BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig746
         (635 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB022211_1514983 Arabidopsis thaliana genomic DNA, chromosome...    51   1e-05   
pir|T45739|T45739 transcription factor-like protein - Arabidopsi...    42   0.009   Arabidopsis thaliana [mouse-ear cress]
gb:AB107692_1526750 Nicotiana tabacum AGP4 mRNA for AG-motif bin...    40   0.043   
pir|T04593|T04593 hypothetical protein F23E13.130 - Arabidopsis ...    39   0.096   Arabidopsis thaliana [mouse-ear cress]
gb:AB107693_1526751 Nicotiana tabacum AGP5 mRNA for AG-motif bin...    37   0.28    
gb:AB015040_1512418 Microsporum ferrugineum gene for chitin synt...    37   0.28    
gb:AB107689_1526747 Nicotiana tabacum AGP1 mRNA for AG-motif bin...    35   0.81    
gb:AP006531_1862294 Oryza sativa (japonica cultivar-group) genom...    35   1.1     
gb:AJ630371_1812733 Candida glabrata ace2 gene for transcription...    34   2.4     
gb:CR380959_1653837 Candida glabrata strain CBS138 chromosome M ...    34   2.4     
gb:AB107691_1526749 Nicotiana tabacum AGP3 mRNA for AG-motif bin...    33   3.1     
gb:BX883042_2111372 Rattus norvegicus chromosome 20, major histo...    33   4.0     
gb:AY363618_1602756 Malus baccata putative TIR-NBS type R protei...    33   4.0     
gb:AY363616_1602754 Malus baccata putative TIR-NBS type R protei...    33   4.0     
gb:AY344225_1600931 Candida glabrata Epa5p (EPA5) and Epa4p (EPA...    33   5.3     
gb:AE016927_359683 Bacteroides thetaiotaomicron VPI-5482, sectio...    33   5.3     
sp|Q9Z0G7|Z297_MOUSE|Z297_MOUSE Zinc finger protein 297 (BING1 protein).>gb...    33   5.3     Mus musculus [mouse]
sp|O13547|CW14_YEAST|CW14_YEAST Covalently-linked cell wall protein 14 prec...    33   5.3     Saccharomyces cerevisiae [brewer's yeast]
gb:AK092426_1913703 Homo sapiens cDNA FLJ35107 fis, clone PLACE6...    32   6.9     
pir|T05297|T05297 hypothetical protein F26P21.10 - Arabidopsis t...    32   6.9     Arabidopsis thaliana [mouse-ear cress]


>gb:AB022211_1514983 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K1L20.>gb:AY136450_1581950 Arabidopsis
           thaliana GATA-binding transcription factor-like protein
           (At5g66320) mRNA, complete cds.>gb:BT010367_1640313
           Arabidopsis thaliana At5g66320 mRNA, complete cds.
          Length = 339

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 53/153 (34%), Positives = 62/153 (40%), Gaps = 17/153 (11%)
 Frame = +3

Query: 141 ECALKSSVRPEMAAKTAHPLGCLENELPAVGSCQXXXXXXXXXXXXXXXSNGFSXXXXXX 320
           + ALKSSVR EMA KT  P+     E  AV + Q                NGFS      
Sbjct: 3   QAALKSSVRKEMALKTTSPV---YEEFLAVTTAQ----------------NGFSVDDFSV 43

Query: 321 XXXXXXXXXXXXNSGSLVFVSVMPE-KRQEEAVGVN----------------FCIEEDFS 449
                        S   VF     + K Q E V V+                F   +DF 
Sbjct: 44  DDLLDL-------SNDDVFADEETDLKAQHEMVRVSSEEPNDDGDALRRSSDFSGCDDFG 96

Query: 450 CFPGGGLNAPADDLDSLEWLSHFVEEDSFSGYS 548
             P   L+ PADDL +LEWLSHFV EDSF+ YS
Sbjct: 97  SLPTSELSLPADDLANLEWLSHFV-EDSFTEYS 128



>pir|T45739|T45739 transcription factor-like protein - Arabidopsis
           thaliana>gb:ATF24M12_1549947 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F24M12.>gb:AY064048_1565986
           Arabidopsis thaliana putative transcription factor
           (At3g51080) mRNA, complete cds.>gb:AY117315_1579356
           Arabidopsis thaliana putative transcription factor
           (At3g51080) mRNA, complete cds.
          Length = 312

