   ++LQI  Q+  G+  MH  +P   H D+K  NVL++ 
Sbjct: 113  ERGGLIDFMNTRLQNRLHEF---EILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISA 169

Query: 733  RKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDE 912
                     L DFGS     +  R+  E   +Q+   ++ +A +R+PE+ D      IDE
Sbjct: 170  NNEYK----LCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDE 225

Query: 913  RTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFV 1092
            ++DIW+LG  LY + Y  +PF     E GG   LAI++ + ++P     P Y E L   +
Sbjct: 226  KSDIWALGIFLYKLCYYTTPF-----EKGG--DLAILSGKFEFPL---YPNYSEQLKGLI 275

Query: 1093 TWMLQPQATVRPHI 1134
              +L      RP++
Sbjct: 276  RDILVQDPRHRPNV 289



>gb:CR380957_1653025 Candida glabrata strain CBS138 chromosome K
            complete sequence.
          Length = 991

 Score = 97.8 bits (242), Expect = 5e-19
 Identities = 82/338 (24%), Positives = 147/338 (43%), Gaps = 15/338 (4%)
 Frame = +1

Query: 205  GGDVWINDNRFRIVRQLGEGGFAYVYLVK-------------EILADPAKPGVSKKFKDP 345
            G  V +  +R  +V  L EGGFA +Y+VK             E +  P KPG        
Sbjct: 99   GKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPG-------- 150

Query: 346  SHASDNGTYAMKKVLIQNSEQLDLVKEEIRV-SSLFSHPNLLPLLDHAVIAVKASEGQSW 522
                      +K+VL+Q+   L+ ++ E+ V   L   PN++   D     ++   G   
Sbjct: 151  ------SPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNIT 204

Query: 523  K-HEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHN 699
            +  E  LL  +  + +LLD      A K   +  ++ +I   +   +  MH       H 
Sbjct: 205  QGFEVLLLMELCPNKSLLDYMNQRLATK--LTEQEIFKIMYDITLAVAQMHYLPVPLIHR 262

Query: 700  DVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPEL 879
            D+K  NVL+           L DFGS         S  +   L +    H +  +R+PE+
Sbjct: 263  DIKIENVLVDANNNFK----LCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEM 318

Query: 880  WDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSD 1059
             D   +  I+E++DIW+LG  LY +++  +PFE     +G   Q A+++++ ++P     
Sbjct: 319  IDLFKYIPINEKSDIWALGVFLYKLLFFTTPFE----RTG---QFAMLHSKFEFPPN--- 368

Query: 1060 PKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISK 1173
              Y   L   +  ML    ++RP+I  ++ ++ ++ ++
Sbjct: 369  -SYSSKLINLIIVMLAENPSLRPNIYQVLYYLSEVTNR 405



>gb:CR380956_1652128 Candida glabrata strain CBS138 chromosome J
            complete sequence.
          Length = 622

 Score = 97.8 bits (242), Expect = 5e-19
 Identities = 80/323 (24%), Positives = 148/323 (45%), Gaps = 1/323 (0%)
 Frame = +1

Query: 205  GGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKK 384
            G  V +  +   I++ L  GG+A +Y  + + AD        +F   + A       +K+
Sbjct: 12   GTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPAD--------QFLGTNMA------VLKR 57

Query: 385  VLIQNSEQLDLVKEEI-RVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMD 561
            V++ +   L+ ++ E+  +  L  H  ++  +D      +  +G    +E +L+      
Sbjct: 58   VIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGT---YEVFLIMEYCSR 114

Query: 562  GTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKG 741
            G L+D        +   + +++L I   +  G+  MH  +P   H D+K  NVL+++   
Sbjct: 115  GGLIDFMNTRLQNR--LTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHK 172

Query: 742  QPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTD 921
                  L DFGS     +  ++  E   ++       +A +RAPE+ D      +++++D
Sbjct: 173  YK----LCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSD 228

Query: 922  IWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWM 1101
            IW+LG  LY + Y  +PFE   GE+G      I+N  V++P     P Y +A+ Q +  M
Sbjct: 229  IWALGVFLYKLCYYTTPFEQT-GEAG------ILNGGVEFP---PYPHYSDAVKQLIMSM 278

Query: 1102 LQPQATVRPHIDDIVIHVDKLIS 1170
            L      RP+I  I+  V KL++
Sbjct: 279  LAKNPLHRPNIFQIIQTVSKLLN 301



>gb:AK046752_1167901 Mus musculus 4 days neonate thymus cDNA, RIKEN
            full-length enriched library, clone:B630007K10
            product:Bmp2-inducible kinase, full insert sequence.
          Length = 649

 Score = 97.4 bits (241), Expect = 6e-19
 Identities = 81/309 (26%), Positives = 137/309 (44%), Gaps = 2/309 (0%)
 Frame = +1

Query: 253  LGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEI 432
            L EGGF+ V+LV+                  +H+      A+K++ + N+  L++ K EI
Sbjct: 54   LAEGGFSTVFLVR------------------THSGIR--CALKRMYVNNTPDLNICKREI 93

Query: 433  RV-SSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKES 609
             +   L  H N++  LD AV ++  +    W  E  +L      G +++     K  +  
Sbjct: 94   TIMKELSGHKNIVGYLDCAVNSISDNV---W--EVLILMEYCRAGQVVNQMN--KKLQTG 146

Query: 610  FSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPA 789
            F+ S+VLQIF   C  +  +H  +    H D+K  N+LL          +L DFGSA   
Sbjct: 147  FTESEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDAGNY----VLCDFGSA--T 200

Query: 790  RKQIRSRSEALQL-QEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGV 966
             K +  + + + + +E   ++ +  +RAPE+ +      I  + DIW+LGC LY + +  
Sbjct: 201  NKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWALGCLLYKLCFFT 260

Query: 967  SPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIV 1146
             PF        G  Q+AI +     P    + +Y   +H  + +ML+P    RP I  + 
Sbjct: 261  LPF--------GESQVAICDGSFTIP---DNSRYSHNVHCLIRFMLEPDPECRPDIFQVS 309

Query: 1147 IHVDKLISK 1173
                K   K
Sbjct: 310  YFAFKFAKK 318



>sp|P38080|KBQ9_YEAST Probable serine/threonine-protein kinase YBR059C
            (EC 2.7.1.37).>pir|S45917|S45917 probable
            serine/threonine-specific protein kinase (EC 2.7.1.-)
            YBR059c - yeast (Saccharomyces
            cerevisiae)>gb:SCYBR059C_1711277 S.cerevisiae chromosome
            II reading frame ORF YBR059c.
          Length = 1108

 Score = 97.4 bits (241), Expect = 6e-19
 Identities = 83/326 (25%), Positives = 151/326 (46%), Gaps = 4/326 (1%)
 Frame = +1

Query: 205  GGDVWINDNRFRIVRQLGEGGFAYVYLVK--EILAD-PAKPGVSKKFKDPSHASDNGTYA 375
            G  V +  ++  +V  L EGGFA +Y+VK  E L +      V  K  D +         
Sbjct: 25   GHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVA--------C 76

Query: 376  MKKVLIQNSEQLDLVKEEIRV-SSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV 552
            +K+VL+Q+   L+ ++ E+ V   L   PN++   D    A +  +G     E  LL  +
Sbjct: 77   LKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSN--ASRRRDGVQG-FEVLLLMEL 133

Query: 553  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH 732
              + +LLD      + K   + +++++I   +   +  MH    S  H D+K  NVL+  
Sbjct: 134  CPNKSLLDYMNQRLSTK--LTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDA 191

Query: 733  RKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDE 912
            +        L DFGS       + +  +   L +    H +  +R+PE+ D      I+E
Sbjct: 192  KNNFK----LADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINE 247

Query: 913  RTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFV 1092
            ++DIW+LG  LY +++  +PFE        + Q AI++++ ++P      KY   L   +
Sbjct: 248  KSDIWALGVFLYKLLFFTTPFEM-------TGQFAILHSKYEFPVN----KYSSKLINLI 296

Query: 1093 TWMLQPQATVRPHIDDIVIHVDKLIS 1170
              ML     +RP+I  ++ H+ ++++
Sbjct: 297  IIMLAENPNLRPNIYQVLYHLCEILN 322



>sp|Q91Z96|BM2K_MOUSE BMP-2 inducible protein kinase (EC 2.7.1.37)
            (BIKe).>gb:AY050249_2074560 Mus musculus BMP-2 inducible
            kinase mRNA, complete cds.
          Length = 1138

 Score = 97.4 bits (241), Expect = 6e-19
 Identities = 81/309 (26%), Positives = 137/309 (44%), Gaps = 2/309 (0%)
 Frame = +1

Query: 253  LGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEI 432
            L EGGF+ V+LV+                  +H+      A+K++ + N+  L++ K EI
Sbjct: 54   LAEGGFSTVFLVR------------------THSGIR--CALKRMYVNNTPDLNICKREI 93

Query: 433  RV-SSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKES 609
             +   L  H N++  LD AV ++  +    W  E  +L      G +++     K  +  
Sbjct: 94   TIMKELSGHKNIVGYLDCAVNSISDNV---W--EVLILMEYCRAGQVVNQMN--KKLQTG 146

Query: 610  FSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPA 789
            F+ S+VLQIF   C  +  +H  +    H D+K  N+LL          +L DFGSA   
Sbjct: 147  FTESEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDAGNY----VLCDFGSA--T 200

Query: 790  RKQIRSRSEALQL-QEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGV 966
             K +  + + + + +E   ++ +  +RAPE+ +      I  + DIW+LGC LY + +  
Sbjct: 201  NKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWALGCLLYKLCFFT 260

Query: 967  SPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIV 1146
             PF        G  Q+AI +     P    + +Y   +H  + +ML+P    RP I  + 
Sbjct: 261  LPF--------GESQVAICDGSFTIP---DNSRYSHNVHCLIRFMLEPDPECRPDIFQVS 309

Query: 1147 IHVDKLISK 1173
                K   K
Sbjct: 310  YFAFKFAKK 318



>gb:CR382135_1668495 Debaryomyces hansenii chromosome C of strain
            CBS767 of Debaryomyces hansenii.
          Length = 759

 Score = 94.4 bits (233), Expect = 5e-18
 Identities = 87/356 (24%), Positives = 150/356 (42%), Gaps = 8/356 (2%)
 Frame = +1

Query: 205  GGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKK 384
            G  + +  +   I++ L EGGFA+VY                   DP     N    +K+
Sbjct: 12   GTKLTVGSHDISIIKYLSEGGFAHVYTCHI---------------DPPFRGSN-IACLKR 55

Query: 385  VLIQNSEQLDLVKEEI-RVSSLFSHPNLLPLLD-HAVIAVKASEGQSW--KHEAYLLFPV 552
            V + N  QL+L+++E+  +  L  + +++  +D HA        G S   ++E ++L   
Sbjct: 56   VAVPNKLQLNLLRQEVDSMKRLKGNKHIVSYIDSHASRLGNPGGGHSTTQQYEVFVLMEY 115

Query: 553  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH 732
                 L+D        K   +  ++L I   +  G+   H+ +P   H D+K  NVL+  
Sbjct: 116  CSKNGLIDYMNTRLTHK--LTEPEILTIMHDITIGVAMCHHLKPPLLHRDIKIENVLIDS 173

Query: 733  RKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDE 912
            +     +  L DFGSA       ++  E  +L +   +H +  +RAPE+ D      ID+
Sbjct: 174  KG----VYKLCDFGSAVGYLPVPKNAKEFSELHDDLMQHTTPQYRAPEMIDLSRGFPIDD 229

Query: 913  RTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQ--VKWPTGLSDPKYPEALHQ 1086
            + DIW+LGC LY + Y  +PFE     S   ++  I+N    +K P       +   L  
Sbjct: 230  KLDIWALGCFLYKLCYYTTPFELPSHSSLQDMEKLILNCSNTLKLPHNQPGLIFSSRLKN 289

Query: 1087 FVTWMLQPQATVRPHIDDIV--IHVDKLISKFSH*EVRCRPKRHAHNYFAKNMIRS 1248
             +   L+     RP+   ++  I + K I K            H HN    +M+ +
Sbjct: 290  VIKCCLRDDPRRRPNAVQLLEEICLMKGIKKVPDVIPYTLKDHHGHNKAHPHMVNN 345



>gb:HSM801970_2017391 Homo sapiens mRNA; cDNA DKFZp434P0116 (from
            clone DKFZp434P0116).
          Length = 661

 Score = 93.6 bits (231), Expect = 9e-18
 Identities = 80/320 (25%), Positives = 138/320 (43%), Gaps = 2/320 (0%)
 Frame = +1

Query: 220  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN 399
            +  ++  +   L EGGF+ V+LV+                  +H       A+K++ + N
Sbjct: 46   VGRHQVTLEESLAEGGFSTVFLVR------------------THGGIR--CALKRMYVNN 85

Query: 400  SEQLDLVKEEIRV-SSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD 576
               L++ K EI +   L  H N++  LD AV ++  +    W  E  +L      G +++
Sbjct: 86   MPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNV---W--EVLILMEYCRAGQVVN 140

Query: 577  NATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLA 756
                 K  +  F+  +VLQIF   C  +  +H  +    H D+K  N+LL          
Sbjct: 141  QMN--KKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDGGNY---- 194

Query: 757  ILMDFGSARPARKQIRSRSEALQL-QEWASEHVSAPFRAPELWDCPSHADIDERTDIWSL 933
            +L DFGSA    K +  + + + + +E   ++ +  +RAPE+ +      I  + DIW+L
Sbjct: 195  VLCDFGSA--TNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWAL 252

Query: 934  GCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQ 1113
            GC LY + +   PF        G  Q+AI +     P    + +Y   +H  + +ML+P 
Sbjct: 253  GCLLYKLCFFTLPF--------GESQVAICDGNFTIP---DNSRYSRNIHCLIRFMLEPD 301

Query: 1114 ATVRPHIDDIVIHVDKLISK 1173
               RP I  +     K   K
Sbjct: 302  PEHRPDIFQVSYFAFKFAKK 321



>gb:BC036021_1981799 Homo sapiens BMP2 inducible kinase, transcript
            variant 2, mRNA (cDNA clone MGC:33000 IMAGE:5272264),
            complete cds.
          Length = 662

 Score = 93.6 bits (231), Expect = 9e-18
 Identities = 80/320 (25%), Positives = 138/320 (43%), Gaps = 2/320 (0%)
 Frame = +1

Query: 220  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN 399
            +  ++  +   L EGGF+ V+LV+                  +H       A+K++ + N
Sbjct: 46   VGRHQVTLEESLAEGGFSTVFLVR------------------THGGIR--CALKRMYVNN 85

Query: 400  SEQLDLVKEEIRV-SSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD 576
               L++ K EI +   L  H N++  LD AV ++  +    W  E  +L      G +++
Sbjct: 86   MPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNV---W--EVLILMEYCRAGQVVN 140

Query: 577  NATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLA 756
                 K  +  F+  +VLQIF   C  +  +H  +    H D+K  N+LL          
Sbjct: 141  QMN--KKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDGGNY---- 194

Query: 757  ILMDFGSARPARKQIRSRSEALQL-QEWASEHVSAPFRAPELWDCPSHADIDERTDIWSL 933
            +L DFGSA    K +  + + + + +E   ++ +  +RAPE+ +      I  + DIW+L
Sbjct: 195  VLCDFGSA--TNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWAL 252

Query: 934  GCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQ 1113
            GC LY + +   PF        G  Q+AI +     P    + +Y   +H  + +ML+P 
Sbjct: 253  GCLLYKLCFFTLPF--------GESQVAICDGNFTIP---DNSRYSRNIHCLIRFMLEPD 301

Query: 1114 ATVRPHIDDIVIHVDKLISK 1173
               RP I  +     K   K
Sbjct: 302  PEHRPDIFQVSYFAFKFAKK 321



>gb:AX282120_1465179 Sequence 3 from Patent WO0177150.
          Length = 389

 Score = 93.6 bits (231), Expect = 9e-18
 Identities = 80/320 (25%), Positives = 138/320 (43%), Gaps = 2/320 (0%)
 Frame = +1

Query: 220  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN 399
            +  ++  +   L EGGF+ V+LV+                  +H       A+K++ + N
Sbjct: 15   VGRHQVTLEESLAEGGFSTVFLVR------------------THGGIR--CALKRMYVNN 54

Query: 400  SEQLDLVKEEIRV-SSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD 576
               L++ K EI +   L  H N++  LD AV ++  +    W  E  +L      G +++
Sbjct: 55   MPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNV---W--EVLILMEYCRAGQVVN 109

Query: 577  NATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLA 756
                 K  +  F+  +VLQIF   C  +  +H  +    H D+K  N+LL          
Sbjct: 110  QMN--KKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDGGNY---- 163

Query: 757  ILMDFGSARPARKQIRSRSEALQL-QEWASEHVSAPFRAPELWDCPSHADIDERTDIWSL 933
            +L DFGSA    K +  + + + + +E   ++ +  +RAPE+ +      I  + DIW+L
Sbjct: 164  VLCDFGSA--TNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWAL 221

Query: 934  GCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQ 1113
            GC LY + +   PF        G  Q+AI +     P    + +Y   +H  + +ML+P 
Sbjct: 222  GCLLYKLCFFTLPF--------GESQVAICDGNFTIP---DNSRYSRNIHCLIRFMLEPD 270

Query: 1114 ATVRPHIDDIVIHVDKLISK 1173
               RP I  +     K   K
Sbjct: 271  PEHRPDIFQVSYFAFKFAKK 290



>pir|T46364|T46364 hypothetical protein DKFZp434P0116.1 - human
            (fragments)
          Length = 661

 Score = 93.6 bits (231), Expect = 9e-18
 Identities = 80/320 (25%), Positives = 138/320 (43%), Gaps = 2/320 (0%)
 Frame = +1

Query: 220  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN 399
            +  ++  +   L EGGF+ V+LV+                  +H       A+K++ + N
Sbjct: 46   VGRHQVTLEESLAEGGFSTVFLVR------------------THGGIR--CALKRMYVNN 85

Query: 400  SEQLDLVKEEIRV-SSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD 576
               L++ K EI +   L  H N++  LD AV ++  +    W  E  +L      G +++
Sbjct: 86   MPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNV---W--EVLILMEYCRAGQVVN 140

Query: 577  NATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLA 756
                 K  +  F+  +VLQIF   C  +  +H  +    H D+K  N+LL          
Sbjct: 141  QMN--KKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDGGNY---- 194

Query: 757  ILMDFGSARPARKQIRSRSEALQL-QEWASEHVSAPFRAPELWDCPSHADIDERTDIWSL 933
            +L DFGSA    K +  + + + + +E   ++ +  +RAPE+ +      I  + DIW+L
Sbjct: 195  VLCDFGSA--TNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWAL 252

Query: 934  GCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQ 1113
            GC LY + +   PF        G  Q+AI +     P    + +Y   +H  + +ML+P 
Sbjct: 253  GCLLYKLCFFTLPF--------GESQVAICDGNFTIP---DNSRYSRNIHCLIRFMLEPD 301

Query: 1114 ATVRPHIDDIVIHVDKLISK 1173
               RP I  +     K   K
Sbjct: 302  PEHRPDIFQVSYFAFKFAKK 321



>sp|Q9NSY1|BM2K_HUMAN BMP-2 inducible protein kinase (EC 2.7.1.37)
            (BIKe) (HRIHFB2017).
          Length = 1161

 Score = 93.6 bits (231), Expect = 9e-18
 Identities = 80/320 (25%), Positives = 138/320 (43%), Gaps = 2/320 (0%)
 Frame = +1

Query: 220  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN 399
            +  ++  +   L EGGF+ V+LV+                  +H       A+K++ + N
Sbjct: 46   VGRHQVTLEESLAEGGFSTVFLVR------------------THGGIR--CALKRMYVNN 85

Query: 400  SEQLDLVKEEIRV-SSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD 576
               L++ K EI +   L  H N++  LD AV ++  +    W  E  +L      G +++
Sbjct: 86   MPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNV---W--EVLILMEYCRAGQVVN 140

Query: 577  NATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLA 756
                 K  +  F+  +VLQIF   C  +  +H  +    H D+K  N+LL          
Sbjct: 141  QMN--KKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDGGNY---- 194

Query: 757  ILMDFGSARPARKQIRSRSEALQL-QEWASEHVSAPFRAPELWDCPSHADIDERTDIWSL 933
            +L DFGSA    K +  + + + + +E   ++ +  +RAPE+ +      I  + DIW+L
Sbjct: 195  VLCDFGSA--TNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWAL 252

Query: 934  GCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQ 1113
            GC LY + +   PF        G  Q+AI +     P    + +Y   +H  + +ML+P 
Sbjct: 253  GCLLYKLCFFTLPF--------GESQVAICDGNFTIP---DNSRYSRNIHCLIRFMLEPD 301

Query: 1114 ATVRPHIDDIVIHVDKLISK 1173
               RP I  +     K   K
Sbjct: 302  PEHRPDIFQVSYFAFKFAKK 321



>pir|T41681|T41681 probable serine/threonine-protein kinase - fission
            yeast  (Schizosaccharomyces pombe)>gb:SPCP1E11_1721723
            S.pombe chromosome III p1 clone p1E11.
          Length = 650

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 85/308 (27%), Positives = 135/308 (43%)
 Frame = +1

Query: 241  IVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLV 420
            + R L EGGF++VYLV+  L  P KP        P  A       +K++   ++  L  V
Sbjct: 35   VKRYLAEGGFSHVYLVQ--LVFPGKP--------PFEA------VLKRIFATDAMALRAV 78

Query: 421  KEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAK 600
             EE+R   L S+     +  +     + S+ Q    E  +L      G L+D        
Sbjct: 79   HEEVRTMKLVSNQKRC-VSYYGSEFFRTSKNQ---FEVLVLLEYCPCGGLIDFLNTRLQV 134

Query: 601  KESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSA 780
            +   S  ++L+I   +   +  MH  +P   H D+K  NVLL      P    L DFGSA
Sbjct: 135  R--LSEQEILKIASDVTEAVAVMHYLKPPLIHRDLKIENVLLA----APNSYKLCDFGSA 188

Query: 781  RPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMY 960
                   ++ +EA QL+    +  +  +R PE+ +      IDE++DIW+LG   Y + Y
Sbjct: 189  CHPIPGAKTAAEAKQLEYDIEKFTTWQYRCPEMINVHKGFGIDEKSDIWALGVLFYKLCY 248

Query: 961  GVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDD 1140
              +PFE+           AI+N    +PT    P Y + L + ++ +LQ     RP+I  
Sbjct: 249  YTTPFEH-------QGLAAIMNVSYAFPT---FPPYSDRLKRLISTLLQQYPWQRPNIYQ 298

Query: 1141 IVIHVDKL 1164
                + K+
Sbjct: 299  TFCEICKM 306



>gb:AE017342_1754990 Cryptococcus neoformans var. neoformans JEC21
            chromosome 2, complete sequence.
          Length = 1122

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 81/288 (28%), Positives = 128/288 (44%), Gaps = 3/288 (1%)
 Frame = +1

Query: 238  RIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDL 417
            RI R L EGG+A+VYL          PG S + K          + +K++  Q+      
Sbjct: 61   RIERYLSEGGYAHVYLTTSD-TPIYPPGRSAEKKGRWGDKGYTQHCLKRIAFQDDSVWVD 119

Query: 418  VKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQS--WKHEAYLLFPVHMDGTLLDNATAM 591
            VK+EI V         LP   H V  + +S  +S   +HE ++L      G ++D     
Sbjct: 120  VKKEIEVMKS------LPPNSHLVQYLGSSHTRSPAGQHEVFILMEFCAGGGIIDLLN-- 171

Query: 592  KAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDF 771
            K  ++     ++L IF  +C  +  MH+ +    H D+K    L+           L DF
Sbjct: 172  KRLRDRLKEIEILNIFTDVCEAVAAMHSLKQPLLHRDLKRPTSLIFK---------LCDF 222

Query: 772  GSAR-PARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLY 948
            GS   PA +  +++ EA  L    + H +  +R+PE+ +      +   +D+W+LGC LY
Sbjct: 223  GSTTFPADRPPQTKLEADALAMDLNRHTTLQYRSPEMVEPMLGLPVGLPSDVWALGCLLY 282

Query: 949  AIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFV 1092
             + Y  +PFE    E G    LAIVNA+  +P     P+Y   L   +
Sbjct: 283  KLCYYTTPFE----EHG---PLAIVNAKYTFP---PMPQYSPRLQHLI 320



>gb:BC086712_2564929 Danio rerio zgc:101641, mRNA (cDNA clone
            MGC:101641 IMAGE:7225745), complete cds.
          Length = 646

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 78/302 (25%), Positives = 132/302 (43%), Gaps = 2/302 (0%)
 Frame = +1

Query: 274  YVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRV-SSLF 450
            Y   V+E++A+    G S  F   +H+      A+K++ + N   L++ + EI +   L 
Sbjct: 38   YQVTVEELIAEG---GFSMVFLARTHSGVR--CALKRMYVNNVHDLNIFRREITIMKELS 92

Query: 451  SHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVL 630
             H N++  LD    AV  S    W  E  +L      G ++      +     F+ ++VL
Sbjct: 93   GHKNIVRYLDTTTNAVGDSV---W--EVLILMEYCKAGQVVKQMN--QRLHIGFTEAEVL 145

Query: 631  QIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSR 810
             IF   C  +  +H  +    H D+K  N+LL  +       +L DFGSA    K +   
Sbjct: 146  NIFCDACEAVARLHQCKTPIIHRDLKVENILLNDQGNY----VLCDFGSA--THKVLLPH 199

Query: 811  SEALQ-LQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYAL 987
             + +  +++   ++ +  +RAPE+ +      I  + DIW+LGC LY + +   PF    
Sbjct: 200  KDGITAVEDEIKKYTTLSYRAPEMINLYQGKAITTKADIWALGCLLYKLCFFTLPF---- 255

Query: 988  GESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLI 1167
                G  Q+AI +     P G    K+   LH  + +ML+P    RP I  +     +L 
Sbjct: 256  ----GESQVAICDGTFAVPDG---SKFSSKLHGLIRYMLEPDQEKRPDIYQVSYFAFRLA 308

Query: 1168 SK 1173
             K
Sbjct: 309  GK 310



>gb:AE014297_1137765 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE014297_1137766 Drosophila melanogaster
            chromosome 3R, complete sequence.>gb:AE003607_1217641
            Drosophila melanogaster chromosome 3R, section 1 of 118
            of the complete sequence.>gb:AE003607_1217642 Drosophila
            melanogaster chromosome 3R, section 1 of 118 of the
            complete sequence.
          Length = 1165

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 78/293 (26%), Positives = 130/293 (44%), Gaps = 5/293 (1%)
 Frame = +1

Query: 205  GGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGT-YAMK 381
            G  V +  +R RI   + EGG+A+VY+ +++                      GT YA+K
Sbjct: 40   GQVVEVAGHRLRIKCVIAEGGYAFVYVAQDV--------------------QTGTEYALK 79

Query: 382  KVLIQNSEQLDLVKEEIRV-SSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHM 558
            +++  + +    +  EI +   L  H N++  +  +  A     G  +     LL  +  
Sbjct: 80   RLIGADMQASTAIINEINIHKQLSGHENIVAFVGSSYTAPSTQLGAQY----LLLTELCK 135

Query: 559  DGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRK 738
             G+L+D     +     F+ + VL+IF Q+   +  +H+  P  AH D+K  N L+    
Sbjct: 136  GGSLVD---CFRTNNAPFNPTCVLRIFYQMARAVASLHSQSPPIAHRDIKIENFLI---- 188

Query: 739  GQPPLAILMDFGSARPARKQIR---SRSEALQLQEWASEHVSAPFRAPELWDCPSHADID 909
            G      L DFGSA           S ++   L++  +   +  +R+PE+ D  S+  I 
Sbjct: 189  GNDKQIKLCDFGSASTEVLSPTFEWSANQRSMLEDQLNTVTTPMYRSPEMLDTWSNNPIG 248

Query: 910  ERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKY 1068
             + DIW+LGC LY + Y   P+     E GG L+  I+NA    P    DP+Y
Sbjct: 249  PKVDIWALGCILYFLCYRKHPY-----EDGGKLR--IINANYMLP---PDPQY 291



>gb:CR382138_1670967 Debaryomyces hansenii chromosome F of strain
            CBS767 of Debaryomyces hansenii.
          Length = 1003

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 82/317 (25%), Positives = 144/317 (45%), Gaps = 2/317 (0%)
 Frame = +1

Query: 205  GGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKK 384
            G  + +  ++  I++ L EGGFA++Y VK    DP +              D     +K+
Sbjct: 10   GTQLPVGGHQVTILKYLSEGGFAHIYKVK---IDPKE-------------EDTDIACLKR 53

Query: 385  VLIQNSEQLDLVKEEIRV-SSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMD 561
            V++ +   LD +++E+ V  +L    N++   D       A+  ++  ++  +L  +  +
Sbjct: 54   VIVPDKNGLDQLRKEVDVMKNLRYGRNIVKYYDS-----HAARLENGTYQVLVLMELCPN 108

Query: 562  GTLLDNATAMKAK-KESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRK 738
             +LLD    M  K K   +  ++L+I   +  G+  MH  +    H D+K  NVL+  + 
Sbjct: 109  KSLLDY---MNVKIKTKLTEPEILKIMLDISIGIYEMHKMK--LVHRDIKIENVLIDAKN 163

Query: 739  GQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERT 918
                   L DFGS        + + +   L        +  +RAPE+ D      IDE+ 
Sbjct: 164  DFK----LCDFGSTSSPIMPPKDQQQFQLLSHDIMYQTTPQYRAPEMIDLYRGFPIDEKA 219

Query: 919  DIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTW 1098
            DIW+LGC LY + Y  +PFE A G+      +AI++A  ++   L  P +   L   +  
Sbjct: 220  DIWALGCFLYKLCYYTTPFE-ANGD------IAILHATFQF---LPAPVFSGDLKNLIII 269

Query: 1099 MLQPQATVRPHIDDIVI 1149
            MLQ     RP+I  +++
Sbjct: 270  MLQENPLFRPNIVQVLM 286



>gb:CR382126_1659178 Kluyveromyces lactis strain NRRL Y-1140
            chromosome F of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 814

 Score = 87.4 bits (215), Expect = 7e-16
 Identities = 80/320 (25%), Positives = 142/320 (44%), Gaps = 2/320 (0%)
 Frame = +1

Query: 214  VWINDNRFRIVRQLGEGGFAYVYLVKEI-LADPAKPGVSKKFKDPSHASDNGTYAMKKVL 390
            V +  +R  I+  L EGGFA +Y VK + L +    G+  K       +      +K+V+
Sbjct: 35   VVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIA-----CLKRVI 89

Query: 391  IQNSEQLDLVKEEIR-VSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
            + +   L+ ++ E+  +  L   PN++   D    A +  +G S   E  LL  +    +
Sbjct: 90   VPDENGLNELRNEVETMKQLRGSPNIVQYYDSN--ASRHPDG-SPGFEILLLMELCPKKS 146

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            LLD      A K   + +++L+I   +   +  MH       H D+K  NVL+       
Sbjct: 147  LLDYMNNKLATK--LTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFK 204

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
                L DFGS       + +  +   L      H +  +R+PE+ D      I+E++DIW
Sbjct: 205  ----LCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIW 260

Query: 928  SLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQ 1107
            +LG  LY +++  +PFE        + Q AI++++ + P       Y   L   +  ML 
Sbjct: 261  ALGIFLYKLLFYTTPFEL-------TGQFAILHSKYEIPQN----GYSSKLINLIIIMLA 309

Query: 1108 PQATVRPHIDDIVIHVDKLI 1167
               ++RP+I  ++ HV  ++
Sbjct: 310  ENPSLRPNIYQVMHHVCSIL 329



>pir|T21800|T21800 hypothetical protein F35G12.3a - Caenorhabditis
            elegans>gb:AF256466_1256559 Caenorhabditis elegans SEL-5A
            serine/threonine kinase mRNA, complete
            cds.>gb:CEF35G12_1363446 Caenorhabditis elegans cosmid
            F35G12, complete sequence.
          Length = 1077

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 78/315 (24%), Positives = 135/315 (42%), Gaps = 10/315 (3%)
 Frame = +1

Query: 220  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN 399
            ++  R  I +Q+ EGGFA VY+  +                      N  +A+K+   ++
Sbjct: 42   LDHTRVTIEKQIAEGGFAIVYVASD--------------------RKNNKFALKRQFTKD 81

Query: 400  SE-QLDLV-KEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLL 573
            +E QL+   +E   +     H N++  +D     +       W  E  LL   H    +L
Sbjct: 82   NEKQLEACCREHSFLKQCIGHKNIVEFVDSYTNCLGNG---IW--ECMLLTEYHQKN-VL 135

Query: 574  DNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPL 753
                   ++ +  +  ++L IF  LC  +  +HN      H D+K  NVL++  K  PP 
Sbjct: 136  QLMNERISQNQYLTNDEILSIFTDLCEAVSFIHNRPQPIIHRDLKVENVLISSHK--PPH 193

Query: 754  AILMDFGSARPARKQIRSRSEALQLQEWASEHVSAP--------FRAPELWDCPSHADID 909
             +L DFGSA          ++ L ++++  E+V +         +R+PE+ D  S  +I 
Sbjct: 194  YVLCDFGSAT---------TQILSVEKYGVEYVKSEVERNTTMCYRSPEMIDFYSGLEIG 244

Query: 910  ERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQF 1089
             ++DIW+LG  LY + +   PFE +         LAI +   ++P   S P  P+ +   
Sbjct: 245  LKSDIWALGVLLYRLCFFCVPFEES--------PLAIQSVNYQFP---SVPNIPDEIKVL 293

Query: 1090 VTWMLQPQATVRPHI 1134
            +  +L      RP I
Sbjct: 294  IYMLLDIDVNRRPSI 308



>pir|T21806|T21806 hypothetical protein F35G12.3b - Caenorhabditis
            elegans>gb:AF256467_1256560 Caenorhabditis elegans SEL-5B
            serine/threonine kinase mRNA, complete
            cds.>gb:CEF35G12_1363447 Caenorhabditis elegans cosmid
            F35G12, complete sequence.
          Length = 690

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 78/315 (24%), Positives = 135/315 (42%), Gaps = 10/315 (3%)
 Frame = +1

Query: 220  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN 399
            ++  R  I +Q+ EGGFA VY+  +                      N  +A+K+   ++
Sbjct: 42   LDHTRVTIEKQIAEGGFAIVYVASD--------------------RKNNKFALKRQFTKD 81

Query: 400  SE-QLDLV-KEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLL 573
            +E QL+   +E   +     H N++  +D     +       W  E  LL   H    +L
Sbjct: 82   NEKQLEACCREHSFLKQCIGHKNIVEFVDSYTNCLGNG---IW--ECMLLTEYHQKN-VL 135

Query: 574  DNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPL 753
                   ++ +  +  ++L IF  LC  +  +HN      H D+K  NVL++  K  PP 
Sbjct: 136  QLMNERISQNQYLTNDEILSIFTDLCEAVSFIHNRPQPIIHRDLKVENVLISSHK--PPH 193

Query: 754  AILMDFGSARPARKQIRSRSEALQLQEWASEHVSAP--------FRAPELWDCPSHADID 909
             +L DFGSA          ++ L ++++  E+V +         +R+PE+ D  S  +I 
Sbjct: 194  YVLCDFGSAT---------TQILSVEKYGVEYVKSEVERNTTMCYRSPEMIDFYSGLEIG 244

Query: 910  ERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQF 1089
             ++DIW+LG  LY + +   PFE +         LAI +   ++P   S P  P+ +   
Sbjct: 245  LKSDIWALGVLLYRLCFFCVPFEES--------PLAIQSVNYQFP---SVPNIPDEIKVL 293

Query: 1090 VTWMLQPQATVRPHI 1134
            +  +L      RP I
Sbjct: 294  IYMLLDIDVNRRPSI 308



>gb:AE014188_968261 Plasmodium falciparum 3D7 chromosome 12, complete
            sequence.>gb:AE014851_1229653 Plasmodium falciparum 3D7
            chromosome 12, section 8 of 9 of the complete sequence.
          Length = 909

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 67/283 (23%), Positives = 124/283 (43%), Gaps = 3/283 (1%)
 Frame = +1

Query: 205  GGDVW-INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMK 381
            GG V+ IN    R  + + EG +++VY+ K++                   + N  Y +K
Sbjct: 13   GGKVYNINGKTIREEKLISEGAYSFVYMAKDL-------------------NTNRAYTIK 53

Query: 382  KVLIQNSEQLDLVKEEIRV-SSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHM 558
            K + Q+ E++D+  +EI +  SL  H N++      +I+          ++  ++   + 
Sbjct: 54   KTICQDKEKIDMANKEINILKSLPPHKNIVQYYGSTIISEN-------NYKIVIMLMEYC 106

Query: 559  D-GTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHR 735
            + G LL+     +  K+      ++ I + +  GL  +HN E    H D+K  N+L   +
Sbjct: 107  ERGNLLN---IFQKNKDKIKEIHIVNILKDIITGLCFLHNQEIPIIHRDIKLENILCD-K 162

Query: 736  KGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDER 915
             G   +        +        S+SE   L+E      +  +R PEL D  S+ +I  +
Sbjct: 163  NGVYKICDFCSHSISNSFFPNDLSKSELSNLKEEIERDTTLIYRPPELIDLYSNFEISWK 222

Query: 916  TDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWP 1044
             DIW +GC LY +++ + PF+        +  L+I+NA    P
Sbjct: 223  IDIWMVGCILYLLLFKIHPFQ-------NNNFLSIINASFTIP 258



>gb:CR380954_1651099 Candida glabrata strain CBS138 chromosome H
            complete sequence.
          Length = 399

 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 42/162 (25%), Positives = 87/162 (53%)
 Frame = +1

Query: 685  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPF 864
            SY+H  + P N++ +       L I+ + GS   A  +I++  +  +L+EW  ++ ++ +
Sbjct: 246  SYSHKMLSPSNIIFSSNG----LPIISELGSCSKADVEIKTAKQLNRLREWVDDNFNS-Y 300

Query: 865  RAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWP 1044
             APE  D  +++ +  + D+WS GC  YA+++G++PFE      G S++ AI   +  +P
Sbjct: 301  MAPEFLDLKTNSKLSTKVDVWSFGCICYALLFGMNPFEREEQLYGASIKYAISTGKFSFP 360

Query: 1045 TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLIS 1170
               S  +Y +++   +   LQ   + RP +  ++ ++ +L S
Sbjct: 361  ---SQSRYSDSILDIIRSCLQVDPSERPSVSIVLNNLQQLQS 399



 Score = 38.5 bits (88), Expect = 0.35
 Identities = 37/154 (24%), Positives = 65/154 (42%), Gaps = 2/154 (1%)
 Frame = +1

Query: 220 INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVL--I 393
           +N  ++ IVR L E   +++YLV+     P     +    D  + S N TY +K++   I
Sbjct: 28  VNGRKYSIVRLLKEDDMSFLYLVRLEDGMPLLSAAASGDDDDGYESVN-TYTLKRIRCPI 86

Query: 394 QNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLL 573
            N   +     EI     F  P ++  +D  VI     +        Y++FP +  G+L 
Sbjct: 87  GNISNVSDAMREIDNYKRFQSPYVVSSVDSQVI-----QELDGAKTIYIVFPHYPLGSLQ 141

Query: 574 DNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHN 675
           D+           S S+ ++I   +  GL  +H+
Sbjct: 142 DSIDDRILDGTFVSESECIRIMCGIARGLLCLHD 175



>gb:AF052296_1236741 Drosophila heteroneura putative
           serine/threonine protein kinase mRNA, partial cds.
          Length = 212

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 64/238 (26%), Positives = 107/238 (44%), Gaps = 2/238 (0%)
 Frame = +1

Query: 253 LGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEI 432
           L EGGFA V+L +                +   ++    YA+K++ + N   L++ K EI
Sbjct: 1   LAEGGFAMVFLARG---------------NGGGSASATKYALKRMYVNNEHDLNVAKREI 45

Query: 433 RVSS-LFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKE- 606
           +++S L  H N++  +D ++ A       +   E  LL P      L      M A+   
Sbjct: 46  QIASNLSGHKNIIGYVDSSITATG-----NGVCEVLLLMPYCKHHML----AMMNARLHV 96

Query: 607 SFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP 786
            F+  +VL IF  +   +  +H  +    H D+K  N+L T         +L DFGSA  
Sbjct: 97  GFTEPEVLTIFCDIAEAVSRLHYCQTPIIHRDLKVENILQTDAGN----FVLCDFGSAT- 151

Query: 787 ARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMY 960
           A+     +     ++E   ++ +  +RAPE+ D  S   I  + DIW+LGC LY + +
Sbjct: 152 AKTLNPQQHGVTVVEEEIQKYTTLSYRAPEMIDLYSGKSITTKADIWALGCMLYKLCF 209



>gb:CED2045_1361802 Caenorhabditis elegans cosmid D2045, complete
            sequence.
          Length = 322

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 55/184 (29%), Positives = 94/184 (51%), Gaps = 1/184 (0%)
 Frame = +1

Query: 628  LQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRS 807
            L+ F  + + ++ +H FE  +AH D+KP N+L   + G      ++DFGSA     +I++
Sbjct: 126  LKYFSGIVSAIEQLHGFE--FAHLDIKPANIL---KSGDT--IKMIDFGSATKMPIEIKT 178

Query: 808  RSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYAL 987
             ++  + +E A E  S  +RAPEL++C   + +    D+W+LG  LY  +Y  +PF   +
Sbjct: 179  SADHHRHKEDAEELCSMMYRAPELFNCEIGSTLTTAVDVWALGVCLYEFLYLENPFN-KI 237

Query: 988  GESGGSLQLAIVNA-QVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKL 1164
             E GGS+ LA  +   +KW     +    E     +  +L      RP I ++   VD L
Sbjct: 238  YEQGGSIALATQSPHMIKWN---ENRHISEKSINLIKSILIVDPNQRPTIGELRAKVDNL 294

Query: 1165 ISKF 1176
            ++ F
Sbjct: 295  LANF 298



>pir|T20367|T20367 hypothetical protein D2045.7 - Caenorhabditis
            elegans
          Length = 283

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 55/184 (29%), Positives = 94/184 (51%), Gaps = 1/184 (0%)
 Frame = +1

