BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig604
         (857 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AC005168_1532249 Arabidopsis thaliana chromosome 2 clone F12C...   126   5e-28   
pir|T02655|T02655 hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4) -...   126   5e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AP001073_1820726 Oryza sativa (japonica cultivar-group) genom...   116   5e-25   
gb:BC025440_2094992 Mus musculus 3-hydroxy-3-methylglutaryl-Coen...   105   8e-22   
gb:AB083316_1871853 Macaca fascicularis hmgcl mRNA for 3-hydroxy...   104   2e-21   
sp|P97519|HMGL_RAT|HMGL_RAT Hydroxymethylglutaryl-CoA lyase, mitochondria...   104   2e-21   Rattus norvegicus [brown rat]
sp|P38060|HMGL_MOUSE|HMGL_MOUSE Hydroxymethylglutaryl-CoA lyase, mitochondr...   103   3e-21   Mus musculus [mouse]
gb:MMHMGCL9_2115330 Mus musculus 3-hydroxy-3-methylglutaryl-CoA ...   103   5e-21   
gb:CR859448_1183564 Pongo pygmaeus mRNA; cDNA DKFZp469I2412 (fro...   103   5e-21   
pir|A45470|A45470 hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4) -...   103   5e-21   Homo sapiens [man]
sp|P35914|HMGL_HUMAN|HMGL_HUMAN Hydroxymethylglutaryl-CoA lyase, mitochondr...   103   5e-21   Homo sapiens [man]
gb:HS886K2_1999704 Human DNA sequence from clone RP5-886K2 on ch...   102   1e-20   
gb:HS886K2_1999702 Human DNA sequence from clone RP5-886K2 on ch...   102   1e-20   
gb:HSHMGCL8_2014135 Human hydroxymethylglutaryl-CoA lyase (HMGCL...   100   4e-20   
gb:BC046023_2549533 Danio rerio zgc:56248, mRNA (cDNA clone MGC:...    99   1e-19   
gb:CR555306_108045 Azoarcus sp. EbN1 complete genome.                  97   3e-19   
sp|P35915|HMGL_CHICK|HMGL_CHICK Hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4...    97   4e-19   Gallus gallus [bantam]
gb:BC072247_2556501 Xenopus laevis hypothetical protein MGC82338...    96   9e-19   
gb:BC037381_2098037 Mus musculus 3-hydroxymethyl-3-methylglutary...    96   1e-18   
gb:AL590290_1929463 Human DNA sequence from clone RP11-228O6 on ...    96   1e-18   
gb:AK127587_1916813 Homo sapiens cDNA FLJ45682 fis, clone FCBBF3...    96   1e-18   
gb:AX643745_1471484 Sequence 4 from Patent WO02099093.                 96   1e-18   
gb:BX571965_790110 Burkholderia pseudomallei strain K96243, chro...    92   1e-17   
gb:AE013598_296604 Xanthomonas oryzae pv. oryzae KACC10331, comp...    91   3e-17   
gb:AE011818_276784 Xanthomonas axonopodis pv. citri str. 306, se...    91   3e-17   
gb:AF411956_2492678 Takifugu rubripes lck gene locus, partial se...    90   5e-17   
gb:CHKHYMEGLB_2569128 Chicken hydroxymethylglutaryl-CoA lyase mR...    90   6e-17   
gb:BX640423_808493 Bordetella parapertussis strain 12822, comple...    90   6e-17   
gb:BX640412_804997 Bordetella pertussis strain Tohama I, complet...    90   6e-17   
gb:AL646058_545189 Ralstonia solanacearum GMI1000 chromosome, co...    89   8e-17   
gb:AE012285_281077 Xanthomonas campestris pv. campestris str. AT...    88   2e-16   
gb:AL590290_1929464 Human DNA sequence from clone RP11-228O6 on ...    86   7e-16   
gb:AE016961_367756 Coxiella burnetii strain RSA 493, section 2 o...    86   7e-16   
pir|T46309|T46309 hypothetical protein DKFZp434G1411.1 - human (...    86   7e-16   Homo sapiens [man]
gb:CP000001_852898 Bacillus cereus ZK, complete genome.                86   1e-15   
gb:AE017272_423766 Bacillus cereus ATCC 10987, section 9 of 18 o...    86   1e-15   
gb:AE017032_382646 Bacillus anthracis str. Ames section 9 of 18 ...    86   1e-15   
gb:AE017006_377402 Bacillus cereus ATCC 14579 section 9 of 18 of...    86   1e-15   
gb:AE014134_1127935 Drosophila melanogaster chromosome 2L, compl...    85   2e-15   
gb:SCO939113_176452 Streptomyces coelicolor A3(2) complete genom...    85   2e-15   
gb:BA000030_703163 Streptomyces avermitilis MA-4680 genomic DNA,...    84   3e-15   
gb:AE017355_463632 Bacillus thuringiensis serovar konkukian str....    84   3e-15   
gb:AE016787_332955 Pseudomonas putida KT2440 section 14 of 21 of...    84   4e-15   
gb:RRU41280_167804 Rhodospirillum rubrum HMG-CoA lyase (hmgL) ge...    84   4e-15   
gb:AY658923_2147933 Synthetic construct Peudomonas aeruginosa cl...    83   8e-15   
gb:CR382128_1661276 Yarrowia lipolytica chromosome B of strain C...    83   8e-15   
pir|H83394|H83394 hydroxymethylglutaryl-CoA lyase PA2011 [import...    83   8e-15   Pseudomonas aeruginosa
gb:BA000032_709155 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    82   1e-14   
gb:AE016916_356720 Chromobacterium violaceum ATCC 12472 section ...    82   1e-14   
pir|T51021|T51021 related to hydroxymethylglutaryl-CoA lyase [im...    81   3e-14   Neurospora crassa
gb:AC025726_1205202 Caenorhabditis elegans cosmid Y71G12B, compl...    80   4e-14   
pir|H98298|H98298 hydroxymethylglutaryl-CoA lyase PA2011 [import...    80   6e-14   Agrobacterium tumefaciens
pir|AG2984|AG2984 hydroxymethylglutaryl-CoA lyase hmgL [imported...    80   6e-14   Agrobacterium tumefaciens
pir|H95929|H95929 probable hydroxymethylglutaryl-CoA lyase (EC 4...    79   1e-13   Sinorhizobium meliloti
gb:AE017333_447990 Bacillus licheniformis DSM 13, complete genom...    78   2e-13   
pir|AH3492|AH3492 hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4) [...    78   2e-13   Brucella melitensis