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 2/64 (3%)
 Frame = +3

Query: 441 DFSC--FPGGGLNAPADDLDSLEWLSHFVEEDSFSGYSLTYPARKLPPLPENKNRVQAEI 614
           DFS   F   GL+ P DD+  LEWLS+FV++ SF+ YS   P  K  P+    NR     
Sbjct: 72  DFSTADFHTSGLSVPMDDIAELEWLSNFVDDSSFTPYSA--PTNK--PVWLTGNRRHLVQ 127

Query: 615 PVRD 626
           PV++
Sbjct: 128 PVKE 131



>gb:AB107692_1526750 Nicotiana tabacum AGP4 mRNA for AG-motif
           binding protein-4, complete cds.
          Length = 326

 Score = 39.7 bits (91), Expect = 0.043
 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 2/43 (4%)
 Frame = +3

Query: 441 DFSCFPG--GGLNAPADDLDSLEWLSHFVEEDSFSGYSLTYPA 563
           +FSC     G L  P D+L++LEWLS FV +DS S +SL  PA
Sbjct: 88  NFSCMDSFSGELPVPVDELENLEWLSQFV-DDSTSEFSLLCPA 129



>pir|T04593|T04593 hypothetical protein F23E13.130 - Arabidopsis
           thaliana>gb:ATCHRIV85_1547584 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           85.>gb:ATF23E13_1549752 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F23E13 (ESSAII
           project).>gb:AY072434_1567251 Arabidopsis thaliana
           putative protein (At4g36240) mRNA, complete
           cds.>gb:AY114720_1578762 Arabidopsis thaliana putative
           protein (At4g36240) mRNA, complete cds.
          Length = 238

 Score = 38.5 bits (88), Expect = 0.096
 Identities = 21/34 (61%), Positives = 24/34 (70%)
 Frame = +3

Query: 438 EDFSCFPGGGLNAPADDLDSLEWLSHFVEEDSFS 539
           ED   FPG   +AP  DL+ LEWLS+FV EDSFS
Sbjct: 57  EDLLSFPG---DAPVGDLEDLEWLSNFV-EDSFS 86



>gb:AB107693_1526751 Nicotiana tabacum AGP5 mRNA for AG-motif
           binding protein-5, complete cds.
          Length = 342

 Score = 37.0 bits (84), Expect = 0.28
 Identities = 23/52 (44%), Positives = 29/52 (55%), Gaps = 1/52 (1%)
 Frame = +3

Query: 468 LNAPADDLDSLEWLSHFVEEDSFSGYSLTYPARKLPPLPE-NKNRVQAEIPV 620
           L+ P +D+  LEWLS FV EDSFSG  LT      P   E ++ + Q   PV
Sbjct: 71  LSVPYEDIVQLEWLSTFV-EDSFSGGGLTLGKENFPLYKETSEAKFQTSSPV 121



>gb:AB015040_1512418 Microsporum ferrugineum gene for chitin
           synthase 1, partial cds.
          Length = 206

 Score = 37.0 bits (84), Expect = 0.28
 Identities = 36/108 (33%), Positives = 49/108 (45%), Gaps = 19/108 (17%)
 Frame = -1

Query: 629 IVSDRNFGLNPVLVFRKRRQLSG------GVC*R-VAGKGVFFH------EMRQPFKAIQ 489
           IVSD    +NP    R R  L+G      G+  + V GK V  H      ++    K  Q
Sbjct: 48  IVSDGRGKINP----RTRAVLAGLGVYQDGIAKQQVNGKDVTAHIYEYTTQIGMEVKGTQ 103

Query: 488 IIRRSIEPAAGKTRKIFF------NTKINAHRFFLPLFRHNRDKHQRP 363
           +I   ++P  G   ++ F        KIN+HR+F PL  H R KH RP
Sbjct: 104 VI---LKPRPGMPVQLLFCLKEKNQKKINSHRWFFPLRPHPRPKHLRP 148



>gb:AB107689_1526747 Nicotiana tabacum AGP1 mRNA for AG-motif
           binding protein-1, complete cds.
          Length = 343