Query: 628  LQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRS 807
            L+ F  + + ++ +H FE  +AH D+KP N+L   + G      ++DFGSA     +I++
Sbjct: 87   LKYFSGIVSAIEQLHGFE--FAHLDIKPANIL---KSGDT--IKMIDFGSATKMPIEIKT 139

Query: 808  RSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYAL 987
             ++  + +E A E  S  +RAPEL++C   + +    D+W+LG  LY  +Y  +PF   +
Sbjct: 140  SADHHRHKEDAEELCSMMYRAPELFNCEIGSTLTTAVDVWALGVCLYEFLYLENPFN-KI 198

Query: 988  GESGGSLQLAIVNA-QVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKL 1164
             E GGS+ LA  +   +KW     +    E     +  +L      RP I ++   VD L
Sbjct: 199  YEQGGSIALATQSPHMIKWN---ENRHISEKSINLIKSILIVDPNQRPTIGELRAKVDNL 255

Query: 1165 ISKF 1176
            ++ F
Sbjct: 256  LANF 259



>gb:CR382126_1659376 Kluyveromyces lactis strain NRRL Y-1140
            chromosome F of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 427

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 76/327 (23%), Positives = 138/327 (42%), Gaps = 3/327 (0%)
 Frame = +1

Query: 175  LNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHA 354
            L  L++ V G    ++N + +   + LG G F    +V++     +   V+ K       
Sbjct: 26   LTKLFNKVTGQPSSYVNKSDYIFGKTLGAGTFG---VVRQARCISSGENVAVKI------ 76

Query: 355  SDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEA 534
                   +KK L   S QL ++ +E+ +    +HPN+          V+  +    K + 
Sbjct: 77   ------LLKKALKGQSVQLQMLYDELSILQQLNHPNI----------VRFKDWFESKEKF 120

Query: 535  YLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPG 714
            Y++  +   G L D       +K  F   D + I +Q+  G++++H  + +  H D+KP 
Sbjct: 121  YIVTQLATGGELFDRIL----EKGKFCEVDAVFIVKQILQGVQYLH--QRNIVHRDLKPE 174

Query: 715  NVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPS 894
            N+L  ++    PL ++ DFG A    K+++  +E +     +  +V     APE+     
Sbjct: 175  NILYLNKSDDSPL-VIGDFGIA----KELKDDNELIHKAAGSMGYV-----APEVLTSSG 224

Query: 895  HADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKY-- 1068
            H    +  DIWS+G   Y ++ G SPF   L ES         + Q  +P     P +  
Sbjct: 225  HG---KPCDIWSIGVITYTLLCGYSPF---LAESADGFIEECTSGQ--YPVVFHKPYWNN 276

Query: 1069 -PEALHQFVTWMLQPQATVRPHIDDIV 1146
              +   +F+ W L      RP   D++
Sbjct: 277  VSKTAKEFILWALTVSPKRRPTATDLI 303



>gb:BC005411_2089843 Mus musculus NIMA (never in mitosis gene
            a)-related expressed kinase 3, mRNA (cDNA clone MGC:5648
            IMAGE:3590866), complete cds.
          Length = 509

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 81/309 (26%), Positives = 130/309 (42%), Gaps = 3/309 (0%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
            + + ++R +G+G F    LV +                    S N T+AMK++ +  S+ 
Sbjct: 2    DNYTVLRVIGQGSFGRALLVLQ-------------------ESSNQTFAMKEIRLLKSDT 42

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHM--DGTLLDNA 582
                KE + ++ +  HPN        ++A K    +S++ E YL   +     G L+   
Sbjct: 43   QTSRKEAVLLAKM-KHPN--------IVAFK----ESFEAEGYLYIVMEYCDGGDLMQRI 89

Query: 583  TAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAIL 762
               K K   F    +L  F Q+C G+ H+H  +    H D+K  NV LTH  G+  L   
Sbjct: 90   KQQKGKL--FPEDTILNWFIQICLGVNHIH--KRRVLHRDIKSKNVFLTHN-GKVKLG-- 142

Query: 763  MDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAP-ELWDCPSHADIDERTDIWSLGC 939
             DFGSAR     +           +A  +V  P+  P E+W+   +   + ++DIWSLGC
Sbjct: 143  -DFGSARLLSSPMA----------FACTYVGTPYYVPPEIWE---NLPYNNKSDIWSLGC 188

Query: 940  TLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQAT 1119
             LY +     PF+     S  +L L I    +     L    Y   L   V  ML+   +
Sbjct: 189  ILYELCALKHPFQ---ANSWKNLILKICQGPIHPLPAL----YSCKLQDLVKQMLKRNPS 241

Query: 1120 VRPHIDDIV 1146
             RP +  ++
Sbjct: 242  HRPSVTTLL 250



>gb:BC085005_1989906 Homo sapiens cyclin G associated kinase, mRNA
            (cDNA clone MGC:99654 IMAGE:6598984), complete cds.
          Length = 1232

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 60/205 (29%), Positives = 96/205 (46%), Gaps = 3/205 (1%)
 Frame = +1

Query: 559  DGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRK 738
            +G L++    M+++    S   VL+IF Q C  ++HMH  +P   H D+K  N+LL+++ 
Sbjct: 48   EGQLVEFLKKMESRGP-LSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQG 106

Query: 739  GQPPLAILMDFGSARPARKQIR---SRSEALQLQEWASEHVSAPFRAPELWDCPSHADID 909
                   L DFGSA           S      ++E  + + +  +R PE+ D  S+  I 
Sbjct: 107  ----TIKLCDFGSATTISHYPDYSWSAQRRALVEEEITRNTTPMYRTPEIIDLYSNFPIG 162

Query: 910  ERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQF 1089
            E+ DIW+LGC LY + +   PFE          +L IVN +   P    D +Y    H  
Sbjct: 163  EKQDIWALGCILYLLCFRQHPFE-------DGAKLRIVNGKYSIPP--HDTQY-TVFHSL 212

Query: 1090 VTWMLQPQATVRPHIDDIVIHVDKL 1164
            +  MLQ     R  I ++V  + ++
Sbjct: 213  IRAMLQVNPEERLSIAEVVHQLQEI 237



>gb:AL646068_547085 Ralstonia solanacearum GMI1000 chromosome,
            complete sequence; segment 12/19.
          Length = 323

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 82/311 (26%), Positives = 131/311 (42%), Gaps = 11/311 (3%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
            + +RIV++L  GGF++VYL  +    P    V+ K   PS  +      +  V+ + S  
Sbjct: 3    SNYRIVKKLASGGFSFVYLATDEHGTP----VAVKEYLPSSLARRSPGELIPVVPEESAS 58

Query: 409  -----LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLL 573
                 L    EE R  +  SHP+++ +L+                  Y++       TL 
Sbjct: 59   AFRLGLKYFFEEGRSLAKISHPSIVRVLNFF----------RENGTVYMVMTYEQGKTLQ 108

Query: 574  DNATA------MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHR 735
            ++         +K  +E F    + Q+F  L +GL+ +H  +    H D+KPGN+ L  R
Sbjct: 109  EHVLGARQQGKLKVLRERF----IRQVFHDLMSGLREVHIHK--LLHLDIKPGNIYL--R 160

Query: 736  KGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDER 915
            +   P  IL+DFG+AR       SR + +          +  F APEL+    H ++   
Sbjct: 161  EDSSP--ILLDFGAARQTLTAEASRFQPMY---------TPGFAAPELYR--KHNELGPW 207

Query: 916  TDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVT 1095
            TDI+S+G T+YA M G  P E    E    L   +   +  +   L D          V 
Sbjct: 208  TDIYSIGATIYACMAGAPPQEATQREKEDKLGENLERLRTVYTGSLID---------LVA 258

Query: 1096 WMLQPQATVRP 1128
            W L+ +   RP
Sbjct: 259  WCLKMKPEERP 269



>gb:AF099066_2054433 Mus musculus serine/threonine-protein kinase
           NEK3 (Nek3) mRNA, complete cds.
          Length = 509

 Score = 76.3 bits (186), Expect = 2e-12
 Identities = 70/253 (27%), Positives = 115/253 (45%), Gaps = 3/253 (1%)
 Frame = +1

Query: 229 NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
           + + ++R +G+G F    LV +                    S N T+AMK++ +  S+ 
Sbjct: 2   DNYTVLRVIGQGSFGRALLVLQ-------------------ESSNQTFAMKEIRLLKSDT 42

Query: 409 LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV-HMDGTLLDNAT 585
               KE + ++ +  HPN        ++A K    +S++ E YL   + + DG   D   
Sbjct: 43  QTSRKEAVLLAKM-KHPN--------IVAFK----ESFEAEGYLYIVMEYCDGG--DLMQ 87

Query: 586 AMKAKKESFSTSD-VLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAIL 762
            +K +K +    D +L  F Q+C G+ H+H  +    H D+K  NV LTH  G+  L   
Sbjct: 88  RIKQQKGNLFPEDTILNWFIQICLGVNHIH--KRRVLHRDIKSKNVFLTHN-GKVKLG-- 142

Query: 763 MDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAP-ELWDCPSHADIDERTDIWSLGC 939
            DFGSAR     +           +A  +V  P+  P E+W+   +   + ++DIWSLGC
Sbjct: 143 -DFGSARLLSSPMA----------FACTYVGTPYYVPPEIWE---NLPYNNKSDIWSLGC 188

Query: 940 TLYAIMYGVSPFE 978
            LY +     PF+
Sbjct: 189 ILYELCALKHPFQ 201



>sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 (EC
           2.7.1.37) (NimA-related protein kinase
           3).>gb:AF093416_2054193 Mus musculus NIMA-related kinase
           NEK3 (Nek3) mRNA, complete cds.
          Length = 511

 Score = 76.3 bits (186), Expect = 2e-12
 Identities = 70/253 (27%), Positives = 115/253 (45%), Gaps = 3/253 (1%)
 Frame = +1

Query: 229 NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
           + + ++R +G+G F    LV +                    S N T+AMK++ +  S+ 
Sbjct: 2   DNYTVLRVIGQGSFGRALLVLQ-------------------ESSNQTFAMKEIRLLKSDT 42

Query: 409 LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV-HMDGTLLDNAT 585
               KE + ++ +  HPN        ++A K    +S++ E YL   + + DG   D   
Sbjct: 43  QTSRKEAVLLAKM-KHPN--------IVAFK----ESFEAEGYLYIVMEYCDGG--DLMQ 87

Query: 586 AMKAKKESFSTSD-VLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAIL 762
            +K +K +    D +L  F Q+C G+ H+H  +    H D+K  NV LTH  G+  L   
Sbjct: 88  RIKQQKGNLFPEDTILNWFIQICLGVNHIH--KRRVLHRDIKSKNVFLTHN-GKVKLG-- 142

Query: 763 MDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAP-ELWDCPSHADIDERTDIWSLGC 939
            DFGSAR     +           +A  +V  P+  P E+W+   +   + ++DIWSLGC
Sbjct: 143 -DFGSARLLSSPMA----------FACTYVGTPYYVPPEIWE---NLPYNNKSDIWSLGC 188

Query: 940 TLYAIMYGVSPFE 978
            LY +     PF+
Sbjct: 189 ILYELCALKHPFQ 201



>gb:AB073313_1197459 Asterina pectinifera sfRSK mRNA for p90 ribosomal
            S6 kinase, complete cds.
          Length = 738

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 74/269 (27%), Positives = 113/269 (42%), Gaps = 1/269 (0%)
 Frame = +1

Query: 349  HASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSH-PNLLPLLDHAVIAVKASEGQSWK 525
            H S    YA+K +     E    V+EEI V   + H PN++ L D         +GQ+  
Sbjct: 439  HKSSGQQYAVKIIKKGKKE----VQEEIEVMLRYGHHPNIITLRD------VYDDGQN-- 486

Query: 526  HEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDV 705
               Y++  +   G LLD       KK+  S  +  +I   +   + ++H  +    H D+
Sbjct: 487  --VYMVMELMKGGELLDKIL----KKKCLSEREACEIMHVVTKTVDYLH--QQRVVHRDL 538

Query: 706  KPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWD 885
            KP N+L     G P    + DFG A    KQ+R+ +  L    +     +A F APE+  
Sbjct: 539  KPSNILYADDSGNPSSLRISDFGFA----KQMRADNGMLMTPCY-----TANFVAPEVLK 589

Query: 886  CPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPK 1065
               +   D   DIWSLG  LY ++ G +PF +   +S   +   I   +     G  D  
Sbjct: 590  RQGY---DAACDIWSLGVLLYTMLAGYTPFAHGPEDSAEIILARIGEGKFPLNGGNWDHV 646

Query: 1066 YPEALHQFVTWMLQPQATVRPHIDDIVIH 1152
             P A  + V WML      RP    ++ H
Sbjct: 647  SPMA-EELVRWMLHVDPFKRPSAAKVLQH 674



 Score = 49.7 bits (117), Expect = 2e-04
 Identities = 68/287 (23%), Positives = 119/287 (41%), Gaps = 4/287 (1%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
            ++F +++ LG+G F  V+LV+++  +                 D+GT    KVL + + +
Sbjct: 59   SQFELLKVLGQGSFGKVFLVRKVFGE-----------------DSGTLYAMKVLKKATLK 101

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
               V++ +R        N+L  ++H  I VK       + + YL+      G L      
Sbjct: 102  ---VRDRMRTK---MERNILVDVNHPFI-VKLHYAFQTEGKLYLILDFLRGGDLF----- 149

Query: 589  MKAKKESFSTSDVLQIF-RQLCAGLKHMHNFEPSYAHNDVKPGNVLLT---HRKGQPPLA 756
             +  KE   T D  +++  +L   L H+H+      + D+KP N+LL    H K      
Sbjct: 150  TRLSKEVMFTEDDAKLYPAELALALDHLHSL--GIIYRDLKPENILLDASGHIK------ 201

Query: 757  ILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLG 936
             L DFG ++          E++   +  S   +  + APE+ +   H       D WS G
Sbjct: 202  -LTDFGLSK----------ESVDNSKTYSFCGTVEYMAPEVVNRRGHT---TAADWWSFG 247

Query: 937  CTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEA 1077
              ++ ++ G  PF+   G+        I  A++  P  LS    PEA
Sbjct: 248  VLMFEMLTGALPFQ---GQHRKETMAMIPKAKLGMPQFLS----PEA 287



>gb:BX294154_771774 Pirellula sp. strain 1 complete genome; segment
           22/24.
          Length = 758

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 59/247 (23%), Positives = 114/247 (46%)
 Frame = +1

Query: 235 FRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLD 414
           ++++ ++GEGGF +V++ ++    P +   + K   P               +++ E + 
Sbjct: 89  YQLMERIGEGGFGWVFVAQQ--RSPVQRRAALKIIKPG--------------MESREVIA 132

Query: 415 LVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMK 594
             + E +  +L  HPN+  + D  V             + Y +  +     L D   + +
Sbjct: 133 RFEAERQAIALMDHPNIARVFDAGVTETA---------QPYFVMELVRGVPLTDFCNSNR 183

Query: 595 AKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFG 774
            +      SD LQ+F  +C  ++H H  +    H D+KP N+L+T + G+P LA ++DFG
Sbjct: 184 LR-----ISDRLQLFVTICHAVQHAH--QKGIIHRDLKPSNILVTLQDGRP-LAKVIDFG 235

Query: 775 SARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAI 954
            A+   + +  ++   +         +  + +PE     S  D+D R+DI+SLG  LY +
Sbjct: 236 VAKAIGQSLTVKTIYTRFTSMVG---TPAYMSPEQ-AAMSTDDVDTRSDIYSLGVLLYEL 291

Query: 955 MYGVSPF 975
           + G +PF
Sbjct: 292 LTGSTPF 298



>gb:AB062881_1197050 Mytilus galloprovincialis mRNA for twitchin,
            complete cds.
          Length = 4736

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 73/247 (29%), Positives = 106/247 (42%)
 Frame = +1

Query: 235  FRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLD 414
            + I+ +LG G F  V+   E      +  V+K    P        Y + K  ++N     
Sbjct: 3879 YEILEELGSGAFGVVHRCVEKAT--GRVFVAKFINTP--------YPLDKFAVKN----- 3923

Query: 415  LVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMK 594
                EI V +   HP LL L D       A E    K+E  L+F     G L D   A  
Sbjct: 3924 ----EINVMNQCHHPKLLQLKD-------AFED---KYEMCLIFEFLAGGELFDRIAAED 3969

Query: 595  AKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFG 774
             K    +  +V+   RQ+C GLKHMH  E S  H DVKP NV+ T +        ++DFG
Sbjct: 3970 YK---MTECEVINYMRQICDGLKHMH--ENSIVHLDVKPENVMCTTKNSNE--VKMIDFG 4022

Query: 775  SARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAI 954
             A        +  E +++        +A F APE+ D      +   TD+W++G   Y +
Sbjct: 4023 LATKL-----NPDEIVKVTT-----ATAEFAAPEIVD---REPVGFYTDMWAVGVLAYVL 4069

Query: 955  MYGVSPF 975
            + G+SPF
Sbjct: 4070 LSGLSPF 4076



>gb:AB042565_1195632 Mytilus galloprovincialis mRNA for twitchin,
           partial cds.
          Length = 878

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 73/247 (29%), Positives = 106/247 (42%)
 Frame = +1

Query: 235 FRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLD 414
           + I+ +LG G F  V+   E      +  V+K    P        Y + K  ++N     
Sbjct: 21  YEILEELGSGAFGVVHRCVEKAT--GRVFVAKFINTP--------YPLDKFAVKN----- 65

Query: 415 LVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMK 594
               EI V +   HP LL L D       A E    K+E  L+F     G L D   A  
Sbjct: 66  ----EINVMNQCHHPKLLQLKD-------AFED---KYEMCLIFEFLAGGELFDRIAAED 111

Query: 595 AKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFG 774
            K    +  +V+   RQ+C GLKHMH  E S  H DVKP NV+ T +        ++DFG
Sbjct: 112 YK---MTECEVINYMRQICDGLKHMH--ENSIVHLDVKPENVMCTTKNSNE--VKMIDFG 164

Query: 775 SARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAI 954
            A        +  E +++        +A F APE+ D      +   TD+W++G   Y +
Sbjct: 165 LATKL-----NPDEIVKVTT-----ATAEFAAPEIVD---REPVGFYTDMWAVGVLAYVL 211

Query: 955 MYGVSPF 975
           + G+SPF
Sbjct: 212 LSGLSPF 218



>gb:AB008202_1193127 Mytilus galloprovincialis mRNA for
           twitchin-like protein, partial cds.
          Length = 335

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 73/247 (29%), Positives = 106/247 (42%)
 Frame = +1

Query: 235 FRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLD 414
           + I+ +LG G F  V+   E      +  V+K    P        Y + K  ++N     
Sbjct: 21  YEILEELGSGAFGVVHRCVEKAT--GRVFVAKFINTP--------YPLDKFAVKN----- 65

Query: 415 LVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMK 594
               EI V +   HP LL L D       A E    K+E  L+F     G L D   A  
Sbjct: 66  ----EINVMNQCHHPKLLQLKD-------AFED---KYEMCLIFEFLAGGELFDRIAAED 111

Query: 595 AKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFG 774
            K    +  +V+   RQ+C GLKHMH  E S  H DVKP NV+ T +        ++DFG
Sbjct: 112 YK---MTECEVINYMRQICDGLKHMH--ENSIVHLDVKPENVMCTTKNSNE--VKMIDFG 164

Query: 775 SARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAI 954
            A        +  E +++        +A F APE+ D      +   TD+W++G   Y +
Sbjct: 165 LATKL-----NPDEIVKVTT-----ATAEFAAPEIVD---REPVGFYTDMWAVGVLAYVL 211

Query: 955 MYGVSPF 975
           + G+SPF
Sbjct: 212 LSGLSPF 218



>gb:EHU48386_1384548 Entamoeba histolytica putative serine/threonine
           protein kinase (EhS4) gene, complete cds.
          Length = 500

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 57/260 (21%), Positives = 118/260 (45%), Gaps = 2/260 (0%)
 Frame = +1

Query: 205 GGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKK 384
           G  +  +    +I +++GEGGF+ VY+ K+                          A+K 
Sbjct: 2   GNSIPFSTGTIQIEKKIGEGGFSQVYVGKDHFERKV--------------------AVKV 41

Query: 385 VLIQNSEQLDLVKEEIRVSSLFSHPN-LLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMD 561
           +   + + L  ++ EI++  + S    ++ LLD  ++          +H+  +       
Sbjct: 42  MGFSSKDTLQRIENEIKIHKIASESRFVIKLLDSIIL--------QQQHQIAIAMEF-CS 92

Query: 562 GTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKG 741
           GTL++          +  T+ +  +   +   L ++H+    Y H D+K  NVL+ + + 
Sbjct: 93  GTLVNEME--HCYPSTIGTNKIRDVMLCVSGSLAYLHS--KGYCHRDIKIENVLIFNGEY 148

Query: 742 QPPLAILMDFGSARPARKQI-RSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERT 918
           +     L DFGSA P    + R + +A +++E   +H +  +R+PE+    ++  I ++ 
Sbjct: 149 K-----LTDFGSAIPTSTYLTRKQGDASEVEEDIEKHTTPEYRSPEMVKVYNYNTIGDKA 203

Query: 919 DIWSLGCTLYAIMYGVSPFE 978
           D+W+ GC LY + + V+PF+
Sbjct: 204 DVWAAGCLLYKLEFFVTPFD 223



>sp|Q8R9T6|PKN1_THETN Probable serine/threonine-protein kinase Sps1
            (EC 2.7.1.37).>gb:AE013107_289143 Thermoanaerobacter
            tengcongensis MB4, section 134 of 244 of the complete
            genome.>gb:AE008691_1111208 Thermoanaerobacter
            tengcongensis strain MB4, complete genome.
          Length = 625

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 82/304 (26%), Positives = 132/304 (43%), Gaps = 5/304 (1%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
            NR+ I+ ++GEGG A VY  K  L +     V+ K   P  A+D     +KK        
Sbjct: 8    NRYEILEKIGEGGMAKVYKAKCHLLNRI---VAIKILRPEFAADENF--VKKF------- 55

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLL----- 573
                K E + ++  SHPN++ + D         EG     + Y +   ++ G  L     
Sbjct: 56   ----KRESQAAASLSHPNIVGIYD------VGQEG-----DIYYIVMEYVKGRTLKELIR 100

Query: 574  DNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPL 753
            +N   ++ K+        ++I  Q+C  L H H  +    H D+KP N+L+T       +
Sbjct: 101  ENGGPLEVKR-------AVEIASQVCRALDHAH--KNKIIHRDIKPQNILVTDED----V 147

Query: 754  AILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSL 933
              + DFG AR A            +        +A + +PE       + +DERTDI+SL
Sbjct: 148  VKVTDFGIARAAN--------GATITYTGDVIGTAYYFSPEQ---AKGSIVDERTDIYSL 196

Query: 934  GCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQ 1113
            G  L+ ++ G  PFE   G+S  S+ L  +   +  P+ L++ K PE L + V    Q  
Sbjct: 197  GIVLFEMLTGKVPFE---GDSPISVALKHIQEDILPPSRLNE-KVPEELDKIVLKATQKD 252

Query: 1114 ATVR 1125
              +R
Sbjct: 253  PNLR 256



>gb:BC072363_2556612 Xenopus laevis hypothetical protein MGC83541,
            mRNA (cDNA clone MGC:83541 IMAGE:5078768), complete cds.
          Length = 492

 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 79/307 (25%), Positives = 128/307 (41%), Gaps = 2/307 (0%)
 Frame = +1

Query: 232  RFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKV-LIQNSEQ 408
            ++ I+R +GEG F    LV                    H + +  Y MK++ L ++S  
Sbjct: 3    QYNILRVVGEGSFGRALLV-------------------CHVNSDQKYVMKEIRLPKSSHA 43

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
            ++  ++E  + S   HPN++   +       + EG       Y++      G LL     
Sbjct: 44   VEDSRKEAVLLSKMKHPNIVTFRE-------SFEGDG---HLYIVMEYCQGGDLLQKIKL 93

Query: 589  MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD 768
             + +   F+   +LQ F Q+C  ++H+H  E    H D+K  N+ LT          L D
Sbjct: 94   QRGRL--FTEQTILQWFVQICLAVQHIH--EKRVLHRDIKSKNIFLTQNCNIK----LGD 145

Query: 769  FGSARPARKQIRSRSEALQLQEWASEHVSAPFRAP-ELWDCPSHADIDERTDIWSLGCTL 945
            FGSAR     I +   A     +A  +V  P+  P E+W+   +   + ++DIWSLGC L
Sbjct: 146  FGSAR-----ILTSPGA-----YACTYVGTPYYVPPEIWE---NMPYNNKSDIWSLGCVL 192

Query: 946  YAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVR 1125
            Y +     PF+     S  +L L I     K P  +   +Y   L   +T M +     R
Sbjct: 193  YELCTLKHPFQ---AGSWKNLILKICQGSYK-PLPM---QYSYELRSLITQMFRKNPRSR 245

Query: 1126 PHIDDIV 1146
            P    I+
Sbjct: 246  PSASTIL 252



>gb:BC012964_2091679 Mus musculus ribosomal protein S6 kinase,
            polypeptide 4, mRNA (cDNA clone MGC:13790 IMAGE:4160873),
            complete cds.
          Length = 773

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 63/196 (32%), Positives = 94/196 (47%)
 Frame = +1

Query: 451  SHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVL 630
            SHPN++ L  H V+  +           YL+  +   G LL++      KK  FS S+  
Sbjct: 462  SHPNVVNL--HEVLHDQL--------HTYLVLELLRGGELLEHIR----KKRLFSESEAS 507

Query: 631  QIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSR 810
            QI R L + +  MH  E    H D+KP N+L        P+ I+ DFG AR     +R +
Sbjct: 508  QILRSLVSAVSFMHE-EAGVVHRDLKPENILYADDTPGAPVKII-DFGFAR-----LRPQ 560

Query: 811  SEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALG 990
            S A  +Q   +   +  + APEL    +    DE  D+WSLG  LY ++ G  PF+ A G
Sbjct: 561  SPAEPMQ---TPCFTLQYAAPELL---AQQGYDESCDLWSLGVILYMMLSGQVPFQGASG 614

Query: 991  ESGGSLQLAIVNAQVK 1038
            + GG  Q A +  +++
Sbjct: 615  Q-GGQSQAAEIMCKIR 629



 Score = 37.7 bits (86), Expect = 0.60
 Identities = 57/261 (21%), Positives = 102/261 (39%), Gaps = 4/261 (1%)
 Frame = +1

Query: 205 GGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKK 384
           G +  ++   F +++ LG G +  V+LV+               K   H +    YAMK 
Sbjct: 23  GHEEKVSVENFALLKVLGTGAYGKVFLVR---------------KTGGHDAGK-LYAMKV 66

Query: 385 V----LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV 552
           +    L+Q ++  +  + E  V  L      L  L +A              + +L+   
Sbjct: 67  LRKAALVQRAKTQEHTRTERSVLELVRQAPFLVTLHYAF---------QTDAKLHLILDY 117

Query: 553 HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH 732
              G +  +      +++ F  ++V     ++   L+H+H     Y   D+K  NVLL  
Sbjct: 118 VSGGEMFTHLY----QRQYFKEAEVRVYGGEIVLALEHLHKLGIIY--RDLKLENVLLDS 171

Query: 733 RKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDE 912
                   +L DFG ++    + + R+         S   +  + APE+    S A   +
Sbjct: 172 EGH----IVLTDFGLSKEFLTEEKERT--------FSFCGTIEYMAPEI--IRSKAGHGK 217

Query: 913 RTDIWSLGCTLYAIMYGVSPF 975
             D WSLG  L+ ++ G SPF
Sbjct: 218 AVDWWSLGILLFELLTGASPF 238



>gb:HSA247087_2001447 Homo sapiens mRNA for myosin light chain kinase
            (MLCK).
          Length = 795

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 77/289 (26%), Positives = 130/289 (44%), Gaps = 2/289 (0%)
 Frame = +1

Query: 373  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV 552
            A K + +++++  + VK EI + +  SH NL+ L D       A E    KH   L+   
Sbjct: 518  AAKIIKVKSAKDREDVKNEINIMNQLSHVNLIQLYD-------AFES---KHSCTLVMEY 567

Query: 553  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH 732
               G L D  T    +K   +  DV+   RQ+C G+ ++H  +    H D+KP N+L  +
Sbjct: 568  VDGGELFDRITD---EKYHLTELDVVLFTRQICEGVHYLH--QHYILHLDLKPENILCVN 622

Query: 733  RKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDE 912
            + G      ++DFG AR  + +     E L++     E     F APE+    ++  +  
Sbjct: 623  QTGHQ--IKIIDFGLARRYKPR-----EKLKVNFGTPE-----FLAPEV---VNYEFVSF 667

Query: 913  RTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFV 1092
             TD+WS+G   Y ++ G+SPF   LGE+       IVN    +     +    EA   FV
Sbjct: 668  PTDMWSVGVITYMLLSGLSPF---LGETDAETMNFIVNCSWDFDADTFEGLSEEA-KDFV 723

Query: 1093 TWMLQPQATVRPHIDDIVIH--VDKLISKFSH*EVRCRPKRHAHNYFAK 1233
            + +L  + + R      + H  ++ L +K S  + R + +     Y A+
Sbjct: 724  SRLLVKEKSCRMSATQCLKHEWLNNLPAKASRSKTRLKSQLLLQKYIAQ 772



>gb:SCCMK2_1707353 S. cerevisiae CMK2 gene for calmodulin-dependent
           protein kinase type II.
          Length = 447

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 65/263 (24%), Positives = 114/263 (43%), Gaps = 3/263 (1%)
 Frame = +1

Query: 196 VNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYA 375
           ++G  + ++N   +   R LG G F  V   +++  +     V+ K              
Sbjct: 34  LSGQPESYVNRTNYIFGRTLGAGSFGVVRQARKLSTNE---DVAIKI------------L 78

Query: 376 MKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSW---KHEAYLLF 546
           +KK L  N+ QL ++ EE+ +    SHPN++   D             W   K + Y++ 
Sbjct: 79  LKKALQGNNVQLQMLYEELSILQKLSHPNIVSFKD-------------WFESKDKFYIVT 125

Query: 547 PVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLL 726
            +   G L D   +    +  F+  D ++I  Q+   +++MH+   +  H D+KP NVL 
Sbjct: 126 QLATGGELFDRILS----RGKFTEVDAVEIIVQILGAVEYMHS--KNVVHRDLKPENVLY 179

Query: 727 THRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADI 906
             +    PL ++ DFG A    KQ++   + +     +  +V     APE+     H   
Sbjct: 180 VDKSENSPL-VIADFGIA----KQLKGEEDLIYKAAGSLGYV-----APEVLTQDGHG-- 227

Query: 907 DERTDIWSLGCTLYAIMYGVSPF 975
            +  DIWS+G   Y ++ G SPF
Sbjct: 228 -KPCDIWSIGVITYTLLCGYSPF 249



>gb:AK052858_1170225 Mus musculus 16 days neonate heart cDNA, RIKEN
            full-length enriched library, clone:D830007F02
            product:weakly similar to MYOSIN LIGHT CHAIN KINASE
            (MLCK) [Homo sapiens], full insert sequence.
          Length = 724

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 80/292 (27%), Positives = 132/292 (45%), Gaps = 4/292 (1%)
 Frame = +1

Query: 373  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV 552
            A K + ++N +  + VK E+ + +  SH NL+ L D       A E +S    ++ L   
Sbjct: 455  AAKIIKVKNVKDREDVKNEVNIMNQLSHVNLIQLYD-------AFESKS----SFTLIME 503

Query: 553  HMDG-TLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLT 729
            ++DG  L D  T    +K   +  DV+   RQ+C G+ ++H  +    H D+KP N+L  
Sbjct: 504  YVDGGELFDRITD---EKYHLTELDVVLFTRQICEGVHYLH--QHYILHLDLKPENILCV 558

Query: 730  HRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADID 909
             + G      ++DFG AR  + +     E L++     E     F APE+    ++  + 
Sbjct: 559  SQTGHQ--IKIIDFGLARRYKPR-----EKLKVNFGTPE-----FLAPEV---VNYEFVS 603

Query: 910  ERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPK-YPEALHQ 1086
              TD+WS+G   Y ++ G+SPF   LGE+       IVN    W       K   E    
Sbjct: 604  FPTDMWSVGVITYMLLSGLSPF---LGETDAETMNFIVNC--SWDFDADTFKGLSEEAKD 658

Query: 1087 FVTWMLQPQATVRPHIDDIVIH--VDKLISKFSH*EVRCRPKRHAHNYFAKN 1236
            FV+ +L  + + R      + H  +  L +K S   VR R ++    Y A++
Sbjct: 659  FVSRLLVKEKSCRMSATQCLKHEWLSHLPAKASGSNVRLRSQQLLQKYMAQS 710



>sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II
           (EC 2.7.1.123).>pir|B40896|B40896
           Ca2+/calmodulin-dependent protein kinase (EC 2.7.1.123)
           CMK2 - yeast (Saccharomyces
           cerevisiae)>gb:SCYOL016C_1714057 S.cerevisiae chromosome
           XV reading frame ORF YOL016c.>gb:YSCCMK2II_1728588
           Saccharomyces cerevisiae CMK2 gene for CaM kinase II,
           complete cds.
          Length = 447

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 65/263 (24%), Positives = 114/263 (43%), Gaps = 3/263 (1%)
 Frame = +1

Query: 196 VNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYA 375
           ++G  + ++N   +   R LG G F  V   +++  +     V+ K              
Sbjct: 34  LSGQPESYVNRTNYIFGRTLGAGSFGVVRQARKLSTNE---DVAIKI------------L 78

Query: 376 MKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSW---KHEAYLLF 546
           +KK L  N+ QL ++ EE+ +    SHPN++   D             W   K + Y++ 
Sbjct: 79  LKKALQGNNVQLQMLYEELSILQKLSHPNIVSFKD-------------WFESKDKFYIVT 125

Query: 547 PVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLL 726
            +   G L D   +    +  F+  D ++I  Q+   +++MH+   +  H D+KP NVL 
Sbjct: 126 QLATGGELFDRILS----RGKFTEVDAVEIIVQILGAVEYMHS--KNVVHRDLKPENVLY 179

Query: 727 THRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADI 906
             +    PL ++ DFG A    KQ++   + +     +  +V     APE+     H   
Sbjct: 180 VDKSENSPL-VIADFGIA----KQLKGEEDLIYKAAGSLGYV-----APEVLTQDGHG-- 227

Query: 907 DERTDIWSLGCTLYAIMYGVSPF 975
            +  DIWS+G   Y ++ G SPF
Sbjct: 228 -KPCDIWSIGVITYTLLCGYSPF 249



>sp|Q9Z2B9|K6A4_MOUSE Ribosomal protein S6 kinase alpha 4 (EC
            2.7.1.37) (Nuclear mitogen-and stress-activated protein
            kinase-2) (90 kDa ribosomal protein S6 kinase 4)
            (RSK-like protein kinase) (RLSK).>gb:AF074714_2053515 Mus
            musculus mitogen- and stress-activated protein kinase-2
            (mMSK2) mRNA, complete cds.
          Length = 773

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 63/196 (32%), Positives = 94/196 (47%)
 Frame = +1

Query: 451  SHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVL 630
            SHPN++ L  H V+  +           YL+  +   G LL++      KK  FS S+  
Sbjct: 462  SHPNVVNL--HEVLHDQL--------HTYLVLELLRGGELLEHIR----KKRLFSESEAS 507

Query: 631  QIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSR 810
            QI R L + +  MH  E    H D+KP N+L        P+ I+ DFG AR     +R +
Sbjct: 508  QILRSLVSAVSFMHE-EAGVVHRDLKPENILYADDTPGAPVKII-DFGFAR-----LRPQ 560

Query: 811  SEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALG 990
            S A  +Q   +   +  + APEL    +    DE  D+WSLG  LY ++ G  PF+ A G
Sbjct: 561  SPAEPMQ---TPCFTLQYAAPELL---AQQGYDESCDLWSLGVILYMMLSGQVPFQGASG 614

Query: 991  ESGGSLQLAIVNAQVK 1038
            + GG  Q A +  +++
Sbjct: 615  Q-GGQSQAAEIMCKIR 629



 Score = 37.7 bits (86), Expect = 0.60
 Identities = 57/261 (21%), Positives = 102/261 (39%), Gaps = 4/261 (1%)
 Frame = +1

Query: 205 GGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKK 384
           G +  ++   F +++ LG G +  V+LV+               K   H +    YAMK 
Sbjct: 23  GHEEKVSVENFALLKVLGTGAYGKVFLVR---------------KTGGHDAGK-LYAMKV 66

Query: 385 V----LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV 552
           +    L+Q ++  +  + E  V  L      L  L +A              + +L+   
Sbjct: 67  LRKAALVQRAKTQEHTRTERSVLELVRQAPFLVTLHYAF---------QTDAKLHLILDY 117

Query: 553 HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH 732
              G +  +      +++ F  ++V     ++   L+H+H     Y   D+K  NVLL  
Sbjct: 118 VSGGEMFTHLY----QRQYFKEAEVRVYGGEIVLALEHLHKLGIIY--RDLKLENVLLDS 171

Query: 733 RKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDE 912
                   +L DFG ++    + + R+         S   +  + APE+    S A   +
Sbjct: 172 EGH----IVLTDFGLSKEFLTEEKERT--------FSFCGTIEYMAPEI--IRSKAGHGK 217

Query: 913 RTDIWSLGCTLYAIMYGVSPF 975
             D WSLG  L+ ++ G SPF
Sbjct: 218 AVDWWSLGILLFELLTGASPF 238



>pir|E96949|E96949 serine/threonine protein kinase fused to TPR
           repeats domain [imported] - Clostridium
           acetobutylicum>gb:AE007555_227745 Clostridium
           acetobutylicum ATCC 824 section 43 of 356 of the
           complete genome.>gb:AE001437_1090700 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 657

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 72/253 (28%), Positives = 118/253 (46%), Gaps = 2/253 (0%)
 Frame = +1

Query: 220 INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN 399
           I +N+++I+  LG+GG + VYL K+I          +KF      S+N         I +
Sbjct: 24  IFENKYKIIDILGKGGMSTVYLAKDIKL--------QKFWAIKEVSNN---------IND 66

Query: 400 SEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDN 579
           + +L +         L +  N+L  LDH   A+        + E+  +    +DG  LD 
Sbjct: 67  TSKLKV--------DLLAETNILKKLDHP--ALPRIVDIIKRDESLYIVMDFIDGVSLDK 116

Query: 580 ATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPS-YAHNDVKPGNVLLTHRKGQPPLA 756
                 K  + +   VL   +Q+C  L ++H+ +P+   + D+KPGN++LT    Q    
Sbjct: 117 ---FIHKNGAINEKVVLDWAKQICDVLSYLHSQKPNPIIYRDMKPGNLMLT----QNGKI 169

Query: 757 ILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELW-DCPSHADIDERTDIWSL 933
            L+DFG AR  +K++   +  +  + +A         APE + DC S    D RTDI+S 
Sbjct: 170 KLIDFGIAREYKKEVSKDTTYIGTRGYA---------APEQYGDCQS----DARTDIYSF 216

Query: 934 GCTLYAIMYGVSP 972
           G TLY ++ G  P
Sbjct: 217 GVTLYHMLTGKGP 229



>pir|T16373|T16373 hypothetical protein F46G11.3 - Caenorhabditis
            elegans>gb:U40412_1403294 Caenorhabditis elegans cosmid
            F46G11, complete sequence.
          Length = 570

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 78/298 (26%), Positives = 127/298 (42%), Gaps = 2/298 (0%)
 Frame = +1

Query: 157  GCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKF 336
            G   S  + LYD    G    IN N +R+ + + +GGF  V+L                 
Sbjct: 16   GAGISEQSELYDR---GQTFSINGNNYRVEKVIAKGGFGTVFLATN-------------- 58

Query: 337  KDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQ 516
                  +     A+K +L  ++     +  EI +     H N++ L D +  A   S  +
Sbjct: 59   ------TKGKQVAVKIMLSHDAAATKDIDNEIDMMKKLQHENIIQLFDAS--AESRSSNR 110

Query: 517  SWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAH 696
            S K      + + M+      A  +   KE  S   V++I       L ++H+      H
Sbjct: 111  SVKE-----YKISMEYCKFSIADVLLKYKE-VSIDFVVRIIYFTTRALVYLHSV--GAIH 162

Query: 697  NDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIR--SRSEALQLQEWASEHVSAPFRA 870
             D+K  N+L+    G   L  L DFGSA     ++   S SE L +QE   ++ +   R+
Sbjct: 163  RDIKAENLLIN---GNGKLK-LCDFGSATTKSIEMAPLSNSERLAVQEEMFKYTTPITRS 218

Query: 871  PELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWP 1044
            PE+ D  S+  I ++ D W++GC +Y + +G  PF+       GS  LAI+N + K P
Sbjct: 219  PEVCDVYSNWPIGKQQDNWAMGCLIYFVAFGEHPFD-------GS-ALAIINGKYKKP 268



>gb:AF074715_1880992 Homo sapiens mitogen- and stress-activated
            protein kinase-2 (MSK2) mRNA, partial cds.
          Length = 705

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 61/196 (31%), Positives = 92/196 (46%)
 Frame = +1

Query: 451  SHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVL 630
            SHPN++ L           E    +   YL+  +   G LL++      KK  FS S+  
Sbjct: 440  SHPNVVNL----------HEVHHDQLHTYLVLELLRGGELLEHIR----KKRHFSESEAS 485

Query: 631  QIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSR 810
            QI R L + +  MH  E    H D+KP N+L        P+ I+ DFG AR     +R +
Sbjct: 486  QILRSLVSAVSFMHE-EAGVVHRDLKPENILYADDTPGAPVKII-DFGFAR-----LRPQ 538

Query: 811  SEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALG 990
            S  + +Q   +   +  + APEL    +    DE  D+WSLG  LY ++ G  PF+ A G
Sbjct: 539  SPGVPMQ---TPCFTLQYAAPELL---AQQGYDESCDLWSLGVILYMMLSGQVPFQGASG 592

Query: 991  ESGGSLQLAIVNAQVK 1038
            + GG  Q A +  +++
Sbjct: 593  Q-GGQSQAAEIMCKIR 607



 Score = 36.2 bits (82), Expect = 1.8
 Identities = 53/257 (20%), Positives = 98/257 (38%)
 Frame = +1