gb:AE017340_456640 Idiomarina loihiensis L2TR, complete genome.        77   3e-13   
gb:BA000043_738178 Geobacillus kaustophilus HTA426 DNA, complete...    77   4e-13   
gb:AE015632_316284 Shewanella oneidensis MR-1 section 181 of 457...    77   4e-13   
gb:AY484417_1608309 Emericella nidulans 3-hydroxy-3-methylglutar...    76   7e-13   
gb:AE016865_352155 Pseudomonas syringae pv. tomato str. DC3000 s...    76   7e-13   
gb:BAM576102_746892 Bacillus amyloliquefaciens partial genome, s...    76   9e-13   
gb:AE011269_271083 Leptospira interrogans serovar lai str. 56601...    76   9e-13   
gb:CR628336_111909 Legionella pneumophila str. Paris complete ge...    75   1e-12   
gb:CR628337_114997 Legionella pneumophila str. Lens complete gen...    75   2e-12   
gb:CP000031_86793 Silicibacter pomeroyi DSS-3, complete genome.        75   2e-12   
gb:BA000040_732682 Bradyrhizobium japonicum USDA 110 DNA, comple...    74   4e-12   
gb:BA000028_695730 Oceanobacillus iheyensis HTE831 DNA, complete...    74   4e-12   
gb:CR378678_97966 Photobacterium profundum SS9 chromosome 2; seg...    74   4e-12   
pir|F83791|F83791 hydroxymethylglutaryl-CoA lyase BH1134 [import...    74   5e-12   Bacillus halodurans
pir|D69893|D69893 hydroxymethylglutaryl-CoA lyase homolog yngG -...    73   8e-12   Bacillus subtilis
gb:BX572601_802153 Rhodopseudomonas palustris CGA009 complete ge...    72   1e-11   
gb:BX640439_813368 Bordetella bronchiseptica strain RB50, comple...    72   2e-11   
sp|P13703|HMGL_PSEMV|HMGL_PSEMV Hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4...    72   2e-11   Pseudomonas mevalonii
gb:BA000032_709669 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    70   4e-11   
gb:AE016809_338240 Vibrio vulnificus CMCP6 chromosome II section...    70   4e-11   
pir|B87307|B87307 3-hydroxy-3-methylglutarate-CoA lyase [importe...    70   4e-11   Caulobacter vibrioides
gb:BX640431_811047 Bordetella parapertussis strain 12822, comple...    69   9e-11   
gb:BX640424_808762 Bordetella parapertussis strain 12822, comple...    69   1e-10   
gb:BA000038_725137 Vibrio vulnificus YJ016 DNA, chromosome II, c...    69   1e-10   
gb:AF218939_489308 Bacillus subtilis FenH (fenH), FenI (fenI), F...    68   2e-10   
gb:BX640422_808080 Bordetella pertussis strain Tohama I, complet...    68   3e-10   
gb:BA000028_697617 Oceanobacillus iheyensis HTE831 DNA, complete...    67   6e-10   
gb:BX842656_826327 Bdellovibrio bacteriovorus complete genome, s...    66   1e-09   
gb:AP006627_562871 Bacillus clausii KSM-K16 DNA, complete genome.      64   5e-09   
gb:AE017343_1755260 Cryptococcus neoformans var. neoformans JEC2...    63   8e-09   
gb:BX640422_808230 Bordetella pertussis strain Tohama I, complet...    63   8e-09   
gb:AF173167_485467 Pseudomonas alcaligenes putative transposase,...    60   4e-08   
gb:BA000040_734624 Bradyrhizobium japonicum USDA 110 DNA, comple...    60   5e-08   
gb:CR543861_104650 Acinetobacter sp. ADP1 complete genome.             60   7e-08   
gb:AE017305_436796 Thermus thermophilus HB27 section 5 of 7 of t...    56   8e-07   
gb:AE017238_413899 Mycobacterium avium subsp. paratuberculosis s...    50   4e-05   
gb:BA000040_728958 Bradyrhizobium japonicum USDA 110 DNA, comple...    50   7e-05   
gb:AE016786_332812 Pseudomonas putida KT2440 section 13 of 21 of...    48   3e-04   
gb:AP006618_561070 Nocardia farcinica IFM 10152 DNA, complete ge...    42   0.020   
pir|T25031|T25031 hypothetical protein T20D3.3 - Caenorhabditis ...    38   0.22    Caenorhabditis elegans [roundworm]
pir|F88778|F88778 protein T20D3.3 [imported] - Caenorhabditis el...    38   0.22    Caenorhabditis elegans [roundworm]
gb:BX640438_813286 Bordetella bronchiseptica strain RB50, comple...    37   0.48    
gb:BX640424_808881 Bordetella parapertussis strain 12822, comple...    37   0.48    
gb:AY538390_1612429 Mitragyna rubrostipulata maturase K (matK) g...    35   1.4     
gb:AE017283_431191 Propionibacterium acnes KPA171202, complete g...    35   1.4     
gb:AF499596_2266583 Phthorimaea operculella granulovirus, comple...    35   2.4     
gb:AY042658_1560840 Suaeda vera maturase K (matK) gene, partial ...    35   2.4     
sp|Q8M9A9|MATK_MANZA|MATK_MANZA Maturase K (Intron maturase).>gb:MZA429295_...    35   2.4     Manilkara zapota [chicle]
sp|O04973|LU1A_LYCPN|LU1A_LYCPN 2-isopropylmalate synthase A (EC 2.3.3.13) ...    35   2.4     Solanum pennellii
gb:ACU61345_1745466 Arbutus canariensis ribosomal maturase (matK...    34   4.1     
gb:SPAPB1E7_1718665 S.pombe chromosome I BAC pB1E7.                    34   4.1     
gb:AY596500_1616765 Helicosporidium sp. ex Simulium jonesii plas...    34   4.1     
gb:AY596499_1616764 Helicosporidium sp. ex Simulium jonesii plas...    34   4.1     
pir|S45338|S45338 myb-related protein MIXTA - garden snapdragon>...    33   5.3     Antirrhinum majus [garden snapdragon]
gb:AK118569_1816538 Arabidopsis thaliana At1g74040 mRNA for puta...    33   9.1     
gb:AF440411_1800072 Arctostaphylos uva-ursi maturase K (matK) ge...    33   9.1     
gb:AC152123_1745202 Genomic sequence for broccoli [Brassica oler...    33   9.1     
pir|C96768|C96768 hypothetical protein F2P9.9 [imported] - Arabi...    33   9.1     Arabidopsis thaliana [mouse-ear cress]