 Score = 35.4 bits (80), Expect = 0.81
 Identities = 23/52 (44%), Positives = 29/52 (55%), Gaps = 1/52 (1%)
 Frame = +3

Query: 468 LNAPADDLDSLEWLSHFVEEDSFSGYSLTYPARKLPPLPE-NKNRVQAEIPV 620
           L+ P +D+  LEWLS FV EDSFSG  LT      P   E ++ + Q   PV
Sbjct: 71  LSVPYEDIVQLEWLSAFV-EDSFSGGGLTLGKDNFPLNKETSEAKFQTSSPV 121



>gb:AP006531_1862294 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1417F08.
          Length = 186

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 20/46 (43%), Positives = 24/46 (52%)
 Frame = -2

Query: 541 PEKESSSTKCDSHSRLSKSSAGALSPPPGKQEKSSSIQKLTPTASS 404
           P   S S+ C   S  S  SAG L PPPG Q+  S    LTPT ++
Sbjct: 64  PSTPSPSSPCIHRSASSSCSAGLLPPPPGAQQAPS--PPLTPTPAA 107



>gb:AJ630371_1812733 Candida glabrata ace2 gene for transcription
           factor.
          Length = 703

 Score = 33.9 bits (76), Expect = 2.4
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 4/68 (5%)
 Frame = -2

Query: 553 VRE*PEKESSSTKCDSHSRL----SKSSAGALSPPPGKQEKSSSIQKLTPTASSCRFSGI 386
           V E P K+ S TK      +    + SS G + PPP +   ++  + +TP  S  RFS I
Sbjct: 202 VTESPSKQRSPTKYQGDDAIIVTKNSSSGGYVFPPPPRVTLNN--EAVTPPLSFSRFSNI 259

Query: 385 TETNTKDP 362
            +  + DP
Sbjct: 260 DQMESSDP 267



>gb:CR380959_1653837 Candida glabrata strain CBS138 chromosome M
           complete sequence.
          Length = 703

 Score = 33.9 bits (76), Expect = 2.4
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 4/68 (5%)
 Frame = -2

Query: 553 VRE*PEKESSSTKCDSHSRL----SKSSAGALSPPPGKQEKSSSIQKLTPTASSCRFSGI 386
           V E P K+ S TK      +    + SS G + PPP +   ++  + +TP  S  RFS I
Sbjct: 202 VTESPSKQRSPTKYQGDDAIIVTKNSSSGGYVFPPPPRVTLNN--EAVTPPLSFSRFSNI 259

Query: 385 TETNTKDP 362
            +  + DP
Sbjct: 260 DQMESSDP 267



>gb:AB107691_1526749 Nicotiana tabacum AGP3 mRNA for AG-motif
           binding protein-3, complete cds.
          Length = 256

 Score = 33.5 bits (75), Expect = 3.1
 Identities = 16/26 (61%), Positives = 20/26 (76%)
 Frame = +3

Query: 468 LNAPADDLDSLEWLSHFVEEDSFSGY 545
           L  P+DD+  LEWLS+FV EDSFS +
Sbjct: 76  LCVPSDDVAELEWLSNFV-EDSFSNF 100



>gb:BX883042_2111372 Rattus norvegicus chromosome 20, major
           histocompatibility complex, assembled from 40 BACs,
           strain Brown Norway (BN/ssNHsd), RT1n haplotype; segment
           1/11.
          Length = 636

 Score = 33.1 bits (74), Expect = 4.0
 Identities = 25/80 (31%), Positives = 34/80 (42%), Gaps = 1/80 (1%)
 Frame = +3

Query: 366 SLVFVSVMPEKRQEEAVGVNFC-IEEDFSCFPGGGLNAPADDLDSLEWLSHFVEEDSFSG 542
           S+  V  + E  ++    VNFC    DF  + GGG  A  DD              + S 
Sbjct: 358 SISDVRTLTEPAEKGEEQVNFCESSNDFGPYEGGGAGAGLDDPGG----------PTPSS 407

Query: 543 YSLTYPARKLPPLPENKNRV 602
           Y LT+P R L PL    N++
Sbjct: 408 YGLTHPPRPLLPLDVPGNQI 427



>gb:AY363618_1602756 Malus baccata putative TIR-NBS type R protein 4
           (R4) gene, complete cds.
          Length = 726