Query: 205 GGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKK 384
           G +  ++   F +++ LG G +  V+LV++     A    + K               K 
Sbjct: 7   GHEEKVSVENFELLKVLGTGAYGKVFLVRKAGGHDAGKLYAMKV------------LRKA 54

Query: 385 VLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDG 564
            L+Q ++  +  + E  V  L      L  L +A              + +L+      G
Sbjct: 55  ALVQRAKTQEHTRTERSVLELVRQAPFLVTLHYAF---------QTDAKLHLILDYVSGG 105

Query: 565 TLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQ 744
            +  +      +++ F  ++V     ++   L+H+H     Y   D+K  NVLL      
Sbjct: 106 EMFTHLY----QRQYFKEAEVRVYGGEIVLALEHLHKLGIIY--RDLKLENVLLDSEGH- 158

Query: 745 PPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDI 924
               +L DFG ++    + + R+         S   +  + APE+    S     +  D 
Sbjct: 159 ---IVLTDFGLSKEFLTEEKERT--------FSFCGTIEYMAPEI--IRSKTGHGKAVDW 205

Query: 925 WSLGCTLYAIMYGVSPF 975
           WSLG  L+ ++ G SPF
Sbjct: 206 WSLGILLFELLTGASPF 222



>gb:AE017348_1758354 Cryptococcus neoformans var. neoformans JEC21
           chromosome 8, complete sequence.
          Length = 419

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 65/221 (29%), Positives = 101/221 (45%), Gaps = 6/221 (2%)
 Frame = +1

Query: 337 KDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQ 516
           ++ S A DN     +K+     + L L++ EI V     HPNL+ L +   I+V  ++  
Sbjct: 4   EEMSGALDNTQSGDEKM----EDPLGLIRREIAVMKKLDHPNLVHLYE--AISVSTADA- 56

Query: 517 SWKHEAYLLFPVHMDGTLL------DNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNF 678
                 +L+      GTL+      D++ A    + +F      + FRQLC GL+++H  
Sbjct: 57  -----LFLVLEYMPGGTLMKVKVGQDDSNA----QPTFDREQTREYFRQLCLGLEYLHAN 107

Query: 679 EPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSA 858
           E    H D+KP N+LL+  +    L  L DFG +    K    R +            S 
Sbjct: 108 E--IVHRDIKPENILLSADR---QLVKLCDFGVSEMFTKTGDDRIQ--------KSGGSP 154

Query: 859 PFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEY 981
            F++PE +  PS     +  DIW+LG TLY ++ G  PF Y
Sbjct: 155 AFQSPESFQ-PSGELHGKAVDIWALGVTLYCMLTGTLPFNY 194



>gb:AX405633_1467561 Sequence 48 from Patent WO0222660.
          Length = 527

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 65/251 (25%), Positives = 103/251 (41%), Gaps = 3/251 (1%)
 Frame = +1

Query: 235 FRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNS-EQL 411
           + ++R +GEG F    LV+                   H S N  +AMK++ +  S    
Sbjct: 25  YMVLRMIGEGSFGRALLVQ-------------------HESSNQMFAMKEIRLPKSFSNT 65

Query: 412 DLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAM 591
              ++E  + +   HPN+          V   E    +   Y++      G L+      
Sbjct: 66  QNSRKEAVLLAKMKHPNI----------VAFKESFEAEGHLYIVMEYCDGGDLMQKIKQQ 115

Query: 592 KAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHR-KGQPPLAILMD 768
           K K   F    +L  F Q+C G+ H+H  +    H D+K  N+ LT   KG+     L D
Sbjct: 116 KGKL--FPEDMILNWFTQMCLGVNHIH--KKRVLHRDIKSKNIFLTQNGKGK-----LGD 166

Query: 769 FGSARPARKQIRSRSEALQLQEWASEHVSAPFRAP-ELWDCPSHADIDERTDIWSLGCTL 945
           FGSAR     +           +A  +V  P+  P E+W+   +   + ++DIWSLGC L
Sbjct: 167 FGSARLLSNPMA----------FACTYVGTPYYVPPEIWE---NLPYNNKSDIWSLGCIL 213

Query: 946 YAIMYGVSPFE 978
           Y +     PF+
Sbjct: 214 YELCTLKHPFQ 224



>gb:A44422_1449149 Sequence 1 from Patent EP0653489.
          Length = 456

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 56/216 (25%), Positives = 96/216 (44%)
 Frame = +1

Query: 337 KDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQ 516
           KD   A +     + K  ++     +L+ +E+ +     HPN++ L +            
Sbjct: 13  KDKITAQEYAVKVISKRQVKQKTDKELLLKEVELLKKLDHPNIMKLYEFF---------- 62

Query: 517 SWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAH 696
             K   YL+  V+  G L D        ++ FS +D  +I RQ+ +G+ +MH  +    H
Sbjct: 63  EDKGYFYLVTEVYTGGELFDEII----NRKRFSEADAARIVRQVLSGINYMHRNK--IVH 116

Query: 697 NDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPE 876
            D+KP N+LL ++K    + I+ DFG +     Q + + +            +A + APE
Sbjct: 117 RDLKPENLLLENKKKDANIRII-DFGLSTHFEPQKKMKDKI----------GTAYYIAPE 165

Query: 877 LWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA 984
           +     H   DE+ D+WS G  LY ++ G  PF  A
Sbjct: 166 VL----HGTYDEKCDVWSTGVILYILLSGCPPFNGA 197



>sp|O75676|K6A4_HUMAN Ribosomal protein S6 kinase alpha 4 (EC
            2.7.1.37) (Nuclear mitogen-and stress-activated protein
            kinase-2) (90 kDa ribosomal protein S6 kinase 4)
            (Ribosomal protein kinase B) (RSKB).>gb:HSA010119_1999951
            Homo sapiens mRNA for Ribosomal protein kinase B (RSK-B).
          Length = 772

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 61/196 (31%), Positives = 92/196 (46%)
 Frame = +1

Query: 451  SHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVL 630
            SHPN++ L           E    +   YL+  +   G LL++      KK  FS S+  
Sbjct: 462  SHPNVVNL----------HEVHHDQLHTYLVLELLRGGELLEHIR----KKRHFSESEAS 507

Query: 631  QIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSR 810
            QI R L + +  MH  E    H D+KP N+L        P+ I+ DFG AR     +R +
Sbjct: 508  QILRSLVSAVSFMHE-EAGVVHRDLKPENILYADDTPGAPVKII-DFGFAR-----LRPQ 560

Query: 811  SEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALG 990
            S  + +Q   +   +  + APEL    +    DE  D+WSLG  LY ++ G  PF+ A G
Sbjct: 561  SPGVPMQ---TPCFTLQYAAPELL---AQQGYDESCDLWSLGVILYMMLSGQVPFQGASG 614

Query: 991  ESGGSLQLAIVNAQVK 1038
            + GG  Q A +  +++
Sbjct: 615  Q-GGQSQAAEIMCKIR 629



 Score = 36.2 bits (82), Expect = 1.8
 Identities = 53/257 (20%), Positives = 98/257 (38%)
 Frame = +1

Query: 205 GGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKK 384
           G +  ++   F +++ LG G +  V+LV++     A    + K               K 
Sbjct: 23  GHEEKVSVENFELLKVLGTGAYGKVFLVRKAGGHDAGKLYAMKV------------LRKA 70

Query: 385 VLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDG 564
            L+Q ++  +  + E  V  L      L  L +A              + +L+      G
Sbjct: 71  ALVQRAKTQEHTRTERSVLELVRQAPFLVTLHYAF---------QTDAKLHLILDYVSGG 121

Query: 565 TLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQ 744
            +  +      +++ F  ++V     ++   L+H+H     Y   D+K  NVLL      
Sbjct: 122 EMFTHLY----QRQYFKEAEVRVYGGEIVLALEHLHKLGIIY--RDLKLENVLLDSEGH- 174

Query: 745 PPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDI 924
               +L DFG ++    + + R+         S   +  + APE+    S     +  D 
Sbjct: 175 ---IVLTDFGLSKEFLTEEKERT--------FSFCGTIEYMAPEI--IRSKTGHGKAVDW 221

Query: 925 WSLGCTLYAIMYGVSPF 975
           WSLG  L+ ++ G SPF
Sbjct: 222 WSLGILLFELLTGASPF 238



>gb:CR380952_1650427 Candida glabrata strain CBS138 chromosome F
           complete sequence.
          Length = 442

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 66/283 (23%), Positives = 120/283 (42%), Gaps = 3/283 (1%)
 Frame = +1

Query: 136 PIARKKMGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAK 315
           P  RK        +   ++ +NG  + +++ + +   + LG G F    +V++    P  
Sbjct: 12  PAVRKPEQVEGHTVTKFFNKLNGQPESYVSKSNYVFGKTLGAGTFG---VVRQARYSPTN 68

Query: 316 PGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIA 495
             V+ K              +KK L  N  QL ++ +E+ +  +  HPN++         
Sbjct: 69  EDVAVKI------------LLKKALKGNDVQLQMLYDELSILQMLKHPNIV--------- 107

Query: 496 VKASEGQSW---KHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKH 666
               E + W   K + Y++  + + G L D   A    K  F+  D + I  Q+ + + +
Sbjct: 108 ----EFKDWFESKDKFYIVTQLAVGGELFDRILA----KGKFTERDAVSITMQILSAVDY 159

Query: 667 MHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASE 846
           MH+   +  H D+KP NVL   +     L ++ DFG A    KQ++   + +     +  
Sbjct: 160 MHS--KNVVHRDLKPENVLYIDKSDDSQL-VIADFGIA----KQLQDNDDLIFKAAGSLG 212

Query: 847 HVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPF 975
           +V     APE+     H    +  DIWS+G  +Y ++ G S F
Sbjct: 213 YV-----APEVLTNNGHG---KPCDIWSIGVIVYTLLCGYSAF 247



>gb:AL139082_1920218 Human DNA sequence from clone RP11-248G5 on
           chromosome 13q14.3-21.1 Contains the 5' end of the ATP7B
           gene for ATPase, Cu++ transporting, beta polypeptide
           (Wilson disease), four novel genes, the NEK3 gene for
           NIMA (never in mitosis gene a)-related kinase 3, the 3'
           end of a novel gene and five CpG islands, complete
           sequence.
          Length = 507

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 64/250 (25%), Positives = 103/250 (41%), Gaps = 2/250 (0%)
 Frame = +1

Query: 235 FRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNS-EQL 411
           + ++R +GEG F    LV+                   H S N  +AMK++ +  S    
Sbjct: 4   YMVLRMIGEGSFGRALLVQ-------------------HESSNQMFAMKEIRLPKSFSNT 44

Query: 412 DLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAM 591
              ++E  + +   HPN+          V   E    +   Y++      G L+      
Sbjct: 45  QNSRKEAVLLAKMKHPNI----------VAFKESFEAEGHLYIVMEYCDGGDLMQKIKQQ 94

Query: 592 KAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDF 771
           K K   F    +L  F Q+C G+ H+H  +    H D+K  N+ LT + G+  L    DF
Sbjct: 95  KGKL--FPEDMILNWFTQMCLGVNHIH--KKRVLHRDIKSKNIFLT-QNGKVKLG---DF 146

Query: 772 GSARPARKQIRSRSEALQLQEWASEHVSAPFRAP-ELWDCPSHADIDERTDIWSLGCTLY 948
           GSAR     +           +A  +V  P+  P E+W+   +   + ++DIWSLGC LY
Sbjct: 147 GSARLLSNPMA----------FACTYVGTPYYVPPEIWE---NLPYNNKSDIWSLGCILY 193

Query: 949 AIMYGVSPFE 978
            +     PF+
Sbjct: 194 ELCTLKHPFQ 203



>gb:AK131359_1917900 Homo sapiens cDNA FLJ16392 fis, clone
           TRACH2020048, moderately similar to Mus musculus
           serine/threonine-protein kinase NEK3 (Nek3) mRNA.
          Length = 510

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 64/250 (25%), Positives = 103/250 (41%), Gaps = 2/250 (0%)
 Frame = +1

Query: 235 FRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNS-EQL 411
           + ++R +GEG F    LV+                   H S N  +AMK++ +  S    
Sbjct: 25  YMVLRMIGEGSFGRALLVQ-------------------HESSNQMFAMKEIRLPKSFSNT 65

Query: 412 DLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAM 591
              ++E  + +   HPN+          V   E    +   Y++      G L+      
Sbjct: 66  QNSRKEAVLLAKMKHPNI----------VAFKESFEAEGHLYIVMEYCDGGDLMQKIKQQ 115

Query: 592 KAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDF 771
           K K   F    +L  F Q+C G+ H+H  +    H D+K  N+ LT + G+  L    DF
Sbjct: 116 KGKL--FPEDMILNWFTQMCLGVNHIH--KKRVLHRDIKSKNIFLT-QNGKVKLG---DF 167

Query: 772 GSARPARKQIRSRSEALQLQEWASEHVSAPFRAP-ELWDCPSHADIDERTDIWSLGCTLY 948
           GSAR     +           +A  +V  P+  P E+W+   +   + ++DIWSLGC LY
Sbjct: 168 GSARLLSNPMA----------FACTYVGTPYYVPPEIWE---NLPYNNKSDIWSLGCILY 214

Query: 949 AIMYGVSPFE 978
            +     PF+
Sbjct: 215 ELCTLKHPFQ 224



>gb:AX803387_1475531 Sequence 49 from Patent WO03000901.
          Length = 546

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 64/250 (25%), Positives = 103/250 (41%), Gaps = 2/250 (0%)
 Frame = +1

Query: 235 FRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNS-EQL 411
           + ++R +GEG F    LV+                   H S N  +AMK++ +  S    
Sbjct: 4   YMVLRMIGEGSFGRALLVQ-------------------HESSNQMFAMKEIRLPKSFSNT 44

Query: 412 DLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAM 591
              ++E  + +   HPN+          V   E    +   Y++      G L+      
Sbjct: 45  QNSRKEAVLLAKMKHPNI----------VAFKESFEAEGHLYIVMEYCDGGDLMQKIKQQ 94

Query: 592 KAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDF 771
           K K   F    +L  F Q+C G+ H+H  +    H D+K  N+ LT + G+  L    DF
Sbjct: 95  KGKL--FPEDMILNWFTQMCLGVNHIH--KKRVLHRDIKSKNIFLT-QNGKVKLG---DF 146

Query: 772 GSARPARKQIRSRSEALQLQEWASEHVSAPFRAP-ELWDCPSHADIDERTDIWSLGCTLY 948
           GSAR     +           +A  +V  P+  P E+W+   +   + ++DIWSLGC LY
Sbjct: 147 GSARLLSNPMA----------FACTYVGTPYYVPPEIWE---NLPYNNKSDIWSLGCILY 193

Query: 949 AIMYGVSPFE 978
            +     PF+
Sbjct: 194 ELCTLKHPFQ 203



>sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 (EC
           2.7.1.37) (NimA-related protein kinase 3) (HSPK
           36).>gb:BC019916_1976938 Homo sapiens NIMA (never in
           mitosis gene a)-related kinase 3, transcript variant 1,
           mRNA (cDNA clone MGC:29949 IMAGE:5000918), complete cds.
          Length = 506

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 64/250 (25%), Positives = 103/250 (41%), Gaps = 2/250 (0%)
 Frame = +1

Query: 235 FRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNS-EQL 411
           + ++R +GEG F    LV+                   H S N  +AMK++ +  S    
Sbjct: 4   YMVLRMIGEGSFGRALLVQ-------------------HESSNQMFAMKEIRLPKSFSNT 44

Query: 412 DLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAM 591
              ++E  + +   HPN+          V   E    +   Y++      G L+      
Sbjct: 45  QNSRKEAVLLAKMKHPNI----------VAFKESFEAEGHLYIVMEYCDGGDLMQKIKQQ 94

Query: 592 KAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDF 771
           K K   F    +L  F Q+C G+ H+H  +    H D+K  N+ LT + G+  L    DF
Sbjct: 95  KGKL--FPEDMILNWFTQMCLGVNHIH--KKRVLHRDIKSKNIFLT-QNGKVKLG---DF 146

Query: 772 GSARPARKQIRSRSEALQLQEWASEHVSAPFRAP-ELWDCPSHADIDERTDIWSLGCTLY 948
           GSAR     +           +A  +V  P+  P E+W+   +   + ++DIWSLGC LY
Sbjct: 147 GSARLLSNPMA----------FACTYVGTPYYVPPEIWE---NLPYNNKSDIWSLGCILY 193

Query: 949 AIMYGVSPFE 978
            +     PF+
Sbjct: 194 ELCTLKHPFQ 203



>sp|P10665|K6AA_XENLA Ribosomal protein S6 kinase II alpha (EC
            2.7.1.37) (S6KII-alpha) (P90- RSK) (MAP kinase-activated
            protein kinase 1) (MAPK-activated protein kinase 1)
            (MAPKAP kinase 1) (MAPKAPK-1).>pir|B30001|B30001
            ribosomal protein S6 kinase (EC 2.7.1.-) II alpha chain -
            African clawed frog>gb:BC077262_2559978 Xenopus laevis S6
            kinase II, mRNA (cDNA clone MGC:79981 IMAGE:5074384),
            complete cds.>gb:XELS6KIIA_2582223 X.laevis ribosomal
            protein S6 kinase II (S6KII) mRNA, complete cds.
          Length = 733

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 69/246 (28%), Positives = 106/246 (43%), Gaps = 3/246 (1%)
 Frame = +1

Query: 268  FAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMK---KVLIQNSEQLDLVKEEIRV 438
            F  VY V+E +      G     K   H   N  YA+K   K     SE++++++     
Sbjct: 412  FMDVYTVRETIG----VGSYSVCKRCVHKGTNMEYAVKVIDKTKRDPSEEIEILRR---- 463

Query: 439  SSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFST 618
                 HPN++ L D         EG S     Y++  +   G LLD     K     FS 
Sbjct: 464  --YGQHPNIIALKD------VYKEGNS----IYVVTELMRGGELLDRILRQKF----FSE 507

Query: 619  SDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQ 798
             +   +   +C  ++++H+      H D+KP N+L     G P    + DFG A    KQ
Sbjct: 508  REASSVLFTVCKTVENLHS--QGVVHRDLKPSNILYVDESGDPESIRICDFGFA----KQ 561

Query: 799  IRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFE 978
            +R+ +  L    +     +A F APE+     +   DE  DIWSLG  LY ++ G +PF 
Sbjct: 562  LRADNGLLMTPCY-----TANFVAPEVLKRQGY---DEGCDIWSLGILLYTMLAGYTPFA 613

Query: 979  YALGES 996
              LG++
Sbjct: 614  NGLGDT 619



 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 65/279 (23%), Positives = 110/279 (39%), Gaps = 4/279 (1%)
 Frame = +1

Query: 235  FRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLD 414
            F +++ LG+G F  V+LV++I    A                N  YAMK +     +  D
Sbjct: 62   FVLLKVLGQGSFGKVFLVRKITPPDA----------------NQLYAMKVLKKATLKVRD 105

Query: 415  LVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMK 594
             V+ ++    L           H    V+       + + YL+      G L        
Sbjct: 106  RVRTKMERDILAD--------VHHPFVVRLHYAFQTEGKLYLILDFLRGGDLFTRL---- 153

Query: 595  AKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLT---HRKGQPPLAILM 765
            +K+  F+  DV     +L  GL H+H+      + D+KP N+LL    H K       L 
Sbjct: 154  SKEVMFTEEDVKFYLAELALGLDHLHSL--GIIYRDLKPENILLDEEGHIK-------LT 204

Query: 766  DFGSARPARKQIRSRSEALQLQEWASEHV-SAPFRAPELWDCPSHADIDERTDIWSLGCT 942
            DFG ++          EA+  ++ A     +  + APE+ +   H+      D WS G  
Sbjct: 205  DFGLSK----------EAIDHEKKAYSFCGTVEYMAPEVVNRQGHS---HSADWWSYGVL 251

Query: 943  LYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSD 1059
            ++ ++ G  PF+   G+        I+ A++  P  LS+
Sbjct: 252  MFEMLTGSLPFQ---GKDRKETMTLILKAKLGMPQFLSN 287



>gb:BC075119_2558233 Xenopus tropicalis NIMA (never in mitosis gene
            a)-related kinase 3, mRNA (cDNA clone MGC:79803
            IMAGE:6986468), complete cds.
          Length = 494

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 82/308 (26%), Positives = 126/308 (40%), Gaps = 3/308 (0%)
 Frame = +1

Query: 232  RFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQL 411
            ++ IVR +GEG F    LV                    H S N  Y MK++ +  S   
Sbjct: 3    QYNIVRVIGEGSFGRALLV-------------------CHKSSNHKYVMKEIRLPKSFHA 43

Query: 412  --DLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNAT 585
              D  KE + ++++  H N++   +       + EG       Y++      G LL    
Sbjct: 44   MEDSRKEAVLLANM-KHSNIVTFQE-------SFEGDG---HLYIVMEYCQGGDLLQKIK 92

Query: 586  AMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILM 765
              K +   F+   +LQ F Q+C  ++++H  E    H D+K  N+ LT    Q     L 
Sbjct: 93   LQKGRL--FTEQTILQWFVQICLAVQYIH--EKRVLHRDIKSKNIFLT----QSCNIKLG 144

Query: 766  DFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAP-ELWDCPSHADIDERTDIWSLGCT 942
            DFGSAR     I +   A     +A  +V  P+  P E+W+   +   + ++DIWSLGC 
Sbjct: 145  DFGSAR-----ILTSPAA-----YACTYVGTPYYVPPEIWE---NMPYNNKSDIWSLGCV 191

Query: 943  LYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATV 1122
            LY +     PF+     S  +L L I     K P  L   +Y   L   +  M +     
Sbjct: 192  LYELCTLKHPFQ---AGSWKNLILKICQGSYK-PLPL---QYSYELRSLINQMFRKNPRS 244

Query: 1123 RPHIDDIV 1146
            RP    I+
Sbjct: 245  RPSASTIL 252



>gb:LME293290_1387701 Leishmania mexicana MKK2 gene for putative
            mitogen-activated protein kinase kinase 2.
          Length = 1090

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 76/315 (24%), Positives = 134/315 (42%), Gaps = 9/315 (2%)
 Frame = +1

Query: 235  FRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQ---NSE 405
            ++I+  +GEG F  VY  +                        G     K +++   N +
Sbjct: 8    YQIIESIGEGSFGKVYKAR--------------------IKGTGQIVAMKFIVKKGKNEK 47

Query: 406  QLDLVKEEIRVSSLFSHPNLLPLLDHA------VIAVKASEGQSWKHEAYLLFPVHMDGT 567
            +L  ++ EI + +  +HP+++ L D        V+ ++ ++G+ +               
Sbjct: 48   ELKNLRSEIEILTKLNHPHIIMLFDSFETDSDFVVVMEYAQGELYD-------------- 93

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            +L++   + AK       +V +I +QL   L ++H+      H D+KP N+L+    GQ 
Sbjct: 94   ILEDEKQLPAK-------EVQKIAKQLIQALNYLHSNR--IIHRDMKPQNILI----GQN 140

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
                L DFG AR         S +       S   +  + APEL    ++   D R D+W
Sbjct: 141  GAVKLADFGFAR---------SMSYNTIVLTSIKGTPLYMAPELVQERAY---DNRVDLW 188

Query: 928  SLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQ 1107
            SLGC LY + YG  PF      +  +L   IV   VK+ +  +DP  PE    F++ +L 
Sbjct: 189  SLGCILYELYYGKPPF---YTNNLFALIKKIVCEPVKYDSKANDPISPE-FKSFLSGLLT 244

Query: 1108 PQATVRPHIDDIVIH 1152
              A+ R +  +++ H
Sbjct: 245  KSASSRLNWPELLNH 259



>gb:LMFL6293_1388260 Leishmania major Friedlin chromosome 13 cosmid
            L6293.>gb:LMFP1046_1388660 Leishmania major Friedlin
            chromosome 13 PAC P1046.
          Length = 1090

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 77/310 (24%), Positives = 132/310 (42%), Gaps = 4/310 (1%)
 Frame = +1

Query: 235  FRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQ---NSE 405
            ++I+  +GEG F  VY  +                        G     K +++   N +
Sbjct: 8    YQIIESIGEGSFGKVYKAR--------------------IKGTGQIVAMKFIVKKGKNEK 47

Query: 406  QLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEA-YLLFPVHMDGTLLDNA 582
            +L  ++ EI + +  +HP+++ L D            S++ ++ +++   +  G L D  
Sbjct: 48   ELKNLRSEIEILTKLNHPHIIMLFD------------SFETDSDFVVVMEYAQGELYDIL 95

Query: 583  TAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAIL 762
               K   E     +V +I +QL   L ++H+      H D+KP N+L+    GQ     L
Sbjct: 96   EDEKQLPEK----EVQKIAKQLIQALNYLHSNR--IIHRDMKPQNILI----GQNGAVKL 145

Query: 763  MDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCT 942
             DFG AR         S +       S   +  + APEL    ++   D R D+WSLGC 
Sbjct: 146  ADFGFAR---------SMSYNTIVLTSIKGTPLYMAPELVQERAY---DNRVDLWSLGCI 193

Query: 943  LYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATV 1122
            LY + YG  PF      +  +L   IV   VK+ +  +DP  PE    F++ +L   A+ 
Sbjct: 194  LYELYYGKPPF---YTNNLFALIKKIVCEPVKYDSKANDPISPE-FKSFLSGLLTKSASS 249

Query: 1123 RPHIDDIVIH 1152
            R +  +++ H
Sbjct: 250  RLNWPELLNH 259



>gb:ETCDPK_1384939 E.tenella mRNA for calmodulin-domain protein
           kinase.
          Length = 487

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 62/252 (24%), Positives = 105/252 (41%)
 Frame = +1

Query: 229 NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
           +R++  R LG+G F  V L K                D     +     + K  ++    
Sbjct: 26  DRYKGQRVLGKGSFGEVILCK----------------DKVTGQEYAVKVISKRQVKQKTD 69

Query: 409 LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
            +L+ +E+ +     HPN++ L +              K   YL+  V+  G L D   +
Sbjct: 70  KELLLKEVELLKKLDHPNIMKLYEFF----------EDKGYFYLVTEVYTGGELFDEIIS 119

Query: 589 MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD 768
            K     FS  D  +I RQ+ +G+ +MH  +    H D+KP N+LL +++    + I+ D
Sbjct: 120 RKR----FSEVDAARIIRQVLSGITYMH--KNKIVHRDLKPENLLLENKRKDANIRII-D 172

Query: 769 FGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLY 948
           FG +       + + +            +A + APE+     H   DE+ D+WS G  LY
Sbjct: 173 FGLSTHFESTKKMKDKI----------GTAYYIAPEVL----HGTYDEKCDVWSTGVILY 218

Query: 949 AIMYGVSPFEYA 984
            ++ G  PF  A
Sbjct: 219 ILLSGCPPFNGA 230



>gb:CR857943_1182138 Pongo pygmaeus mRNA; cDNA DKFZp468H2010 (from
            clone DKFZp468H2010).
          Length = 819

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 76/289 (26%), Positives = 129/289 (44%), Gaps = 2/289 (0%)
 Frame = +1

Query: 373  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV 552
            A K + +++++  + VK EI + +  SH NL+ L D       A E    KH   L+   
Sbjct: 542  AAKIIKVKSAKDREDVKNEINIMNQLSHVNLIQLYD-------AFES---KHSCTLVMEY 591

Query: 553  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH 732
               G L D  T    +K   +  DV+   RQ+C G+ ++H  +    H D+KP N+L  +
Sbjct: 592  VDGGELFDRITD---EKYHLTELDVVLFTRQICEGVHYLH--QHYILHLDLKPENILCVN 646

Query: 733  RKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDE 912
            + G      ++DFG AR  + +     E L++     E     F APE+    ++  +  
Sbjct: 647  QTGHQ--IKIIDFGLARRYKPR-----EKLKVNFGTPE-----FLAPEV---VNYEFVSF 691

Query: 913  RTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFV 1092
             TD+WS+G   Y ++ G+SPF   LGE+       IVN    +     +    EA   FV
Sbjct: 692  PTDMWSVGVITYMLLSGLSPF---LGETDAETMNFIVNCSWDFDADTFEGLSEEA-KDFV 747

Query: 1093 TWMLQPQATVRPHIDDIVIH--VDKLISKFSH*EVRCRPKRHAHNYFAK 1233
            + +L  + + R      + H  ++ L +K    + R + +     Y A+
Sbjct: 748  SRLLVKEESCRMSATQCLKHEWLNNLPAKALRSKTRLKSQLLLQKYIAQ 796



>gb:AB072828_1871315 Homo sapiens NEK3 mRNA for NIMA-related protein
           kinase 3, complete cds.
          Length = 489

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 64/250 (25%), Positives = 103/250 (41%), Gaps = 2/250 (0%)
 Frame = +1

Query: 235 FRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNS-EQL 411
           + ++R +GEG F    LV+                   H S N  +AMK++ +  S    
Sbjct: 4   YMVLRMIGEGFFGRALLVQ-------------------HESSNQMFAMKEIRLPKSFSNT 44

Query: 412 DLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAM 591
              ++E  + +   HPN+          V   E    +   Y++      G L+      
Sbjct: 45  QNSRKEAVLLAKMKHPNI----------VAFKESFEAEGHLYIVMEYCDGGDLMQKIKQQ 94

Query: 592 KAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDF 771
           K K   F    +L  F Q+C G+ H+H  +    H D+K  N+ LT + G+  L    DF
Sbjct: 95  KGKL--FPEDMILNWFTQMCLGVNHIH--KKRVLHRDIKSKNIFLT-QNGKVKLG---DF 146

Query: 772 GSARPARKQIRSRSEALQLQEWASEHVSAPFRAP-ELWDCPSHADIDERTDIWSLGCTLY 948
           GSAR     +           +A  +V  P+  P E+W+   +   + ++DIWSLGC LY
Sbjct: 147 GSARLLSNPMA----------FACTYVGTPYYVPPEIWE---NLPYNNKSDIWSLGCILY 193

Query: 949 AIMYGVSPFE 978
            +     PF+
Sbjct: 194 ELCTLKHPFQ 203



>gb:AB055927_1196749 Procambarus clarkii mRNA for projectin, complete
            cds.
          Length = 8625

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 62/247 (25%), Positives = 108/247 (43%)
 Frame = +1

Query: 235  FRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLD 414
            + I+ ++G G F  V+  +E                         +A K + + ++ + +
Sbjct: 7684 YDILEEIGTGAFGVVHRCRE-------------------RKTGNIFAAKFIPVASAMEKE 7724

Query: 415  LVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMK 594
            L+++EI + +   HP L+ L D       A E      E  L+F     G L +  TA  
Sbjct: 7725 LIRKEIDIMNHLHHPKLINLHD-------AFEDDD---EMVLIFEFLSGGELFERITA-- 7772

Query: 595  AKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFG 774
             +    S ++V+   RQ+C G+KHMH  E +  H DVKP N++   +        L+DFG
Sbjct: 7773 -EGYVMSEAEVINYMRQICEGVKHMH--EKNIIHLDVKPENIMCQTKTSTN--VKLIDFG 7827

Query: 775  SARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAI 954
             A          +E +++    +E     F APE+ +      +   TD+W++G   Y +
Sbjct: 7828 LATKL-----DPNEVVKISTGTAE-----FAAPEIVE---REPVGFYTDMWAVGVLAYVL 7874

Query: 955  MYGVSPF 975
            + G+SPF
Sbjct: 7875 LSGLSPF 7881



>gb:CER166_1366877 Caenorhabditis elegans cosmid R166, complete
           sequence.
          Length = 763

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 67/248 (27%), Positives = 107/248 (43%), Gaps = 6/248 (2%)
 Frame = +1

Query: 253 LGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEI 432
           LG G +  V   K I     K GV    K      +  T++ K++L     ++++ K   
Sbjct: 209 LGSGAYGSVTTCKSI-----KSGVEYAVKIVDKQGE--THSRKRIL----REVNIFK--- 254

Query: 433 RVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEA---YLLFPVHMDGTLLDNATAMKAKK 603
              +   HPN++ LLD             W  +    YL+      G LL +      ++
Sbjct: 255 ---TCKDHPNIVQLLD-------------WFEDETNFYLVMEKMRGGPLLQHIL----QR 294

Query: 604 ESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAIL-MDFGSA 780
           + F+  +  ++ + +   LK MH  +   AH DVKP NVL T      P+ +  +D  S 
Sbjct: 295 KYFTEEEARRVTKDISLALKFMH--DRGIAHRDVKPENVLCTDPNHVSPVKLCDLDLASQ 352

Query: 781 RPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDC--PSHADIDERTDIWSLGCTLYAI 954
           RP + +    S+     + AS   SA F APE+ D         D++ D WSLG  LY +
Sbjct: 353 RPPQHERHPLSQVASEPDLASPVGSAEFMAPEVVDAYVGDSLKYDKKCDTWSLGVILYIM 412

Query: 955 MYGVSPFE 978
           + G +PF+
Sbjct: 413 LAGYAPFQ 420



>gb:AY071017_1295102 Drosophila melanogaster RE09533 full length cDNA.
          Length = 277

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 69/279 (24%), Positives = 121/279 (43%), Gaps = 6/279 (2%)
 Frame = +1

Query: 220  INDNRFRIVRQLGEGGFAYVYLV--KEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLI 393
            + D++ R VR LG+G F  V+L    E+   P +                    +K++++
Sbjct: 3    LGDSKLRAVRVLGQGTFGRVFLCHQNEVRGQPERK-----------------VCVKRIIV 45

Query: 394  QNSE-QLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHM--DG 564
            +N + +L L+KEE+ + S   HP+++  L            +S+ H   +   +    +G
Sbjct: 46   RNPKTELGLIKEEVYIISQLRHPHIVEFL------------RSFSHAGTVNIVMEYVPNG 93

Query: 565  TLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQ 744
            TL D    + +     +   ++  FR +  GL+++H       H D+KP N+LL      
Sbjct: 94   TLRDVIQQLPSGTGGVNQERLMGYFRDMVVGLEYLHI--RCVIHRDIKPENMLLDANDR- 150

Query: 745  PPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDI 924
                 + DFG A          + + QLQ      +   + APE     S   +D ++D+
Sbjct: 151  ---VRIADFGIANV-------HAPSTQLQAGMGTPM---YMAPEAMS--SQGKVDFKSDV 195

Query: 925  WSLGCTLYAIMYGVSPFEYALGESG-GSLQLAIVNAQVK 1038
            WSLG  LY +  G SPF   L ++   +L   +V A V+
Sbjct: 196  WSLGLVLYELCLGRSPFAAFLDKNATPALLHTVVQALVR 234



>pir|T13619|T13619 hypothetical protein 8D8.5 - fruit fly (Drosophila
            melanogaster)>gb:AE014298_1123846 Drosophila melanogaster
            chromosome X, complete sequence.>gb:AE003420_1209028
            Drosophila melanogaster chromosome X, section 4 of 74 of
            the complete sequence.>gb:AF306498_1260759 Drosophila
            melanogaster protein kinase PAN GU (png) mRNA, complete
            cds.>gb:DMC8D8_1378468 Drosophila melanogaster cosmid
            clone 8D8.
          Length = 291

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 69/279 (24%), Positives = 121/279 (43%), Gaps = 6/279 (2%)
 Frame = +1

Query: 220  INDNRFRIVRQLGEGGFAYVYLV--KEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLI 393
            + D++ R VR LG+G F  V+L    E+   P +                    +K++++
Sbjct: 3    LGDSKLRAVRVLGQGTFGRVFLCHQNEVRGQPERK-----------------VCVKRIIV 45

Query: 394  QNSE-QLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHM--DG 564
            +N + +L L+KEE+ + S   HP+++  L            +S+ H   +   +    +G
Sbjct: 46   RNPKTELGLIKEEVYIISQLRHPHIVEFL------------RSFSHAGTVNIVMEYVPNG 93

Query: 565  TLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQ 744
            TL D    + +     +   ++  FR +  GL+++H       H D+KP N+LL      
Sbjct: 94   TLRDVIQQLPSGTGGVNQERLMGYFRDMVVGLEYLHI--RCVIHRDIKPENMLLDANDRV 151

Query: 745  PPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDI 924
                 + DFG A          + + QLQ      +   + APE     S   +D ++D+
Sbjct: 152  K----IADFGIANV-------HAPSTQLQAGMGTPM---YMAPEAMS--SQGKVDFKSDV 195

Query: 925  WSLGCTLYAIMYGVSPFEYALGESG-GSLQLAIVNAQVK 1038
            WSLG  LY +  G SPF   L ++   +L   +V A V+
Sbjct: 196  WSLGLVLYELCLGRSPFAAFLDKNATPALLHTVVQALVR 234



>pir|T24230|T24230 hypothetical protein R166.5 - Caenorhabditis
           elegans>gb:CER166_1366878 Caenorhabditis elegans cosmid
           R166, complete sequence.
          Length = 761

 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 67/248 (27%), Positives = 107/248 (43%), Gaps = 6/248 (2%)
 Frame = +1

Query: 253 LGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEI 432
           LG G +  V   K I     K GV    K      +  T++ K++L     ++++ K   
Sbjct: 207 LGSGAYGSVTTCKSI-----KSGVEYAVKIVDKQGE--THSRKRIL----REVNIFK--- 252

Query: 433 RVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEA---YLLFPVHMDGTLLDNATAMKAKK 603
              +   HPN++ LLD             W  +    YL+      G LL +      ++
Sbjct: 253 ---TCKDHPNIVQLLD-------------WFEDETNFYLVMEKMRGGPLLQHIL----QR 292

Query: 604 ESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAIL-MDFGSA 780
           + F+  +  ++ + +   LK MH  +   AH DVKP NVL T      P+ +  +D  S 
Sbjct: 293 KYFTEEEARRVTKDISLALKFMH--DRGIAHRDVKPENVLCTDPNHVSPVKLCDLDLASQ 350

Query: 781 RPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDC--PSHADIDERTDIWSLGCTLYAI 954
           RP + +    S+     + AS   SA F APE+ D         D++ D WSLG  LY +
Sbjct: 351 RPPQHERHPLSQVASEPDLASPVGSAEFMAPEVVDAYVGDSLKYDKKCDTWSLGVILYIM 410

Query: 955 MYGVSPFE 978
           + G +PF+
Sbjct: 411 LAGYAPFQ 418



>gb:AY660551_1344359 Eimeria tenella strain GS calmodulin-domain
           protein kinase mRNA, complete cds.
          Length = 490

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 62/252 (24%), Positives = 104/252 (41%)
 Frame = +1

Query: 229 NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
           +R++  R LG+G F  V L K                D     +     + K  ++    
Sbjct: 27  DRYKGQRVLGKGSFGEVILCK----------------DKVTGQEYAVKVISKRQVKQKTD 70

Query: 409 LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
            +L+ +E+ +     HPN++          K  E    K   YL+  V+  G   D   +
Sbjct: 71  KELLLKEVELLKKLDHPNIM----------KLCEFFEDKGYFYLVTEVYTGGEFFDEIIS 120

Query: 589 MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD 768
            K     FS  D  +I RQ+ +G+ +MH  +    H D+KP N+LL +++    + I+ D
Sbjct: 121 RKR----FSEVDAARIIRQVLSGITYMH--KNKIVHRDLKPENLLLENKRKDANIRII-D 173

Query: 769 FGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLY 948
           FG +       + + +            +A + APE+     H   DE+ D+WS G  LY
Sbjct: 174 FGLSTHFESTKKMKDKI----------GTAYYIAPEVL----HGTYDEKCDVWSTGVILY 219

Query: 949 AIMYGVSPFEYA 984
            ++ G  PF  A
Sbjct: 220 ILLSGCPPFNGA 231



>gb:AF333958_1263449 Toxoplasma gondii calmodulin-domain protein
           kinase 1 (CDPK1) mRNA, complete cds.
          Length = 507

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 72/257 (28%), Positives = 109/257 (42%), Gaps = 2/257 (0%)
 Frame = +1

Query: 220 INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN 399
           I  +R++  R LG+G F  V L K+ +                     G     KV+ + 
Sbjct: 46  IFSDRYKGQRVLGKGSFGEVILCKDKIT--------------------GQECAVKVISKR 85

Query: 400 SEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDN 579
                 VK++    SL     LL  LDH  I +K  E    K   YL+  V+  G L D 
Sbjct: 86  Q-----VKQKTDKESLLREVQLLKQLDHPNI-MKLYEFFEDKGYFYLVGEVYTGGELFDE 139

Query: 580 ATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAI 759
             + K     FS  D  +I RQ+ +G+ +MH  +    H D+KP N+LL  +     + I
Sbjct: 140 IISRKR----FSEVDAARIIRQVLSGITYMH--KNKIVHRDLKPENLLLESKSKDANIRI 193

Query: 760 LMDFGSAR--PARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSL 933
           + DFG +    A K+++ +              +A + APE+     H   DE+ D+WS 
Sbjct: 194 I-DFGLSTHFEASKKMKDKIG------------TAYYIAPEVL----HGTYDEKCDVWST 236

Query: 934 GCTLYAIMYGVSPFEYA 984
           G  LY ++ G  PF  A
Sbjct: 237 GVILYILLSGCPPFNGA 253



>gb:HSM805135_1187350 Homo sapiens mRNA; cDNA DKFZp434B079 (from
           clone DKFZp434B079).
          Length = 501

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 62/242 (25%), Positives = 100/242 (41%), Gaps = 2/242 (0%)
 Frame = +1

Query: 235 FRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNS-EQL 411
           + ++R +GEG F    LV+                   H S N  +AMK++ +  S    
Sbjct: 4   YMVLRMIGEGSFGRALLVQ-------------------HESSNQMFAMKEIRLPKSFSNT 44

Query: 412 DLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAM 591
              ++E  + +   HPN+          V   E    +   Y++      G L+      
Sbjct: 45  QNSRKEAVLLAKMKHPNI----------VAFKESFEAEGHLYIVMEYCDGGDLMQKIKQQ 94

Query: 592 KAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDF 771
           K K   F    +L  F Q+C G+ H+H  +    H D+K  N+ LT + G+  L    DF
Sbjct: 95  KGKL--FPEDMILNWFTQMCLGVNHIH--KKRVLHRDIKSKNIFLT-QNGKVKLG---DF 146