>gb:AC005168_1532249 Arabidopsis thaliana chromosome 2 clone F12C20
           map B68, complete sequence.>gb:AF327420_1786789
           Arabidopsis thaliana putative hydroxymethylglutaryl-CoA
           lyase (At2g26800) mRNA, complete
           cds.>gb:AF349521_1790207 Arabidopsis thaliana putative
           hydroxymethylglutaryl-CoA lyase (At2g26800) mRNA,
           complete cds.
          Length = 468

 Score =  126 bits (317), Expect = 5e-28
 Identities = 85/202 (42%), Positives = 113/202 (55%), Gaps = 11/202 (5%)
 Frame = +3

Query: 282 LSCDPMLSHKAVRKFSRLRFGACSVFGNDILGSVPEMELQNFKGEQGKRFSSSKMDREED 461
           LS D + S   + +  R   GAC     D +G          +  +G+  ++S    ++D
Sbjct: 43  LSFDKLPSMSTMDRIQRFSSGACRP--RDDVG-------MGHRWIEGRDCTTSNSCIDDD 93

Query: 462 NG---RVYLWQRQTNRVSH------NPAFTRETS-VTGTTHNAFHMLHHCYSTQLNPRHG 611
                  + W+R T ++S       N +F   TS V+GT   +       YST  N    
Sbjct: 94  KSFAKESFPWRRHTRKLSEGEHMFRNISFAGRTSTVSGTLRESKSFKEQKYSTFSNENGT 153

Query: 612 VGL-NKVLGSLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVS 788
             + NK+   +P+FV+IVEVGPRDGLQNEK I+ TSVKVELIQ LVS+GL VVEATSFVS
Sbjct: 154 SHISNKISKGIPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIQRLVSSGLPVVEATSFVS 213

Query: 789 PKWVPQLADAXDVIQAIXNIAG 854
           PKWVPQLADA DV+ A+  + G
Sbjct: 214 PKWVPQLADAKDVMDAVNTLDG 235



>pir|T02655|T02655 hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4) -
           Arabidopsis thaliana>gb:AY128409_1580708 Arabidopsis
           thaliana putative hydroxymethylglutaryl-CoA lyase
           (At2g26800) mRNA, complete cds.>gb:BT000081_1634359
           Arabidopsis thaliana putative hydroxymethylglutaryl-CoA
           lyase (At2g26800) mRNA, complete cds.
          Length = 433

 Score =  126 bits (317), Expect = 5e-28
 Identities = 85/202 (42%), Positives = 113/202 (55%), Gaps = 11/202 (5%)
 Frame = +3

Query: 282 LSCDPMLSHKAVRKFSRLRFGACSVFGNDILGSVPEMELQNFKGEQGKRFSSSKMDREED 461
           LS D + S   + +  R   GAC     D +G          +  +G+  ++S    ++D
Sbjct: 8   LSFDKLPSMSTMDRIQRFSSGACRP--RDDVG-------MGHRWIEGRDCTTSNSCIDDD 58

Query: 462 NG---RVYLWQRQTNRVSH------NPAFTRETS-VTGTTHNAFHMLHHCYSTQLNPRHG 611
                  + W+R T ++S       N +F   TS V+GT   +       YST  N    
Sbjct: 59  KSFAKESFPWRRHTRKLSEGEHMFRNISFAGRTSTVSGTLRESKSFKEQKYSTFSNENGT 118

Query: 612 VGL-NKVLGSLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVS 788
             + NK+   +P+FV+IVEVGPRDGLQNEK I+ TSVKVELIQ LVS+GL VVEATSFVS
Sbjct: 119 SHISNKISKGIPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIQRLVSSGLPVVEATSFVS 178

Query: 789 PKWVPQLADAXDVIQAIXNIAG 854
           PKWVPQLADA DV+ A+  + G
Sbjct: 179 PKWVPQLADAKDVMDAVNTLDG 200



>gb:AP001073_1820726 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0667A10.
          Length = 419

 Score =  116 bits (291), Expect = 5e-25
 Identities = 66/143 (46%), Positives = 88/143 (61%), Gaps = 1/143 (0%)
 Frame = +3

Query: 432 SSSKMDREEDNGRVYLWQRQTNRVSHNPAFTRETSVTGTTHNAFHMLHHCYSTQLNPRHG 611
           SSS    EE+     ++QRQ            +   T     + +  ++ Y +  + +  
Sbjct: 44  SSSDNPAEENPCTRQIYQRQLMPHRFKLFLGEKRHFTYANGASLNPQNYRYFSSSSGQQS 103