 Score = 33.1 bits (74), Expect = 4.0
 Identities = 18/60 (30%), Positives = 27/60 (45%)
 Frame = -2

Query: 541 PEKESSSTKCDSHSRLSKSSAGALSPPPGKQEKSSSIQKLTPTASSCRFSGITETNTKDP 362
           P+K S S  C   S  S SS+ + S P      SSS    + T+S    S  + +++  P
Sbjct: 56  PDKASFSNPCSPSSSSSSSSSSSASSPSSSTSSSSSASSASSTSSPSSSSSSSSSSSASP 115



>gb:AY363616_1602754 Malus baccata putative TIR-NBS type R protein 4
           (R4) mRNA, complete cds.
          Length = 726

 Score = 33.1 bits (74), Expect = 4.0
 Identities = 18/60 (30%), Positives = 27/60 (45%)
 Frame = -2

Query: 541 PEKESSSTKCDSHSRLSKSSAGALSPPPGKQEKSSSIQKLTPTASSCRFSGITETNTKDP 362
           P+K S S  C   S  S SS+ + S P      SSS    + T+S    S  + +++  P
Sbjct: 56  PDKASFSNPCSPSSSSSSSSSSSASSPSSSTSSSSSASSASSTSSPSSSSSSSSSSSASP 115



>gb:AY344225_1600931 Candida glabrata Epa5p (EPA5) and Epa4p (EPA4)
           genes, complete cds.
          Length = 1416

 Score = 32.7 bits (73), Expect = 5.3
 Identities = 21/111 (18%), Positives = 33/111 (29%)
 Frame = -2

Query: 529 SSSTKCDSHSRLSKSSAGALSPPPGKQEKSSSIQKLTPTASSCRFSGITETNTKDPEXXX 350
           SSS+   S S  S SS+ + SP       SSS    +P+ SS   S  + +++       
Sbjct: 356 SSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSS 415

Query: 349 XXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXX*QLPTAGNSFSKHPS 197
                                                   ++ +S S  PS
Sbjct: 416 SSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPS 466



>gb:AE016927_359683 Bacteroides thetaiotaomicron VPI-5482, section 2
           of 21 of the complete genome.>gb:AE015928_986171
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 429

 Score = 32.7 bits (73), Expect = 5.3
 Identities = 21/66 (31%), Positives = 36/66 (54%)
 Frame = -2

Query: 586 SGSGGSFRAGYVRE*PEKESSSTKCDSHSRLSKSSAGALSPPPGKQEKSSSIQKLTPTAS 407
           S S G++  G     P + SSS++  + S  ++SS+ + +  P    +SSS    +P++S
Sbjct: 337 SRSSGTYSRGSSSYTPSR-SSSSRTYTPSSSNRSSSSSRTYTPSSSSRSSSSSSYSPSSS 395

Query: 406 SCRFSG 389
           S R SG
Sbjct: 396 SSRSSG 401



>sp|Q9Z0G7|Z297_MOUSE Zinc finger protein 297 (BING1
           protein).>gb:AF100956_2054521 Mus musculus major
           histocompatibility locus class II region; Fas-binding
           protein Daxx (DAXX) gene, partial cds; Bing1 (BING1),
           tapasin (tapasin), RalGDS-like factor (RLF), KE2 (KE2),
           BING4 (BING4), beta1, 3-galactosyl transferase
           (beta1,3-galactosyl transferase), ribosomal protein
           subunit S18 (RPS18), Sacm21 (Sacm21), H2K1(b)
           (H2-K1(b)), RING1 (RING1), KE6a (KE6a), KE4 (KE4),
           RXRbeta (RXRbeta), collagen alpha-2 (XI) (COLA11A2),
           H2-O alpha (H2-Oalpha), RING3 (RING3), H2-M alpha (H2-M
           alpha), H2-M beta 2 (H2-M beta2), and H2-M beta1 (H2-M
           beta1) genes, complete cds; and LMP 2 gene, partial
           cds.>gb:BC026964_2095659 Mus musculus zinc finger
           protein 297, mRNA (cDNA clone MGC:30544 IMAGE:5043642),
           complete cds.>gb:BC052154_2100974 Mus musculus zinc
           finger protein 297, mRNA (cDNA clone MGC:59282
           IMAGE:6329405), complete cds.>gb:MMHC425O18_2115203 Mus
           musculus major histocompatibility complex region NG27,
           NG28, RPS28, NADH oxidoreductase, NG29, KIFC1,
           Fas-binding protein, BING1, tapasin, RalGDS-like, KE2,
           BING4, beta 1,3-galactosyl transferase, and RPS18 genes,
           complete cds; Sacm21 gene, partial cds; and unknown
           gene.
          Length = 638