Query: 772 GSARPARKQIRSRSEALQLQEWASEHVSAPFRAP-ELWDCPSHADIDERTDIWSLGCTLY 948
           GSAR     +           +A  +V  P+  P E+W+   +   + ++DIWSLGC LY
Sbjct: 147 GSARLLSNPMA----------FACTYVGTPYYVPPEIWE---NLPYNNKSDIWSLGCILY 193

Query: 949 AI 954
            +
Sbjct: 194 EL 195



>gb:CR382130_1662670 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 907

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 76/287 (26%), Positives = 130/287 (45%), Gaps = 12/287 (4%)
 Frame = +1

Query: 169 SGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPS 348
           S +N  YD V+G   +    N + ++++LG G    V L +++        V+ K  D  
Sbjct: 32  SYVNLDYDPVSGRTTL----NTYEVIKELGRGQHGKVKLGRDLTTGEY---VAIKVVDRL 84

Query: 349 HASDNGTYA-MKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWK 525
                G YA ++K     +   + VK EI +     HP+++ LL+  +  VK+       
Sbjct: 85  GKPKLGKYAQLRKDPSDRNVHEEAVKREIAILKKCEHPHIVRLLE-VMDDVKS------- 136

Query: 526 HEAYLLFPVHMDGTLL---DNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAH 696
            + +++      G L+   D+ T       S +  +  Q+FR +  GL+++H F+    H
Sbjct: 137 RKIFMVLEYCEGGELVWQNDDGTP------SMTMDEARQVFRDVLLGLEYLH-FQ-GIIH 188

Query: 697 NDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPE 876
            D+KP N+LL H++ +     + DFG +        S  +     E A    +  F APE
Sbjct: 189 RDIKPANLLLCHKQVK-----ISDFGVS------FTSAGDTTDEIELAKTAGTPAFFAPE 237

Query: 877 LWDCPSHAD----IDERTDIWSLGCTLYAIMYGVSPF----EYALGE 993
           L  C ++      +  + DIW+LG TLY +++G  PF    EY L E
Sbjct: 238 L--CQNNPGKGNCVTNKIDIWALGVTLYCLLFGKVPFSADSEYELFE 282



>gb:AY047563_1289522 Drosophila melanogaster GH07636 full length cDNA.
          Length = 1721

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 62/249 (24%), Positives = 107/249 (42%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
            +R+ I+ ++G G F  V+  +E                    S    +A K + + +S +
Sbjct: 775  DRYDILEEIGTGAFGVVHRCRE-------------------RSTGNIFAAKFIPVSHSVE 815

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
             DL++ EI + +   H  L+ L D       A E      E  L+      G L +  TA
Sbjct: 816  KDLIRREIDIMNQLHHQKLINLHD-------AFEDDD---EMILILEFLSGGELFERITA 865

Query: 589  MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD 768
               +    + ++V+   RQ+C G++HMH  E +  H D+KP N++   R        L+D
Sbjct: 866  ---EGYVMTEAEVINYMRQICEGIRHMH--EQNIIHLDIKPENIMCQTRSSTN--VKLID 918

Query: 769  FGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLY 948
            FG A          +E +++    +E     F APE+    +   +   TD+W+ G   Y
Sbjct: 919  FGLATRL-----DPNEVVKITTGTAE-----FAAPEI---VNREPVGFYTDMWATGVLSY 965

Query: 949  AIMYGVSPF 975
             ++ G+SPF
Sbjct: 966  VLLSGLSPF 974



>gb:AF047475_1236386 Drosophila melanogaster projectin (projectin)
            gene, partial cds.
          Length = 6658

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 73/310 (23%), Positives = 127/310 (40%), Gaps = 2/310 (0%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
            +R+ I+ ++G G F  V+  +E                    S    +A K + + +S +
Sbjct: 5712 DRYDILEEIGTGAFGVVHRCRE-------------------RSTGNIFAAKFIPVSHSVE 5752

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
             DL++ EI + +   H  L+ L D       A E      E  L+      G L +  TA
Sbjct: 5753 KDLIRREIDIMNQLHHQKLINLHD-------AFEDDD---EMILILEFLSGGELFERITA 5802

Query: 589  MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD 768
               +    + ++V+   RQ+C G++HMH  E +  H D+KP N++   R        L+D
Sbjct: 5803 ---EGYVMTEAEVINYMRQICEGIRHMH--EQNIIHLDIKPENIMCQTRSSTN--VKLID 5855

Query: 769  FGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLY 948
            FG A          +E +++    +E     F APE+    +   +   TD+W+ G   Y
Sbjct: 5856 FGLATRL-----DPNEVVKITTGTAE-----FGAPEI---VNREPVGFYTDMWATGVLSY 5902

Query: 949  AIMYGVSPFEYALGESGGSLQLAIVNAQV-KWPTGLSDPKY-PEALHQFVTWMLQPQATV 1122
             ++ G+SPF      +G +    + N +   W   L   KY  E    F+  +L      
Sbjct: 5903 VLLSGLSPF------AGDNDDQTLKNVKACDWDFALESFKYISEEAKDFIRKLLVRNKEK 5956

Query: 1123 RPHIDDIVIH 1152
            R    + ++H
Sbjct: 5957 RMTAHECLLH 5966



>gb:AE014135_1137696 Drosophila melanogaster chromosome 4, complete
            sequence.>gb:AE003843_1227403 Drosophila melanogaster
            chromosome 4, section 3 of 5 of the complete sequence.
          Length = 8647

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 62/249 (24%), Positives = 107/249 (42%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
            +R+ I+ ++G G F  V+  +E                    S    +A K + + +S +
Sbjct: 7701 DRYDILEEIGTGAFGVVHRCRE-------------------RSTGNIFAAKFIPVSHSVE 7741

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
             DL++ EI + +   H  L+ L D       A E      E  L+      G L +  TA
Sbjct: 7742 KDLIRREIDIMNQLHHQKLINLHD-------AFEDDD---EMILILEFLSGGELFERITA 7791

Query: 589  MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD 768
               +    + ++V+   RQ+C G++HMH  E +  H D+KP N++   R        L+D
Sbjct: 7792 ---EGYVMTEAEVINYMRQICEGIRHMH--EQNIIHLDIKPENIMCQTRSSTN--VKLID 7844

Query: 769  FGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLY 948
            FG A          +E +++    +E     F APE+    +   +   TD+W+ G   Y
Sbjct: 7845 FGLATRL-----DPNEVVKITTGTAE-----FAAPEI---VNREPVGFYTDMWATGVLSY 7891

Query: 949  AIMYGVSPF 975
             ++ G+SPF
Sbjct: 7892 VLLSGLSPF 7900



>gb:AE014135_1137695 Drosophila melanogaster chromosome 4, complete
            sequence.>gb:AE003843_1227402 Drosophila melanogaster
            chromosome 4, section 3 of 5 of the complete sequence.
          Length = 8648

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 62/249 (24%), Positives = 107/249 (42%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
            +R+ I+ ++G G F  V+  +E                    S    +A K + + +S +
Sbjct: 7702 DRYDILEEIGTGAFGVVHRCRE-------------------RSTGNIFAAKFIPVSHSVE 7742

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
             DL++ EI + +   H  L+ L D       A E      E  L+      G L +  TA
Sbjct: 7743 KDLIRREIDIMNQLHHQKLINLHD-------AFEDDD---EMILILEFLSGGELFERITA 7792

Query: 589  MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD 768
               +    + ++V+   RQ+C G++HMH  E +  H D+KP N++   R        L+D
Sbjct: 7793 ---EGYVMTEAEVINYMRQICEGIRHMH--EQNIIHLDIKPENIMCQTRSSTN--VKLID 7845

Query: 769  FGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLY 948
            FG A          +E +++    +E     F APE+    +   +   TD+W+ G   Y
Sbjct: 7846 FGLATRL-----DPNEVVKITTGTAE-----FAAPEI---VNREPVGFYTDMWATGVLSY 7892

Query: 949  AIMYGVSPF 975
             ++ G+SPF
Sbjct: 7893 VLLSGLSPF 7901



>gb:AE014135_1137694 Drosophila melanogaster chromosome 4, complete
            sequence.>gb:AE003843_1227401 Drosophila melanogaster
            chromosome 4, section 3 of 5 of the complete sequence.
          Length = 8930

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 62/249 (24%), Positives = 107/249 (42%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
            +R+ I+ ++G G F  V+  +E                    S    +A K + + +S +
Sbjct: 7984 DRYDILEEIGTGAFGVVHRCRE-------------------RSTGNIFAAKFIPVSHSVE 8024

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
             DL++ EI + +   H  L+ L D       A E      E  L+      G L +  TA
Sbjct: 8025 KDLIRREIDIMNQLHHQKLINLHD-------AFEDDD---EMILILEFLSGGELFERITA 8074

Query: 589  MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD 768
               +    + ++V+   RQ+C G++HMH  E +  H D+KP N++   R        L+D
Sbjct: 8075 ---EGYVMTEAEVINYMRQICEGIRHMH--EQNIIHLDIKPENIMCQTRSSTN--VKLID 8127

Query: 769  FGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLY 948
            FG A          +E +++    +E     F APE+    +   +   TD+W+ G   Y
Sbjct: 8128 FGLATRL-----DPNEVVKITTGTAE-----FAAPEI---VNREPVGFYTDMWATGVLSY 8174

Query: 949  AIMYGVSPF 975
             ++ G+SPF
Sbjct: 8175 VLLSGLSPF 8183



>gb:AE014135_1137693 Drosophila melanogaster chromosome 4, complete
            sequence.>gb:AE003843_1227400 Drosophila melanogaster
            chromosome 4, section 3 of 5 of the complete sequence.
          Length = 8943

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 62/249 (24%), Positives = 107/249 (42%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
            +R+ I+ ++G G F  V+  +E                    S    +A K + + +S +
Sbjct: 7997 DRYDILEEIGTGAFGVVHRCRE-------------------RSTGNIFAAKFIPVSHSVE 8037

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
             DL++ EI + +   H  L+ L D       A E      E  L+      G L +  TA
Sbjct: 8038 KDLIRREIDIMNQLHHQKLINLHD-------AFEDDD---EMILILEFLSGGELFERITA 8087

Query: 589  MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD 768
               +    + ++V+   RQ+C G++HMH  E +  H D+KP N++   R        L+D
Sbjct: 8088 ---EGYVMTEAEVINYMRQICEGIRHMH--EQNIIHLDIKPENIMCQTRSSTN--VKLID 8140

Query: 769  FGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLY 948
            FG A          +E +++    +E     F APE+    +   +   TD+W+ G   Y
Sbjct: 8141 FGLATRL-----DPNEVVKITTGTAE-----FAAPEI---VNREPVGFYTDMWATGVLSY 8187

Query: 949  AIMYGVSPF 975
             ++ G+SPF
Sbjct: 8188 VLLSGLSPF 8196



>gb:BX294150_770391 Pirellula sp. strain 1 complete genome; segment
            18/24.
          Length = 656

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 84/328 (25%), Positives = 137/328 (41%), Gaps = 18/328 (5%)
 Frame = +1

Query: 220  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN 399
            I   R+ ++  +G+GG   VY  +  L D     V+ K              +K  LI+N
Sbjct: 98   ITHPRYEVLEAIGQGGMGSVYKARHRLMDRL---VAIK-------------VIKPELIRN 141

Query: 400  SEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDN 579
            ++ +   + E++ ++   HPN++   D   +            E +LL   H+DG  +D 
Sbjct: 142  AKAIQRFQREVKAAARLVHPNIVTAFDAEQVG-----------ELHLLVMEHVDG--IDL 188

Query: 580  ATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLT---HRKGQPP 750
            A  +K ++   S     +   Q+ AGL+H   FE    H D+KP N++++      G   
Sbjct: 189  AELVK-QRGRLSVPVACEYIAQVAAGLQHA--FENGMVHRDIKPPNLMMSTSHESSGNNA 245

Query: 751  LAI------LMDFGSARPARKQIRSRSEALQLQEWASEHVSA--------PFRAPELWDC 888
              +      ++DFG A  A        E LQ    AS  ++A         + APE    
Sbjct: 246  SKLSGVTIKILDFGLASFAVPD--DSDENLQT---ASHSITAIGTFIGTPAYVAPEQAQD 300

Query: 889  PSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSD-PK 1065
               ADI  R+DI+SLG TL+ +++G  P      +   + Q     A  +   GL D  K
Sbjct: 301  ARQADI--RSDIYSLGATLHFLLFGRPPNAPKKADGRDTNQ-----ANTESSEGLIDEDK 353

Query: 1066 YPEALHQFVTWMLQPQATVRPHIDDIVI 1149
             P++L   +  M+ P    R    D VI
Sbjct: 354  IPDSLRDIIDRMMSPDPKDRFQTPDNVI 381



>pir|T13931|T13931 projectin - fruit fly (Drosophila melanogaster)
            (fragment)
          Length = 6658

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 73/310 (23%), Positives = 127/310 (40%), Gaps = 2/310 (0%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
            +R+ I+ ++G G F  V+  +E                    S    +A K + + +S +
Sbjct: 5712 DRYDILEEIGTGAFGVVHRCRE-------------------RSTGNIFAAKFIPVSHSVE 5752

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
             DL++ EI + +   H  L+ L D       A E      E  L+      G L +  TA
Sbjct: 5753 KDLIRREIDIMNQLHHQKLINLHD-------AFEDDD---EMILILEFLSGGELFERITA 5802

Query: 589  MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD 768
               +    + ++V+   RQ+C G++HMH  E +  H D+KP N++   R        L+D
Sbjct: 5803 ---EGYVMTEAEVINYMRQICEGIRHMH--EQNIIHLDIKPENIMCQTRSSTN--VKLID 5855

Query: 769  FGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLY 948
            FG A          +E +++    +E     F APE+    +   +   TD+W+ G   Y
Sbjct: 5856 FGLATRL-----DPNEVVKITTGTAE-----FGAPEI---VNREPVGFYTDMWATGVLSY 5902

Query: 949  AIMYGVSPFEYALGESGGSLQLAIVNAQV-KWPTGLSDPKY-PEALHQFVTWMLQPQATV 1122
             ++ G+SPF      +G +    + N +   W   L   KY  E    F+  +L      
Sbjct: 5903 VLLSGLSPF------AGDNDDQTLKNVKACDWDFALESFKYISEEAKDFIRKLLVRNKEK 5956

Query: 1123 RPHIDDIVIH 1152
            R    + ++H
Sbjct: 5957 RMTAHECLLH 5966



>sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I
           (EC 2.7.1.123).>pir|A40896|A40896
           Ca2+/calmodulin-dependent protein kinase (EC 2.7.1.123)
           CMK1 - yeast (Saccharomyces
           cerevisiae)>gb:YSCCHRVIN_1728524 Saccharomyces
           cerevisiae chromosome VI complete DNA
           sequence.>gb:YSCCMK1II_1728587 Saccharomyces cerevisiae
           CMK1 gene for CaM kinase II, complete cds.
          Length = 446

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 64/257 (24%), Positives = 110/257 (42%), Gaps = 4/257 (1%)
 Frame = +1

Query: 217 WINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAM-KKVLI 393
           ++N  ++   + LG G F                GV ++ K+     D     + KK L 
Sbjct: 31  YVNKKKYVFGKTLGAGTF----------------GVVRQAKNTETGEDVAVKILIKKALK 74

Query: 394 QNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSW---KHEAYLLFPVHMDG 564
            N  QL+ + +E+ +     HPN++   D             W   K + Y++  +   G
Sbjct: 75  GNKVQLEALYDELDILQRLHHPNIVAFKD-------------WFESKDKFYIITQLAKGG 121

Query: 565 TLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQ 744
            L D       KK  F+  D ++I  ++ + +K+MH+   +  H D+KP N+L   +  +
Sbjct: 122 ELFDRIL----KKGKFTEEDAVRILVEILSAVKYMHS--QNIVHRDLKPENLLYIDKSDE 175

Query: 745 PPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDI 924
            PL ++ DFG A    K+++S  E L     +  +V     APE+     H    +  DI
Sbjct: 176 SPL-VVADFGIA----KRLKSDEELLYKPAGSLGYV-----APEVLTQDGHG---KPCDI 222

Query: 925 WSLGCTLYAIMYGVSPF 975
           WS+G   Y ++ G S F
Sbjct: 223 WSIGVITYTLLCGYSAF 239



>gb:BC070744_2555714 Xenopus laevis hypothetical protein MGC83745,
           mRNA (cDNA clone MGC:83745 IMAGE:6640141), complete cds.
          Length = 1427

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 66/260 (25%), Positives = 116/260 (44%), Gaps = 3/260 (1%)
 Frame = +1

Query: 226 DNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSE 405
           DN + I  +LG G FA V                KK ++ S  +      +KK   ++S 
Sbjct: 10  DNYYDIGEELGSGQFAVV----------------KKCQEKSAGTHYAAKFIKKRRTKSSR 53

Query: 406 Q---LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD 576
           +    + ++ E+ +     HPN++ L  H V   K         +  L+  +   G L D
Sbjct: 54  RGVTREDIEREVSILKEIQHPNVITL--HEVYENKT--------DVILILELVAGGELFD 103

Query: 577 NATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLA 756
                 A+KES +  +  +  +Q+  G+ ++H+ +   AH D+KP N++L  R    P  
Sbjct: 104 ----FLAEKESLTEEEATEFIKQILNGVNYLHSLQ--IAHFDLKPENIMLLDRNAPKPRI 157

Query: 757 ILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLG 936
            ++DFG A     +I S +      E+ +   +  F APE+    ++  +   +D+WS+G
Sbjct: 158 KIIDFGLAH----RIDSGN------EFKNIFGTPEFVAPEI---VNYEPLGLESDMWSIG 204

Query: 937 CTLYAIMYGVSPFEYALGES 996
              Y ++ G SPF   LGE+
Sbjct: 205 VITYILLSGASPF---LGET 221



>gb:AE017356_1760231 Cryptococcus neoformans var. neoformans JEC21
           chromosome 14, complete sequence.
          Length = 1326

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 69/257 (26%), Positives = 113/257 (43%), Gaps = 7/257 (2%)
 Frame = +1

Query: 229 NRFRIVRQLGEGGFAYVYLVK------EILADPAKPGVSKKFKDPSHASDNGTYAMKKVL 390
           +RF  + ++G G +  V+L K        L++P   GV K  K    A+  G+ A  KV 
Sbjct: 163 DRFTFISEIGFGNWGSVWLCKPKHARSSQLSEPG--GVVKLGKQA--AASGGSGAGGKVA 218

Query: 391 IQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTL 570
           I+   +        RV +L+    ++  L H             + E++++ P +    L
Sbjct: 219 IKLVHRSKTATTAARVRALWGEMKIIRALRHE------PHPSIIQFESFVITPSY---AL 269

Query: 571 LDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPP 750
           +               S     FRQL + + ++H  E    HND+KP NVLL+H      
Sbjct: 270 VIMPHLSHLIPVCLPPSRATPYFRQLASAVGYLH--ERGITHNDIKPANVLLSHND---- 323

Query: 751 LAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDER-TDIW 927
           + +L+DFG A+  +  + +R   L    W +     P RA  +         DER +D+W
Sbjct: 324 IPVLVDFGFAQ--KWDVGARGSFLSSISWGTPEYLDPQRAKGM-------PHDERASDVW 374

Query: 928 SLGCTLYAIMYGVSPFE 978
           SLG T++ I+ G +PFE
Sbjct: 375 SLGITMFEILIGRTPFE 391



>gb:AF043629_1235900 Toxoplasma gondii protein kinase 4 (tpk4) mRNA,
           complete cds.
          Length = 501

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 72/257 (28%), Positives = 108/257 (42%), Gaps = 2/257 (0%)
 Frame = +1

Query: 220 INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN 399
           I  +R++  R LG+G F  V L K  +                     G     KV+ + 
Sbjct: 46  IFSHRYKGQRVLGKGSFGEVILCKHKIT--------------------GQECAVKVISKR 85

Query: 400 SEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDN 579
                 VK++    SL     LL  LDH  I +K  E    K   YL+  V+  G L D 
Sbjct: 86  Q-----VKQKTDKESLLREVQLLKQLDHPNI-MKLYEFFEDKGYFYLVGEVYTGGELFDE 139

Query: 580 ATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAI 759
             + K     FS  D  +I RQ+ +G+ +MH  +    H D+KP N+LL  +     + I
Sbjct: 140 IISRKR----FSEVDAARIIRQVLSGITYMH--KNKIVHRDLKPENLLLESKSKDANIRI 193

Query: 760 LMDFGSAR--PARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSL 933
           + DFG +    A K+++ +              +A + APE+     H   DE+ D+WS 
Sbjct: 194 I-DFGLSTHFEASKKMKDKIG------------TAYYIAPEVL----HGTYDEKCDVWST 236

Query: 934 GCTLYAIMYGVSPFEYA 984
           G  LY ++ G  PF  A
Sbjct: 237 GVILYILLSGCPPFNGA 253



>gb:ACTWITCH_1208280 A.californica mRNA for twitchin-like protein.
          Length = 451

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 68/245 (27%), Positives = 104/245 (42%)
 Frame = +1

Query: 418  VKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKA 597
            VK EI + +   HP L+ L D       A E    K++  L+      G L D   A   
Sbjct: 89   VKNEISIMNQLHHPKLINLHD-------AFED---KYDMVLILEFLSGGELFDRIAAEDY 138

Query: 598  KKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGS 777
            K    S ++V+   RQ C GLKHMH  E S  H D+KP N++   +K       ++DFG 
Sbjct: 139  K---MSEAEVINYMRQACEGLKHMH--EHSIVHLDIKPENIMCETKKASS--VKIIDFGL 191

Query: 778  ARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIM 957
            A        +  E +++        +A F APE+ D      +   TD+W++G   Y ++
Sbjct: 192  ATKL-----NPDEIVKVTT-----ATAEFAAPEIVD---REPVGFYTDMWAIGVLGYVLL 238

Query: 958  YGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHID 1137
             G+SPF    GE        +     ++         PEA   F+  +LQ +   R  + 
Sbjct: 239  SGLSPF---AGEDDLETLQNVKRCDWEFDEDAFSSVSPEA-KDFIKNLLQKEPRKRLTVH 294

Query: 1138 DIVIH 1152
            D + H
Sbjct: 295  DALEH 299



>pir|S49128|S49128 twitchin-like protein - California sea hare
            (fragment)
          Length = 451

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 68/245 (27%), Positives = 104/245 (42%)
 Frame = +1

Query: 418  VKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKA 597
            VK EI + +   HP L+ L D       A E    K++  L+      G L D   A   
Sbjct: 89   VKNEISIMNQLHHPKLINLHD-------AFED---KYDMVLILEFLSGGELFDRIAAEDY 138

Query: 598  KKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGS 777
            K    S ++V+   RQ C GLKHMH  E S  H D+KP N++   +K       ++DFG 
Sbjct: 139  K---MSEAEVINYMRQACEGLKHMH--EHSIVHLDIKPENIMCETKKASS--VKIIDFGL 191

Query: 778  ARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIM 957
            A        +  E +++        +A F APE+ D      +   TD+W++G   Y ++
Sbjct: 192  ATKL-----NPDEIVKVTT-----ATAEFAAPEIVD---REPVGFYTDMWAIGVLGYVLL 238

Query: 958  YGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHID 1137
             G+SPF    GE        +     ++         PEA   F+  +LQ +   R  + 
Sbjct: 239  SGLSPF---AGEDDLETLQNVKRCDWEFDEDAFSSVSPEA-KDFIKNLLQKEPRKRLTVH 294

Query: 1138 DIVIH 1152
            D + H
Sbjct: 295  DALEH 299



>sp|P18652|K6AA_CHICK Ribosomal protein S6 kinase II alpha (EC
            2.7.1.37) (S6KII-alpha) (P90- RSK) (MAP kinase-activated
            protein kinase 1) (MAPK-activated protein kinase 1)
            (MAPKAP kinase 1) (MAPKAPK-1).>pir|A32571|A32571
            ribosomal protein S6 kinase II (EC 2.7.1.-) alpha chain
            homolog - chicken>gb:CHKS6KIIA_2569530 Gallus gallus
            (clone AV36) ribosomal protein S6 kinase (rsk) mRNA,
            complete cds.
          Length = 752

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 68/237 (28%), Positives = 105/237 (44%), Gaps = 1/237 (0%)
 Frame = +1

Query: 268  FAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSL 447
            F+  Y+VKE +      G     K   H + N  YA+K  +I  S++     EEI +   
Sbjct: 431  FSDGYVVKEAIG----VGSYSVCKRCIHKTTNMEYAVK--VIDKSKRDP--SEEIEILLR 482

Query: 448  FS-HPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSD 624
            +  HPN++ L D         +G+      YL+  +   G LLD     K     FS  +
Sbjct: 483  YGQHPNIITLKD------VYDDGKY----VYLVTELMRGGELLDKILRQKF----FSERE 528

Query: 625  VLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIR 804
               +   +C  ++++H+      H D+KP N+L     G P    + DFG A    KQ+R
Sbjct: 529  ASSVLHTICKTVEYLHS--QGVVHRDLKPSNILYVDESGNPESIRICDFGFA----KQLR 582

Query: 805  SRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPF 975
            + +  L    +     +A F APE+     +   DE  DIWSLG  LY ++ G +PF
Sbjct: 583  AENGLLMTPCY-----TANFVAPEVLKRQGY---DEGCDIWSLGVLLYTMLAGCTPF 631



 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 66/280 (23%), Positives = 116/280 (41%), Gaps = 4/280 (1%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
            ++F +++ LG+G F  V+LV++I                +    N  YAMK +     + 
Sbjct: 78   SQFELLKVLGQGSFGKVFLVRKI----------------TPPDSNHLYAMKVLKKATLKV 121

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
             D V+ +I         ++L  ++H  + VK       + + YL+      G L      
Sbjct: 122  RDRVRTKI-------ERDILADVNHPFV-VKLHYAFQTEGKLYLILDFLRGGDLFTRL-- 171

Query: 589  MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLT---HRKGQPPLAI 759
              +K+  F+  DV     +L  GL H+H+      + D+KP N+LL    H K       
Sbjct: 172  --SKEVMFTEEDVKFYLAELALGLDHLHSL--GIIYRDLKPENILLDEEGHIK------- 220

Query: 760  LMDFGSARPARKQIRSRSEALQLQEWASEHV-SAPFRAPELWDCPSHADIDERTDIWSLG 936
            L DFG ++          EA+  ++ A     +  + APE+ +   H+      D WS G
Sbjct: 221  LTDFGLSK----------EAIDHEKKAYSFCGTVEYMAPEVVNRQGHS---HSADWWSYG 267

Query: 937  CTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLS 1056
              ++ ++ G  PF+   G+        I+ A++  P  LS
Sbjct: 268  VLMFEMLTGSLPFQ---GKDRKETMTLILKAKLGMPQFLS 304



>gb:CEZK617_1371674 Caenorhabditis elegans cosmid ZK617, complete
            sequence.>gb:CEZK829_1371824 Caenorhabditis elegans
            cosmid ZK829, complete sequence.
          Length = 7158

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 65/250 (26%), Positives = 106/250 (42%), Gaps = 1/250 (0%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
            + + I  +LG G F  V+ V E                    +    +A K V+  +   
Sbjct: 6259 DHYDIHEELGTGAFGVVHRVTE-------------------RATGNNFAAKFVMTPHESD 6299

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
             + V++EI+  S+  HP L+ L D       A E  +   E  +++     G L +    
Sbjct: 6300 KETVRKEIQTMSVLRHPTLVNLHD-------AFEDDN---EMVMIYEFMSGGELFEKVAD 6349

Query: 589  MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD 768
               K    S  + ++  RQ+C GL HMH  E +Y H D+KP N++ T ++       L+D
Sbjct: 6350 EHNK---MSEDEAVEYMRQVCKGLCHMH--ENNYVHLDLKPENIMFTTKRSNE--LKLID 6402

Query: 769  FG-SARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTL 945
            FG +A    KQ    +             +A F APE+ +      +   TD+WS+G   
Sbjct: 6403 FGLTAHLDPKQSVKVTTG-----------TAEFAAPEVAE---GKPVGYYTDMWSVGVLS 6448

Query: 946  YAIMYGVSPF 975
            Y ++ G+SPF
Sbjct: 6449 YILLSGLSPF 6458



>gb:CEUNC22_1368692 Caenorhabditis elegans unc-22 gene for twitchin.
          Length = 6048

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 65/250 (26%), Positives = 106/250 (42%), Gaps = 1/250 (0%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
            + + I  +LG G F  V+ V E                    +    +A K V+  +   
Sbjct: 5149 DHYDIHEELGTGAFGVVHRVTE-------------------RATGNNFAAKFVMTPHESD 5189

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
             + V++EI+  S+  HP L+ L D       A E  +   E  +++     G L +    
Sbjct: 5190 KETVRKEIQTMSVLRHPTLVNLHD-------AFEDDN---EMVMIYEFMSGGELFEKVAD 5239

Query: 589  MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD 768
               K    S  + ++  RQ+C GL HMH  E +Y H D+KP N++ T ++       L+D
Sbjct: 5240 EHNK---MSEDEAVEYMRQVCKGLCHMH--ENNYVHLDLKPENIMFTTKRSNE--LKLID 5292

Query: 769  FG-SARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTL 945
            FG +A    KQ    +             +A F APE+ +      +   TD+WS+G   
Sbjct: 5293 FGLTAHLDPKQSVKVTTG-----------TAEFAAPEVAE---GKPVGYYTDMWSVGVLS 5338

Query: 946  YAIMYGVSPF 975
            Y ++ G+SPF
Sbjct: 5339 YILLSGLSPF 5348



>pir|T27935|T27935 hypothetical protein ZK617.1b - Caenorhabditis
            elegans
          Length = 7160

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 65/250 (26%), Positives = 106/250 (42%), Gaps = 1/250 (0%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
            + + I  +LG G F  V+ V E                    +    +A K V+  +   
Sbjct: 6261 DHYDIHEELGTGAFGVVHRVTE-------------------RATGNNFAAKFVMTPHESD 6301

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
             + V++EI+  S+  HP L+ L D       A E  +   E  +++     G L +    
Sbjct: 6302 KETVRKEIQTMSVLRHPTLVNLHD-------AFEDDN---EMVMIYEFMSGGELFEKVAD 6351

Query: 589  MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD 768
               K    S  + ++  RQ+C GL HMH  E +Y H D+KP N++ T ++       L+D
Sbjct: 6352 EHNK---MSEDEAVEYMRQVCKGLCHMH--ENNYVHLDLKPENIMFTTKRSNE--LKLID 6404

Query: 769  FG-SARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTL 945
            FG +A    KQ    +             +A F APE+ +      +   TD+WS+G   
Sbjct: 6405 FGLTAHLDPKQSVKVTTG-----------TAEFAAPEVAE---GKPVGYYTDMWSVGVLS 6450

Query: 946  YAIMYGVSPF 975
            Y ++ G+SPF
Sbjct: 6451 YILLSGLSPF 6460



>pir|A88852|A88852 protein unc-22 [imported] - Caenorhabditis elegans
          Length = 6831

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 65/250 (26%), Positives = 106/250 (42%), Gaps = 1/250 (0%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
            + + I  +LG G F  V+ V E                    +    +A K V+  +   
Sbjct: 5932 DHYDIHEELGTGAFGVVHRVTE-------------------RATGNNFAAKFVMTPHESD 5972

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
             + V++EI+  S+  HP L+ L D       A E  +   E  +++     G L +    
Sbjct: 5973 KETVRKEIQTMSVLRHPTLVNLHD-------AFEDDN---EMVMIYEFMSGGELFEKVAD 6022

Query: 589  MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD 768
               K    S  + ++  RQ+C GL HMH  E +Y H D+KP N++ T ++       L+D
Sbjct: 6023 EHNK---MSEDEAVEYMRQVCKGLCHMH--ENNYVHLDLKPENIMFTTKRSNE--LKLID 6075

Query: 769  FG-SARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTL 945
            FG +A    KQ    +             +A F APE+ +      +   TD+WS+G   
Sbjct: 6076 FGLTAHLDPKQSVKVTTG-----------TAEFAAPEVAE---GKPVGYYTDMWSVGVLS 6121

Query: 946  YAIMYGVSPF 975
            Y ++ G+SPF
Sbjct: 6122 YILLSGLSPF 6131



>pir|S57242|S57242 twitchin [similarity] - Caenorhabditis
            elegans>gb:CEZK617_1371673 Caenorhabditis elegans cosmid
            ZK617, complete sequence.>gb:CEZK829_1371823
            Caenorhabditis elegans cosmid ZK829, complete sequence.
          Length = 6839

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 65/250 (26%), Positives = 106/250 (42%), Gaps = 1/250 (0%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
            + + I  +LG G F  V+ V E                    +    +A K V+  +   
Sbjct: 5940 DHYDIHEELGTGAFGVVHRVTE-------------------RATGNNFAAKFVMTPHESD 5980

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
             + V++EI+  S+  HP L+ L D       A E  +   E  +++     G L +    
Sbjct: 5981 KETVRKEIQTMSVLRHPTLVNLHD-------AFEDDN---EMVMIYEFMSGGELFEKVAD 6030

Query: 589  MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD 768
               K    S  + ++  RQ+C GL HMH  E +Y H D+KP N++ T ++       L+D
Sbjct: 6031 EHNK---MSEDEAVEYMRQVCKGLCHMH--ENNYVHLDLKPENIMFTTKRSNE--LKLID 6083

Query: 769  FG-SARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTL 945
            FG +A    KQ    +             +A F APE+ +      +   TD+WS+G   
Sbjct: 6084 FGLTAHLDPKQSVKVTTG-----------TAEFAAPEVAE---GKPVGYYTDMWSVGVLS 6129

Query: 946  YAIMYGVSPF 975
            Y ++ G+SPF
Sbjct: 6130 YILLSGLSPF 6139



>gb:BC066785_2554608 Xenopus tropicalis hypothetical protein
           MGC76030, mRNA (cDNA clone MGC:76030 IMAGE:5384896),
           complete cds.
          Length = 381

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 53/189 (28%), Positives = 85/189 (44%)
 Frame = +1

Query: 412 DLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAM 591
           D V+ E+ +     HPN++ L  H V A KA        E  L+  +   G L D     
Sbjct: 59  DQVEREVFILQQLEHPNIMRL--HDVFASKA--------EMVLILELIRGGELFD----F 104

Query: 592 KAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDF 771
            A+KE+ S  D ++   Q+  G+ +MH    S AH D+KP N++L  +    P   ++DF
Sbjct: 105 IAEKEALSEEDAIEFLEQILKGVAYMHT--RSIAHFDLKPENIMLLQKDVPHPKIKIIDF 162

Query: 772 GSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYA 951
           G A+        +S     Q  A E ++             +  +   TD+WS+G   Y 
Sbjct: 163 GLAQKIEDGTVFKSLCGTPQYIAPEVIN-------------YEPLGPPTDMWSIGVITYI 209

Query: 952 IMYGVSPFE 978
           ++ G+SPF+
Sbjct: 210 LLSGLSPFQ 218



>gb:AY555067_1335209 Plasmodium berghei calcium dependent protein
           kinase 4 (cdpk4) mRNA, complete cds.
          Length = 528

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 64/250 (25%), Positives = 109/250 (43%)
 Frame = +1

Query: 226 DNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSE 405
           + +++ ++ LG+G F  V L K+              K   H      YA+K +  ++  
Sbjct: 67  NEQYKGIKILGKGSFGEVILSKD--------------KHTGHE-----YAIKVISKKH-- 105

Query: 406 QLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNAT 585
               VK +    SL     LL +LDH  I +K  E     +  YL+  V+  G L D   
Sbjct: 106 ----VKRKTDKQSLLREVELLKMLDHINI-MKLYEFFEDNNYYYLVSDVYSGGELFDEII 160

Query: 586 AMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILM 765
           + K     F   D  +I +Q+ +G+ +MH  + +  H D+KP N+LL  +  +  +  ++
Sbjct: 161 SRKR----FYEVDAARIIKQVLSGITYMH--KNNVVHRDLKPENILLETKNKEDMIIKII 214

Query: 766 DFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTL 945
           DFG +       + + +            +A + AP++     H   DE+ DIWS G  L
Sbjct: 215 DFGLSTHFEYSKKMKDKI----------GTAYYIAPDVL----HGTYDEKCDIWSCGVIL 260

Query: 946 YAIMYGVSPF 975
           Y ++ G  PF
Sbjct: 261 YILLSGCPPF 270



>gb:AY389513_1324997 Eimeria tenella calmodulin-domain protein
           kinase mRNA, partial cds.
          Length = 487

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 62/252 (24%), Positives = 105/252 (41%)
 Frame = +1

Query: 229 NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
           +R++  R LG+G F  V L K                D     +     + K  ++    
Sbjct: 26  DRYKGQRVLGKGSFGEVILCK----------------DKVTGQEYAVKVISKRQVKQKTD 69

Query: 409 LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
            +L+ +E+ +     HPN++ L +              K   YL+  V+  G L     +
Sbjct: 70  KELLLKEVELLKKLVHPNIMKLYEFF----------EDKGYFYLVTEVYTGGELFGEIIS 119

Query: 589 MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD 768
            K     FS  D  +I RQ+ +G+ +MH  +    H D+KP N+LL +++    + I+ D
Sbjct: 120 RKR----FSEVDAARIIRQVLSGITYMH--KNKIVHRDLKPENLLLENKRKDANIRII-D 172

Query: 769 FGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLY 948
           FG +          +     +E   +  +A + APE+     H   DE+ D+WS G  LY
Sbjct: 173 FGLS----------THFESTKEMKDKIGTAYYIAPEVL----HGAYDEKCDVWSTGVILY 218

Query: 949 AIMYGVSPFEYA 984
            ++ G  PF  A
Sbjct: 219 ILLSGCPPFNGA 230



>sp|Q7RJG2|CDP4_PLAYO Calcium-dependent protein kinase 4 (EC
           2.7.1.37).
          Length = 527

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 64/250 (25%), Positives = 109/250 (43%)
 Frame = +1

Query: 226 DNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSE 405
           + +++ ++ LG+G F  V L K+              K   H      YA+K +  ++  
Sbjct: 66  NEQYKGIKILGKGSFGEVILSKD--------------KHTGHE-----YAIKVISKKH-- 104

Query: 406 QLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNAT 585
               VK +    SL     LL +LDH  I +K  E     +  YL+  V+  G L D   
Sbjct: 105 ----VKRKTDKQSLLREVELLKMLDHINI-MKLYEFFEDNNYYYLVSDVYSGGELFDEII 159

Query: 586 AMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILM 765
           + K     F   D  +I +Q+ +G+ +MH  + +  H D+KP N+LL  +  +  +  ++
Sbjct: 160 SRKR----FYEVDAARIIKQVLSGITYMH--KNNVVHRDLKPENILLETKNKEDMIIKII 213

Query: 766 DFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTL 945
           DFG +       + + +            +A + AP++     H   DE+ DIWS G  L
Sbjct: 214 DFGLSTHFEYSKKMKDKI----------GTAYYIAPDVL----HGTYDEKCDIWSCGVIL 259

Query: 946 YAIMYGVSPF 975
           Y ++ G  PF
Sbjct: 260 YILLSGCPPF 269



>sp|P62345|CDP4_PLABA Calcium-dependent protein kinase 4 (EC
           2.7.1.37) (PbCDPK4).
          Length = 527

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 64/250 (25%), Positives = 109/250 (43%)
 Frame = +1

Query: 226 DNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSE 405
           + +++ ++ LG+G F  V L K+              K   H      YA+K +  ++  
Sbjct: 66  NEQYKGIKILGKGSFGEVILSKD--------------KHTGHE-----YAIKVISKKH-- 104

Query: 406 QLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNAT 585
               VK +    SL     LL +LDH  I +K  E     +  YL+  V+  G L D   
Sbjct: 105 ----VKRKTDKQSLLREVELLKMLDHINI-MKLYEFFEDNNYYYLVSDVYSGGELFDEII 159

Query: 586 AMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILM 765
           + K     F   D  +I +Q+ +G+ +MH  + +  H D+KP N+LL  +  +  +  ++
Sbjct: 160 SRKR----FYEVDAARIIKQVLSGITYMH--KNNVVHRDLKPENILLETKNKEDMIIKII 213

Query: 766 DFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTL 945
           DFG +       + + +            +A + AP++     H   DE+ DIWS G  L
Sbjct: 214 DFGLSTHFEYSKKMKDKI----------GTAYYIAPDVL----HGTYDEKCDIWSCGVIL 259

Query: 946 YAIMYGVSPF 975
           Y ++ G  PF
Sbjct: 260 YILLSGCPPF 269



>gb:AF363966_2489444 Rana dybowskii 90-kDa ribosomal protein S6
           kinase (Rsk) mRNA, complete cds.
          Length = 733

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 62/210 (29%), Positives = 94/210 (44%), Gaps = 1/210 (0%)
 Frame = +1

Query: 349 HASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAVIAVKASEGQSWK 525
           H   N  YA+K  +I  S++     EEI +   +  HPN++ L D         EG S  
Sbjct: 435 HKGTNMEYAVK--IIDKSKKDP--SEEIEILRRYGQHPNIIALKD------VYEEGNS-- 482

Query: 526 HEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDV 705
              YL+  +   G LLD     K     FS  +   +   +C  ++++H+      + D+
Sbjct: 483 --VYLVTDLMRGGELLDRILRQKF----FSEREACAVLLTMCKTVEYLHS--QGVVNRDL 534

Query: 706 KPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWD 885
           KP N+L     G P    + DFG A    KQ+R+ +  L    +     +A F APE+  
Sbjct: 535 KPSNILYVDESGNPESIRICDFGFA----KQLRAENGLLMTPCY-----TANFVAPEVLK 585

Query: 886 CPSHADIDERTDIWSLGCTLYAIMYGVSPF 975
              +   DE  DIWSLG  LY ++ G +PF
Sbjct: 586 RQGY---DEGCDIWSLGILLYTMLAGYTPF 612



 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 63/282 (22%), Positives = 116/282 (41%), Gaps = 4/282 (1%)
 Frame = +1

Query: 223  NDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNS 402
            + + F +++ LG+G F  V+LV++I                +   +N  YAMK +     
Sbjct: 59   DQSHFVLLKVLGQGSFGKVFLVRKI----------------TPPDNNQLYAMKVLKKATL 102