Query: 612 VGL-NKVLGSLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVS 788
           +G+ NK++  LP  V+IVEVGPRDGLQNEK I+ T VK+ELIQ L ++GL VVEATSFVS
Sbjct: 104 IGIGNKIIHDLPRSVKIVEVGPRDGLQNEKNIVPTHVKIELIQRLATSGLSVVEATSFVS 163

Query: 789 PKWVPQLADAXDVIQAIXNIAGV 857
           PKWVPQLADA DV+  + NI GV
Sbjct: 164 PKWVPQLADAKDVMDVVRNIEGV 186



>gb:BC025440_2094992 Mus musculus
           3-hydroxy-3-methylglutaryl-Coenzyme A lyase, mRNA (cDNA
           clone MGC:29242 IMAGE:5049759), complete cds.
          Length = 325

 Score =  105 bits (263), Expect = 8e-22
 Identities = 54/93 (58%), Positives = 66/93 (70%), Gaps = 7/93 (7%)
 Frame = +3

Query: 600 PRHGVGLNKV-------LGSLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGL 758
           PR  VGL  +       +G+LP+ V+IVEVGPRDGLQNEK I+ T VK+ LI ML  AGL
Sbjct: 9   PRRLVGLTSLRAVSTSSMGTLPKQVKIVEVGPRDGLQNEKSIVPTPVKIRLIDMLSEAGL 68

Query: 759 EVVEATSFVSPKWVPQLADAXDVIQAIXNIAGV 857
            V+EATSFVSPKWVPQ+AD  DV++ I    G+
Sbjct: 69  PVIEATSFVSPKWVPQMADHSDVLKGIQKFPGI 101



>gb:AB083316_1871853 Macaca fascicularis hmgcl mRNA for
           3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase,
           complete cds.
          Length = 325

 Score =  104 bits (259), Expect = 2e-21
 Identities = 54/97 (55%), Positives = 69/97 (71%), Gaps = 7/97 (7%)
 Frame = +3

Query: 588 TQLNPRHGVGLNKV-------LGSLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLV 746
           T+  PR  VGL  +       + +LP+ V+IVEVGPRDGLQNEK I+ST VK++LI ML 
Sbjct: 5   TKALPRRLVGLASLRAVSTSSMDTLPKQVKIVEVGPRDGLQNEKNIVSTPVKIKLIDMLS 64

Query: 747 SAGLEVVEATSFVSPKWVPQLADAXDVIQAIXNIAGV 857
            AGL V+EATSFVSPKWVPQ+AD  +V++ I    G+
Sbjct: 65  EAGLSVIEATSFVSPKWVPQMADHAEVLKGIQKFPGI 101



>sp|P97519|HMGL_RAT Hydroxymethylglutaryl-CoA lyase, mitochondrial
           precursor (EC 4.1.3.4) (HMG-CoA lyase) (HL)
           (3-hydroxy-3-methylglutarate-CoA
           lyase).>gb:BC061797_2104658 Rattus norvegicus
           3-hydroxy-3-methylglutaryl-Coenzyme A lyase, mRNA (cDNA
           clone MGC:72427 IMAGE:5598033), complete
           cds.>gb:RN3H3MCL_2134310 R.norvegicus mRNA for
           3-hydroxy-3-methylglutaryl CoA lyase.
          Length = 325

 Score =  104 bits (259), Expect = 2e-21
 Identities = 49/76 (64%), Positives = 61/76 (80%)
 Frame = +3

Query: 630 LGSLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQL 809
           +G+LP+ V+IVEVGPRDGLQNEK I+ T VK++LI ML  AGL V+EATSFVSPKWVPQ+
Sbjct: 26  MGTLPKRVKIVEVGPRDGLQNEKSIVPTPVKIKLIDMLSEAGLPVIEATSFVSPKWVPQM 85

Query: 810 ADAXDVIQAIXNIAGV 857
           AD  DV++ I    G+
Sbjct: 86  ADHSDVLKGIQKFPGI 101



>sp|P38060|HMGL_MOUSE Hydroxymethylglutaryl-CoA lyase, mitochondrial
           precursor (EC 4.1.3.4) (HMG-CoA lyase) (HL)
           (3-hydroxy-3-methylglutarate-CoA
           lyase).>pir|I57009|I57009 3-Hydroxy-3-methylglutaryl
           coenzyme A lyase - mouse>gb:S65036_2138821
           Hmgcl=3-Hydroxy-3-methylglutaryl coenzyme A lyase [mice,
           liver, mRNA, 1420 nt].
          Length = 325

 Score =  103 bits (258), Expect = 3e-21
 Identities = 53/93 (56%), Positives = 65/93 (69%), Gaps = 7/93 (7%)
 Frame = +3

Query: 600 PRHGVGLNKV-------LGSLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGL 758
           PR  VGL  +       +G+LP+ V+IVEVGPRDGLQNEK I+ T VK+ LI ML  AGL
Sbjct: 9   PRRLVGLTSLRAVSTSSMGTLPKQVKIVEVGPRDGLQNEKSIVPTPVKIRLIDMLSEAGL 68

Query: 759 EVVEATSFVSPKWVPQLADAXDVIQAIXNIAGV 857
            V+EATSFVSP WVPQ+AD  DV++ I    G+
Sbjct: 69  PVIEATSFVSPNWVPQMADHSDVLKGIQKFPGI 101



>gb:MMHMGCL9_2115330 Mus musculus 3-hydroxy-3-methylglutaryl-CoA
           lyase (Hmgcl) gene, exon 9 and complete cds.
          Length = 325

 Score =  103 bits (256), Expect = 5e-21
 Identities = 52/93 (55%), Positives = 66/93 (70%), Gaps = 7/93 (7%)
 Frame = +3

