BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig658
         (541 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:U13643_1401834 Caenorhabditis elegans cosmid T07E3, complete ...    32   8.0     
pir|T16774|T16774 hypothetical protein SSSD1.1 - Caenorhabditis ...    32   8.0     Caenorhabditis elegans [roundworm]
pir|G88492|G88492 protein T07E3.4 [imported] - Caenorhabditis el...    32   8.0     Caenorhabditis elegans [roundworm]


>gb:U13643_1401834 Caenorhabditis elegans cosmid T07E3, complete
           sequence.
          Length = 354

 Score = 31.6 bits (70), Expect = 8.0
 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 5/51 (9%)
 Frame = -2

Query: 267 LQARGLNEKWRHHKGEKTVCALMPWVLTEKTRSQ-----RIFWVAKMMIKN 130
           L  +G+  +W  ++G+KT   ++PW      RS      R F + ++++KN
Sbjct: 67  LGKKGIEMRWVSYEGQKTKTTVVPWSTVRSPRSSFEFNFRRFAIQRILLKN 117



>pir|T16774|T16774 hypothetical protein SSSD1.1 - Caenorhabditis
           elegans
          Length = 599

 Score = 31.6 bits (70), Expect = 8.0
 Identities = 24/65 (36%), Positives = 37/65 (56%), Gaps = 1/65 (1%)
 Frame = +1

Query: 292 VPWKIKLQLMIFLKKL*QNLQYLVQKLGMLVPNLNLELHQKVVVALKRTYLVMLYQI-LK 468
           VP K ++QL+IF   + QN  +L+ +  +L+P   ++L           YLVML QI L+
Sbjct: 166 VPEKRQVQLLIFTFSIHQNHYHLISRYKLLLPE-EIQL-----------YLVMLSQILLQ 213

Query: 469 LAAIG 483
           LA +G
Sbjct: 214 LATLG 218



>pir|G88492|G88492 protein T07E3.4 [imported] - Caenorhabditis
           elegans>gb:U13643_1401833 Caenorhabditis elegans cosmid
           T07E3, complete sequence.
          Length = 427

 Score = 31.6 bits (70), Expect = 8.0
 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 5/51 (9%)
 Frame = -2

Query: 267 LQARGLNEKWRHHKGEKTVCALMPWVLTEKTRSQ-----RIFWVAKMMIKN 130
           L  +G+  +W  ++G+KT   ++PW      RS      R F + ++++KN
Sbjct: 140 LGKKGIEMRWVSYEGQKTKTTVVPWSTVRSPRSSFEFNFRRFAIQRILLKN 190


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 509,500,876
Number of Sequences: 1806583
Number of extensions: 8960937
Number of successful extensions: 21078
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 20702
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21072
length of database: 581,917,975
effective HSP length: 117
effective length of database: 370,547,764
effective search space used: 22973961368
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)