Query: 403  EQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNA 582
            +  D V+ ++         ++L  + H  + V+       + + YL+      G L    
Sbjct: 103  KVRDRVRTKM-------ERDILAEVHHPFV-VRLHYAFQTEGKLYLILDFLRGGDLFTRL 154

Query: 583  TAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLT---HRKGQPPL 753
                +K+  F+  DV     +L  GL H+H+      + D+KP N+LL    H K     
Sbjct: 155  ----SKEVMFTEEDVKFYLAELALGLDHLHSL--GIIYRDLKPENILLDEEGHIK----- 203

Query: 754  AILMDFGSARPARKQIRSRSEALQLQEWASEHV-SAPFRAPELWDCPSHADIDERTDIWS 930
              L DFG ++          E++  ++ A     +  + APE+ +   H+      D WS
Sbjct: 204  --LTDFGLSK----------ESIDHEKKAYSFCGTVEYMAPEVVNRQGHS---HSADWWS 248

Query: 931  LGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLS 1056
             G  ++ ++ G  PF+   G+        I+ A++  P  LS
Sbjct: 249  YGVLMFEMLTGSLPFQ---GKDRKETMTLILKAKLGMPQFLS 287



>gb:BX294154_771605 Pirellula sp. strain 1 complete genome; segment
            22/24.
          Length = 880

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 79/342 (23%), Positives = 137/342 (40%), Gaps = 6/342 (1%)
 Frame = +1

Query: 232  RFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQL 411
            R+ I  +LG GG   VY                     SH       A+K + +   +  
Sbjct: 584  RYHIHEELGAGGMGVVYRA-------------------SHTELGREIALKVLRVDRQDDD 624

Query: 412  DLVK--EEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNAT 585
            D  +   E R+++    P+ + + D+         G +   EA+ +  + +DG  L    
Sbjct: 625  DHRRFDREARLAASLCSPHSVTIYDY---------GHNEHGEAFCVMQL-LDGLTLSEIV 674

Query: 586  AMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILM 765
            A    +E    +  + I RQ+C  +   H+      H D+KP N++L+        A++ 
Sbjct: 675  ARSGHQEP---ARAIWIMRQVCQAVLEAHS--QGLMHRDLKPQNIMLSFDTIVGDWAVVF 729

Query: 766  DFGSARPARKQIRSRSEALQLQE--WASEHVSAPFRAPELWDCPSHADIDERTDIWSLGC 939
            DFG A+P    +       Q  E  WA   +   + APE +  PS   +D R+D++SLGC
Sbjct: 730  DFGLAKP----LEPNQGVFQTAETVWAGTPM---YMAPERFRAPSV--MDPRSDVYSLGC 780

Query: 940  TLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQAT 1119
             LY ++ G  PF     ES     L +    ++  T   +P   E        M + +  
Sbjct: 781  VLYFLLSGRPPFAECDPES--MFALILTQQPLEIETHRGEPVEAELNALVQACMAKDKHD 838

Query: 1120 VRPHIDDIVIHVDKLISKF--SH*EVRCRPKRHAHNYFAKNM 1239
                + D++  +D L  ++  +  + R   +RHA    AK +
Sbjct: 839  RVGSVADLIQRLDALAPRYPWTQEDARHWWQRHADEELAKKL 880



>gb:BX294148_769970 Pirellula sp. strain 1 complete genome; segment
            16/24.
          Length = 510

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 82/352 (23%), Positives = 144/352 (40%), Gaps = 6/352 (1%)
 Frame = +1

Query: 88   RENFVRDLE*EARGS*PIARKKMGCSFSGLNALYD----AVNGGGDVWINDNRFRIVRQL 255
            +E F++ +  +  G+ P + KK+  ++     L D     +  G        +++++  +
Sbjct: 24   QERFLKKVREKCEGNLPASSKKLALAYKKAGLLTDWHIEKLFTGKYKGFFLGKYKLLGHI 83

Query: 256  GEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIR 435
            G GG + VYL + I       G+  K              + K  + ++  L   K E +
Sbjct: 84   GSGGMSSVYLAEHI-------GLGDK---------RAIKVLPKKRVNDASYLARFKLEAK 127

Query: 436  VSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFS 615
              +  +HPN++  L H +     ++G     + + +   ++DG  L     +  +     
Sbjct: 128  AIASLNHPNIV--LAHDI----DNDG-----DVHYIVMEYVDGVDLQ---VLVRRDGPLD 173

Query: 616  TSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARK 795
             S   ++  Q   GL H HN      H DVKP N+L+           L+D G A  ++ 
Sbjct: 174  FSTAAELISQAARGLAHAHN--RGVVHRDVKPANLLID----SDGRVRLLDMGLALVSKT 227

Query: 796  QIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPF 975
                  E+L +    +   +A + APE     SH  +D R DI+ LGCTLY ++ G  PF
Sbjct: 228  ---GDDESLTVANNENVLGTADYLAPEQ-ALNSHT-VDHRVDIYGLGCTLYFLLTGRPPF 282

Query: 976  EYALGESGGSLQLAIVNAQVKWPTGLSD--PKYPEALHQFVTWMLQPQATVR 1125
                  + G+L   I   Q + P  + +  P+ P  L   V  M+Q     R
Sbjct: 283  ------AEGTLAQRIAKHQNEMPKAIRELRPECPGELEGIVVKMIQKDPRYR 328



>gb:AP008226_579051 Thermus thermophilus HB8 genomic DNA, complete
            genome.
          Length = 652

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 78/313 (24%), Positives = 118/313 (37%), Gaps = 8/313 (2%)
 Frame = +1

Query: 232  RFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQL 411
            R+ I+ ++G GG A VY  K+      K G     K P               + +   +
Sbjct: 97   RYEILEKVGLGGMATVYKAKD-----RKTGRLVALKVPQER-----------FLGDPRFV 140

Query: 412  DLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAM 591
                 E  V +   HPN++ + DH  +     EG  +    +L      DG  LD     
Sbjct: 141  RRFHREAEVLTRMDHPNIVKVYDHGQV-----EGVHYIAMEFL------DGEGLDKLI-- 187

Query: 592  KAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLT----HRKGQPPLAI 759
              ++   S      I  ++   LKH+H       H D+KPGN+++        G  P  +
Sbjct: 188  --EERRLSLRQAAAILARVADALKHIH--AQGIVHRDIKPGNIMVLKGALREDGVDPRGV 243

Query: 760  -LMDFGSARPARKQIRSRSEALQLQEWASEHVSAP-FRAPELWDCPSHADIDERTDIWSL 933
             LMDFG A             L         +  P + +PE         +D R+DI+SL
Sbjct: 244  RLMDFGIAA---------GRVLTRLTITGARIGTPVYMSPEQ---AKGQKLDHRSDIYSL 291

Query: 934  GCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSD--PKYPEALHQFVTWMLQ 1107
            G  LY  + G  PF        G  +  I     + PT      P+ P+AL   V  ML+
Sbjct: 292  GIVLYEALTGQPPFT-------GGYETVIHQQIFQMPTPPKQLRPEIPQALSDLVLRMLE 344

Query: 1108 PQATVRPHIDDIV 1146
                 RP +D++V
Sbjct: 345  KDPAKRPGLDEVV 357



>gb:AE017305_436864 Thermus thermophilus HB27 section 5 of 7 of the
            complete genome.>gb:AE017221_1078842 Thermus thermophilus
            HB27 complete genome.
          Length = 652

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 78/313 (24%), Positives = 118/313 (37%), Gaps = 8/313 (2%)
 Frame = +1

Query: 232  RFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQL 411
            R+ I+ ++G GG A VY  K+      K G     K P               + +   +
Sbjct: 97   RYEILEKVGLGGMATVYKAKD-----RKTGRLVALKVPQER-----------FLGDPRFV 140

Query: 412  DLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAM 591
                 E  V +   HPN++ + DH  +     EG  +    +L      DG  LD     
Sbjct: 141  RRFHREAEVLTRMDHPNIVKVYDHGQV-----EGVHYIAMEFL------DGEGLDKLI-- 187

Query: 592  KAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLT----HRKGQPPLAI 759
              ++   S      I  ++   LKH+H       H D+KPGN+++        G  P  +
Sbjct: 188  --EERRLSLRQAAAILARVADALKHIH--AQGIVHRDIKPGNIMVLKGALREDGVDPRGV 243

Query: 760  -LMDFGSARPARKQIRSRSEALQLQEWASEHVSAP-FRAPELWDCPSHADIDERTDIWSL 933
             LMDFG A             L         +  P + +PE         +D R+DI+SL
Sbjct: 244  RLMDFGIAA---------GRVLTRLTITGARIGTPVYMSPEQ---AKGQKLDHRSDIYSL 291

Query: 934  GCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSD--PKYPEALHQFVTWMLQ 1107
            G  LY  + G  PF        G  +  I     + PT      P+ P+AL   V  ML+
Sbjct: 292  GIVLYEALTGQPPFT-------GGYETVIHQQIFQMPTPPKQLRPEIPQALSDLVLRMLE 344

Query: 1108 PQATVRPHIDDIV 1146
                 RP +D++V
Sbjct: 345  KDPAKRPGLDEVV 357



>sp|P38147|CHK1_YEAST Serine/threonine-protein kinase CHK1 (EC
           2.7.1.37) (Checkpoint kinase 1).>pir|S46155|S46155
           probable serine/threonine-specific protein kinase (EC
           2.7.1.-) YBR274w - yeast (Saccharomyces
           cerevisiae)>gb:SCYBR274W_1711515 S.cerevisiae chromosome
           II reading frame ORF YBR274w.>gb:AF117345_1769520
           Saccharomyces cerevisiae checkpoint protein kinase
           homolog Chk1 (CHK1) gene, partial cds.
          Length = 527

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 60/190 (31%), Positives = 90/190 (47%), Gaps = 1/190 (0%)
 Frame = +1

Query: 412 DLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAM 591
           D+ KE +  S    HPN+L L+D  V           K   +++  +   G L D     
Sbjct: 61  DITKEVVLQSKCSKHPNVLRLIDCNVS----------KEYMWIILEMADGGDLFD----- 105

Query: 592 KAKKESFSTSDVLQI-FRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD 768
           K + +    SDV Q  F+QL + + ++H  E   AH D+KP N+LL  + G   LA   D
Sbjct: 106 KIEPDVGVDSDVAQFYFQQLVSAINYLH-VECGVAHRDIKPENILLD-KNGNLKLA---D 160

Query: 769 FGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLY 948
           FG A     Q R +   L++     +  S P+ APE+         D RTDIWS+G  L+
Sbjct: 161 FGLA----SQFRRKDGTLRVS--MDQRGSPPYMAPEVLYSEEGYYAD-RTDIWSIGILLF 213

Query: 949 AIMYGVSPFE 978
            ++ G +P+E
Sbjct: 214 VLLTGQTPWE 223



>gb:BC071102_2555964 Xenopus laevis S6 kinase II beta, mRNA (cDNA
            clone MGC:81220 IMAGE:6318872), complete cds.
          Length = 733

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 67/244 (27%), Positives = 104/244 (42%), Gaps = 1/244 (0%)
 Frame = +1

Query: 268  FAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSL 447
            F  VY V+E +      G     K   H   N  YA+K  +I  S++     EEI +   
Sbjct: 412  FTDVYTVRETIG----VGSYSVCKRCVHKGTNMEYAVK--VIDKSKRDP--SEEIEILRR 463

Query: 448  FS-HPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSD 624
            +  HPN++ L D               +  YL+  +   G LLD     K     FS  +
Sbjct: 464  YGQHPNIITLKDVYEEC----------NSIYLVTELMRGGELLDRILRQKF----FSERE 509

Query: 625  VLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIR 804
               +   +C  ++++H+      H D+KP N+L     G P    + DFG +    KQ+R
Sbjct: 510  ACSVLFTVCKTVEYLHS--QGVVHRDLKPSNILYVDESGDPESIRICDFGFS----KQLR 563

Query: 805  SRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA 984
            + +  L    +     +A F APE+     +   DE  DIWSLG  LY ++ G +PF   
Sbjct: 564  AENGLLMTPCY-----TANFVAPEVLKRQGY---DEGCDIWSLGILLYTMLAGYTPFANG 615

Query: 985  LGES 996
             G++
Sbjct: 616  PGDT 619



 Score = 49.7 bits (117), Expect = 2e-04
 Identities = 65/283 (22%), Positives = 112/283 (39%), Gaps = 4/283 (1%)
 Frame = +1

Query: 223  NDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNS 402
            + + F +++ LG+G F  V+LV++I    A                N  YAMK +     
Sbjct: 58   DQSHFVLLKVLGQGSFGKVFLVRKITPPDA----------------NQLYAMKVLKKATL 101

Query: 403  EQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNA 582
            +  D V+ ++    L           H    V+       + + YL+      G L    
Sbjct: 102  KVRDRVRTKMERDILAD--------VHHPFVVRLHYAFQTEGKLYLILDFLRGGDLFTRL 153

Query: 583  TAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLT---HRKGQPPL 753
                +K+  F+  DV     +L  GL H+H+      + D+KP N+LL    H K     
Sbjct: 154  ----SKEVMFTEEDVKFYLAELALGLDHLHSL--GIIYRDLKPENILLDEEGHIK----- 202

Query: 754  AILMDFGSARPARKQIRSRSEALQLQEWASEHV-SAPFRAPELWDCPSHADIDERTDIWS 930
              L DFG ++          EA+  ++ A     +  + APE+ +   H+      D WS
Sbjct: 203  --LTDFGLSK----------EAIDHEKKAYSFCGTVEYMAPEVVNRQGHS---HGADWWS 247

Query: 931  LGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSD 1059
             G  ++ ++ G  PF+   G+        I+ A++  P  LS+
Sbjct: 248  YGVLMFEMLTGSLPFQ---GKDRKETMTLILKAKLGMPQFLSN 287



>gb:AE017348_1758391 Cryptococcus neoformans var. neoformans JEC21
           chromosome 8, complete sequence.
          Length = 485

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 64/241 (26%), Positives = 101/241 (41%)
 Frame = +1

Query: 253 LGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEI 432
           LG GGF  V  VK + A P +       K            + K L++ +EQ   V +EI
Sbjct: 37  LGRGGFGKV--VKALWAPPEREPKEVALK-----------IINKKLVKGNEQA--VLDEI 81

Query: 433 RVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESF 612
            V     HPN++ + D              + + Y+ F + + G L D  +    ++  F
Sbjct: 82  SVLKHLDHPNIVHVWDDF----------ESRDKYYIAFELAVGGELFDRIS----ERGKF 127

Query: 613 STSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPAR 792
           +  D ++  RQ+     ++H  E + AH D+KP N+L   R    PL ++ DFG A+   
Sbjct: 128 TERDAVECIRQVLQATAYLH--EHNVAHRDLKPENILYKTRDADSPL-VIADFGIAKHLE 184

Query: 793 KQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSP 972
              +  SEA           S  + APE+     H     + D WS+G   Y ++ G  P
Sbjct: 185 TPDQECSEAAG---------SFGYAAPEVLLGKPHG---MKVDCWSIGIIAYTLLCGYPP 232

Query: 973 F 975
           F
Sbjct: 233 F 233



>gb:AE016814_1745838 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome I, complete sequence.
          Length = 453

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 64/269 (23%), Positives = 111/269 (41%), Gaps = 2/269 (0%)
 Frame = +1

Query: 175 LNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHA 354
           L   +  V G    ++N   +   + LG G F  V                   +   ++
Sbjct: 36  LTKFFHKVTGQPASYVNKADYIFGKTLGAGAFGVV-------------------RQARNS 76

Query: 355 SDNGTYAMKKVLIQ--NSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKH 528
             N   A+K +L +     +L ++ +E+ +     HPN+          VK  +    + 
Sbjct: 77  KQNQNVAIKILLKRALKGNELQMLYDELSILQKLDHPNI----------VKFKDWFESRE 126

Query: 529 EAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVK 708
           + Y++  +   G L D       KK  F+ +D ++I  Q+   +++MH+   +  H D+K
Sbjct: 127 KFYIVTQLATGGELFDRIL----KKGKFTETDAVKIVVQMLTAVEYMHS--QNVVHRDLK 180

Query: 709 PGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDC 888
           P NVL      +  L ++ DFG A    KQ+ S S+ +     +  +V     APE+   
Sbjct: 181 PENVLYLDPSDESQL-VISDFGIA----KQLSSESQLIHRAAGSMGYV-----APEVLTT 230

Query: 889 PSHADIDERTDIWSLGCTLYAIMYGVSPF 975
             H    +  DIWSLG   Y ++ G SPF
Sbjct: 231 SGHG---KPCDIWSLGVITYTLLCGYSPF 256



>gb:EMCDPK_1384617 E.maxima mRNA for calmodulin-domain protein
           kinase.
          Length = 414

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 54/174 (31%), Positives = 83/174 (47%)
 Frame = +1

Query: 463 LLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFR 642
           LL  LDH  I +K  E    K   YL+  V+  G L D        ++ FS +D  +I R
Sbjct: 4   LLKKLDHPNI-MKLYEFFEDKGYFYLVTEVYTGGELFDEII----NRKRFSEADAARIVR 58

Query: 643 QLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEAL 822
           Q+ +G+ +MH  +    H D+KP N+LL ++K    + I+ DFG +     Q + + +  
Sbjct: 59  QVLSGINYMHRNK--IVHRDLKPENLLLENKKKDANIRII-DFGLSTHFEPQKKMKDKI- 114

Query: 823 QLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA 984
                     +A + APE+     H   DE+ D+WS G  LY ++ G  PF  A
Sbjct: 115 ---------GTAYYIAPEVL----HGTYDEKCDVWSTGVILYILLSGCPPFNGA 155



>gb:AF453997_1272563 Tetrahymena thermophila protein tyrosine kinase 1
            (TtPTK1) gene, complete cds.
          Length = 549

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 69/309 (22%), Positives = 124/309 (40%), Gaps = 3/309 (0%)
 Frame = +1

Query: 235  FRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN--SEQ 408
            F I+++LGEG F  VY VK                     SD   YAMKKV + +  +++
Sbjct: 11   FEILKRLGEGSFGSVYQVKR-------------------KSDEKIYAMKKVKMMSLSTKE 51

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
             +    E+R+ +     N        +I+ K +          ++      G +L   + 
Sbjct: 52   KENALNEVRILASIKSDN--------IISYKEAFYDEKSSTLCIIMEFATKGDVLQQISE 103

Query: 589  MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD 768
             K K   F  + + +    +  GLK +H+ +    H D+K  NV +             +
Sbjct: 104  KKKKHSYFEENLIWKYAADMLLGLKSLHDMK--ILHRDLKGANVFIA------------E 149

Query: 769  FGSARPARKQIRSRSEALQLQEWASEHVSAPF-RAPELWDCPSHADIDERTDIWSLGCTL 945
             GS R     +      +Q +++A      P+  +PE+W    +   D + D+WSLGC L
Sbjct: 150  DGSLRLGDLNVSK----VQKRDFAYTQTGTPYYTSPEVWQ---NRPYDSKCDVWSLGCVL 202

Query: 946  YAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVR 1125
            Y I+    PF+   G S   L   ++      P  L   +Y   + +F+   L+ +  +R
Sbjct: 203  YEIVTLEPPFK---GTSMEDLYKRVLRGNFS-PINLQ--RYSSDIQKFIESCLKVEPKMR 256

Query: 1126 PHIDDIVIH 1152
              ++ ++ H
Sbjct: 257  SSVESLLNH 265



>gb:PFMAL7P1_1191888 Plasmodium falciparum 3D7 chromosome 7, ***
           SEQUENCING IN PROGRESS ***, 12 ordered pieces.
          Length = 528

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 63/250 (25%), Positives = 109/250 (43%)
 Frame = +1

Query: 226 DNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSE 405
           + +++ ++ LG+G F  V L ++              K   H      YA+K +  ++  
Sbjct: 67  NEQYKGIKILGKGSFGEVILSRD--------------KHTGHE-----YAIKVISKKH-- 105

Query: 406 QLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNAT 585
               VK +    SL     LL +LDH  I +K  E     +  YL+  V+  G L D   
Sbjct: 106 ----VKRKTDKESLLREVELLKMLDHINI-MKLYEFFEDNNYYYLVSDVYTGGELFDEII 160

Query: 586 AMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILM 765
           + K     F   D  +I +Q+ +G+ +MH  + +  H D+KP N+LL  +  +  +  ++
Sbjct: 161 SRKR----FYEIDAARIIKQILSGITYMH--KNNVVHRDLKPENILLETKNKEDMIIKII 214

Query: 766 DFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTL 945
           DFG +       + + +            +A + AP++     H   DE+ DIWS G  L
Sbjct: 215 DFGLSTHFEYSKKMKDKI----------GTAYYIAPDVL----HGTYDEKCDIWSCGVIL 260

Query: 946 YAIMYGVSPF 975
           Y ++ G  PF
Sbjct: 261 YILLSGCPPF 270



>pir|H75566|H75566 probable serine/threonine protein kinase -
            Deinococcus radiodurans (strain R1)>gb:AE001868_40348
            Deinococcus radiodurans R1 section 5 of 229 of the
            complete chromosome 1.>gb:AE000513_881243 Deinococcus
            radiodurans R1 complete chromosome 1.
          Length = 591

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 79/331 (23%), Positives = 137/331 (41%), Gaps = 12/331 (3%)
 Frame = +1

Query: 202  GGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMK 381
            GG DV+  D  + ++ ++G GG   VY  K                      D    A+K
Sbjct: 2    GGSDVFFQD--YEVLERVGIGGMGSVYRAKR-------------------RQDGRVVALK 40

Query: 382  KVLIQNSEQLDLVKE---EIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV 552
                +       VK    E  V   F+HPN++ + D+ + A           E Y+    
Sbjct: 41   VPQEKYLADAKFVKRFYREAEVLKRFTHPNIVRVYDYRMQAP----------EHYIAME- 89

Query: 553  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLT- 729
            ++DG  L++      +++ F+ S+ +Q+ R +   L+H+H    +  H D+KP NV++  
Sbjct: 90   YLDGDSLEDLL----ERQPFTFSESVQMLRAMSDALRHIHM--QNVVHRDIKPANVMVLR 143

Query: 730  ----HRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAP-FRAPELWDCPS 894
                + K +     LMDFG A           + L         V  P + APE      
Sbjct: 144  GAFENGKLREGGIKLMDFGIAV---------GKVLTRLTMPGARVGTPIYMAPEQ---AK 191

Query: 895  HADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQV---KWPTGLSDPK 1065
               +D R+D++SLG   Y ++ GV+ F        GS + A+V+ QV     P    + +
Sbjct: 192  GNRVDARSDVYSLGLLAYEMVTGVTAFR-------GSYE-AVVHQQVFEQPKPPKQVNLE 243

Query: 1066 YPEALHQFVTWMLQPQATVRPHIDDIVIHVD 1158
             P  L   +  M++    +RP +D+++  +D
Sbjct: 244  VPGKLSDLILHMIEKDPALRPTLDEVIARID 274



>sp|P10666|K6AB_XENLA Ribosomal protein S6 kinase II beta (EC
            2.7.1.37) (S6KII-beta) (P90- RSK).>pir|A30001|A30001
            ribosomal protein S6 kinase (EC 2.7.-.-) II beta chain -
            African clawed frog>gb:XELS6KIIB_2582224 X.laevis
            ribosomal protein S6 kinase II beta (S6KII) mRNA,
            complete cds.
          Length = 629

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 67/244 (27%), Positives = 104/244 (42%), Gaps = 1/244 (0%)
 Frame = +1

Query: 268  FAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSL 447
            F  VY V+E +      G     K   H   N  YA+K  +I  S++     EEI +   
Sbjct: 412  FTDVYTVRETIG----VGSYSVCKRCVHKGTNMEYAVK--VIDKSKRDP--SEEIEILRR 463

Query: 448  FS-HPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSD 624
            +  HPN++ L D               +  YL+  +   G LLD     K     FS  +
Sbjct: 464  YGQHPNIITLKDVYEEC----------NSIYLVTELMRGGELLDRILRQKF----FSERE 509

Query: 625  VLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIR 804
               +   +C  ++++H+      H D+KP N+L     G P    + DFG +    KQ+R
Sbjct: 510  ACSVLFTVCKTVEYLHS--QGVVHRDLKPSNILYVDESGDPESIRICDFGFS----KQLR 563

Query: 805  SRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA 984
            + +  L    +     +A F APE+     +   DE  DIWSLG  LY ++ G +PF   
Sbjct: 564  AENGLLMTPCY-----TANFVAPEVLKRQGY---DEGCDIWSLGILLYTMLAGYTPFANG 615

Query: 985  LGES 996
             G++
Sbjct: 616  PGDT 619



 Score = 49.7 bits (117), Expect = 2e-04
 Identities = 65/283 (22%), Positives = 112/283 (39%), Gaps = 4/283 (1%)
 Frame = +1

Query: 223  NDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNS 402
            + + F +++ LG+G F  V+LV++I    A                N  YAMK +     
Sbjct: 58   DQSHFVLLKVLGQGSFGKVFLVRKITPPDA----------------NQLYAMKVLKKATL 101

Query: 403  EQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNA 582
            +  D V+ ++    L           H    V+       + + YL+      G L    
Sbjct: 102  KVRDRVRTKMERDILAD--------VHHPFVVRLHYAFQTEGKLYLILDFLRGGDLFTRL 153

Query: 583  TAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLT---HRKGQPPL 753
                +K+  F+  DV     +L  GL H+H+      + D+KP N+LL    H K     
Sbjct: 154  ----SKEVMFTEEDVKFYLAELALGLDHLHSL--GIIYRDLKPENILLDEEGHIK----- 202

Query: 754  AILMDFGSARPARKQIRSRSEALQLQEWASEHV-SAPFRAPELWDCPSHADIDERTDIWS 930
              L DFG ++          EA+  ++ A     +  + APE+ +   H+      D WS
Sbjct: 203  --LTDFGLSK----------EAIDHEKKAYSFCGTVEYMAPEVVNRQGHS---HGADWWS 247

Query: 931  LGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSD 1059
             G  ++ ++ G  PF+   G+        I+ A++  P  LS+
Sbjct: 248  YGVLMFEMLTGSLPFQ---GKDRKETMTLILKAKLGMPQFLSN 287



>sp|Q8IBS5|CDP4_PLAF7 Calcium-dependent protein kinase 4 (EC
           2.7.1.37).
          Length = 527

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 63/250 (25%), Positives = 109/250 (43%)
 Frame = +1

Query: 226 DNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSE 405
           + +++ ++ LG+G F  V L ++              K   H      YA+K +  ++  
Sbjct: 66  NEQYKGIKILGKGSFGEVILSRD--------------KHTGHE-----YAIKVISKKH-- 104

Query: 406 QLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNAT 585
               VK +    SL     LL +LDH  I +K  E     +  YL+  V+  G L D   
Sbjct: 105 ----VKRKTDKESLLREVELLKMLDHINI-MKLYEFFEDNNYYYLVSDVYTGGELFDEII 159

Query: 586 AMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILM 765
           + K     F   D  +I +Q+ +G+ +MH  + +  H D+KP N+LL  +  +  +  ++
Sbjct: 160 SRKR----FYEIDAARIIKQILSGITYMH--KNNVVHRDLKPENILLETKNKEDMIIKII 213

Query: 766 DFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTL 945
           DFG +       + + +            +A + AP++     H   DE+ DIWS G  L
Sbjct: 214 DFGLSTHFEYSKKMKDKI----------GTAYYIAPDVL----HGTYDEKCDIWSCGVIL 259

Query: 946 YAIMYGVSPF 975
           Y ++ G  PF
Sbjct: 260 YILLSGCPPF 269



>gb:AB016838_1193639 Caenorhabditis elegans mRNA for
            Ca2+/calmodulin-dependent protein kinase kinase, complete
            cds.>gb:U11029_1401732 Caenorhabditis elegans cosmid
            C05H8, complete sequence.
          Length = 432

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 82/325 (25%), Positives = 136/325 (41%), Gaps = 13/325 (4%)
 Frame = +1

Query: 217  WINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQ 396
            +I  N++R++ ++G+G +    +VK    +  K   + K  D      N     +    +
Sbjct: 15   YIQLNQYRLMEEIGQGSYG---IVKLAYNEEDKNLYALKVLDKMKLLKNFACFRQPPPRR 71

Query: 397  NSEQ---------LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFP 549
            N E          L LV++EI +    SHPN++ L++     V      ++    Y++F 
Sbjct: 72   NKENAAPSVLRNPLQLVQKEIAILKKLSHPNVVKLVE-----VLDDPNDNY---LYMVFE 123

Query: 550  VHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLT 729
                G++L+  T     +++         FR    GL+++H       H D+KP N+LL+
Sbjct: 124  FVEKGSILEIPTDKPLDEDT-----AWSYFRDTLCGLEYLHY--QKIVHRDIKPSNLLLS 176

Query: 730  HRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAP-FRAPE-LWDCPSHAD 903
               GQ  +A   DFG +           E   +  + S     P F APE L +  +H  
Sbjct: 177  DI-GQVKIA---DFGVS----------CEFEGIDAFLSGTAGTPAFMAPEALTEGANHFY 222

Query: 904  IDERTDIWSLGCTLYAIMYGVSPF--EYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEA 1077
                 DIWSLG TLYA + G  PF   Y +     +L   I N  + +P     P   EA
Sbjct: 223  SGRAQDIWSLGITLYAFVIGTVPFVDNYII-----ALHKKIKNDPIVFPEA---PILSEA 274

Query: 1078 LHQFVTWMLQPQATVRPHIDDIVIH 1152
            L   +  ML+     R  + ++ +H
Sbjct: 275  LQDIILGMLKKDPGHRLMLHEVKVH 299



>gb:AP006618_558822 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 529

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 67/248 (27%), Positives = 100/248 (40%), Gaps = 1/248 (0%)
 Frame = +1

Query: 235 FRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLD 414
           +RIVR+LG GG   VYL +     P +  V  K  DP   +D G  A             
Sbjct: 13  YRIVRRLGAGGMGTVYLAEHPRL-PRRDAV--KVLDPELGADPGYRAR------------ 57

Query: 415 LVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQS-WKHEAYLLFPVHMDGTLLDNATAM 591
             + E  +++   HPN++ + D      +  EG+  W    Y+      DG  +D    +
Sbjct: 58  -FEREAELAARLEHPNVVAVYD------RGREGEFLWIAMRYV------DG--VDAGELV 102

Query: 592 KAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDF 771
            A+         + I      GL   H       H DVKP N+L++       +  L DF
Sbjct: 103 AAEPAGLPAERAVGIVAAAARGLDAAHR--RGLLHRDVKPANILVSTDDDGADVVRLTDF 160

Query: 772 GSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYA 951
           G AR       +    L          S  + APE +   +   +D RTD+++LGCTLY 
Sbjct: 161 GIARSLDAAATTSGSVL---------ASFAYAAPETF---AGGPLDARTDVYALGCTLYE 208

Query: 952 IMYGVSPF 975
           ++ G  PF
Sbjct: 209 MLTGAVPF 216



>pir|T37317|T37317 probable Ca2+/calmodulin-dependent protein kinase
            kinase (EC 2.7.1.-) - Caenorhabditis elegans
          Length = 357

 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 82/325 (25%), Positives = 136/325 (41%), Gaps = 13/325 (4%)
 Frame = +1

Query: 217  WINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQ 396
            +I  N++R++ ++G+G +    +VK    +  K   + K  D      N     +    +
Sbjct: 15   YIQLNQYRLMEEIGQGSYG---IVKLAYNEEDKNLYALKVLDKMKLLKNFACFRQPPPRR 71

Query: 397  NSEQ---------LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFP 549
            N E          L LV++EI +    SHPN++ L++     V      ++    Y++F 
Sbjct: 72   NKENAAPSVLRNPLQLVQKEIAILKKLSHPNVVKLVE-----VLDDPNDNY---LYMVFE 123

Query: 550  VHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLT 729
                G++L+  T     +++         FR    GL+++H       H D+KP N+LL+
Sbjct: 124  FVEKGSILEIPTDKPLDEDT-----AWSYFRDTLCGLEYLHY--QKIVHRDIKPSNLLLS 176

Query: 730  HRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAP-FRAPE-LWDCPSHAD 903
               GQ  +A   DFG +           E   +  + S     P F APE L +  +H  
Sbjct: 177  DI-GQVKIA---DFGVS----------CEFEGIDAFLSGTAGTPAFMAPEALTEGANHFY 222

Query: 904  IDERTDIWSLGCTLYAIMYGVSPF--EYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEA 1077
                 DIWSLG TLYA + G  PF   Y +     +L   I N  + +P     P   EA
Sbjct: 223  SGRAQDIWSLGITLYAFVIGTVPFVDNYII-----ALHKKIKNDPIVFPEA---PILSEA 274

Query: 1078 LHQFVTWMLQPQATVRPHIDDIVIH 1152
            L   +  ML+     R  + ++ +H
Sbjct: 275  LQDIILGMLKKDPGHRLMLHEVKVH 299



>gb:BC088802_2565895 Xenopus laevis hypothetical LOC496293, mRNA
           (cDNA clone MGC:98827 IMAGE:3401390), complete cds.
          Length = 360

 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 51/189 (26%), Positives = 85/189 (44%)
 Frame = +1

Query: 412 DLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAM 591
           D ++ E+ +     HPN++ L  H V A KA        E  L+  +   G L D     
Sbjct: 59  DQIEREVFILQQLEHPNIMRL--HDVFASKA--------EMVLILELIRGGELFD----F 104

Query: 592 KAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDF 771
            A+KE+ S  D ++   Q+  G+ +MH    + AH D+KP N++L  +    P   ++DF
Sbjct: 105 IAEKEALSEEDAIEFLEQILKGVTYMHTC--NIAHLDLKPENIMLQEKDVPHPKIKIIDF 162

Query: 772 GSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYA 951
           G A+        +S     Q  A E ++             +  +   TD+WS+G   Y 
Sbjct: 163 GLAQKIEDGAVFKSLCGTPQYIAPEVIN-------------YEPLGPPTDMWSIGVITYI 209

Query: 952 IMYGVSPFE 978
           ++ G+SPF+
Sbjct: 210 LLSGLSPFQ 218



>gb:AE016818_1747944 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome V, complete
            sequence.>gb:AF286114_1783194 Eremothecium gossypii Trf5
            (TRF5), PAK-like protein kinase (CLA4), and Ynl297c
            (YNL297c) genes, complete cds.
          Length = 793

 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 80/337 (23%), Positives = 136/337 (40%), Gaps = 9/337 (2%)
 Frame = +1

Query: 235  FRIVRQLGEGGFAYVYLVKEILADP--AKPGVSKKFKDPSHASDN--GTYAMKKVLIQNS 402
            F+++ + G+G    VYL + +   P     GVS+        +DN     A+K++++   
Sbjct: 498  FQMIEKAGQGASGSVYLAQRLKIPPYDENSGVSQH-----ELNDNIGDKVAIKQMILSKQ 552

Query: 403  EQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNA 582
             + +L+  EI V     H N++  L+    A   +E   W    Y+      D  +++N+
Sbjct: 553  PRKELIVNEILVMKDSQHKNIVNFLE----AYLKTEDDLWVVMEYMEGGSLTD--VIENS 606

Query: 583  TAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLL-THRKGQPPLAI 759
                A +   +   +  I R+ C GLK +H  +    H D+K  NVLL TH + +     
Sbjct: 607  IGSDASESPMTEPQIAYIVRETCQGLKFLH--DKHIIHRDIKSDNVLLDTHGRVK----- 659

Query: 760  LMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGC 939
            + DFG       +   R+  +    W          APE+       + DE+ D+WSLG 
Sbjct: 660  ITDFGFCAKLTDKRSKRATMVGTPYWM---------APEV---VKQREYDEKVDVWSLGI 707

Query: 940  TLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEAL----HQFVTWMLQ 1107
                ++ G  P  Y   E   +L L   N       G    K+PE L     +F++  L 
Sbjct: 708  MTIEMLEGEPP--YLNEEPLKALYLIATN-------GTPKLKHPELLSLEIKRFLSVCLC 758

Query: 1108 PQATVRPHIDDIVIHVDKLISKFSH*EVRCRPKRHAH 1218
                 R   ++++ H        S  E  C P+  A+
Sbjct: 759  VDVRYRASTEELLHH--------SFFETSCEPEELAN 787



>gb:CEC54G4_1361613 Caenorhabditis elegans cosmid C54G4, complete
            sequence.
          Length = 772

 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 66/269 (24%), Positives = 116/269 (43%), Gaps = 3/269 (1%)
 Frame = +1

Query: 358  DNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAVIAVKASEGQSWKHEA 534
            D   +A+K V  + + Q    + E R+  +   HPN++ L D            S     
Sbjct: 404  DGAQFAVKIVSQKFASQ---AQREARILEMVQGHPNIVQLHDV----------HSDPLHF 450

Query: 535  YLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPG 714
            YL+  +     LL+       K E F+ S+   I RQL + +K++H  +    H D+KP 
Sbjct: 451  YLVMEILTGNELLERIR----KLERFTESEAADIMRQLVSAVKYLH--DKRIVHRDLKPE 504

Query: 715  NVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDC-P 891
            N+L         L  L+DFG AR     +  + +++Q+    +   +  + APE+ D   
Sbjct: 505  NILFESIDSSARLR-LVDFGFARLLPNSMEQQLKSVQVLRKMTPCFTLQYAAPEVLDVGD 563

Query: 892  SHADIDERTDIWSLGCTLYAIMYGVSPFE-YALGESGGSLQLAIVNAQVKWPTGLSDPKY 1068
            S  + +E+ D+WSLG  L+ ++ G  PF   +  ES   +   I  A+  + TG +    
Sbjct: 564  SQPEYNEQCDLWSLGVVLFTMLSGQVPFHARSRQESATEIMQRICRAEFSF-TGDAWTNV 622

Query: 1069 PEALHQFVTWMLQPQATVRPHIDDIVIHV 1155
                   +T +L      R  + ++  H+
Sbjct: 623  SADAKNLITGLLTVDPKKRLSMQELTAHM 651



>gb:AL670399_2072641 Mouse DNA sequence from clone RP23-263M10 on
            chromosome 11 Contains the 3' end of the Atp2a3 gene for
            ubiquitous Ca++ transporting ATPase, the P2rx1 and P2rx5
            genes for purinergic receptor P2X ligand-gated ion
            channel 1 and 5, 111 novel genes, the Camkk1 gene for
            calcium/calmodulin-dependent protein kinase kinase 1
            alpha, the Itgae gene for epithelial-associated integrin
            alpha E, the Gsg2 gene for germ cell-specific gene 2
            protein, the gene for a novel protein similar to human
            tax interacting protein 1, the Ctns gene for nephropathic
            cystinosis protein and five CpG islands, complete
            sequence.
          Length = 342

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 76/326 (23%), Positives = 130/326 (39%), Gaps = 9/326 (2%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADP-------AKPGVSKKFKDPSHASDNGTYAMKKV 387
            N++++  ++G+G +  V L      D        +K  + K++  P      G+ A +  
Sbjct: 6    NQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQATQGG 65

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
              +    L+ V +EI +     H N++ L++  V+   A +        YL+F +   G 
Sbjct: 66   PAKQLLPLERVYQEIAILKKLDHVNVVKLIE--VLDDPAEDN------LYLVFDLLRKGP 117

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            +++         + F         R +  GL+++H       H D+KP N+LL    G  
Sbjct: 118  VMEVPC-----DKPFPEEQARLYLRDIILGLEYLHC--QKIVHRDIKPSNLLL----GDD 166

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
                + DFG +       +      QL   A    +  F APE       +   +  D+W
Sbjct: 167  GHVKIADFGVSN------QFEGNDAQLSSTAG---TPAFMAPEAISDSGQSFSGKALDVW 217

Query: 928  SLGCTLYAIMYGVSPF--EYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWM 1101
            + G TLY  +YG  PF  +Y L     +L   I N  V +P    +P+  E L   +  M
Sbjct: 218  ATGVTLYCFVYGKCPFIDDYIL-----TLHRKIKNEAVVFP---EEPEVSEDLKDLILRM 269

Query: 1102 LQPQATVRPHIDDIVIHVDKLISKFS 1179
            L      R  + DI I V  ++ K S
Sbjct: 270  LDKNPETRIGVSDIKILVKSMLRKRS 295



>gb:AB023658_2044286 Rattus norvegicus mRNA for
            Ca/calmodulin-dependent protein kinase kinase alpha,
            CaM-kinase kinase alpha, complete cds.>gb:S83194_2139812
            Ca2+/calmodulin-dependent protein kinase IV kinase
            isoform [rats, brain, mRNA, 3429 nt].
          Length = 505

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 74/317 (23%), Positives = 126/317 (39%), Gaps = 9/317 (2%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADP-------AKPGVSKKFKDPSHASDNGTYAMKKV 387
            N++++  ++G+G +  V L      D        +K  + K++  P      G+ A +  
Sbjct: 126  NQYKLQSEIGKGAYGVVRLAYNEREDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQAPQGG 185

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
              +    L+ V +EI +     H N++ L++  V+   A +        YL+F +   G 
Sbjct: 186  PAKQLLPLERVYQEIAILKKLDHVNVVKLIE--VLDDPAEDN------LYLVFDLLRKGP 237

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            +++         + F         R +  GL+++H       H D+KP N+LL    G  
Sbjct: 238  VMEVPC-----DKPFPEEQARLYLRDIILGLEYLHC--QKIVHRDIKPSNLLL----GDD 286

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
                + DFG +       +      QL   A    +  F APE       +   +  D+W
Sbjct: 287  GHVKIADFGVSN------QFEGNDAQLSSTAG---TPAFMAPEAISDTGQSFSGKALDVW 337

Query: 928  SLGCTLYAIMYGVSPF--EYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWM 1101
            + G TLY  +YG  PF  EY L     +L   I N  V +P    +P+  E L   +  M
Sbjct: 338  ATGVTLYCFVYGKCPFIDEYIL-----ALHRKIKNEAVVFP---EEPEVSEELKDLILKM 389