Query: 600 PRHGVGLNKV-------LGSLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGL 758
           PR  VGL  +       +G+LP+ V+IVEVGPRDGLQNEK I+ T VK+ LI ++  AGL
Sbjct: 9   PRRLVGLTSLRAVSTSSMGTLPKQVKIVEVGPRDGLQNEKSIVPTPVKIRLIDIVSEAGL 68

Query: 759 EVVEATSFVSPKWVPQLADAXDVIQAIXNIAGV 857
            V+EATSFVSPKWVPQ+AD  DV++ I    G+
Sbjct: 69  PVIEATSFVSPKWVPQMADHSDVLKGIQKFPGI 101



>gb:CR859448_1183564 Pongo pygmaeus mRNA; cDNA DKFZp469I2412 (from
           clone DKFZp469I2412).
          Length = 325

 Score =  103 bits (256), Expect = 5e-21
 Identities = 52/93 (55%), Positives = 66/93 (70%), Gaps = 7/93 (7%)
 Frame = +3

Query: 600 PRHGVGLNKV-------LGSLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGL 758
           PR  VGL  +       +G+LP+ V+IVEVGPRDGLQNEK I+ST VK++LI ML  AGL
Sbjct: 9   PRRLVGLASLRAVSTSSMGTLPKRVKIVEVGPRDGLQNEKNIVSTPVKIKLIDMLSEAGL 68

Query: 759 EVVEATSFVSPKWVPQLADAXDVIQAIXNIAGV 857
            V+E TSFVSPKWVPQ+ D  +V++ I    G+
Sbjct: 69  SVIETTSFVSPKWVPQMGDHTEVLKGIQKFPGI 101



>pir|A45470|A45470 hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4) -
           human>gb:HUMHYMEGLA_2032303 Human
           hydroxymethylglutaryl-CoA lyase mRNA, complete cds.
          Length = 325

 Score =  103 bits (256), Expect = 5e-21
 Identities = 52/93 (55%), Positives = 66/93 (70%), Gaps = 7/93 (7%)
 Frame = +3

Query: 600 PRHGVGLNKV-------LGSLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGL 758
           PR  VGL  +       +G+LP+ V+IVEVGPRDGLQNEK I+ST VK++LI ML  AGL
Sbjct: 9   PRRLVGLASLRAVSTSSMGTLPKRVKIVEVGPRDGLQNEKNIVSTPVKIKLIDMLSEAGL 68

Query: 759 EVVEATSFVSPKWVPQLADAXDVIQAIXNIAGV 857
            V+E TSFVSPKWVPQ+ D  +V++ I    G+
Sbjct: 69  SVIETTSFVSPKWVPQMGDHTEVLKGIQKFPGI 101



>sp|P35914|HMGL_HUMAN Hydroxymethylglutaryl-CoA lyase, mitochondrial
           precursor (EC 4.1.3.4) (HMG-CoA lyase) (HL)
           (3-hydroxy-3-methylglutarate-CoA
           lyase).>gb:BC010570_1972701 Homo sapiens
           3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase
           (hydroxymethylglutaricaciduria), mRNA (cDNA clone
           MGC:17215 IMAGE:4178704), complete
           cds.>gb:BT009792_1990929 Homo sapiens
           3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase
           (hydroxymethylglutaricaciduria) mRNA, complete
           cds.>gb:CR456884_1993091 Homo sapiens full open reading
           frame cDNA clone RZPDo834H0718D for gene HMGCL,
           3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase
           (hydroxymethylglutaricaciduria); complete cds, incl.
           stopcodon.
          Length = 325

 Score =  103 bits (256), Expect = 5e-21
 Identities = 52/93 (55%), Positives = 66/93 (70%), Gaps = 7/93 (7%)
 Frame = +3

Query: 600 PRHGVGLNKV-------LGSLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGL 758
           PR  VGL  +       +G+LP+ V+IVEVGPRDGLQNEK I+ST VK++LI ML  AGL
Sbjct: 9   PRRLVGLASLRAVSTSSMGTLPKRVKIVEVGPRDGLQNEKNIVSTPVKIKLIDMLSEAGL 68

Query: 759 EVVEATSFVSPKWVPQLADAXDVIQAIXNIAGV 857
            V+E TSFVSPKWVPQ+ D  +V++ I    G+
Sbjct: 69  SVIETTSFVSPKWVPQMGDHTEVLKGIQKFPGI 101



>gb:HS886K2_1999704 Human DNA sequence from clone RP5-886K2 on
           chromosome 1p35.1-36.12 Contains a neuronal thread
           protein (AD7C-NTP) pseudogene, the TCEB3 gene for
           transcription elongation factor B (SIII), polypeptide 3
           (110kDa, elongin A), two novel genes, a novel gene
           (HT014), the LYPLA2 gene for lysophospholipase II, the
           GALE gene for UDP-galactose-4-epimerase and the HMGCL
           gene for 3-hydroxymethyl-3-methylglutaryl-Coenzyme A
           lyase (hydroxymethylglutaricaciduria), complete
           sequence.
          Length = 181

 Score =  102 bits (253), Expect = 1e-20
 Identities = 47/76 (61%), Positives = 60/76 (78%)
 Frame = +3

Query: 630 LGSLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQL 809
           +G+LP+ V+IVEVGPRDGLQNEK I+ST VK++LI ML  AGL V+E TSFVSPKWVPQ+
Sbjct: 1   MGTLPKRVKIVEVGPRDGLQNEKNIVSTPVKIKLIDMLSEAGLSVIETTSFVSPKWVPQM 60