 Score = 32.7 bits (73), Expect = 5.3
 Identities = 25/80 (31%), Positives = 34/80 (42%), Gaps = 1/80 (1%)
 Frame = +3

Query: 366 SLVFVSVMPEKRQEEAVGVNFC-IEEDFSCFPGGGLNAPADDLDSLEWLSHFVEEDSFSG 542
           S+  V  + E   +    VNFC    DF  + GGG  A  DD              + S 
Sbjct: 358 SISDVRTLTEPADKGEEQVNFCESSNDFGPYEGGGAGAGLDDPGG----------PTPSS 407

Query: 543 YSLTYPARKLPPLPENKNRV 602
           Y+LT+P R L PL    N++
Sbjct: 408 YALTHPPRPLLPLDVPGNQI 427



>sp|O13547|CW14_YEAST Covalently-linked cell wall protein 14
           precursor (Inner cell wall protein).>pir|S77699|S77699
           inner cell wall mannoprotein ICWP - yeast (Saccharomyces
           cerevisiae)>gb:YSCL8084_1729524 Saccharomyces cerevisiae
           chromosome XII cosmid 8084.
          Length = 238

 Score = 32.7 bits (73), Expect = 5.3
 Identities = 21/58 (36%), Positives = 28/58 (48%)
 Frame = -2

Query: 535 KESSSTKCDSHSRLSKSSAGALSPPPGKQEKSSSIQKLTPTASSCRFSGITETNTKDP 362
           K SSSTK  S S  S + A + S     +  SSS    +  ASS   S  + ++TK P
Sbjct: 106 KASSSTKASSSSASSSTKASSSSASSSTKASSSSAAPSSSKASSTESSSSSSSSTKAP 163



>gb:AK092426_1913703 Homo sapiens cDNA FLJ35107 fis, clone
           PLACE6006871, moderately similar to SUPPRESSOR PROTEIN
           SRP40.
          Length = 258

 Score = 32.3 bits (72), Expect = 6.9
 Identities = 23/116 (19%), Positives = 34/116 (29%), Gaps = 11/116 (9%)
 Frame = -2

Query: 529 SSSTKCDSHSRLSKSSAGALSPP-----------PGKQEKSSSIQKLTPTASSCRFSGIT 383
           SSS+   SHS  S SS+ + S P           P     SSS    +P++SS   S   
Sbjct: 70  SSSSPSSSHSSSSPSSSSSTSSPSSSSSSSSSSSPSSSNSSSSSSSSSPSSSSSSSSSSP 129

Query: 382 ETNTKDPEXXXXXXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXX*QLPTAGNS 215
            +++  P                                           P++ NS
Sbjct: 130 SSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSSSSPSSSSPSSSGSSPSSSNS 185



>pir|T05297|T05297 hypothetical protein F26P21.10 - Arabidopsis
           thaliana>gb:ATCHRIV78_1547209 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           78.>gb:ATF26P21_1550164 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F26P21 (ESSA
           project).>gb:BT008342_1639559 Arabidopsis thaliana
           At4g32890 mRNA, complete cds.>gb:AK117169_1815216
           Arabidopsis thaliana At4g32890 mRNA for unknown protein,
           complete cds, clone: RAFL16-71-E16.
          Length = 308

 Score = 32.3 bits (72), Expect = 6.9
 Identities = 16/25 (64%), Positives = 19/25 (76%)
 Frame = +3

Query: 468 LNAPADDLDSLEWLSHFVEEDSFSG 542
           L  P DD+  LEWLS+FVEE SF+G
Sbjct: 70  LYIPNDDIAELEWLSNFVEE-SFAG 93


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 567,997,000
Number of Sequences: 1806583
Number of extensions: 10341766
Number of successful extensions: 35979
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 32837
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 35080
length of database: 581,917,975
effective HSP length: 119
effective length of database: 366,934,598
effective search space used: 33757983016
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)