Query: 1102 LQPQATVRPHIDDIVIH 1152
            L      R  + DI +H
Sbjct: 390  LDKNPETRIGVSDIKLH 406



>gb:AL139082_1920216 Human DNA sequence from clone RP11-248G5 on
            chromosome 13q14.3-21.1 Contains the 5' end of the ATP7B
            gene for ATPase, Cu++ transporting, beta polypeptide
            (Wilson disease), four novel genes, the NEK3 gene for
            NIMA (never in mitosis gene a)-related kinase 3, the 3'
            end of a novel gene and five CpG islands, complete
            sequence.>gb:BC063885_1986416 Homo sapiens similar to
            Serine/threonine-protein kinase Nek1 (NimA-related
            protein kinase 1), mRNA (cDNA clone MGC:75495
            IMAGE:30383658), complete cds.
          Length = 708

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 81/328 (24%), Positives = 133/328 (40%), Gaps = 7/328 (2%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
            +++ +++ +G+G F   YL K      +K  V K+               +K+ IQ  E 
Sbjct: 2    DKYDVIKAIGQGAFGKAYLAKG--KSDSKHCVIKEIN------------FEKMPIQEKEA 47

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
                K+E+ +     HPN++   +            S++    L   +       D    
Sbjct: 48   S---KKEVILLEKMKHPNIVAFFN------------SFQENGRLFIVMEY----CDGGDL 88

Query: 589  MKAKKES----FSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLA 756
            MK         FS   +L  F Q+  GLKH+H  +    H D+K  N+ L+ + G   +A
Sbjct: 89   MKRINRQRGVLFSEDQILGWFVQISLGLKHIH--DRKILHRDIKAQNIFLS-KNGM--VA 143

Query: 757  ILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR-APELWDCPSHADIDERTDIWSL 933
             L DFG AR     +          E A   +  P+  +PE+     +   + +TDIWSL
Sbjct: 144  KLGDFGIARVLNNSM----------ELARTCIGTPYYLSPEICQ---NKPYNNKTDIWSL 190

Query: 934  GCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQ 1113
            GC LY +     PFE      G +LQ  ++         +S P +   LH  ++ + Q  
Sbjct: 191  GCVLYELCTLKHPFE------GNNLQQLVLKICQAHFAPIS-PGFSRELHSLISQLFQVS 243

Query: 1114 ATVRPHIDDIVIH--VDKLISKFSH*EV 1191
               RP I+ I+    ++ LI K+   EV
Sbjct: 244  PRDRPSINSILKRPFLENLIPKYLTPEV 271



>gb:LES297917_1684550 Lycopersicon esculentum mRNA for B2-type cyclin
            dependent kinase (cdkB2 gene).
          Length = 315

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 76/293 (25%), Positives = 126/293 (43%), Gaps = 8/293 (2%)
 Frame = +1

Query: 373  AMKKVLIQNSEQ---LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLL 543
            A+KK  +   E+      ++E   +  L   P+++ L+D     VK  + +  K   YL+
Sbjct: 44   ALKKTRLHEDEEGVPPTTLREISLLRMLSRDPHIVRLMD-----VKQGQNKEGKTVLYLV 98

Query: 544  FPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVL 723
            F  +MD  +       +AK E+     V  +  QLC G+   H       H D+KP N+L
Sbjct: 99   FE-YMDTDVKKFIRTFRAKGETMPLKIVKSLMYQLCKGVAFCHGH--GVLHRDLKPHNLL 155

Query: 724  LTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHAD 903
            +  +     LA   DFG  R         +  L ++++  E ++  +RAPE+    +H  
Sbjct: 156  MDRKTNVLKLA---DFGLGR---------AYTLPIKKYTHEILTLWYRAPEVLLGATH-- 201

Query: 904  IDERTDIWSLGCTLYAIM--YGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEA 1077
                 D+WS+GC    ++    + P +  L +     +L     +  WP G+S       
Sbjct: 202  YSTAVDMWSVGCIFAELVTNQALFPGDSELQQLLHIFRLLGTPNEELWP-GVSKLVN--- 257

Query: 1078 LHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFSH*EVRCR---PKRHAHNYF 1227
             H++  W  QP +TV P +D+  IH   L+S+  H E   R    K   H YF
Sbjct: 258  WHEYPQWKPQPLSTVVPGLDEDGIH---LLSEMLHYEPSRRISAKKAMEHPYF 307



>gb:CR382139_1672622 Debaryomyces hansenii chromosome G of strain
            CBS767 of Debaryomyces hansenii.
          Length = 1531

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 84/327 (25%), Positives = 134/327 (40%), Gaps = 7/327 (2%)
 Frame = +1

Query: 235  FRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLD 414
            +++ R LG G    V L K + +      V    K      +N  Y    V    S +  
Sbjct: 90   WKLGRTLGRGSTGRVRLAKNVNSGKLA-AVKIVPKSNFKKLENPKYKRNSVDSSGSVKDR 148

Query: 415  L---VKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSW--KHEAYLLFPVHMDGTLLDN 579
            L   ++ EI +  L SHPN++ L D             W  K++ YL+      G L D 
Sbjct: 149  LPYGIEREIIIMKLISHPNIMGLYD------------VWENKNDLYLILEYIEGGELFDY 196

Query: 580  ATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAI 759
                  KK      + +  F+Q+  G+ ++H F  +  H D+KP N+LL   K       
Sbjct: 197  LI----KKGKLQEFEAISYFKQIINGIHYLHQF--NICHRDLKPENLLLDFNKNIK---- 246

Query: 760  LMDFGSARPARKQIRSRSEALQLQEWASEHV--SAPFRAPELWDCPSHADIDERTDIWSL 933
            + DFG A            AL+++E   E    S  + +PE+    ++      +DIWS 
Sbjct: 247  IADFGMA------------ALEVREKLLETSCGSPHYASPEIVAGKNYHGAP--SDIWSC 292

Query: 934  GCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQ 1113
            G  L+A++ G  PF+    E+   L L + N +   P  LS           ++ ML+  
Sbjct: 293  GIILFALLTGHLPFD---DENIRKLLLKVQNGKFLMPNNLSSES-----KDLISKMLKVN 344

Query: 1114 ATVRPHIDDIVIHVDKLISKFSH*EVR 1194
             + R  ID I+ H   L++K+    VR
Sbjct: 345  PSERITIDAILQH--PLLTKYPEPSVR 369



>gb:AX455761_1468851 Sequence 7 from Patent WO0220800.
          Length = 561

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 73/315 (23%), Positives = 126/315 (40%), Gaps = 7/315 (2%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADP-------AKPGVSKKFKDPSHASDNGTYAMKKV 387
            N++++  ++G+G +  V L      D        +K  + K++  P      G+ A +  
Sbjct: 126  NQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQAAQGG 185

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
              +    L+ V +EI +     H N++ L++  V+   A +        YL+F +   G 
Sbjct: 186  PAKQLLPLERVYQEIAILKKLDHVNVVKLIE--VLDDPAEDN------LYLVFDLLRKGP 237

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            +++         + FS        R +  GL+++H       H D+KP N+LL    G  
Sbjct: 238  VMEVPC-----DKPFSEEQARLYLRDVILGLEYLHC--QKIVHRDIKPSNLLL----GDD 286

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
                + DFG +       +      QL   A    +  F APE       +   +  D+W
Sbjct: 287  GHVKIADFGVSN------QFEGNDAQLSSTAG---TPAFMAPEAISDSGQSFSGKALDVW 337

Query: 928  SLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQ 1107
            + G TLY  +YG  PF   + +   +L   I N  V +P G   P+  E L   +  ML 
Sbjct: 338  ATGVTLYCFVYGKCPF---IDDFILALHRKIKNEPVVFPEG---PEISEELKDLILKMLD 391

Query: 1108 PQATVRPHIDDIVIH 1152
                 R  + DI +H
Sbjct: 392  KNPETRIGVPDIKLH 406



>gb:MYCRRN1_152132 Mycoplasma gallisepticum strain A5969 genomic large
            direct repeat and flanking sequences.>gb:MYCRRN1_152146
            Mycoplasma gallisepticum strain A5969 genomic large
            direct repeat and flanking sequences.
          Length = 420

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 75/313 (23%), Positives = 133/313 (42%), Gaps = 28/313 (8%)
 Frame = +1

Query: 199  NGGGDVWIND---NRFRIVRQLGEGGF-AYVYLVKEILADPAKPGVSKKFKDPSHASDNG 366
            N  G + +ND   NR+ I+ +L  GG  + +Y  K I+AD  K   SKK       S   
Sbjct: 16   NSEGYLMVNDKLFNRYVILNKLTTGGMNSVIYTAKNIMADSTKLNDSKK-------STVV 68

Query: 367  TYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLL--DHAVIAVKASEGQSWKHEAYL 540
               +K+     +++   +++E+  SS  SHPNL+     D   I ++ +      ++  +
Sbjct: 69   IKLVKRSPEDTNDKWAKLQQELITSSRISHPNLIATYETDDKGILIERNNRMIRINDVLV 128

Query: 541  LFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNV 720
            +   ++ GT L N    K    + S  + L  FR++  G++ +HN+     H D+KP N+
Sbjct: 129  IVMEYVQGTTLRNYIISKG---NLSVKEALYYFRRMVEGIQKLHNYSHQIIHRDLKPENL 185

Query: 721  LLTHRKGQPPLAILMDFG-----SARPARKQIRSRS-----------EALQLQEWASEHV 852
            +L+  K    L I+ DFG     S     K + +             +ALQ +    E+ 
Sbjct: 186  MLS--KDYRELKII-DFGISTSISTESVLKVLTNEKALYGTHEYMCPDALQKEPVLDEN- 241

Query: 853  SAPFRAPEL------WDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQL 1014
            + P   P+       W  P+      + D ++ G  L+ ++ G  PF   + +       
Sbjct: 242  NKPVINPKTNTPLMRWKAPT-----VQYDFYAFGVILFEMLTGQKPFNKKIDDKKLERPQ 296

Query: 1015 AIVNAQVKWPTGL 1053
             I+N   K+   L
Sbjct: 297  DIINLPNKFDVPL 309



>pir|A57156|A57156 Ca2+/calmodulin-dependent protein kinase (EC
            2.7.1.123) IV - rat>gb:RATCCDP_2131739 Rattus norvegicus
            Ca2+/calmodulin-dependent protein kinase kinase mRNA,
            complete cds.
          Length = 505

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 74/317 (23%), Positives = 126/317 (39%), Gaps = 9/317 (2%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADP-------AKPGVSKKFKDPSHASDNGTYAMKKV 387
            N++++  ++G+G +  V L      D        +K  + K++  P      G+ A +  
Sbjct: 126  NQYKLQSEIGKGAYGVVRLAYNEREDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQAPQGG 185

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
              +    L+ V +EI +     H N++ L++  V+   A +        YL+F +   G 
Sbjct: 186  PAKQLLPLERVYQEIAILKKLDHVNVVKLIE--VLDDPAEDN------LYLVFDLLRKGP 237

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            +++         + F         R +  GL+++H       H D+KP N+LL    G  
Sbjct: 238  VMEVPC-----DKPFPEEQARLYLRDIILGLEYLHC--QKIVHRDIKPSNLLL----GDD 286

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
                + DFG +       +      QL   A    +  F APE       +   +  D+W
Sbjct: 287  GHVKIADFGVSN------QFEGNDAQLSSTAG---TPAFMAPEAISDTGQSFSGKALDVW 337

Query: 928  SLGCTLYAIMYGVSPF--EYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWM 1101
            + G TLY  +YG  PF  EY L     +L   I N  V +P    +P+  E L   +  M
Sbjct: 338  ATGVTLYCFVYGKCPFIDEYIL-----ALHRKIKNEAVVFP---EEPEVSEELKDLILKM 389

Query: 1102 LQPQATVRPHIDDIVIH 1152
            L      R  + DI +H
Sbjct: 390  LDKNPETRIGVSDIKLH 406



>gb:AL627313_1931080 Human DNA sequence from clone RP11-492M19 on
           chromosome 1 Contains a novel pseudogene (LOC151871), a
           novel gene similar to ribosomal protein S6 kinase,
           90kDa, polypeptide 1 (RPS6KA1), a chromosome 20 open
           reading frame 52 (C20orf52) pseudogene and two CpG
           islands, complete sequence.
          Length = 578

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 68/237 (28%), Positives = 104/237 (43%), Gaps = 1/237 (0%)
 Frame = +1

Query: 268 FAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSL 447
           F+  Y+VKE +      G   + K   H + N  YA+K  +I  S++     EEI +   
Sbjct: 257 FSDGYVVKETIG----VGSYSECKRCVHKATNMEYAVK--VIDKSKRDP--SEEIEILLR 308

Query: 448 FS-HPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSD 624
           +  HPN++ L D              KH  YL+  +   G LLD     K     FS  +
Sbjct: 309 YGQHPNIITLKDVY---------DDGKH-VYLVTELMRGGELLDKILRQKF----FSERE 354

Query: 625 VLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIR 804
              +   +   ++++H+      H D+KP N+L     G P    + DFG A    KQ+R
Sbjct: 355 ASFVLHTIGKTVEYLHS--QGVVHRDLKPSNILYVDESGNPECLRICDFGFA----KQLR 408

Query: 805 SRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPF 975
           + +  L    +     +A F APE+     +   DE  DIWSLG  LY ++ G +PF
Sbjct: 409 AENGLLMTPCY-----TANFVAPEVLKRQGY---DEGCDIWSLGILLYTMLAGYTPF 457



 Score = 40.0 bits (92), Expect = 0.12
 Identities = 40/150 (26%), Positives = 66/150 (44%), Gaps = 1/150 (0%)
 Frame = +1

Query: 610  FSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPA 789
            F+  DV     +L  GL H+H+    Y   D+KP N+LL   +G   L    DFG ++  
Sbjct: 2    FTEEDVKFYLAELALGLDHLHSLGIIY--RDLKPENILLDE-EGHIKLT---DFGLSK-- 53

Query: 790  RKQIRSRSEALQLQEWASEHV-SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGV 966
                    EA+  ++ A     +  + APE+ +   H+      D WS G  ++ ++ G 
Sbjct: 54   --------EAIDHEKKAYSFCGTVEYMAPEVVNRQGHS---HSADWWSYGVLMFEMLTGS 102

Query: 967  SPFEYALGESGGSLQLAIVNAQVKWPTGLS 1056
             PF+   G+        I+ A++  P  LS
Sbjct: 103  LPFQ---GKDRKETMTLILKAKLGMPQFLS 129



>gb:AF009561_1231593 Paramecium tetraurelia calcium-dependent
           protein kinase-b (PCaPK-b) gene, complete cds.
          Length = 493

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 61/210 (29%), Positives = 94/210 (44%), Gaps = 1/210 (0%)
 Frame = +1

Query: 349 HASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKH 528
           H S     AMK++      +  ++KE+    ++FS  N L  LDH  I VK  E      
Sbjct: 75  HKSSGYKRAMKQI-----RKDKIIKED--EENMFSEVNTLKELDHPNI-VKLHELFQDAK 126

Query: 529 EAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVK 708
             YL+      G L    T MK     FS      I +Q+ AG+ H H  E    H D+K
Sbjct: 127 NYYLVTEYLEGGELFQKITDMK----HFSEKMAADIMKQILAGVVHCH--EKKVVHRDLK 180

Query: 709 PGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR-APELWD 885
           P N+L  ++K    L I+ DFG++R            ++  +  ++ +  P+  APE+  
Sbjct: 181 PENILFENKKPNSNLKII-DFGTSRK-----------METNQNLTKRLGTPYYIAPEVLK 228

Query: 886 CPSHADIDERTDIWSLGCTLYAIMYGVSPF 975
                + +E+ D+WS G  LY ++ G  PF
Sbjct: 229 ----RNYNEKCDVWSCGVILYIMLCGYPPF 254



>pir|I51901|I51901 ribosomal protein S6 kinase 2 (EC 2.7.1.-) 1 -
            human>gb:HUMS6KINA_2036468 Homo sapiens ribosomal protein
            S6 kinase 1 (RPS6KA1) mRNA, complete cds.
          Length = 735

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 68/237 (28%), Positives = 104/237 (43%), Gaps = 1/237 (0%)
 Frame = +1

Query: 268  FAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSL 447
            F+  Y+VKE +      G   + K   H + N  YA+K  +I  S++     EEI +   
Sbjct: 414  FSDGYVVKETIG----VGSYSECKRCVHKATNMEYAVK--VIDKSKRDP--SEEIEILLR 465

Query: 448  FS-HPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSD 624
            +  HPN++ L D              KH  YL+  +   G LLD     K     FS  +
Sbjct: 466  YGQHPNIITLKDVY---------DDGKH-VYLVTELMRGGELLDKILRQKF----FSERE 511

Query: 625  VLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIR 804
               +   +   ++++H+      H D+KP N+L     G P    + DFG A    KQ+R
Sbjct: 512  ASFVLHTIGKTVEYLHS--QGVVHRDLKPSNILYVDESGNPECLRICDFGFA----KQLR 565

Query: 805  SRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPF 975
            + +  L    +     +A F APE+     +   DE  DIWSLG  LY ++ G +PF
Sbjct: 566  AENGLLMTPCY-----TANFVAPEVLKRQGY---DEGCDIWSLGILLYTMLAGYTPF 614



 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 66/280 (23%), Positives = 117/280 (41%), Gaps = 4/280 (1%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
            + F +++ LG+G F  V+LV+++     +P       D  H      YAMK +     + 
Sbjct: 60   SHFELLKVLGQGSFGKVFLVRKV----TRP-------DSGH-----LYAMKVLKKATLKV 103

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
             D V+ ++         ++L  ++H  + VK       + + YL+      G L      
Sbjct: 104  RDRVRTKM-------ERDILADVNHPFV-VKLHYAFQTEGKLYLILDFLRGGDLFTRL-- 153

Query: 589  MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLT---HRKGQPPLAI 759
              +K+  F+  DV     +L  GL H+H+      + D+KP N+LL    H K       
Sbjct: 154  --SKEVMFTEEDVKFYLAELALGLDHLHSL--GIIYRDLKPENILLDEEGHIK------- 202

Query: 760  LMDFGSARPARKQIRSRSEALQLQEWASEHV-SAPFRAPELWDCPSHADIDERTDIWSLG 936
            L DFG ++          EA+  ++ A     +  + APE+ +   H+      D WS G
Sbjct: 203  LTDFGLSK----------EAIDHEKKAYSFCGTVEYMAPEVVNRQGHS---HSADWWSYG 249

Query: 937  CTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLS 1056
              ++ ++ G  PF+   G+        I+ A++  P  LS
Sbjct: 250  VLMFEMLTGSLPFQ---GKDRKETMTLILKAKLGMPQFLS 286



>sp|Q15418|K6A1_HUMAN Ribosomal protein S6 kinase alpha 1 (EC
            2.7.1.37) (S6K-alpha 1) (90 kDa ribosomal protein S6
            kinase 1) (p90-RSK 1) (Ribosomal S6 kinase 1) (RSK-1)
            (pp90RSK1).>gb:AL627313_1931079 Human DNA sequence from
            clone RP11-492M19 on chromosome 1 Contains a novel
            pseudogene (LOC151871), a novel gene similar to ribosomal
            protein S6 kinase, 90kDa, polypeptide 1 (RPS6KA1), a
            chromosome 20 open reading frame 52 (C20orf52) pseudogene
            and two CpG islands, complete
            sequence.>gb:BC014966_1974862 Homo sapiens ribosomal
            protein S6 kinase, 90kDa, polypeptide 1, mRNA (cDNA clone
            MGC:23062 IMAGE:4867373), complete cds.
          Length = 735

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 68/237 (28%), Positives = 104/237 (43%), Gaps = 1/237 (0%)
 Frame = +1

Query: 268  FAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSL 447
            F+  Y+VKE +      G   + K   H + N  YA+K  +I  S++     EEI +   
Sbjct: 414  FSDGYVVKETIG----VGSYSECKRCVHKATNMEYAVK--VIDKSKRDP--SEEIEILLR 465

Query: 448  FS-HPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSD 624
            +  HPN++ L D              KH  YL+  +   G LLD     K     FS  +
Sbjct: 466  YGQHPNIITLKDVY---------DDGKH-VYLVTELMRGGELLDKILRQKF----FSERE 511

Query: 625  VLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIR 804
               +   +   ++++H+      H D+KP N+L     G P    + DFG A    KQ+R
Sbjct: 512  ASFVLHTIGKTVEYLHS--QGVVHRDLKPSNILYVDESGNPECLRICDFGFA----KQLR 565

Query: 805  SRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPF 975
            + +  L    +     +A F APE+     +   DE  DIWSLG  LY ++ G +PF
Sbjct: 566  AENGLLMTPCY-----TANFVAPEVLKRQGY---DEGCDIWSLGILLYTMLAGYTPF 614



 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 66/280 (23%), Positives = 117/280 (41%), Gaps = 4/280 (1%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
            + F +++ LG+G F  V+LV+++     +P       D  H      YAMK +     + 
Sbjct: 60   SHFELLKVLGQGSFGKVFLVRKV----TRP-------DSGH-----LYAMKVLKKATLKV 103

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
             D V+ ++         ++L  ++H  + VK       + + YL+      G L      
Sbjct: 104  RDRVRTKM-------ERDILADVNHPFV-VKLHYAFQTEGKLYLILDFLRGGDLFTRL-- 153

Query: 589  MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLT---HRKGQPPLAI 759
              +K+  F+  DV     +L  GL H+H+      + D+KP N+LL    H K       
Sbjct: 154  --SKEVMFTEEDVKFYLAELALGLDHLHSL--GIIYRDLKPENILLDEEGHIK------- 202

Query: 760  LMDFGSARPARKQIRSRSEALQLQEWASEHV-SAPFRAPELWDCPSHADIDERTDIWSLG 936
            L DFG ++          EA+  ++ A     +  + APE+ +   H+      D WS G
Sbjct: 203  LTDFGLSK----------EAIDHEKKAYSFCGTVEYMAPEVVNRQGHS---HSADWWSYG 249

Query: 937  CTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLS 1056
              ++ ++ G  PF+   G+        I+ A++  P  LS
Sbjct: 250  VLMFEMLTGSLPFQ---GKDRKETMTLILKAKLGMPQFLS 286



>gb:BC086026_2564619 Xenopus laevis hypothetical LOC495572, mRNA (cDNA
            clone MGC:98113 IMAGE:7200295), complete cds.
          Length = 735

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 68/237 (28%), Positives = 103/237 (43%), Gaps = 1/237 (0%)
 Frame = +1

Query: 268  FAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSL 447
            F+  Y+VKE +      G     K   H + N  YA+K  +I  S++     EEI +   
Sbjct: 414  FSDGYVVKETIG----VGSYSVCKRCVHKATNMEYAVK--VIDKSKRDP--SEEIEILLR 465

Query: 448  FS-HPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSD 624
            +  HPN++ L D              KH  YL+  +   G LLD     K     FS  +
Sbjct: 466  YGQHPNIITLKDVY---------DDGKH-VYLVTELMRGGELLDKILRQKF----FSERE 511

Query: 625  VLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIR 804
               +   +   ++++H+      H D+KP N+L     G P    + DFG A    KQ+R
Sbjct: 512  ASFVLHTISKTVEYLHS--QGVVHRDLKPSNILYVDESGNPECLRICDFGFA----KQLR 565

Query: 805  SRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPF 975
            + +  L    +     +A F APE+     +   DE  DIWSLG  LY ++ G +PF
Sbjct: 566  AENGLLMTPCY-----TANFVAPEVLKRQGY---DEGCDIWSLGILLYTMLAGYTPF 614



 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 66/280 (23%), Positives = 117/280 (41%), Gaps = 4/280 (1%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
            ++F +++ LG+G F  V+LV+++     +P       D  H      YAMK +     + 
Sbjct: 60   SQFELLKVLGQGSFGKVFLVRKV----TRP-------DSGH-----LYAMKVLKKATLKV 103

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
             D V+ ++         ++L  ++H  + VK       + + YL+      G L      
Sbjct: 104  RDRVRTKM-------ERDILADVNHPFV-VKLHYAFQTEGKLYLILDFLRGGDLFTRL-- 153

Query: 589  MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLT---HRKGQPPLAI 759
              +K+  F+  DV     +L  GL H+H+      + D+KP N+LL    H K       
Sbjct: 154  --SKEVMFTEEDVKFYLAELALGLDHLHSL--GIIYRDLKPENILLDEEGHIK------- 202

Query: 760  LMDFGSARPARKQIRSRSEALQLQEWASEHV-SAPFRAPELWDCPSHADIDERTDIWSLG 936
            L DFG ++          EA+  ++ A     +  + APE+ +   H       D WS G
Sbjct: 203  LTDFGLSK----------EAIDHEKKAYSFCGTVEYMAPEVVNRQGHT---HSADWWSYG 249

Query: 937  CTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLS 1056
              ++ ++ G  PF+   G+        I+ A++  P  LS
Sbjct: 250  VLMFEMLTGSLPFQ---GKDRKETMTLILKAKLGMPQFLS 286



>gb:BC049076_2099898 Mus musculus ribosomal protein S6 kinase
            polypeptide 1, mRNA (cDNA clone IMAGE:5703939), partial
            cds.
          Length = 773

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 68/237 (28%), Positives = 103/237 (43%), Gaps = 1/237 (0%)
 Frame = +1

Query: 268  FAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSL 447
            F+  Y+VKE +      G     K   H + N  YA+K  +I  S++     EEI +   
Sbjct: 452  FSDGYVVKETIG----VGSYSVCKRCVHKATNMEYAVK--VIDKSKRDP--SEEIEILLR 503

Query: 448  FS-HPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSD 624
            +  HPN++ L D              KH  YL+  +   G LLD     K     FS  +
Sbjct: 504  YGQHPNIITLKDVY---------DDGKH-VYLVTELMRGGELLDKILRQKF----FSERE 549

Query: 625  VLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIR 804
               +   +   ++++H+      H D+KP N+L     G P    + DFG A    KQ+R
Sbjct: 550  ASFVLHTISKTVEYLHS--QGVVHRDLKPSNILYVDESGNPECLRICDFGFA----KQLR 603

Query: 805  SRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPF 975
            + +  L    +     +A F APE+     +   DE  DIWSLG  LY ++ G +PF
Sbjct: 604  AENGLLMTPCY-----TANFVAPEVLKRQGY---DEGCDIWSLGILLYTMLAGYTPF 652



 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 66/280 (23%), Positives = 117/280 (41%), Gaps = 4/280 (1%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
            ++F +++ LG+G F  V+LV+++     +P       D  H      YAMK +     + 
Sbjct: 98   SQFELLKVLGQGSFGKVFLVRKV----TRP-------DSGH-----LYAMKVLKKATLKV 141

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
             D V+ ++         ++L  ++H  + VK       + + YL+      G L      
Sbjct: 142  RDRVRTKM-------ERDILADVNHPFV-VKLHYAFQTEGKLYLILDFLRGGDLFTRL-- 191

Query: 589  MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLT---HRKGQPPLAI 759
              +K+  F+  DV     +L  GL H+H+      + D+KP N+LL    H K       
Sbjct: 192  --SKEVMFTEEDVKFYLAELALGLDHLHSL--GIIYRDLKPENILLDEEGHIK------- 240

Query: 760  LMDFGSARPARKQIRSRSEALQLQEWASEHV-SAPFRAPELWDCPSHADIDERTDIWSLG 936
            L DFG ++          EA+  ++ A     +  + APE+ +   H       D WS G
Sbjct: 241  LTDFGLSK----------EAIDHEKKAYSFCGTVEYMAPEVVNRQGHT---HSADWWSYG 287

Query: 937  CTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLS 1056
              ++ ++ G  PF+   G+        I+ A++  P  LS
Sbjct: 288  VLMFEMLTGSLPFQ---GKDRKETMTLILKAKLGMPQFLS 324



>gb:AF458700_1801554 Medicago sativa putative ankyrin-kinase (apk1)
            mRNA, complete cds.
          Length = 475

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 68/280 (24%), Positives = 124/280 (44%), Gaps = 7/280 (2%)
 Frame = +1

Query: 361  NGTYAMKKVLIQNS----EQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKH 528
            NGT    K+L ++S    + +++ K E+ +     HPN++  +      +          
Sbjct: 211  NGTKVAVKILDKDSYSDPDTINIFKHELTLLEKVRHPNVVQFVGAVTQNIPMM------- 263

Query: 529  EAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPS-YAHNDV 705
               ++   H  G L    T    KK   S S VL+    +  G+ ++H  +P    H D+
Sbjct: 264  ---IVREYHAKGDL----TGYIQKKGRLSPSKVLRFSLDIARGMNYLHECKPDPIIHCDL 316

Query: 706  KPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWD 885
            KP N+LL +  GQ  +A    FG+ R +   + +  +AL  Q  A+   S+ + APE++ 
Sbjct: 317  KPKNILLDNG-GQLKVA---GFGTVRFS---LITPDKALLEQPEANIDPSSLYVAPEIY- 368

Query: 886  CPSHADIDERT-DIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPT-GLSD 1059
                 D+ +R+ D +S G  +Y ++ G+ PF     E      L ++  + K P   +  
Sbjct: 369  ---RGDVFDRSVDAYSFGLIVYEMIEGIPPFHPKPAEEA----LKLMCLEGKRPQFKIKT 421

Query: 1060 PKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS 1179
              YP  L + +     P+  VRP    ++  +DK+++  S
Sbjct: 422  KSYPPDLKELIEECWDPEPEVRPTFSQVIARLDKIVANCS 461



>gb:AF458699_1801553 Medicago truncatula ankyrin-kinase mRNA, complete
            cds.
          Length = 477

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 68/280 (24%), Positives = 124/280 (44%), Gaps = 7/280 (2%)
 Frame = +1

Query: 361  NGTYAMKKVLIQNS----EQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKH 528
            NGT    K+L ++S    + +++ K E+ +     HPN++  +      +          
Sbjct: 213  NGTKVAVKILDKDSYSDPDTINIFKHELTLLEKVRHPNVVQFVGAVTQNIPMM------- 265

Query: 529  EAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPS-YAHNDV 705
               ++   H  G L    T    KK   S S VL+    +  G+ ++H  +P    H D+
Sbjct: 266  ---IVREYHAKGDL----TGYIQKKGRLSPSKVLRFSLDIARGMNYLHECKPDPIIHCDL 318

Query: 706  KPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWD 885
            KP N+LL +  GQ  +A    FG+ R +   + +  +AL  Q  A+   S+ + APE++ 
Sbjct: 319  KPKNILLDNG-GQLKVA---GFGTVRFS---LITPDKALLEQPEANIDPSSLYVAPEIY- 370

Query: 886  CPSHADIDERT-DIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPT-GLSD 1059
                 D+ +R+ D +S G  +Y ++ G+ PF     E      L ++  + K P   +  
Sbjct: 371  ---RGDVFDRSVDAYSFGLIVYEMIEGIPPFHPKPAEEA----LKLMCLEGKRPQFKIKT 423

Query: 1060 PKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS 1179
              YP  L + +     P+  VRP    ++  +DK+++  S
Sbjct: 424  KSYPPDLKELIEECWDPEPEVRPTFSQVIARLDKIVANCS 463



>gb:SCCMK1_1707352 S. cerevisiae CMK1 gene for
           Ca2+/calmodulin-dependant protein kinase.
          Length = 445

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 54/204 (26%), Positives = 92/204 (45%), Gaps = 3/204 (1%)
 Frame = +1

Query: 376 MKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSW---KHEAYLLF 546
           +KK L  N  QL+ + +E+ +     HPN++   D             W   K + Y++ 
Sbjct: 69  IKKALKGNKVQLEALYDELDILQRLHHPNIVAFKD-------------WFESKDKFYIIT 115

Query: 547 PVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLL 726
            +   G L D       KK  F+  D ++I  ++ + +K+MH+   +  H D+KP N+L 
Sbjct: 116 QLAKGGELFDRIL----KKGKFTEEDAVRILVEILSAVKYMHS--QNIVHRDLKPENLLY 169

Query: 727 THRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADI 906
             +  + PL ++ DFG A    K ++S  E L     A  +V     APE+     H   
Sbjct: 170 IDKSDESPL-VVADFGIA----KTLKSDEELLYKAGTALGYV-----APEVLTQDGHG-- 217

Query: 907 DERTDIWSLGCTLYAIMYGVSPFE 978
            +  DIWS+G   Y ++ G +  +
Sbjct: 218 -KPCDIWSIGVITYTLLCGYATID 240



>gb:AY364644_1602840 Chlamydomonas reinhardtii NIMA-related kinase 2
            mRNA, complete cds.
          Length = 653

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 68/313 (21%), Positives = 128/313 (40%), Gaps = 6/313 (1%)
 Frame = +1

Query: 226  DNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSE 405
            D +F++++ LG+G +  V+LV+ +                   +D+ TYA+K++ +++  
Sbjct: 8    DRQFKVLKFLGKGSYGSVFLVQRL-------------------ADSQTYALKEMDVRSMS 48

Query: 406  QLDLVKE--EIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDN 579
            Q +      EIR+ +  +HPN+          V  +E     +   ++     DG L   
Sbjct: 49   QAEREDSINEIRLLASVNHPNV----------VCYNEAFLDGNRLCIIMEYAADGDLAKV 98

Query: 580  ATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAI 759
                +  K       + + F Q+  GL+ +H+ +    H D+KPGN+++        +A 
Sbjct: 99   IKKQQMMKRPLPEDMIWKYFIQVVMGLQALHSMK--ILHRDIKPGNIMVFDNG----VAK 152

Query: 760  LMDFGSARPARKQIRSRSEALQLQEWASEHVSAP-FRAPELWDCPSHADIDERTDIWSLG 936
            + D G A+   K   ++++           +  P +  PE+W    +      +D W++G
Sbjct: 153  IGDLGIAKLLTKTAAAKTQ-----------IGTPHYMGPEIW---KNRPYSYTSDTWAIG 198

Query: 937  CTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDP---KYPEALHQFVTWMLQ 1107
            C LY +     PFE     S   L+  ++        G   P    +   L Q V   L 
Sbjct: 199  CLLYELAALAVPFE---ARSMSELRYKVLR-------GTYPPIPNTFSRDLQQMVRECLD 248

Query: 1108 PQATVRPHIDDIV 1146
            P    RP +D I+
Sbjct: 249  PNPDKRPTMDQIL 261



>gb:OCU38275_1442615 Oryctolagus cuniculus skeletal and cardiac muscle
            titin mRNA, partial cds.
          Length = 775

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 82/347 (23%), Positives = 147/347 (42%), Gaps = 5/347 (1%)
 Frame = +1

Query: 232  RFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQL 411
            ++ I   LG G F  V+   E                    S   T+  K V ++ ++Q+
Sbjct: 41   KYMIAEDLGRGEFGIVHRCVE-------------------TSSKKTFMAKFVKVKGTDQV 81

Query: 412  DLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAM 591
             LVK+EI + ++  H N+L L           E      E  ++F   + G  LD    +
Sbjct: 82   -LVKKEISILNIARHRNILYL----------HESFESMEELVMIFEF-ISG--LDIFERI 127

Query: 592  KAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDF 771
                   +  +++   RQ+C  L+ +H+   S  H D++P N++   R+    +  +++F
Sbjct: 128  NTSAFELNEREIVSYVRQVCEALEFLHSH--SIGHFDIRPENIIYQTRRSS--VIKIIEF 183

Query: 772  GSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYA 951
            G AR  +       +  +LQ  A E+      APE+     H  +   TD+WSLG  +Y 
Sbjct: 184  GQARQLKP-----GDNFRLQFTAPEYY-----APEVHQ---HDVVSSATDMWSLGTLVYV 230

Query: 952  IMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPH 1131
            ++ G++PF   L E+   +   I+NA+  +          EA+  FV  +L  +   R  
Sbjct: 231  LLSGINPF---LAETNQQIIENIMNAEYTFDEEAFKEISLEAM-DFVDRLLVKERKSRMT 286

Query: 1132 IDDIVIH--VDKLISKFSH*EVR-CRPKRHAHNYFAK--NMIRSIGR 1257
              + + H  + + I + S   +R  + +R+ H    K  NM+ S  R
Sbjct: 287  ASEALQHPWLKQKIDRVSTKVIRTLKHRRYYHTLIKKDLNMVVSAAR 333



>gb:AE014298_1124695 Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE003442_1209877 Drosophila melanogaster
            chromosome X, section 26 of 74 of the complete
            sequence.>gb:AY095023_1298173 Drosophila melanogaster
            LD04361 full insert cDNA.
          Length = 735

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 62/250 (24%), Positives = 100/250 (40%), Gaps = 3/250 (1%)
 Frame = +1

Query: 412  DLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAM 591
            D +  EI V     HPN++    H V     S         Y++      G L       
Sbjct: 61   DALVSEISVLRQLQHPNIVQYYHHLVNREAKS--------VYIVMECCAGGDLAQIVQRA 112

Query: 592  KAKKESFSTSDVLQIFRQLCAGLKHMHNFEPS--YAHNDVKPGNVLLTHRKGQPPLAILM 765
            +++++ F    + ++  QLC  L+  HN  P+    H D+KP N+ L         A L 
Sbjct: 113  RSQRQRFEEPYIWRVLFQLCRALQVCHNKIPNGTILHRDIKPANIFLDAAGN----AKLG 168

Query: 766  DFGSARPARKQIRSRSEALQLQEWASEHVSAP-FRAPELWDCPSHADIDERTDIWSLGCT 942
            DFG AR  R+           Q +A+  V  P + +PEL     +   D ++D+W++GC 
Sbjct: 169  DFGLARMLRRD----------QSFAASFVGTPHYMSPELVKGRKY---DRKSDVWAVGCL 215

Query: 943  LYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATV 1122
            +Y +     PF    G +   L   I   +      +    Y   L + + +ML      
Sbjct: 216  VYEMCALRPPFR---GRAFDQLSEKIAQGEFSRIPAI----YSTDLQEIIAFMLAVDHEQ 268

Query: 1123 RPHIDDIVIH 1152
            RP I+ I+ H
Sbjct: 269  RPGIEVIIRH 278



>sp|P18653|K6A1_MOUSE Ribosomal protein S6 kinase alpha 1 (EC
            2.7.1.37) (S6K-alpha 1) (90 kDa ribosomal protein S6
            kinase 1) (p90-RSK 1) (Ribosomal S6 kinase 1) (RSK-1)
            (pp90RSK1) (MAP kinase-activated protein kinase 1a)
            (MAPKAPK1A).>pir|B32571|B32571 ribosomal protein S6
            kinase II (EC 2.7.1.-) alpha chain homolog (clone Mu6A) -
            mouse>gb:MUSS6KA_2129946 Mus musculus (clone Mu6a)
            ribosomal protein S6 kinase (rsk) mRNA, complete cds.
          Length = 724

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 68/237 (28%), Positives = 103/237 (43%), Gaps = 1/237 (0%)
 Frame = +1

Query: 268  FAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSL 447
            F+  Y+VKE +      G     K   H + N  YA+K  +I  S++     EEI +   
Sbjct: 403  FSDGYVVKETIG----VGSYSVCKRCVHKATNMEYAVK--VIDKSKRDP--SEEIEILLR 454

Query: 448  FS-HPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSD 624
            +  HPN++ L D              KH  YL+  +   G LLD     K     FS  +
Sbjct: 455  YGQHPNIITLKDVY---------DDGKH-VYLVTELMRGGELLDKILRQKF----FSERE 500

Query: 625  VLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIR 804
               +   +   ++++H+      H D+KP N+L     G P    + DFG A    KQ+R
Sbjct: 501  ASFVLHTISKTVEYLHS--QGVVHRDLKPSNILYVDESGNPECLRICDFGFA----KQLR 554

Query: 805  SRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPF 975
            + +  L    +     +A F APE+     +   DE  DIWSLG  LY ++ G +PF
Sbjct: 555  AENGLLMTPCY-----TANFVAPEVLKRQGY---DEGCDIWSLGILLYTMLAGYTPF 603



 Score = 40.8 bits (94), Expect = 0.071
 Identities = 57/240 (23%), Positives = 99/240 (41%), Gaps = 4/240 (1%)
 Frame = +1

Query: 229 NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
           ++F +++ LG+G F  V+LV+++     +P       D  H      YAMK +     + 
Sbjct: 60  SQFELLKVLGQGSFGKVFLVRKV----TRP-------DSGH-----LYAMKVLKKATLKV 103

Query: 409 LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
            D V+ ++         ++L  ++H  + VK       + + YL+      G L      
Sbjct: 104 RDRVRTKM-------ERDILADVNHPFV-VKLHYAFQTEGKLYLILDFLRGGDLFTRL-- 153

Query: 589 MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLT---HRKGQPPLAI 759
             +K+  F+  DV     +L  GL H+H+      + D+KP N+LL    H K       
Sbjct: 154 --SKEVMFTEEDVKFYLAELALGLDHLHSL--GIIYRDLKPENILLDEEGHIK------- 202

Query: 760 LMDFGSARPARKQIRSRSEALQLQEWASEHV-SAPFRAPELWDCPSHADIDERTDIWSLG 936
           L DFG ++          EA+  ++ A     +  + APE+ +   H       D WS G
Sbjct: 203 LTDFGLSK----------EAIDHEKKAYSFCGTVEYMAPEVVNRQGHT---HSADWWSYG 249



>sp|P39009|DUN1_YEAST DNA damage response protein kinase DUN1 (EC
            2.7.1.-).>pir|S43941|S43941 protein kinase DUN1 (EC
            2.7.1.-) - yeast (Saccharomyces
            cerevisiae)>gb:SCCHRIVLA_1706998 S.cerevisiae DNA
            fragment of 38.5kb from left arm of chromosome
            IV.>gb:SCYDL101C_1711668 S.cerevisiae chromosome IV
            reading frame ORF YDL101c.>gb:YSCDUN1A_1728837
            Saccharomyces cerevisiae protein kinase (Dun1) gene,
            complete cds.
          Length = 513

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 75/313 (23%), Positives = 131/313 (41%), Gaps = 5/313 (1%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
            +++ + ++LG G +A   LVKE         V+ K     HA  N      K        
Sbjct: 198  DKYLLGKELGAGHYA---LVKEAKNKKTGQQVAVKI---FHAQQNDDQKKNKQF------ 245

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
                +EE  +     HPN++ LLD  V  +  S+ Q      YL+     DG L +    
Sbjct: 246  ----REETNILMRVQHPNIVNLLDSFVEPISKSQIQK-----YLVLEKIDDGELFERIVR 296

Query: 589  MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD 768
                ++  S +    +F+QL  GLK++H  E +  H D+KP N+LL   + + P  + + 
Sbjct: 297  KTCLRQDESKA----LFKQLLTGLKYLH--EQNIIHRDIKPENILLNITRRENPSQVQLG 350