Query: 810 ADAXDVIQAIXNIAGV 857
            D  +V++ I    G+
Sbjct: 61  GDHTEVLKGIQKFPGI 76



>gb:HS886K2_1999702 Human DNA sequence from clone RP5-886K2 on
           chromosome 1p35.1-36.12 Contains a neuronal thread
           protein (AD7C-NTP) pseudogene, the TCEB3 gene for
           transcription elongation factor B (SIII), polypeptide 3
           (110kDa, elongin A), two novel genes, a novel gene
           (HT014), the LYPLA2 gene for lysophospholipase II, the
           GALE gene for UDP-galactose-4-epimerase and the HMGCL
           gene for 3-hydroxymethyl-3-methylglutaryl-Coenzyme A
           lyase (hydroxymethylglutaricaciduria), complete
           sequence.
          Length = 300

 Score =  102 bits (253), Expect = 1e-20
 Identities = 47/76 (61%), Positives = 60/76 (78%)
 Frame = +3

Query: 630 LGSLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQL 809
           +G+LP+ V+IVEVGPRDGLQNEK I+ST VK++LI ML  AGL V+E TSFVSPKWVPQ+
Sbjct: 1   MGTLPKRVKIVEVGPRDGLQNEKNIVSTPVKIKLIDMLSEAGLSVIETTSFVSPKWVPQM 60

Query: 810 ADAXDVIQAIXNIAGV 857
            D  +V++ I    G+
Sbjct: 61  GDHTEVLKGIQKFPGI 76



>gb:HSHMGCL8_2014135 Human hydroxymethylglutaryl-CoA lyase (HMGCL)
           gene, exon 9 and partial cds.
          Length = 305

 Score =  100 bits (249), Expect = 4e-20
 Identities = 46/76 (60%), Positives = 60/76 (78%)
 Frame = +3

Query: 630 LGSLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQL 809
           +G+LP+ V+IVEVGP+DGLQNEK I+ST VK++LI ML  AGL V+E TSFVSPKWVPQ+
Sbjct: 6   MGTLPKRVKIVEVGPQDGLQNEKNIVSTPVKIKLIDMLSEAGLSVIETTSFVSPKWVPQM 65

Query: 810 ADAXDVIQAIXNIAGV 857
            D  +V++ I    G+
Sbjct: 66  GDHTEVLKGIQKFPGI 81



>gb:BC046023_2549533 Danio rerio zgc:56248, mRNA (cDNA clone
           MGC:56248 IMAGE:5601671), complete cds.
          Length = 340

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 48/74 (64%), Positives = 58/74 (78%)
 Frame = +3

Query: 636 SLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLAD 815
           +LPE V+IVEVGPRDGLQNEK I+ T VK+ LI ML  AGL V+EATSFVSPKWVPQ+AD
Sbjct: 43  ALPERVKIVEVGPRDGLQNEKTIVPTEVKIRLIDMLSEAGLPVIEATSFVSPKWVPQMAD 102

Query: 816 AXDVIQAIXNIAGV 857
             +V++ +    GV
Sbjct: 103 QEEVMRGLHKKPGV 116



>gb:CR555306_108045 Azoarcus sp. EbN1 complete genome.
          Length = 303

 Score = 97.4 bits (241), Expect = 3e-19
 Identities = 48/73 (65%), Positives = 56/73 (76%)
 Frame = +3

Query: 639 LPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADA 818
           LP  V+IVEVGPRDGLQNEK +++T  KVELI  L  AGL+ +EATSFVSPKWVPQ+ADA
Sbjct: 3   LPNAVKIVEVGPRDGLQNEKAVVATDTKVELIARLADAGLKAIEATSFVSPKWVPQMADA 62

Query: 819 XDVIQAIXNIAGV 857
             V+  I   AGV
Sbjct: 63  AFVMARIERRAGV 75



>sp|P35915|HMGL_CHICK Hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4)
           (HMG-CoA lyase) (HL) (3- hydroxy-3-methylglutarate-CoA
           lyase).>pir|B45470|B45470 hydroxymethylglutaryl-CoA
           lyase (EC 4.1.3.4) - chicken
          Length = 298

 Score = 97.1 bits (240), Expect = 4e-19
 Identities = 44/74 (59%), Positives = 57/74 (77%)
 Frame = +3

Query: 636 SLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLAD 815
           + P+ V++VEVGPRDGLQNEK ++ T VK+ LI ML   GL V+EATSFVSP+WVPQ+AD
Sbjct: 1   AFPQRVKVVEVGPRDGLQNEKSVVPTPVKIRLIDMLSETGLPVIEATSFVSPRWVPQMAD 60

Query: 816 AXDVIQAIXNIAGV 857
             +V+Q I  + GV
Sbjct: 61  HAEVMQGINKLPGV 74



>gb:BC072247_2556501 Xenopus laevis hypothetical protein MGC82338,
           mRNA (cDNA clone MGC:82338 IMAGE:4174429), complete cds.
          Length = 328

 Score = 95.9 bits (237), Expect = 9e-19
 Identities = 45/68 (66%), Positives = 55/68 (80%)
 Frame = +3

Query: 636 SLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLAD 815
           S P+ V+IVEVGPRDGLQNEK ++ T VK+ LI ML  AGL+ +EATSFVSPKWVPQ+AD
Sbjct: 31  SFPKEVKIVEVGPRDGLQNEKTVVPTDVKIHLINMLSEAGLQAIEATSFVSPKWVPQMAD 90

Query: 816 AXDVIQAI 839
             +V+Q I
Sbjct: 91  HKNVMQGI 98



>gb:BC037381_2098037 Mus musculus
           3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase-like
           1, mRNA (cDNA clone MGC:36512 IMAGE:5368383), complete
           cds.
          Length = 343

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 45/76 (59%), Positives = 56/76 (73%)
 Frame = +3

Query: 630 LGSLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQL 809
           L  LPE+V+IVEVGPRDGLQNEK I+ T +K+ELI  L   GL V+E TSFVS +WVPQ+
Sbjct: 41  LPGLPEYVKIVEVGPRDGLQNEKVIVPTDIKIELINQLSQTGLSVIEVTSFVSSRWVPQM 100