Query: 769  FGSARPARKQIRSRSEAL-----QLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSL 933
                     Q++     L     ++Q   +   +  + APE+     +     + D+WS 
Sbjct: 351  PWDEDEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTS---KVDLWSA 407

Query: 934  GCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQ 1113
            G  LY  + G  PF   LG    SL+  I+ A+  + +   D K  +++   ++ +L   
Sbjct: 408  GVILYVCLCGFPPFSDQLGPP--SLKEQILQAKYAFYSPYWD-KIDDSVLHLISNLLVLN 464

Query: 1114 ATVRPHIDDIVIH 1152
               R +ID+ + H
Sbjct: 465  PDERYNIDEALNH 477



>gb:CHKCDK6G_2568867 Gallus gallus cyclin-dependent kinase (cdk6)
            gene, complete cds.
          Length = 326

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 81/315 (25%), Positives = 137/315 (43%), Gaps = 9/315 (2%)
 Frame = +1

Query: 226  DNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY-AMKKVLIQNS 402
            D ++  V ++GEG +  V+  +++                    + G + A+K+V +Q S
Sbjct: 10   DQQYECVAEIGEGAYGKVFKARDL-------------------KNGGRFVALKRVRVQTS 50

Query: 403  EQ---LDLVKEE--IRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
            E+   L  ++E   +R    F HPN++ L D  V  V  ++ ++   +  L+F  H+D  
Sbjct: 51   EEGMPLSTIREVAVLRHLETFEHPNVVRLFD--VCTVSRTDRET---KLTLVFE-HVDQD 104

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            L       K  +    T  +  +  QL  GL  +H+      H D+KP N+L+T   GQ 
Sbjct: 105  LTTYLD--KVPEPGVPTETIKDMMLQLFRGLDFLHSHR--VVHRDLKPQNILVT-SSGQI 159

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
             LA   DFG AR    Q+   S  + L  W        +RAPE+    S+A      D+W
Sbjct: 160  KLA---DFGLARIYSFQMALTSVVVTL--W--------YRAPEVLLQSSYA---TPVDLW 203

Query: 928  SLGCTLYAIMYGVSPF---EYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTW 1098
            S+GC ++A M+   P       + + G    +  +  +  WP  ++ P+     + F + 
Sbjct: 204  SVGC-IFAEMFRRKPLFRGNSDVDQLGKIFDVIGLPEEEDWPNDVALPR-----NAFASR 257

Query: 1099 MLQPQATVRPHIDDI 1143
              QP     P IDD+
Sbjct: 258  PAQPIEKFVPDIDDM 272



>gb:AF384863_2490827 Danio rerio myosin IIIA (myo3a) mRNA, complete
            cds.
          Length = 1775

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 85/338 (25%), Positives = 131/338 (38%), Gaps = 9/338 (2%)
 Frame = +1

Query: 169  SGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPS 348
            SG + ++D+     D W       I+  +G+G +  VY V   + D +K  V  K  DP 
Sbjct: 5    SGKSIIFDSFPDPSDTW------EIIETIGKGTYGKVYKVHNKV-DGSKAAV--KILDPI 55

Query: 349  HASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKH 528
            H  D    A   +L                 +L  HPN++            +  Q W  
Sbjct: 56   HDIDEEIEAEYNIL----------------KALSDHPNVVKFFGMFYKKDVKTGDQLW-- 97

Query: 529  EAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVK 708
               L+  +   G++ D A  M  + +      +  I  +   GL+H+H  +    H DVK
Sbjct: 98   ---LVLELCNGGSVTDLAKGMLKRGDRMEEPIIAFILHEALMGLQHLHVNKT--IHRDVK 152

Query: 709  PGNVLLTHRKGQPPLAILMDFG-SARPARKQIRSRSEALQLQEWASEHVSAPF-RAPELW 882
              N+LLT   G      L+DFG SA+    ++R  +            V  PF  APE+ 
Sbjct: 153  GNNILLTTGGGIK----LVDFGVSAQLTNTRLRRNTS-----------VGTPFWMAPEVI 197

Query: 883  DCPSHAD--IDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTG-- 1050
             C    D   DER D+WSLG T   +  G  P            +L  + A  K P    
Sbjct: 198  ACEQQLDSTYDERCDVWSLGITAIELGDGDPPL----------AELHPMRALFKIPRNPP 247

Query: 1051 --LSDPK-YPEALHQFVTWMLQPQATVRPHIDDIVIHV 1155
              L  P+ +    + F+   L     +RP++ D++ HV
Sbjct: 248  PTLHQPELWSNDFNDFIRKCLIKDFELRPNVLDLLQHV 285



>gb:AF461701S6_2066523 Mus musculus calcium/calmodulin-dependent
            protein kinase kinase alpha (Camkk1) gene, exon 16 and
            complete cds.>gb:AL670399_2072640 Mouse DNA sequence from
            clone RP23-263M10 on chromosome 11 Contains the 3' end of
            the Atp2a3 gene for ubiquitous Ca++ transporting ATPase,
            the P2rx1 and P2rx5 genes for purinergic receptor P2X
            ligand-gated ion channel 1 and 5, 111 novel genes, the
            Camkk1 gene for calcium/calmodulin-dependent protein
            kinase kinase 1 alpha, the Itgae gene for
            epithelial-associated integrin alpha E, the Gsg2 gene for
            germ cell-specific gene 2 protein, the gene for a novel
            protein similar to human tax interacting protein 1, the
            Ctns gene for nephropathic cystinosis protein and five
            CpG islands, complete sequence.>gb:BC017529_2092478 Mus
            musculus calcium/calmodulin-dependent protein kinase
            kinase 1, alpha, mRNA (cDNA clone MGC:27706
            IMAGE:4924656), complete cds.
          Length = 505

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 73/317 (23%), Positives = 126/317 (39%), Gaps = 9/317 (2%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADP-------AKPGVSKKFKDPSHASDNGTYAMKKV 387
            N++++  ++G+G +  V L      D        +K  + K++  P      G+ A +  
Sbjct: 126  NQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQATQGG 185

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
              +    L+ V +EI +     H N++ L++  V+   A +        YL+F +   G 
Sbjct: 186  PAKQLLPLERVYQEIAILKKLDHVNVVKLIE--VLDDPAEDN------LYLVFDLLRKGP 237

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            +++         + F         R +  GL+++H       H D+KP N+LL    G  
Sbjct: 238  VMEVPC-----DKPFPEEQARLYLRDIILGLEYLHC--QKIVHRDIKPSNLLL----GDD 286

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
                + DFG +       +      QL   A    +  F APE       +   +  D+W
Sbjct: 287  GHVKIADFGVSN------QFEGNDAQLSSTAG---TPAFMAPEAISDSGQSFSGKALDVW 337

Query: 928  SLGCTLYAIMYGVSPF--EYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWM 1101
            + G TLY  +YG  PF  +Y L     +L   I N  V +P    +P+  E L   +  M
Sbjct: 338  ATGVTLYCFVYGKCPFIDDYIL-----TLHRKIKNEAVVFP---EEPEVSEDLKDLILRM 389

Query: 1102 LQPQATVRPHIDDIVIH 1152
            L      R  + DI +H
Sbjct: 390  LDKNPETRIGVSDIKLH 406



>gb:CR382121_1654590 Kluyveromyces lactis strain NRRL Y-1140
            chromosome A of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 879

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 73/310 (23%), Positives = 125/310 (40%), Gaps = 4/310 (1%)
 Frame = +1

Query: 235  FRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDN---GTYAMKKVLIQNSE 405
            FR+V + G+G    VYL + +   P        +KD   A  N      A+K++++    
Sbjct: 588  FRMVEKAGQGASGSVYLAERLQLPP--------YKDELEAEKNQLGNKVAIKQMILSKQP 639

Query: 406  QLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNAT 585
            + +L+  EI V     H N++  L+    A   +E   W    Y+      D  +++N+ 
Sbjct: 640  RKELIVNEILVMKDSKHNNIVNFLE----AYLKTEDDLWVVMEYMEGGSLTD--IIENSP 693

Query: 586  AMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILM 765
               + +   +   +  I R+ C GLK +H  +    H D+K  NVLL  R G+  +    
Sbjct: 694  TGSSGQSPLTEPQIAYIVRETCQGLKFLH--DKHIIHRDIKSDNVLLDTR-GRVKIT--- 747

Query: 766  DFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTL 945
            DFG       +   R+  +    W          APE+       + DE+ D+WSLG   
Sbjct: 748  DFGFCAKLTDKRSKRATMVGTPYWM---------APEV---VKQREYDEKVDVWSLGIMT 795

Query: 946  YAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPE-ALHQFVTWMLQPQATV 1122
              ++    P  Y   E   +L L   N   K    L  P+Y    + +F++  L      
Sbjct: 796  IEMLESEPP--YLNEEPLKALYLIATNGTPK----LKHPEYLSLEIKRFLSVCLCVDVKY 849

Query: 1123 RPHIDDIVIH 1152
            R   ++++ H
Sbjct: 850  RASTEELLHH 859



>gb:CR548612_1375577 Paramecium tetraurelia macronuclear largest
           chromosome, complete sequence.
          Length = 567

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 64/260 (24%), Positives = 122/260 (46%), Gaps = 9/260 (3%)
 Frame = +1

Query: 226 DNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSE 405
           D  +++  Q+G+G F+ V +  +I     +              +   +A+K +  Q  +
Sbjct: 128 DKTYKLGAQIGQGSFSTVNIYNQIKVHQCQN------------KEGEIFAVKIIKKQTIK 175

Query: 406 QLDLVKE-------EIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDG 564
           Q++  K        EI+   +F+HPN+L L        +  E QS     YLL   +++G
Sbjct: 176 QINKNKNYEEQLLNEIQALRMFNHPNILKLF-------RVYENQS---NIYLLTE-YING 224

Query: 565 TLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQ 744
             L    + ++ K+ +S  D+  +  ++ + ++ +H  +    H D+KP N+LL+    Q
Sbjct: 225 PEL---VSQQSSKKIYSQEDLRIMIFKILSAIEQIH--QQKVMHRDIKPQNILLSGNDIQ 279

Query: 745 PPLAILMDFG-SARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCP-SHADIDERT 918
            P  +++DFG +A   +KQI              +  S  + APE+     S    +++ 
Sbjct: 280 KP--VIIDFGLAAFTCQKQIPF-----------PQCGSPGYSAPEVLKYEESKKTYNQQC 326

Query: 919 DIWSLGCTLYAIMYGVSPFE 978
           DI+S+G TL+ I+YG +PF+
Sbjct: 327 DIFSIGITLFVILYGYNPFK 346



>gb:HSM801550_1186246 Homo sapiens mRNA; cDNA DKFZp761M0423 (from
            clone DKFZp761M0423).>gb:AF425232_1901806 Homo sapiens
            CaMKK alpha protein mRNA, complete
            cds.>gb:AF425301_1901842 Homo sapiens CAMKK alpha protein
            (CAMKK1) mRNA, complete cds.>gb:BC043487_1983418 Homo
            sapiens calcium/calmodulin-dependent protein kinase
            kinase 1, alpha, transcript variant 1, mRNA (cDNA clone
            MGC:49844 IMAGE:5751570), complete cds.
          Length = 505

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 72/315 (22%), Positives = 126/315 (40%), Gaps = 7/315 (2%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADP-------AKPGVSKKFKDPSHASDNGTYAMKKV 387
            N++++  ++G+G +  V L      D        +K  + K++  P      G+ A +  
Sbjct: 126  NQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQAAQGG 185

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
              +    L+ V +EI +     H N++ L++  V+   A +        YL+F +   G 
Sbjct: 186  PAKQLLPLERVYQEIAILKKLDHVNVVKLIE--VLDDPAEDN------LYLVFDLLRKGP 237

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            +++         + FS        R +  GL+++H       H D+KP N+LL    G  
Sbjct: 238  VMEVPC-----DKPFSEEQARLYLRDVILGLEYLHC--QKIVHRDIKPSNLLL----GDD 286

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
                + DFG +       +      QL   A    +  F APE       +   +  D+W
Sbjct: 287  GHVKIADFGVSN------QFEGNDAQLSSTAG---TPAFMAPEAISDSGQSFSGKALDVW 337

Query: 928  SLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQ 1107
            + G TLY  +YG  PF   + +   +L   I N  V +P    +P+  E L   +  ML 
Sbjct: 338  ATGVTLYCFVYGKCPF---IDDFILALHRKIKNEPVVFP---EEPEISEELKDLILKMLD 391

Query: 1108 PQATVRPHIDDIVIH 1152
                 R  + DI +H
Sbjct: 392  KNPETRIGVPDIKLH 406



>gb:BX294134_765349 Pirellula sp. strain 1 complete genome; segment
            2/24.
          Length = 779

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 54/256 (21%), Positives = 112/256 (43%)
 Frame = +1

Query: 235  FRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLD 414
            + +  Q+GEGGF  V++ ++    P +  V+ K   P               + + E + 
Sbjct: 86   YTLREQIGEGGFGLVFVAEQ--ESPVRRRVALKIVKPG--------------VGSKEVIA 129

Query: 415  LVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMK 594
              + E +  +L +HPN+  + D  V A          +  Y +  +     + +      
Sbjct: 130  RFEAERQAVALMNHPNIAQVFDAGVTA---------DYRPYFVMELVRGLPITEFCD--- 177

Query: 595  AKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFG 774
              ++     + L +   +C+ + H H  +    H D+KP NV++T    +  +A ++DFG
Sbjct: 178  --EKQMDVRERLNLMIDVCSAVHHAH--QKGVIHRDIKPSNVMVTLHDDRA-VAKVIDFG 232

Query: 775  SARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAI 954
             A+   +++  ++   +        +   + +PE  +  S  D+D R+DI+SLG  +Y +
Sbjct: 233  VAKALDQKLTDKTVYTRFFSMIGTPL---YMSPEQAEMSS-LDVDTRSDIYSLGVLMYEL 288

Query: 955  MYGVSPFEYALGESGG 1002
            + G +PF+    +S G
Sbjct: 289  LVGATPFDRGRLDSAG 304



>gb:BA000030_703311 Streptomyces avermitilis MA-4680 genomic DNA,
            complete genome.
          Length = 803

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 83/332 (25%), Positives = 136/332 (40%), Gaps = 8/332 (2%)
 Frame = +1

Query: 199  NGGGDV--WINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY 372
            N GG V   +   R+R+V  +G+GG   V+   + + D  +  V +   D   A D  T 
Sbjct: 4    NSGGGVPGLLVTGRYRLVESIGQGGMGRVWRATDEMLD-RQVAVKEMRIDGLDAEDTRTR 62

Query: 373  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV 552
              + +             E R ++  SHPN++ + D     V     + W      +   
Sbjct: 63   RERTL------------REARATARISHPNVVRVYD-----VVDESDRLW------IVME 99

Query: 553  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVL--- 723
             +DG  L+       +       +  +I R+L A L+ +H       H D+KPGNVL   
Sbjct: 100  LVDGRSLERIVV---EDGPLGPGETARIGRELVAALRQVH--AGGVLHRDIKPGNVLVEN 154

Query: 724  LTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHAD 903
            L HR       +L DFG        I +  +A  L        S  + APE     S   
Sbjct: 155  LGHR------VVLTDFG--------IAAIQDAKALTMVGMLVGSPDYMAPER---VSGRP 197

Query: 904  IDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPE--- 1074
                +D+WSLG TL A + G SPF         S  LA ++A +       +P+ P    
Sbjct: 198  QGPPSDVWSLGATLCAALGGHSPF-------SRSTTLATLHAVL-----YEEPELPTEAG 245

Query: 1075 ALHQFVTWMLQPQATVRPHIDDIVIHVDKLIS 1170
             L Q +  +L+ + +VRP ++++   ++ L++
Sbjct: 246  GLRQILAALLEKEPSVRPGLEEVAAALEALVA 277



>gb:AE016969_369907 Mycoplasma gallisepticum strain R section 3 of 4
            of the complete genome.>gb:AE015450_1034556 Mycoplasma
            gallisepticum strain R complete genome.
          Length = 424

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 75/313 (23%), Positives = 132/313 (42%), Gaps = 28/313 (8%)
 Frame = +1

Query: 199  NGGGDVWIND---NRFRIVRQLGEGGF-AYVYLVKEILADPAKPGVSKKFKDPSHASDNG 366
            N  G + +ND   NR+ I+ +L  GG  + +Y  K I AD  K   SKK       S   
Sbjct: 20   NSEGYLMVNDKLFNRYVILNKLTTGGMNSVIYTAKNITADSTKLNDSKK-------STVV 72

Query: 367  TYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLL--DHAVIAVKASEGQSWKHEAYL 540
               +K+     +++   +++E+  SS  SHPNL+     D   I ++ +      ++  +
Sbjct: 73   IKLVKRSPEDTNDKWAKLQQELITSSRISHPNLIATYETDDKGILIERNNRMIRINDVLV 132

Query: 541  LFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNV 720
            +   ++ GT L N    K    + S  + L  FR++  G++ +HN+     H D+KP N+
Sbjct: 133  IVMEYVQGTTLRNYIISKG---NLSVKEALYYFRRMVEGIQKLHNYSHQIIHRDLKPENL 189

Query: 721  LLTHRKGQPPLAILMDFG-----SARPARKQIRSRS-----------EALQLQEWASEHV 852
            +L+  K    L I+ DFG     S     K + +             +ALQ +    E+ 
Sbjct: 190  MLS--KDYRELKII-DFGISTSISTESVLKVLTNEKALYGTHEYMCPDALQKEPVLDEN- 245

Query: 853  SAPFRAPEL------WDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQL 1014
            + P   P+       W  P+      + D ++ G  L+ ++ G  PF   + +       
Sbjct: 246  NKPVINPKTNTPLMRWKAPT-----VQYDFYAFGVILFEMLTGQKPFNKKIDDKKLERPQ 300

Query: 1015 AIVNAQVKWPTGL 1053
             I+N   K+   L
Sbjct: 301  DIINLPNKFDVPL 313



>gb:AL714003_2504391 Zebrafish DNA sequence from clone BUSM1-167C3 in
             linkage group 9 Contains the 3' end of a novel gene
             similar to TTN (titin), a novel gene similar to FKBP
             (FK506-binding protein) and the 5' part of a novel
             collagen gene, complete sequence.
          Length = 18412

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 60/249 (24%), Positives = 109/249 (43%)
 Frame = +1

Query: 229   NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
             N++ I  +LG G F  V+   E                    S   TY  K V ++ ++Q
Sbjct: 16446 NKYMIAEELGRGQFGIVHRCIE-------------------TSSEKTYMAKFVKVKGADQ 16486

Query: 409   LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
               LVK+EI   ++  H N L L           E      E  +++   + G  +D    
Sbjct: 16487 A-LVKKEIATLNVARHKNFLLL----------HESFDSPEELVMIYEF-ISG--VDIFER 16532

Query: 589   MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD 768
             +       S  +++   RQ+C  L+ +H+   SY H D++P N++ T RKG      +++
Sbjct: 16533 LGTANFELSECEIVNYIRQVCEALEFLHS--KSYGHFDIRPENIVYTTRKGNN--VKIIE 16588

Query: 769   FGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLY 948
              G +R       +  + +++Q     + +A F APE+     +  +   TD+WS+G  +Y
Sbjct: 16589 LGQSRHL-----TPGDQIKIQ-----YTTAEFAAPEIHQ---NEMVSTVTDMWSVGVLVY 16635

Query: 949   AIMYGVSPF 975
              ++ G++PF
Sbjct: 16636 VLLSGLNPF 16644



>gb:BVU309171_1643192 Beta vulgaris mRNA for putative
            phosphoenolpyruvate carboxylase kinase.
          Length = 282

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 70/287 (24%), Positives = 122/287 (42%), Gaps = 5/287 (1%)
 Frame = +1

Query: 232  RFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQL 411
            ++++  ++G G F  V+               + F   SH S       K++L+ +    
Sbjct: 8    QYQLCDEIGRGRFGVVF---------------RCFSPSSHTSFAVKSIDKRLLLDDETDR 52

Query: 412  DLVKEEIRVSSLFS-HPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHM--DGTLLDNA 582
            + + +E ++  + S HPN+L + D             +  +++LL    +  + TL D  
Sbjct: 53   ECLDKEPKILQILSPHPNILQIHD------------IFDSDSHLLIVTDLCQESTLYDRV 100

Query: 583  TAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSY-AHNDVKPGNVLLTHRKGQPPLAI 759
             +       FS +D   +F QL   L H H    +Y  H DVKP N+L   R        
Sbjct: 101  VSAGP----FSETDACSVFTQLIDALAHCHR---NYICHRDVKPDNILFDSRNRVK---- 149

Query: 760  LMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR-APELWDCPSHADIDERTDIWSLG 936
            L DFGSA             ++ +E  +  V  P+  APE+    +  + +E+ D+WS G
Sbjct: 150  LCDFGSAE--------WFGGVEGRERMNGIVGTPYYVAPEVL---AGREYNEKIDVWSAG 198

Query: 937  CTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEA 1077
              LY ++ GV PF    G++      A++   +++PT +     PEA
Sbjct: 199  VILYIMLGGVPPF---YGDTVEDTFAAVLRGNLRFPTKIFRSISPEA 242



>gb:AK043543_1166622 Mus musculus 10 days neonate cortex cDNA, RIKEN
            full-length enriched library, clone:A830007B13
            product:similar to MRNA, SIMILAR TO HUMAN HYPOTHETICAL
            PROTEIN FLJ23495, COMPLETE CDS [Macaca fascicularis],
            full insert sequence.
          Length = 438

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 78/308 (25%), Positives = 128/308 (41%), Gaps = 3/308 (0%)
 Frame = +1

Query: 232  RFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQL 411
            R+ + ++LG G F  VYLV +     AKPG   K              +K++ +      
Sbjct: 29   RYVLQQKLGSGSFGTVYLVSD---KKAKPGEELK-------------VLKEISVGELNPN 72

Query: 412  DLVKEEIRVSSLFSHPNLLPLLDH-AVIAVKASEGQSWKHEAYLLFPVHMDGTLLD-NAT 585
            + V+  +          LL  L H A++   AS     + E + +   + +G  LD    
Sbjct: 73   ETVQANVEAQ-------LLSRLHHPAIVRFHAS---FMEQETFCIITEYCEGRDLDYRIQ 122

Query: 586  AMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILM 765
              K   + F+ + +++ F QL  G+ +MH  E    H D+K  N+ L +      L  + 
Sbjct: 123  EYKEAGKVFAENQIVEWFIQLLLGVDYMH--ERRILHRDLKSKNIFLKNN-----LLKIG 175

Query: 766  DFGSARPARKQIRSRSEALQLQEWASEHVSAP-FRAPELWDCPSHADIDERTDIWSLGCT 942
            DFG +R                E A+    AP + +PE      H   D ++DIWSL C 
Sbjct: 176  DFGVSRLLMGSC----------ELATTLTGAPHYMSPEAL---KHQGYDAKSDIWSLAC- 221

Query: 943  LYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATV 1122
               I+Y +   ++A     GS  L++V   V+  T     +YP  L+  +  ML    ++
Sbjct: 222  ---ILYEMCCLDHAF---AGSSFLSVVLNIVEGKTPSLPDRYPRELNTIMERMLNKSPSL 275

Query: 1123 RPHIDDIV 1146
            RP   DI+
Sbjct: 276  RPSAADIL 283



>gb:BX294149_770228 Pirellula sp. strain 1 complete genome; segment
            17/24.
          Length = 1030

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 78/309 (25%), Positives = 121/309 (39%), Gaps = 6/309 (1%)
 Frame = +1

Query: 220  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVL--- 390
            ++   + IVR LG GG   VYL +                     +  G     KVL   
Sbjct: 100  VSIGEYEIVRPLGRGGMGNVYLARH--------------------TKLGRLVALKVLAGH 139

Query: 391  -IQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
             + +++  +    E+R     SHP ++   D   I   A           +L    +DG 
Sbjct: 140  RLADAKMKERFGAEMRAVGQLSHPGIVSAHDAREIDGTA-----------VLITEFIDGM 188

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
             L     + ++      +D   + RQ+   L++    +  + H DVKP N++L+ R G+ 
Sbjct: 189  DL---AQLVSRTGPIEIADACDLIRQVAVALQYTS--DQGFVHRDVKPSNIMLS-RSGEV 242

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
             L   +D G AR        R E   L        +A + APE         +D R DI+
Sbjct: 243  KL---LDLGLARLQEP----RHETSGLTGTGQAMGTADYIAPE--QVTDSRGVDVRADIY 293

Query: 928  SLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSD--PKYPEALHQFVTWM 1101
            SLGCTL+ ++ G +PF      +  +   A V+     P  L+D  P  P  L + V  M
Sbjct: 294  SLGCTLFKLLTGHAPFAGPQCTTAFAKMTAHVSTP---PPVLNDFLPDAPAGLAKLVASM 350

Query: 1102 LQPQATVRP 1128
            L    T RP
Sbjct: 351  LDKDPTSRP 359



>sp|Q63531|K6A1_RAT Ribosomal protein S6 kinase alpha 1 (EC 2.7.1.37)
            (S6K-alpha 1) (90 kDa ribosomal protein S6 kinase 1)
            (p90-RSK 1) (Ribosomal S6 kinase 1) (RSK-1) (pp90RSK1)
            (MAP kinase-activated protein kinase 1a)
            (MAPKAPK1A).>pir|A53300|A53300 ribosomal protein S6
            kinase (EC 2.7.-.-) II - rat>gb:RATRSK1X_2133778 Rat S6
            protein kinase (Rsk-1) mRNA, complete cds.
          Length = 735

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 68/237 (28%), Positives = 103/237 (43%), Gaps = 1/237 (0%)
 Frame = +1

Query: 268  FAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSL 447
            F+  Y+VKE +      G     K   H + N  YA+K  +I  S++     EEI +   
Sbjct: 414  FSDGYIVKETIG----VGSYSVCKRCVHKATNMEYAVK--VIDKSKRDP--SEEIEILLR 465

Query: 448  FS-HPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSD 624
            +  HPN++ L D              KH  YL+  +   G LLD     K     FS  +
Sbjct: 466  YGQHPNIITLKDVY---------DDSKH-VYLVTELMRGGELLDKILRQKF----FSERE 511

Query: 625  VLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIR 804
               +   +   ++++H+      H D+KP N+L     G P    + DFG A    KQ+R
Sbjct: 512  ASFVLYTISKTVEYLHS--QGVVHRDLKPSNILYVDESGNPECLRICDFGFA----KQLR 565

Query: 805  SRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPF 975
            + +  L    +     +A F APE+     +   DE  DIWSLG  LY ++ G +PF
Sbjct: 566  AENGLLMTPCY-----TANFVAPEVLKRQGY---DEGCDIWSLGVLLYTMLAGYTPF 614



 Score = 51.2 bits (121), Expect = 5e-05
 Identities = 67/281 (23%), Positives = 117/281 (41%), Gaps = 5/281 (1%)
 Frame = +1

Query: 229  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNG-TYAMKKVLIQNSE 405
            + F +++ LG+G F  V+LV+++     +P             DNG  YAMK +     +
Sbjct: 60   SHFELLKVLGQGSFGKVFLVRKV----TRP-------------DNGHLYAMKVLKKATLK 102

Query: 406  QLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNAT 585
              D V+ ++         ++L  ++H  + VK       + + YL+      G L     
Sbjct: 103  VRDRVRTKM-------ERDILADVNHPFV-VKLHYAFQTEGKLYLILDFLRGGDLFTRL- 153

Query: 586  AMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLT---HRKGQPPLA 756
               +K+  F+  DV     +L  GL H+H+      + D+KP N+LL    H K      
Sbjct: 154  ---SKEVMFTEEDVKFYLAELALGLDHLHSL--GIIYRDLKPENILLDEEGHIK------ 202

Query: 757  ILMDFGSARPARKQIRSRSEALQLQEWASEHV-SAPFRAPELWDCPSHADIDERTDIWSL 933
             L DFG ++          EA+  ++ A     +  + APE+ +   H       D WS 
Sbjct: 203  -LTDFGLSK----------EAIDHEKKAYSFCGTVEYMAPEVVNRQGHT---HSADWWSY 248

Query: 934  GCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLS 1056
            G  ++ ++ G  PF+   G+        I+ A++  P  LS
Sbjct: 249  GVLMFEMLTGSLPFQ---GKDRKETMTLILKAKLGMPQFLS 286



>gb:AF034090_1762739 Neurospora crassa MAPKK kinase (nrc-1) gene,
            complete cds.
          Length = 666

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 82/327 (25%), Positives = 130/327 (39%), Gaps = 13/327 (3%)
 Frame = +1

Query: 208  GDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKV 387
            GD W +D+ +     +G+G F  VYL    +         K+ + P+  +D+   A KK 
Sbjct: 382  GDAW-DDSMWMKGSLIGQGSFGSVYLALHAITGELL--AVKQVETPAPGADSKNDARKKS 438

Query: 388  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDG- 564
            +I+       +K EI +     HPN++  L           G S   E   +F  ++ G 
Sbjct: 439  MIE------ALKREITLLRDLQHPNIVQYL-----------GCSSSAEYLNIFLEYVPGG 481

Query: 565  ---TLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHR 735
               T+LD   A+         S V    RQ+  GL ++HN +    H D+K  N+L+ + 
Sbjct: 482  SVQTMLDQYGALPE-------SLVRSFVRQILQGLSYVHNRD--IIHRDIKGANILVDN- 531

Query: 736  KGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAP-FRAPELWDCPS---HAD 903
            KG   ++   DFG        I  + EA  +   A+ +   P  +    W  P       
Sbjct: 532  KGTIKIS---DFG--------ISKKLEATNILNGANNNKHRPSLQGSVFWMAPEVVKQTS 580

Query: 904  IDERTDIWSLGCTLYAIMYGVSPFE-----YALGESGGSLQLAIVNAQVKWPTGLSDPKY 1068
               + DIWSLGC +  +M G  PF       A+ + GGS       A    P   S    
Sbjct: 581  YTRKADIWSLGCLVVEMMTGTHPFPDCTQLQAIFKIGGS------KASPTIPDNAS---- 630

Query: 1069 PEALHQFVTWMLQPQATVRPHIDDIVI 1149
             E   QF+    +     RP  D++++
Sbjct: 631  -EEAKQFLAQTFEIDHNKRPSADELML 656



>gb:D89662_1376520 Drosophila melanogaster mRNA for myosin light
           chain kinase isoform-III, partial cds.
          Length = 569

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 69/261 (26%), Positives = 107/261 (40%)
 Frame = +1

Query: 193 AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY 372
           +V  GGD     +RF I+ +LG+G F  VY V+E                          
Sbjct: 234 SVQSGGDF---KSRFEIIEELGKGRFGIVYKVQE------------------RGQPEQLL 272

Query: 373 AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV 552
           A K +    S+    V EEI +     HP LL L         A+  +S   E  ++   
Sbjct: 273 AAKVIKCIKSQDRQKVLEEISIMRALQHPKLLQL---------AASFES-PREIVMVMEY 322

Query: 553 HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH 732
              G LL    A      + +  D +   RQ+C G+ +MH    S  H D+KP N++  H
Sbjct: 323 ITGGELLQRVVA---DDFTLTEMDCILFLRQVCDGVAYMHG--QSVVHLDLKPENIMC-H 376

Query: 733 RKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDE 912
            +    + I+ DFG A+  R   ++    L          +  F  PE+    S+  I  
Sbjct: 377 TRTSHQIKII-DFGLAQ--RLDTKAPVRVL--------FGTPEFIPPEII---SYEPIGF 422

Query: 913 RTDIWSLGCTLYAIMYGVSPF 975
           ++D+WS+G   Y ++ G+SPF
Sbjct: 423 QSDMWSVGVICYVLLSGLSPF 443



>gb:AB009878_1193174 Tetrahymena pyriformis mRNA for NRK-related
            kinase, complete cds.
          Length = 561

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 68/307 (22%), Positives = 125/307 (40%), Gaps = 3/307 (0%)
 Frame = +1

Query: 235  FRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKV--LIQNSEQ 408
            F I+++LGEG F  VY VK                     SD   YAMKKV  +  ++++
Sbjct: 11   FEILKRLGEGSFGSVYQVKR-------------------KSDEKIYAMKKVKMISLSTKE 51

Query: 409  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
             ++   E+R+ +     N        VI+ K +          ++      G +L   T 
Sbjct: 52   KEMALNEVRILASIKSDN--------VISYKEAFYDDKSSTLCIIMDFAAKGDVLAQITD 103

Query: 589  MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD 768
             K +   F  + + +    +  GLK +H+ +    H D+K  NV +             +
Sbjct: 104  KKKRHSYFEENVIWKYAADMLLGLKSLHDMK--ILHRDMKGANVFIA------------E 149

Query: 769  FGSARPARKQIRSRSEALQLQEWASEHVSAPF-RAPELWDCPSHADIDERTDIWSLGCTL 945
             GS +     +      ++ +++A      P+  +PE+W+   +   D + D+WSLGC L
Sbjct: 150  DGSLKLGDLNVSK----VEKRDYAYTETGTPYYTSPEVWE---NRPYDSKCDVWSLGCVL 202

Query: 946  YAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVR 1125
            Y I     PF+   G S   L   ++    + P  L   +Y   L +F+   L+ +   R
Sbjct: 203  YEITTLEPPFK---GISMEDLYKKVLRGNFE-PINLQ--RYSSDLQKFIENCLKVEPRNR 256

Query: 1126 PHIDDIV 1146
              +++++
Sbjct: 257  SSVEELL 263



>gb:CR933642_1185671 Homo sapiens mRNA; cDNA DKFZp686D06121 (from
            clone DKFZp686D06121).
          Length = 1287

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 78/316 (24%), Positives = 124/316 (39%), Gaps = 5/316 (1%)
 Frame = +1

Query: 244  VRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQ--NSEQLDL 417
            ++++GEG F    LVK                      D   Y +K++ I   +S++ + 
Sbjct: 7    LQKIGEGSFGKAILVKS-------------------TEDGRQYVIKEINISRMSSKEREE 47

Query: 418  VKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKA 597
             + E+ V +   HPN+          V+  E        Y++      G L     A K 
Sbjct: 48   SRREVAVLANMKHPNI----------VQYRESFEENGSLYIVMDYCEGGDLFKRINAQKG 97

Query: 598  KKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGS 777
                F    +L  F Q+C  LKH+H  +    H D+K  N+ LT + G   L    DFG 
Sbjct: 98   VL--FQEDQILDWFVQICLALKHVH--DRKILHRDIKSQNIFLT-KDGTVQLG---DFGI 149

Query: 778  ARPARKQIRSRSEALQLQEWASEHVSAPFR-APELWDCPSHADIDERTDIWSLGCTLYAI 954
            AR     +          E A   +  P+  +PE+ +   +   + ++DIW+LGC LY +
Sbjct: 150  ARVLNSTV----------ELARTCIGTPYYLSPEICE---NKPYNNKSDIWALGCVLYEL 196

Query: 955  MYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHI 1134
                  FE     S  +L L I++     P  L    Y   L   V+ + +     RP +
Sbjct: 197  CTLKHAFE---AGSMKNLVLKIISGSFP-PVSL---HYSYDLRSLVSQLFKRNPRDRPSV 249

Query: 1135 DDIVI--HVDKLISKF 1176
            D I+    + K I KF
Sbjct: 250  DSILEKGFIAKRIEKF 265



>gb:AK054237_1170747 Mus musculus 2 days pregnant adult female oviduct
            cDNA, RIKEN full-length enriched library,
            clone:E230038G21 product:similar to MRNA, SIMILAR TO
            HUMAN HYPOTHETICAL PROTEIN FLJ23495, COMPLETE CDS [Macaca
            fascicularis], full insert sequence.
          Length = 365

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 76/307 (24%), Positives = 127/307 (41%), Gaps = 2/307 (0%)
 Frame = +1

Query: 232  RFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQL 411
            R+ + ++LG G F  VYLV +     AKPG   K              +K++ +      
Sbjct: 29   RYVLQQKLGSGSFGTVYLVSD---KKAKPGEELK-------------VLKEISVGELNPN 72

Query: 412  DLVKEEIRVSSLFSHPNLLPLLDH-AVIAVKASEGQSWKHEAYLLFPVHMDGTLLD-NAT 585
            + V+  +          LL  L H A++   AS     + E + +   + +G  LD    
Sbjct: 73   ETVQANVEAQ-------LLSRLHHPAIVRFHAS---FMEQETFCIITEYCEGRDLDYRIQ 122

Query: 586  AMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILM 765
              K   + F+ + +++ F QL  G+ +MH  E    H D+K  N+ L +      L  + 
Sbjct: 123  EYKEAGKVFAENQIVEWFIQLLLGVDYMH--ERRILHRDLKSKNIFLKNN-----LLKIG 175

Query: 766  DFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTL 945
            DFG +R     +   S  L      + H  +P       +   H   D ++DIWSL C  
Sbjct: 176  DFGVSR-----LLMGSCELATTLTGTPHYMSP-------EALKHQGYDAKSDIWSLAC-- 221

Query: 946  YAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVR 1125
              I+Y +   ++A     GS  L++V   V+  T     +YP  L+  +  ML    ++R
Sbjct: 222  --ILYEMCCLDHAF---AGSSFLSVVLNIVEGKTPSLPDRYPRELNTIMERMLNKSPSLR 276

Query: 1126 PHIDDIV 1146
            P   DI+
Sbjct: 277  PSAADIL 283



>gb:AK030042_1161799 Mus musculus adult male testis cDNA, RIKEN
            full-length enriched library, clone:4932416N14
            product:similar to MRNA, SIMILAR TO HUMAN HYPOTHETICAL
            PROTEIN FLJ23495, COMPLETE CDS [Macaca fascicularis],
            full insert sequence.
          Length = 628

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 76/307 (24%), Positives = 127/307 (41%), Gaps = 2/307 (0%)
 Frame = +1

Query: 232  RFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQL 411
            R+ + ++LG G F  VYLV +     AKPG   K              +K++ +      
Sbjct: 29   RYVLQQKLGSGSFGTVYLVSD---KKAKPGEELK-------------VLKEISVGELNPN 72

Query: 412  DLVKEEIRVSSLFSHPNLLPLLDH-AVIAVKASEGQSWKHEAYLLFPVHMDGTLLD-NAT 585
            + V+  +          LL  L H A++   AS     + E + +   + +G  LD    
Sbjct: 73   ETVQANVEAQ-------LLSRLHHPAIVRFHAS---FMEQETFCIITEYCEGRDLDYRIQ 122

Query: 586  AMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILM 765
              K   + F+ + +++ F QL  G+ +MH  E    H D+K  N+ L +      L  + 
Sbjct: 123  EYKEAGKVFAENQIVEWFIQLLLGVDYMH--ERRILHRDLKSKNIFLKNN-----LLKIG 175

Query: 766  DFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTL 945
            DFG +R     +   S  L      + H  +P       +   H   D ++DIWSL C  
Sbjct: 176  DFGVSR-----LLMGSCELATTLTGTPHYMSP-------EALKHQGYDAKSDIWSLAC-- 221

Query: 946  YAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVR 1125
              I+Y +   ++A     GS  L++V   V+  T     +YP  L+  +  ML    ++R
Sbjct: 222  --ILYEMCCLDHAF---AGSSFLSVVLNIVEGKTPSLPDRYPRELNTIMERMLNKSPSLR 276

Query: 1126 PHIDDIV 1146
            P   DI+
Sbjct: 277  PSAADIL 283



>gb:AF377950_505716 Myxococcus xanthus MglA (mglA), MglB (mglB),
            putative membrane protein, putative outermembrane
            lipoprotein, and MasK (masK) genes, complete cds.
          Length = 646

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 69/287 (24%), Positives = 129/287 (44%), Gaps = 7/287 (2%)
 Frame = +1

Query: 241  IVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLV 420
            +VR+L EGG A ++L K + AD  +  V  K   P              L  N + +++ 
Sbjct: 27   LVRKLAEGGMAEIFLAKLLGADGFERNVVIKRMLPH-------------LTNNPDFVEMF 73

Query: 421  KEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAK 600
            ++E R+++  +HPN++ + +     +  +EG       Y +   ++ G        +  +
Sbjct: 74   RDEARLAAKLAHPNIVQIQE-----LGFAEG------CYYICMEYLAGEDFSTTLRLAGR 122

Query: 601  KESFSTSDV-LQIFRQLCAGLKHMHNF-----EP-SYAHNDVKPGNVLLTHRKGQPPLAI 759
            K  +    V L++      GL   H F     +P +  H D+ P N+ LT++ GQ  +  
Sbjct: 123  KRHYVPLPVVLRVLIDAARGLHFAHEFTNEAGQPLNVVHRDISPSNLYLTYQ-GQVKV-- 179

Query: 760  LMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGC 939
             +DFG A+   + + +R+  ++ +          + APE        ++D R DI++LG 
Sbjct: 180  -LDFGIAKAESRLVNTRTGVVKGKYM--------YMAPEQ---ARGKEVDRRADIFALGV 227

Query: 940  TLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEAL 1080
            +LY  +  V PF     E+  ++  A++  ++K P  L  P  PE L
Sbjct: 228  SLYEALTHVRPFS---RENDLAVLNALLQGELKPPRELR-PDLPEEL 270



>gb:AE010186_260222 Pyrococcus furiosus DSM 3638, section 61 of 173 of
            the complete genome.>gb:AE009950_901003 Pyrococcus
            furiosus DSM 3638, complete genome.
          Length = 370

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 68/261 (26%), Positives = 113/261 (43%), Gaps = 2/261 (0%)
 Frame = +1

Query: 232  RFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQL 411
            ++R +  LGEGGFA VY V                       ++G     KV   N    
Sbjct: 92   KYRPLEVLGEGGFAEVYKVVR--------------------KNDGKIVAIKVPRINQGTS 131

Query: 412  DLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAM 591
             L  +E+ +    +HPN++ L D  ++ +   E +        +  V ++G ++ N    
Sbjct: 132  KLFIKEVSIWLHLNHPNIVRLYDADILPIPHLEME-------YVEGVKINGKIVRNLDEY 184

Query: 592  -KAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD 768
             K  +E  +    L+I + +  GLKH H+      H D+KP N+LLT R   P +    D
Sbjct: 185  PKPMREDIA----LKIIKGIAEGLKHAHS--RGIYHLDLKPLNILLT-RDLTPKIT---D 234