Query: 810 ADAXDVIQAIXNIAGV 857
           AD  +V++ I    GV
Sbjct: 101 ADHAEVMRGIRQYPGV 116



>gb:AL590290_1929463 Human DNA sequence from clone RP11-228O6 on
           chromosome 6, complete sequence.>gb:AL590406_1929554
           Human DNA sequence from clone RP11-418P12 on chromosome
           6, complete sequence.>gb:BC024194_1978266 Homo sapiens
           3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase-like
           1, mRNA (cDNA clone MGC:33395 IMAGE:4818781), complete
           cds.
          Length = 340

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 45/76 (59%), Positives = 55/76 (72%)
 Frame = +3

Query: 630 LGSLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQL 809
           L  LPEFV+IVEVGPRDGLQNEK I+ T +K+E I  L   GL V+E TSFVS +WVPQ+
Sbjct: 41  LSGLPEFVKIVEVGPRDGLQNEKVIVPTDIKIEFINRLSQTGLSVIEVTSFVSSRWVPQM 100

Query: 810 ADAXDVIQAIXNIAGV 857
           AD  +V++ I    GV
Sbjct: 101 ADHTEVMKGIHQYPGV 116



>gb:AK127587_1916813 Homo sapiens cDNA FLJ45682 fis, clone
           FCBBF3001018, moderately similar to
           Hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4).
          Length = 297

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 45/76 (59%), Positives = 55/76 (72%)
 Frame = +3

Query: 630 LGSLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQL 809
           L  LPEFV+IVEVGPRDGLQNEK I+ T +K+E I  L   GL V+E TSFVS +WVPQ+
Sbjct: 71  LSGLPEFVKIVEVGPRDGLQNEKVIVPTDIKIEFINRLSQTGLSVIEVTSFVSSRWVPQM 130

Query: 810 ADAXDVIQAIXNIAGV 857
           AD  +V++ I    GV
Sbjct: 131 ADHTEVMKGIHQYPGV 146



>gb:AX643745_1471484 Sequence 4 from Patent WO02099093.
          Length = 355

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 45/76 (59%), Positives = 55/76 (72%)
 Frame = +3

Query: 630 LGSLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQL 809
           L  LPEFV+IVEVGPRDGLQNEK I+ T +K+E I  L   GL V+E TSFVS +WVPQ+
Sbjct: 56  LSGLPEFVKIVEVGPRDGLQNEKVIVPTDIKIEFINRLSQTGLSVIEVTSFVSSRWVPQM 115

Query: 810 ADAXDVIQAIXNIAGV 857
           AD  +V++ I    GV
Sbjct: 116 ADHTEVMKGIHQYPGV 131



>gb:BX571965_790110 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.
          Length = 311

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 44/73 (60%), Positives = 53/73 (72%)
 Frame = +3

Query: 636 SLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLAD 815
           +LP+ V+IVEVGPRDGLQNE+  + T VK+EL+  L  AG   VEA SFVSPKWVPQ+AD
Sbjct: 2   TLPQSVKIVEVGPRDGLQNEQTFVPTGVKIELVNRLSQAGFRNVEAASFVSPKWVPQMAD 61

Query: 816 AXDVIQAIXNIAG 854
             DV+  I   AG
Sbjct: 62  GADVMAGIARRAG 74



>gb:AE013598_296604 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 339

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 43/73 (58%), Positives = 54/73 (73%)
 Frame = +3

Query: 639 LPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADA 818
           + +FVRIVEVGPRDGLQNE   I+T+ K+ LI  L + GL  +EATSFVSP+WVPQLADA
Sbjct: 1   MSDFVRIVEVGPRDGLQNEARPIATADKIALIDQLSATGLRTIEATSFVSPRWVPQLADA 60

Query: 819 XDVIQAIXNIAGV 857
            +V+  I    G+
Sbjct: 61  AEVLAGITQAPGI 73



>gb:AE011818_276784 Xanthomonas axonopodis pv. citri str. 306,
           section 196 of 469 of the complete
           genome.>gb:AE008923_918559 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 298

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 43/73 (58%), Positives = 54/73 (73%)
 Frame = +3

Query: 639 LPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADA 818
           + +FVRIVEVGPRDGLQNE + I+T+ K+ LI  L + GL  +EATSFVSP+WVPQLADA
Sbjct: 1   MSDFVRIVEVGPRDGLQNEAQPIATADKIALIDQLSATGLRTIEATSFVSPRWVPQLADA 60

Query: 819 XDVIQAIXNIAGV 857
            +V   I    G+
Sbjct: 61  AEVFAGIAQAPGI 73



>gb:AF411956_2492678 Takifugu rubripes lck gene locus, partial
           sequence.
          Length = 325

 Score = 90.1 bits (222), Expect = 5e-17
 Identities = 43/69 (62%), Positives = 53/69 (76%)
 Frame = +3

Query: 651 VRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXDVI 830
           V+IVEVGPRDGLQNEK I+    K+ LI ML ++GL V+EATSFVSPKWVPQ+AD  +V+
Sbjct: 33  VKIVEVGPRDGLQNEKTIVPLETKIHLIDMLSASGLPVIEATSFVSPKWVPQMADQVEVM 92

Query: 831 QAIXNIAGV 857
           + I    GV
Sbjct: 93  KGISRKPGV 101



>gb:CHKHYMEGLB_2569128 Chicken hydroxymethylglutaryl-CoA lyase mRNA,
           3' end.
          Length = 292

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 41/66 (62%), Positives = 51/66 (77%)
 Frame = +3

Query: 660 VEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXDVIQAI 839
           +EVGPRDGLQNEK ++ T VK+ LI ML   GL V+EATSFVSP+WVPQ+AD  +V+Q I
Sbjct: 3   LEVGPRDGLQNEKSVVPTPVKIRLIDMLSETGLPVIEATSFVSPRWVPQMADHAEVMQGI 62