Query: 769  FGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLY 948
            +G A+ A   +R+ S ++          +  + APE      +  +DERTD+W +G   Y
Sbjct: 235  WGLAKIA---VRTFSGSIS-------GYTPLYAAPEQLAPSKYGGVDERTDVWQIGVIFY 284

Query: 949  AIMYGVSPFE-YALGESGGSL 1008
             ++ G  PF+ Y   E  G +
Sbjct: 285  ELLTGKLPFDGYTYEEIRGKI 305



>gb:CR861243_1185252 Pongo pygmaeus mRNA; cDNA DKFZp459H053 (from
           clone DKFZp459H053).
          Length = 802

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 57/210 (27%), Positives = 91/210 (43%)
 Frame = +1

Query: 349 HASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKH 528
           H   N  +A+K  +I    + +  KE   +     HPN++ L  H V   +         
Sbjct: 445 HKKSNQAFAVK--IISKRMEANTQKEITALKLCEGHPNIVKL--HEVFHDQL-------- 492

Query: 529 EAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVK 708
             +L+  +   G L +       KK+ FS ++   I R+L + + HMH+      H D+K
Sbjct: 493 HTFLVMELLNGGELFERIK----KKKHFSETEASYIMRKLVSAVSHMHDV--GVVHRDLK 546

Query: 709 PGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDC 888
           P N+L T       + I+ DFG ARP         +    Q   +   +  + APEL + 
Sbjct: 547 PENLLFTDENDNLEIKII-DFGFARP---------KPPDNQPLKTPCFTLHYAAPELLNQ 596

Query: 889 PSHADIDERTDIWSLGCTLYAIMYGVSPFE 978
             +   DE  D+WSLG  LY ++ G  PF+
Sbjct: 597 NGY---DESCDLWSLGVILYTMLSGQVPFQ 623



 Score = 41.2 bits (95), Expect = 0.055
 Identities = 63/294 (21%), Positives = 113/294 (38%), Gaps = 3/294 (1%)
 Frame = +1

Query: 235  FRIVRQLGEGGFAYVYLVKEILA-DPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQL 411
            F +++ LG G +  V+LV++I   D  K    K  K             K  ++Q ++  
Sbjct: 49   FELLKVLGTGAYGKVFLVRKISGHDTGKLYAMKVLK-------------KATIVQKAKTT 95

Query: 412  DLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAM 591
            +  + E +V     H    P L     A +         + +L+      G L  + +  
Sbjct: 96   EHTRTERQV---LEHTRQSPFLVTLHYAFQTET------KLHLILDYINGGELFTHLS-- 144

Query: 592  KAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDF 771
              ++E F+  +V     ++   L+H+H     Y   D+K  N+LL          +L DF
Sbjct: 145  --QRERFTEHEVQIYVGEIVLALEHLHKLGIIY--RDIKLENILLDSNGH----VMLTDF 196

Query: 772  GSARP--ARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTL 945
            G ++   A +  R+ S    ++  A + V               +  D+  D WSLG  +
Sbjct: 197  GLSKEFVADETERAYSFCGTIEYMAPDIVRG-----------GDSGHDKAVDWWSLGVLM 245

Query: 946  YAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQ 1107
            Y ++ G SPF    GE           A++      S+P YP+ +      ++Q
Sbjct: 246  YELLTGASPFTVD-GEKNS-------QAEISRRILKSEPPYPQEMSALAKDLIQ 291



>gb:BX294151_770622 Pirellula sp. strain 1 complete genome; segment
           19/24.
          Length = 1097

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 60/251 (23%), Positives = 110/251 (43%), Gaps = 1/251 (0%)
 Frame = +1

Query: 229 NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
           +R+ I   +GEGG   V++ ++    P +  V+ K             A K+ L + S  
Sbjct: 94  DRYSICELIGEGGMGSVFVAQQ--EQPVRRKVALKI-------IRAEIATKEALARFS-- 142

Query: 409 LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATA 588
                         +    L ++DH  IA     G +   + YL+  + + GT +     
Sbjct: 143 --------------AERQALAMMDHPCIAKVLDGGATESGQPYLVMEL-VQGTPITE--- 184

Query: 589 MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD 768
             A     S    L++F+++C  ++H H       H D+KP N+L+    G+  L  ++D
Sbjct: 185 -YASHSGLSIEQRLRLFQKVCHAVQHAH--RKGVIHRDLKPSNILVAEIDGE-ALPKVID 240

Query: 769 FGSARPARKQIRSRSEALQLQEWASEHVSAP-FRAPELWDCPSHADIDERTDIWSLGCTL 945
           FG A+   + +      + +    ++ +  P + +PE  +  +  DID R+D++SLG  L
Sbjct: 241 FGLAKALDQPLTD----ITIHTGFAQLMGTPMYMSPEQAEMGT-IDIDTRSDVYSLGVLL 295

Query: 946 YAIMYGVSPFE 978
           Y +M G  PF+
Sbjct: 296 YELMVGAPPFD 306



>gb:AE016822_339352 Leifsonia xyli subsp. xyli str. CTCB07, complete
            genome.
          Length = 565

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 68/250 (27%), Positives = 116/250 (46%), Gaps = 10/250 (4%)
 Frame = +1

Query: 421  KEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV--HMDGTLLDNATAMK 594
            ++E + ++  +HP ++ + D     V+ ++G    HEA L F V  ++DG LL +     
Sbjct: 58   RQEAQAAARMAHPTIVRVFDAGEETVRETDG----HEAQLPFMVMEYVDGVLLKDLI--- 110

Query: 595  AKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFG 774
             K  +  T + ++I   +   L++ H       H D+KPGNV++T + GQ  +   MDFG
Sbjct: 111  -KAGTLETEETVRITDGILTALEYSHR--AGVVHRDIKPGNVMIT-KSGQVKV---MDFG 163

Query: 775  SARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAI 954
             AR       S S A   Q  A    ++ F +PE     S   +D RTD++S G  L+ +
Sbjct: 164  IARAI-----SDSSATVAQTTAVLGTASYF-SPEQAKGES---VDARTDLYSTGVVLFEM 214

Query: 955  MYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWML--------QP 1110
            + G  PF    G++  ++    V+     P+ + +PK   A+   V   L        Q 
Sbjct: 215  LTGRPPFR---GDTPVAVAYQHVSETAVAPSTI-NPKVSPAMDDVVAHSLAKDRFERFQT 270

Query: 1111 QATVRPHIDD 1140
             A  R H+++
Sbjct: 271  VAEFRTHLEE 280



>sp|Q03145|EPA2_MOUSE Ephrin type-A receptor 2 precursor (EC
            2.7.1.112) (Tyrosine-protein kinase receptor ECK)
            (Epithelial cell kinase) (MPK-5)
            (SEK-2).>pir|S49004|S49004 tyrosine kinase Mpk-5 -
            mouse>gb:MMECK_2114783 M.musculus ECK mRNA.
          Length = 977

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 58/251 (23%), Positives = 107/251 (42%), Gaps = 4/251 (1%)
 Frame = +1

Query: 427  EIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKE 606
            E  +   FSH N++PL           EG   K++  ++   +M+   LD    ++ K  
Sbjct: 664  EASIMGQFSHHNIIPL-----------EGVVSKYKPMMIITEYMENGALDKF--LREKDG 710

Query: 607  SFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP 786
             FS   ++ + R + +G+K++ N   +Y H D+   N+L+        +  + DFG +R 
Sbjct: 711  EFSVLQLVGMLRGIASGMKYLANM--NYVHRDLAARNILVNSNL----VCKVSDFGLSRV 764

Query: 787  ARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCP---SHADIDERTDIWSLGCTLYAIM 957
                           +  + + ++  + P  W  P   S+      +D+WS G  ++ +M
Sbjct: 765  LE------------DDPEATYTTSGGKIPIRWTAPEAISYRKFTSASDVWSYGIVMWEVM 812

Query: 958  -YGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHI 1134
             YG  P+     E      +  +N   + PT +     P A++Q +    Q + + RP  
Sbjct: 813  TYGERPY----WELSNHEVMKAINDGFRLPTPMD---CPSAIYQLMMQCWQQERSRRPKF 865

Query: 1135 DDIVIHVDKLI 1167
             DIV  +DKLI
Sbjct: 866  ADIVSILDKLI 876



>gb:AC105363_1737956 Oryza sativa (japonica cultivar-group) chromosome
            3 clone OJ1705B08, complete sequence.
          Length = 606

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 70/282 (24%), Positives = 114/282 (40%), Gaps = 2/282 (0%)
 Frame = +1

Query: 235  FRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLD 414
            ++++ ++G G FA VYL   +        V+ K  DP    +                  
Sbjct: 29   YKLLEEIGVGSFAKVYLATHLRTGDV---VAVKEIDPRRIDERVRGG------------- 72

Query: 415  LVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMK 594
             + EE  + S  SHPN+L L+D            + + E   L   + +G  L+      
Sbjct: 73   -ILEEKAILSTLSHPNILRLID------------TIQEENLYLILEYCNGGDLEGYRTKG 119

Query: 595  AKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFG 774
             +      +      RQL  GLK +     S  H D+KP N+LL+   G      + DFG
Sbjct: 120  GEDARLPDATARDFMRQLAEGLKMLRG--RSIVHRDLKPQNLLLS-TNGDAITLKIGDFG 176

Query: 775  SARPARKQIRSRSEALQLQEWASEHVSAP-FRAPELWDCPSHADIDERTDIWSLGCTLYA 951
             AR           +L  +  A+    +P + APE+  C    D D + D+WS+G  L+ 
Sbjct: 177  FAR-----------SLVQENLAATMCGSPSYMAPEIMRC---EDYDAKADLWSVGVILFQ 222

Query: 952  IMYGVSPFEYALGESGGSLQLAIVNAQ-VKWPTGLSDPKYPE 1074
            ++ G  PF    G +   L+  I  +  VK+P  + D  +P+
Sbjct: 223  LVTGKLPF---YGANLFKLRQNIHESNGVKFPKEIKDDLHPD 261



>gb:AY143661_1583250 Glycine max phosphoenolpyruvate carboxylase
            kinase mRNA, complete cds.>gb:AY144180_1583506 Glycine
            max phosphoenolpyruvate carboxylase kinase (PPCK1) mRNA,
            complete cds.>gb:AY144181_1583507 Glycine max
            phosphoenolpyruvate carboxylase kinase (PPCK1) gene,
            complete cds.>gb:AY374445_1603478 Glycine max
            phosphoenolpyruvate-carboxylase kinase (PPCK1) gene,
            complete cds.
          Length = 282

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 71/286 (24%), Positives = 111/286 (38%), Gaps = 10/286 (3%)
 Frame = +1

Query: 220  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMK---KVL 390
            +    ++++ +LG G F  V+                      H + N  YA K   K  
Sbjct: 7    VKKEEYQVLEELGRGRFGTVFRC-------------------FHRTSNKFYAAKLIEKRR 47

Query: 391  IQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTL 570
            + N ++  +  E   +S L  HPN+L ++D    A   S          ++  +    TL
Sbjct: 48   LLNEDRRCIEMEAKAMSFLSPHPNILQIMDAFEDADSCS----------IVLELCQPHTL 97

Query: 571  LDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPP 750
            LD   A     E  + S    + +QL   + H H      AH D+KP N+L         
Sbjct: 98   LDRIAAQGPLTEPHAAS----LLKQLLEAVAHCH--AQGLAHRDIKPENILFDEGNKLK- 150

Query: 751  LAILMDFGSARPARKQIRSRSEALQLQEWASEH------VSAPFR-APELWDCPSHADID 909
               L DFGSA                 EW  E       V  P+  APE+       + D
Sbjct: 151  ---LSDFGSA-----------------EWLGEGSSMSGVVGTPYYVAPEVI---MGREYD 187

Query: 910  ERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPT 1047
            E+ D+WS G  LYA++ G  PF    GES   +  +++ A +++P+
Sbjct: 188  EKVDVWSSGVILYAMLAGFPPF---YGESAPEIFESVLRANLRFPS 230



>gb:D89663_1376521 Drosophila melanogaster mRNA for myosin light
           chain kinase isoform-II, partial cds.
          Length = 832

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 68/261 (26%), Positives = 107/261 (40%)
 Frame = +1

Query: 193 AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY 372
           +V  GGD     +RF I+ +LG+G F  VY V+E                          
Sbjct: 367 SVQSGGDF---KSRFEIIEELGKGRFGIVYKVQE------------------RGQPEQLL 405

Query: 373 AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV 552
           A K +    S+    V EEI +     HP LL L         A+  +S   E  ++   
Sbjct: 406 AAKVIKCIKSQDRQKVLEEISIMRALQHPKLLQL---------AASFES-PREIVMVMEY 455

Query: 553 HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH 732
              G L +   A      + +  D +   RQ+C G+ +MH    S  H D+KP N++  H
Sbjct: 456 ITGGELFERVVA---DDFTLTEMDCILFLRQVCDGVAYMHG--QSVVHLDLKPENIMC-H 509

Query: 733 RKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDE 912
            +    + I+ DFG A+  R   ++    L          +  F  PE+    S+  I  
Sbjct: 510 TRTSHQIKII-DFGLAQ--RLDTKAPVRVL--------FGTPEFIPPEII---SYEPIGF 555

Query: 913 RTDIWSLGCTLYAIMYGVSPF 975
           ++D+WS+G   Y ++ G+SPF
Sbjct: 556 QSDMWSVGVICYVLLSGLSPF 576



>gb:D89661_1376519 Drosophila melanogaster mRNA for myosin light
           chain kinase isoform-I, complete cds.
          Length = 929

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 68/261 (26%), Positives = 107/261 (40%)
 Frame = +1

Query: 193 AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY 372
           +V  GGD     +RF I+ +LG+G F  VY V+E                          
Sbjct: 283 SVQSGGDF---KSRFEIIEELGKGRFGIVYKVQE------------------RGQPEQLL 321

Query: 373 AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV 552
           A K +    S+    V EEI +     HP LL L         A+  +S   E  ++   
Sbjct: 322 AAKVIKCIKSQDRQKVLEEISIMRALQHPKLLQL---------AASFES-PREIVMVMEY 371

Query: 553 HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH 732
              G L +   A      + +  D +   RQ+C G+ +MH    S  H D+KP N++  H
Sbjct: 372 ITGGELFERVVA---DDFTLTEMDCILFLRQVCDGVAYMHG--QSVVHLDLKPENIMC-H 425

Query: 733 RKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDE 912
            +    + I+ DFG A+  R   ++    L          +  F  PE+    S+  I  
Sbjct: 426 TRTSHQIKII-DFGLAQ--RLDTKAPVRVL--------FGTPEFIPPEII---SYEPIGF 471

Query: 913 RTDIWSLGCTLYAIMYGVSPF 975
           ++D+WS+G   Y ++ G+SPF
Sbjct: 472 QSDMWSVGVICYVLLSGLSPF 492



>gb:AF255671_1256423 Drosophila melanogaster clone RTD3
           Stretchin-MLCK mRNA, complete cds.
          Length = 732

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 68/261 (26%), Positives = 107/261 (40%)
 Frame = +1

Query: 193 AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY 372
           +V  GGD     +RF I+ +LG+G F  VY V+E                          
Sbjct: 139 SVQSGGDF---KSRFEIIEELGKGRFGIVYKVQE------------------RCQPEQLL 177

Query: 373 AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV 552
           A K +    S+    V EEI +     HP LL L         A+  +S   E  ++   
Sbjct: 178 AAKVIKCIKSQDRQKVLEEISIMRALQHPKLLQL---------AASFES-PREIVMVMEY 227

Query: 553 HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH 732
              G L +   A      + +  D +   RQ+C G+ +MH    S  H D+KP N++  H
Sbjct: 228 ITGGELFERVVA---DDFTLTEMDCILFLRQVCDGVAYMHG--QSVVHLDLKPENIMC-H 281

Query: 733 RKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDE 912
            +    + I+ DFG A+  R   ++    L          +  F  PE+    S+  I  
Sbjct: 282 TRTSHQIKII-DFGLAQ--RLDTKAPVRVL--------FGTPEFIPPEII---SYEPIGF 327

Query: 913 RTDIWSLGCTLYAIMYGVSPF 975
           ++D+WS+G   Y ++ G+SPF
Sbjct: 328 QSDMWSVGVICYVLLSGLSPF 348



>gb:AF255670_1256422 Drosophila melanogaster clone RTD42
           Stretchin-MLCK mRNA, partial cds.
          Length = 786

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 68/261 (26%), Positives = 107/261 (40%)
 Frame = +1

Query: 193 AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY 372
           +V  GGD     +RF I+ +LG+G F  VY V+E                          
Sbjct: 140 SVQSGGDF---KSRFEIIEELGKGRFGIVYKVQE------------------RCQPEQLL 178

Query: 373 AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV 552
           A K +    S+    V EEI +     HP LL L         A+  +S   E  ++   
Sbjct: 179 AAKVIKCIKSQDRQKVLEEISIMRALQHPKLLQL---------AASFES-PREIVMVMEY 228

Query: 553 HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH 732
              G L +   A      + +  D +   RQ+C G+ +MH    S  H D+KP N++  H
Sbjct: 229 ITGGELFERVVA---DDFTLTEMDCILFLRQVCDGVAYMHG--QSVVHLDLKPENIMC-H 282

Query: 733 RKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDE 912
            +    + I+ DFG A+  R   ++    L          +  F  PE+    S+  I  
Sbjct: 283 TRTSHQIKII-DFGLAQ--RLDTKAPVRVL--------FGTPEFIPPEII---SYEPIGF 328

Query: 913 RTDIWSLGCTLYAIMYGVSPF 975
           ++D+WS+G   Y ++ G+SPF
Sbjct: 329 QSDMWSVGVICYVLLSGLSPF 349



>gb:AF255668_1256420 Drosophila melanogaster clone RTD6
           Stretchin-MLCK mRNA, partial cds.
          Length = 577

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 68/261 (26%), Positives = 107/261 (40%)
 Frame = +1

Query: 193 AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY 372
           +V  GGD     +RF I+ +LG+G F  VY V+E                          
Sbjct: 242 SVQSGGDF---KSRFEIIEELGKGRFGIVYKVQE------------------RCQPEQLL 280

Query: 373 AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV 552
           A K +    S+    V EEI +     HP LL L         A+  +S   E  ++   
Sbjct: 281 AAKVIKCIKSQDRQKVLEEISIMRALQHPKLLQL---------AASFES-PREIVMVMEY 330

Query: 553 HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH 732
              G L +   A      + +  D +   RQ+C G+ +MH    S  H D+KP N++  H
Sbjct: 331 ITGGELFERVVA---DDFTLTEMDCILFLRQVCDGVAYMHG--QSVVHLDLKPENIMC-H 384

Query: 733 RKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDE 912
            +    + I+ DFG A+  R   ++    L          +  F  PE+    S+  I  
Sbjct: 385 TRTSHQIKII-DFGLAQ--RLDTKAPVRVL--------FGTPEFIPPEII---SYEPIGF 430

Query: 913 RTDIWSLGCTLYAIMYGVSPF 975
           ++D+WS+G   Y ++ G+SPF
Sbjct: 431 QSDMWSVGVICYVLLSGLSPF 451



>gb:AF039037_1235258 Caenorhabditis elegans cosmid R02C2, complete
           sequence.
          Length = 316

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 67/256 (26%), Positives = 115/256 (44%), Gaps = 4/256 (1%)
 Frame = +1

Query: 226 DNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLI--QN 399
           D  + +++ LG+G F  V LV            ++++ +          A+K+++I  Q+
Sbjct: 22  DRPYEVLKPLGQGSFGQVALVS-----------NRRYPEM-------LAALKRIVITGQD 63

Query: 400 SEQLDLVKEEIRVS-SLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD 576
            E +D +++EI +  SL  H N++ +L       K S+ Q      Y+       G L +
Sbjct: 64  REYIDAIRKEITIQESLTGHENVIQVLG------KESDAQF----CYMFLEYADGGDLYE 113

Query: 577 NATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHR-KGQPPL 753
             T+      SFS  +    F+QL  GLK +H  +   AH D+KP N++LTH  K +   
Sbjct: 114 KITSGC----SFSLEEAHSYFKQLVNGLKFLHCRD--VAHRDIKPENLMLTHSGKSEMRH 167

Query: 754 AILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSL 933
             + DFG A       R +   L  ++      S  + APE++    +     + DIWS 
Sbjct: 168 LKIADFGLA----TWYRYKGAELIFEQRCG---SVEYVAPEIYTGAQYR--GPQIDIWSA 218

Query: 934 GCTLYAIMYGVSPFEY 981
           G  L A++    P+E+
Sbjct: 219 GVVLLAMLTRQLPWEF 234



>gb:CR857862_1182063 Pongo pygmaeus mRNA; cDNA DKFZp469A1729 (from
            clone DKFZp469A1729).
          Length = 234

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 58/197 (29%), Positives = 91/197 (46%), Gaps = 3/197 (1%)
 Frame = +1

Query: 610  FSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPA 789
            FS   +L  F Q+  GLKH+H  +    H D+K  N+ L+ + G   +A L DFG AR  
Sbjct: 21   FSEDQILGWFVQISLGLKHIH--DRKILHRDIKAQNIFLS-KNGM--VAKLGDFGIARVL 75

Query: 790  RKQIRSRSEALQLQEWASEHVSAPFR-APELWDCPSHADIDERTDIWSLGCTLYAIMYGV 966
               +          E A   +  P+  +PE+     +++   +TDIWSLGC LY +    
Sbjct: 76   NNSM----------ELARTCIGTPYYLSPEICQNKPYSN---KTDIWSLGCVLYELCTLK 122

Query: 967  SPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIV 1146
             PFE      G +LQ  ++         +S P++   LH  ++ + Q     RP I+ I+
Sbjct: 123  HPFE------GNNLQQLVLKICQAHFAPIS-PRFSRELHSLISQLFQVSPRDRPSINSIL 175

Query: 1147 IH--VDKLISKFSH*EV 1191
                ++ LI K+   EV
Sbjct: 176  KRPFLENLIPKYLTPEV 192



>gb:AE013599_1132090 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003808_1225544 Drosophila melanogaster
           chromosome 2R, section 42 of 74 of the complete
           sequence.
          Length = 785

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 68/261 (26%), Positives = 107/261 (40%)
 Frame = +1

Query: 193 AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY 372
           +V  GGD     +RF I+ +LG+G F  VY V+E                          
Sbjct: 139 SVQSGGDF---KSRFEIIEELGKGRFGIVYKVQE------------------RGQPEQLL 177

Query: 373 AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV 552
           A K +    S+    V EEI +     HP LL L         A+  +S   E  ++   
Sbjct: 178 AAKVIKCIKSQDRQKVLEEISIMRALQHPKLLQL---------AASFES-PREIVMVMEY 227

Query: 553 HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH 732
              G L +   A      + +  D +   RQ+C G+ +MH    S  H D+KP N++  H
Sbjct: 228 ITGGELFERVVA---DDFTLTEMDCILFLRQVCDGVAYMHG--QSVVHLDLKPENIMC-H 281

Query: 733 RKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDE 912
            +    + I+ DFG A+  R   ++    L          +  F  PE+    S+  I  
Sbjct: 282 TRTSHQIKII-DFGLAQ--RLDTKAPVRVL--------FGTPEFIPPEII---SYEPIGF 327

Query: 913 RTDIWSLGCTLYAIMYGVSPF 975
           ++D+WS+G   Y ++ G+SPF
Sbjct: 328 QSDMWSVGVICYVLLSGLSPF 348



>gb:AE013599_1132089 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003808_1225543 Drosophila melanogaster
           chromosome 2R, section 42 of 74 of the complete
           sequence.
          Length = 929

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 68/261 (26%), Positives = 107/261 (40%)
 Frame = +1

Query: 193 AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY 372
           +V  GGD     +RF I+ +LG+G F  VY V+E                          
Sbjct: 283 SVQSGGDF---KSRFEIIEELGKGRFGIVYKVQE------------------RGQPEQLL 321

Query: 373 AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV 552
           A K +    S+    V EEI +     HP LL L         A+  +S   E  ++   
Sbjct: 322 AAKVIKCIKSQDRQKVLEEISIMRALQHPKLLQL---------AASFES-PREIVMVMEY 371

Query: 553 HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH 732
              G L +   A      + +  D +   RQ+C G+ +MH    S  H D+KP N++  H
Sbjct: 372 ITGGELFERVVA---DDFTLTEMDCILFLRQVCDGVAYMHG--QSVVHLDLKPENIMC-H 425

Query: 733 RKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDE 912
            +    + I+ DFG A+  R   ++    L          +  F  PE+    S+  I  
Sbjct: 426 TRTSHQIKII-DFGLAQ--RLDTKAPVRVL--------FGTPEFIPPEII---SYEPIGF 471

Query: 913 RTDIWSLGCTLYAIMYGVSPF 975
           ++D+WS+G   Y ++ G+SPF
Sbjct: 472 QSDMWSVGVICYVLLSGLSPF 492



>gb:AE013599_1132088 Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE003808_1225542 Drosophila melanogaster
            chromosome 2R, section 42 of 74 of the complete sequence.
          Length = 1506

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 68/261 (26%), Positives = 107/261 (40%)
 Frame = +1

Query: 193  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY 372
            +V  GGD     +RF I+ +LG+G F  VY V+E                          
Sbjct: 860  SVQSGGDF---KSRFEIIEELGKGRFGIVYKVQE------------------RGQPEQLL 898

Query: 373  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV 552
            A K +    S+    V EEI +     HP LL L         A+  +S   E  ++   
Sbjct: 899  AAKVIKCIKSQDRQKVLEEISIMRALQHPKLLQL---------AASFES-PREIVMVMEY 948

Query: 553  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH 732
               G L +   A      + +  D +   RQ+C G+ +MH    S  H D+KP N++  H
Sbjct: 949  ITGGELFERVVA---DDFTLTEMDCILFLRQVCDGVAYMHG--QSVVHLDLKPENIMC-H 1002

Query: 733  RKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDE 912
             +    + I+ DFG A+  R   ++    L          +  F  PE+    S+  I  
Sbjct: 1003 TRTSHQIKII-DFGLAQ--RLDTKAPVRVL--------FGTPEFIPPEII---SYEPIGF 1048

Query: 913  RTDIWSLGCTLYAIMYGVSPF 975
            ++D+WS+G   Y ++ G+SPF
Sbjct: 1049 QSDMWSVGVICYVLLSGLSPF 1069



>gb:AE013599_1132087 Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE003808_1225541 Drosophila melanogaster
            chromosome 2R, section 42 of 74 of the complete sequence.
          Length = 4463

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 68/261 (26%), Positives = 107/261 (40%)
 Frame = +1

Query: 193  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY 372
            +V  GGD     +RF I+ +LG+G F  VY V+E                          
Sbjct: 3817 SVQSGGDF---KSRFEIIEELGKGRFGIVYKVQE------------------RGQPEQLL 3855

Query: 373  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV 552
            A K +    S+    V EEI +     HP LL L         A+  +S   E  ++   
Sbjct: 3856 AAKVIKCIKSQDRQKVLEEISIMRALQHPKLLQL---------AASFES-PREIVMVMEY 3905

Query: 553  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH 732
               G L +   A      + +  D +   RQ+C G+ +MH    S  H D+KP N++  H
Sbjct: 3906 ITGGELFERVVA---DDFTLTEMDCILFLRQVCDGVAYMHG--QSVVHLDLKPENIMC-H 3959

Query: 733  RKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDE 912
             +    + I+ DFG A+  R   ++    L          +  F  PE+    S+  I  
Sbjct: 3960 TRTSHQIKII-DFGLAQ--RLDTKAPVRVL--------FGTPEFIPPEII---SYEPIGF 4005

Query: 913  RTDIWSLGCTLYAIMYGVSPF 975
            ++D+WS+G   Y ++ G+SPF
Sbjct: 4006 QSDMWSVGVICYVLLSGLSPF 4026



>gb:AE013599_1132086 Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE003808_1225540 Drosophila melanogaster
            chromosome 2R, section 42 of 74 of the complete sequence.
          Length = 9270

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 68/261 (26%), Positives = 107/261 (40%)
 Frame = +1

Query: 193  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY 372
            +V  GGD     +RF I+ +LG+G F  VY V+E                          
Sbjct: 8624 SVQSGGDF---KSRFEIIEELGKGRFGIVYKVQE------------------RGQPEQLL 8662

Query: 373  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV 552
            A K +    S+    V EEI +     HP LL L         A+  +S   E  ++   
Sbjct: 8663 AAKVIKCIKSQDRQKVLEEISIMRALQHPKLLQL---------AASFES-PREIVMVMEY 8712

Query: 553  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH 732
               G L +   A      + +  D +   RQ+C G+ +MH    S  H D+KP N++  H
Sbjct: 8713 ITGGELFERVVA---DDFTLTEMDCILFLRQVCDGVAYMHG--QSVVHLDLKPENIMC-H 8766

Query: 733  RKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDE 912
             +    + I+ DFG A+  R   ++    L          +  F  PE+    S+  I  
Sbjct: 8767 TRTSHQIKII-DFGLAQ--RLDTKAPVRVL--------FGTPEFIPPEII---SYEPIGF 8812

Query: 913  RTDIWSLGCTLYAIMYGVSPF 975
            ++D+WS+G   Y ++ G+SPF
Sbjct: 8813 QSDMWSVGVICYVLLSGLSPF 8833



>pir|F88924|F88924 protein R02C2.2 [imported] - Caenorhabditis
           elegans
          Length = 484

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 67/256 (26%), Positives = 115/256 (44%), Gaps = 4/256 (1%)
 Frame = +1

Query: 226 DNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLI--QN 399
           D  + +++ LG+G F  V LV            ++++ +          A+K+++I  Q+
Sbjct: 22  DRPYEVLKPLGQGSFGQVALVS-----------NRRYPEM-------LAALKRIVITGQD 63

Query: 400 SEQLDLVKEEIRVS-SLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD 576
            E +D +++EI +  SL  H N++ +L       K S+ Q      Y+       G L +
Sbjct: 64  REYIDAIRKEITIQESLTGHENVIQVLG------KESDAQF----CYMFLEYADGGDLYE 113

Query: 577 NATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHR-KGQPPL 753
             T+      SFS  +    F+QL  GLK +H  +   AH D+KP N++LTH  K +   
Sbjct: 114 KITSGC----SFSLEEAHSYFKQLVNGLKFLHCRD--VAHRDIKPENLMLTHSGKSEMRH 167

Query: 754 AILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSL 933
             + DFG A       R +   L  ++      S  + APE++    +     + DIWS 
Sbjct: 168 LKIADFGLA----TWYRYKGAELIFEQRCG---SVEYVAPEIYTGAQYR--GPQIDIWSA 218

Query: 934 GCTLYAIMYGVSPFEY 981
           G  L A++    P+E+
Sbjct: 219 GVVLLAMLTRQLPWEF 234



>sp|Q64261|CDK6_MOUSE Cell division protein kinase 6 (EC 2.7.1.37)
            (Serine/threonine-protein kinase PLSTIRE)
            (CRK2).>gb:AK078973_1172540 Mus musculus adult male cecum
            cDNA, RIKEN full-length enriched library,
            clone:9130423C03 product:cyclin-dependent kinase 6, full
            insert sequence.>gb:AF132483_2055811 Mus musculus strain
            BALB/c cyclin-dependent kinase 6 (Cdk6) mRNA, complete
            cds.
          Length = 326

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 79/305 (25%), Positives = 134/305 (43%), Gaps = 15/305 (4%)
 Frame = +1

Query: 226  DNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY-AMKKVLIQNS 402
            D ++  V ++GEG +  V+  +++                    + G + A+K+V +Q S
Sbjct: 10   DQQYECVAEIGEGAYGKVFKARDL-------------------KNGGRFVALKRVRVQTS 50

Query: 403  EQ---LDLVKEE--IRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT 567
            E+   L  ++E   +R    F HPN++ L D  V  V  ++ ++   +  L+F  H+D  
Sbjct: 51   EEGMPLSTIREVAVLRHLETFEHPNVVRLFD--VCTVSRTDRET---KLTLVFE-HVDQD 104

Query: 568  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP 747
            L       K  +    T  +  +  QL  GL  +H+      H D+KP N+L+T   GQ 
Sbjct: 105  LTTYLD--KVPEPGVPTETIKDMMFQLLRGLDFLHSHR--VVHRDLKPQNILVT-SSGQI 159

Query: 748  PLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIW 927
             LA   DFG AR    Q+   S  + L  W        +RAPE+    S+A      D+W
Sbjct: 160  KLA---DFGLARIYSFQMALTSVVVTL--W--------YRAPEVLLQSSYA---TPVDLW 203

Query: 928  SLGCTLYAIMYGVSPF---EYALGESGGSLQLAIVNAQVKWPTGLSDP------KYPEAL 1080
            S+GC ++A M+   P       + + G  L +  +  +  WP  ++ P      K  + +
Sbjct: 204  SVGC-IFAEMFRRKPLFRGSSDVDQLGKILDIIGLPGEEDWPRDVALPRQAFHSKSAQPI 262

Query: 1081 HQFVT 1095
             +FVT
Sbjct: 263  EKFVT 267



>gb:BC045856_2549375 Danio rerio zgc:56006, mRNA (cDNA clone
           MGC:56006 IMAGE:3819766), complete cds.
          Length = 732

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 61/216 (28%), Positives = 95/216 (43%), Gaps = 12/216 (5%)
 Frame = +1

Query: 364 GTYAMKKVLIQNSEQLD----LVKEEIR-----VSSLF---SHPNLLPLLDHAVIAVKAS 507
           G+Y++ K  +Q S  +D    ++K+E R     V  L     HPN++ L D         
Sbjct: 423 GSYSVCKRCVQKSTGMDYAVKIIKKERRDPTEEVEILLRYGQHPNIITLKD------VFD 476

Query: 508 EGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPS 687
           +G+S     YL+  +   G LLD     K     FS  +   +   +   ++++H     
Sbjct: 477 DGRS----VYLVTELMKGGELLDKILRQKF----FSEREASAVLYTITKTVEYLH--AQG 526

Query: 688 YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR 867
             H D+KP N+L     G P    + DFG A    KQ+R+ +  L      +   +A F 
Sbjct: 527 VVHRDLKPSNILYVDESGNPESIRICDFGFA----KQLRAENGLLM-----TPCYTANFV 577

Query: 868 APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPF 975
           APE+     +   D   DIWSLG  LY ++ G +PF
Sbjct: 578 APEVLKKQGY---DAACDIWSLGVLLYTMLTGFTPF 610



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 67/282 (23%), Positives = 112/282 (39%)
 Frame = +1

Query: 232  RFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQL 411
            +F + + LG+G F  V+LVK+I    A                   YAMK +     +  
Sbjct: 58   QFELRKVLGQGSFGKVFLVKKISGPDA----------------GQLYAMKVLKKATLKVR 101

Query: 412  DLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAM 591
            D V+ ++         ++L  ++H  I VK       + + YL+      G L       
Sbjct: 102  DRVRTKM-------ERDILVEVNHPFI-VKLHYAFQTEGKLYLILDFLRGGDLFTRL--- 150

Query: 592  KAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDF 771
             +K+  F+  DV     +L   L H+H       + D+KP N+LL           L DF
Sbjct: 151  -SKEVMFTEEDVKFYLAELALALDHLHGL--GIIYRDLKPENILL----DDDGHIELTDF 203

Query: 772  GSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYA 951
            G    +++ I   ++A       S   +  + APE+ +   H    +  D WS G  ++ 
Sbjct: 204  GL---SKESIDHENKAY------SFCGTVEYMAPEVVNRRGHT---QSADWWSYGVLMFE 251

Query: 952  IMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEA 1077
            ++ G  PF+   G+        I+ A++  P  LS    PEA
Sbjct: 252  MLTGALPFQ---GKDRKETMTMILKAKLGMPQFLS----PEA 286



>gb:AE016819_1748695 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome VI, complete sequence.
          Length = 361

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 47/154 (30%), Positives = 72/154 (46%)
 Frame = +1

Query: 685  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPF 864
            S+   D++P  V+LT + G P   I+ D  +   +   + + +   +++     H S  +
Sbjct: 196  SFVLCDLRPSAVMLTPQ-GMP---IISDLSACVRSGYALANATRLARMRAVLDTHGSPMY 251

Query: 865  RAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWP 1044
             APEL     +A I    DIWSLGC  YA+MYG+SPFE      G  L+ A  +    +P
Sbjct: 252  LAPELCALEPNACILPPADIWSLGCICYALMYGISPFEREEQLHGTPLRQARASGLFSFP 311

Query: 1045 TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIV 1146
                +P Y   L   V   L  +   RP ID ++
Sbjct: 312  ---DNPVYSLQLLDIVRQCLAVKPDARPTIDSLM 342



>gb:TCU69958_1399927 Trypanosoma cruzi cdc2-related protein kinase 3
            (tcrk3) gene, complete cds.
          Length = 311

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 74/293 (25%), Positives = 128/293 (43%), Gaps = 6/293 (2%)
 Frame = +1

Query: 373  AMKKVLIQNSEQ--LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLF 546
            A+KKV +  +E+        E+ +     HPN++ LLD     V  ++G+      YL+F
Sbjct: 50   ALKKVRLDRTEEGIPQTALREVSILQEIHHPNVVNLLD-----VICTDGK-----LYLIF 99

Query: 547  PVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLL 726
              ++D    D   A++ +  +F+   + ++  QL  GL   H       H+D+KP N+L+
Sbjct: 100  E-YVD---YDLKKAIEKRGCTFTGVTLKKLVYQLLDGLFFCHRHR--IVHSDLKPANILI 153

Query: 727  THRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADI 906
            T       +  L DFG AR  +         + +  +  E V+  +RAPE+     H   
Sbjct: 154  T----SDNVLKLADFGLARTFQ---------IPMHTYTHEVVTLWYRAPEILLGEKH--Y 198

Query: 907  DERTDIWSLGCTLYAIMYGVSPF--EYALGESGGSLQL--AIVNAQVKWPTGLSDPKYPE 1074
                DIWS+GC    +  G   F  +  +G+     Q+    ++ +  WP   S P Y +
Sbjct: 199  TPAVDIWSVGCIFAELARGKVIFRGDSEIGQLFEIFQILGTPMDNEGSWPGVSSLPDYRD 258

Query: 1075 ALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFSH*EVRCRPKRHAHNYFAK 1233
                F  W  +P A V P +D   I +   + K+S  E     +   H++F++
Sbjct: 259  V---FPRWAGKPLAQVIPQLDSEAIDLISRMLKYSPAERISAKEALQHSWFSE 308



>gb:AE013599_1133332 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003458_1210631 Drosophila melanogaster
           chromosome 2R, section 66 of 74 of the complete
           sequence.>gb:AF027300_1234350 Drosophila melanogaster
           positive transcription elongation factor b small subunit
           mRNA, complete cds.>gb:AY118809_1300531 Drosophila
           melanogaster GH21935 full insert cDNA.
          Length = 404

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 69/250 (27%), Positives = 115/250 (46%), Gaps = 2/250 (0%)
 Frame = +1

Query: 229 NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ 408
           N++  V ++G+G F  V+  +E      K G +KKF            AMKKVL+ N ++
Sbjct: 48  NKYEKVAKIGQGTFGEVFKARE------KKG-NKKF-----------VAMKKVLMDNEKE 89

Query: 409 LDLVK--EEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNA 582
              +    EIR+  L  H N++ L++  +   KA+    ++   YL+F    D    D A
Sbjct: 90  GFPITALREIRILQLLKHENVVNLIE--ICRTKATATNGYRSTFYLVF----DFCEHDLA 143

Query: 583 TAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAIL 762
             +      FS  ++ ++ +QL  GL ++H+      H D+K  NVL+T    +  +  L
Sbjct: 144 GLLSNMNVKFSLGEIKKVMQQLLNGLYYIHS--NKILHRDMKAANVLIT----KHGILKL 197

Query: 763 MDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCT 942
            DFG AR A    ++ S+      + +  V+  +R PEL       +     D+W  GC 
Sbjct: 198 ADFGLAR-AFSIPKNESK----NRYTNRVVTLWYRPPEL--LLGDRNYGPPVDMWGAGC- 249

Query: 943 LYAIMYGVSP 972
           + A M+  SP
Sbjct: 250 IMAEMWTRSP 259



>gb:BA000033_711395 Staphylococcus aureus subsp. aureus MW2 DNA,
            complete genome, strain:MW2.>gb:BX571856_780642
            Staphylococcus aureus subsp. aureus strain MRSA252,
            complete genome.>gb:BX571857_783375 Staphylococcus aureus
            strain MSSA476, complete genome.
          Length = 664

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 72/295 (24%), Positives = 122/295 (41%), Gaps = 4/295 (1%)
 Frame = +1

Query: 220  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN 399
            I + R++IV +LG GG + VYL ++ + +  K  +   F  P                + 
Sbjct: 5    IINERYKIVDKLGGGGMSTVYLAEDTILN-IKVAIKAIFIPPR---------------EK 48

Query: 400  SEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDN 579
             E L   + E+  SS  SH N++ ++D              + + Y L   +++G  L  
Sbjct: 49   EETLKRFEREVHNSSQLSHQNIVSMID-----------VDEEDDCYYLVMEYIEGPTLSE 97

Query: 580  ATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAI 759
                       S    +    Q+  G+KH H+      H D+KP N+L+   K       
Sbjct: 98   YIESHGP---LSVDTAINFTNQILDGIKHAHDMR--IVHRDIKPQNILIDSNKTLK---- 148

Query: 760  LMDFGSARPARKQIRSRSEALQLQEWASEHV--SAPFRAPELWDCPSHADIDERTDIWSL 933
            + DFG A+       + SE    Q   + HV  +  + +PE          DE TDI+S+
Sbjct: 149  IFDFGIAK-------ALSETSLTQ---TNHVLGTVQYFSPEQ---AKGEATDECTDIYSI 195

Query: 934  GCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPK--YPEALHQFV 1092
            G  LY ++ G  PF    GE+  ++ +AI + Q   P   +D +   P++L   +
Sbjct: 196  GIVLYEMLVGEPPFN---GET--AVSIAIKHIQDSVPNVTTDVRKDIPQSLSNVI 245


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,595,734,657
Number of Sequences: 1806583
Number of extensions: 35340927
Number of successful extensions: 111586
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 97746
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 106269
length of database: 581,917,975
effective HSP length: 128
effective length of database: 350,675,351
effective search space used: 124139074254
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)