Query: 840 XNIAGV 857
             + GV
Sbjct: 63  NKLPGV 68



>gb:BX640423_808493 Bordetella parapertussis strain 12822, complete
           genome; segment 1/14.
          Length = 302

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 44/73 (60%), Positives = 53/73 (72%)
 Frame = +3

Query: 636 SLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLAD 815
           S P  V+IVEV PRDGLQNEKE I+T +KVEL+  L +AG + VEA SFVSPKWVPQ+AD
Sbjct: 2   SQPSRVKIVEVSPRDGLQNEKEFIATDIKVELVDRLSAAGFQNVEAASFVSPKWVPQMAD 61

Query: 816 AXDVIQAIXNIAG 854
             +V+  I    G
Sbjct: 62  GAEVMARIARRPG 74



>gb:BX640412_804997 Bordetella pertussis strain Tohama I, complete
           genome; segment 2/12.>gb:BX640437_812895 Bordetella
           bronchiseptica strain RB50, complete genome; segment
           1/16.
          Length = 302

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 44/73 (60%), Positives = 53/73 (72%)
 Frame = +3

Query: 636 SLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLAD 815
           S P  V+IVEV PRDGLQNEKE I+T +KVEL+  L +AG + VEA SFVSPKWVPQ+AD
Sbjct: 2   SQPSRVKIVEVSPRDGLQNEKEFIATDIKVELVDRLSAAGFQNVEAASFVSPKWVPQMAD 61

Query: 816 AXDVIQAIXNIAG 854
             +V+  I    G
Sbjct: 62  GAEVMARIARRPG 74



>gb:AL646058_545189 Ralstonia solanacearum GMI1000 chromosome,
           complete sequence; segment 2/19.
          Length = 309

 Score = 89.4 bits (220), Expect = 8e-17
 Identities = 43/73 (58%), Positives = 51/73 (69%)
 Frame = +3

Query: 636 SLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLAD 815
           + P FV++VEVGPRDGLQNEK  +ST  KVEL+  L  AG   VEA SFVSP+WVPQ+AD
Sbjct: 2   TFPHFVKVVEVGPRDGLQNEKSPVSTEAKVELVNRLSDAGFVNVEAASFVSPRWVPQMAD 61

Query: 816 AXDVIQAIXNIAG 854
             DV+  I    G
Sbjct: 62  GADVMARIQRRPG 74



>gb:AE012285_281077 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 193 of 460 of the complete
           genome.>gb:AE008922_914359 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 298

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 42/73 (57%), Positives = 53/73 (72%)
 Frame = +3

Query: 639 LPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADA 818
           + +FVRIVEVGPRDGLQNE   I+++ K+ LI  L + GL  +EATSFVSP+WVPQLADA
Sbjct: 1   MSDFVRIVEVGPRDGLQNEANPIASADKIALINQLSATGLRTIEATSFVSPRWVPQLADA 60

Query: 819 XDVIQAIXNIAGV 857
            +V   I    G+
Sbjct: 61  AEVFAGITRQPGI 73



>gb:AL590290_1929464 Human DNA sequence from clone RP11-228O6 on
           chromosome 6, complete sequence.>gb:AL590406_1929556
           Human DNA sequence from clone RP11-418P12 on chromosome
           6, complete sequence.>gb:HSM802362_2017470 Homo sapiens
           mRNA; cDNA DKFZp434G1411 (from clone DKFZp434G1411);
           partial cds.
          Length = 157

 Score = 86.3 bits (212), Expect = 7e-16
 Identities = 40/61 (65%), Positives = 47/61 (77%)
 Frame = +3

Query: 630 LGSLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQL 809
           L  LPEFV+IVEVGPRDGLQNEK I+ T +K+E I  L   GL V+E TSFVS +WVPQ+
Sbjct: 47  LSGLPEFVKIVEVGPRDGLQNEKVIVPTDIKIEFINRLSQTGLSVIEVTSFVSSRWVPQV 106

Query: 810 A 812
           A
Sbjct: 107 A 107



>gb:AE016961_367756 Coxiella burnetii strain RSA 493, section 2 of 7
           of the complete genome.>gb:AE016828_1008492 Coxiella
           burnetii strain RSA 493, complete genome.
          Length = 303

 Score = 86.3 bits (212), Expect = 7e-16
 Identities = 40/67 (59%), Positives = 52/67 (77%)
 Frame = +3

Query: 639 LPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADA 818
           LP+ V +VEVGPRDGLQNE + + T +K+E I  L  +GL V+EATSFVSPKWVPQ+AD 
Sbjct: 7   LPKKVTLVEVGPRDGLQNEPQNVPTHLKIEFINQLSQSGLSVIEATSFVSPKWVPQMADH 66

Query: 819 XDVIQAI 839
            +V++ I
Sbjct: 67  REVMEGI 73



>pir|T46309|T46309 hypothetical protein DKFZp434G1411.1 - human
           (fragment)
          Length = 157

 Score = 86.3 bits (212), Expect = 7e-16
 Identities = 40/61 (65%), Positives = 47/61 (77%)
 Frame = +3

Query: 630 LGSLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQL 809
           L  LPEFV+IVEVGPRDGLQNEK I+ T +K+E I  L   GL V+E TSFVS +WVPQ+
Sbjct: 47  LSGLPEFVKIVEVGPRDGLQNEKVIVPTDIKIEFINRLSQTGLSVIEVTSFVSSRWVPQV 106

Query: 810 A 812
           A
Sbjct: 107 A 107



>gb:CP000001_852898 Bacillus cereus ZK, complete genome.
          Length = 303

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 42/67 (62%), Positives = 48/67 (71%)
 Frame = +3

Query: 639 LPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADA 818
           LP F  I EVGPRDGLQNEK+I+ T  KV+ IQ+L  AGL  VE +SFV PKWVP LADA
Sbjct: 3   LPNFAVIKEVGPRDGLQNEKKIVGTKDKVKWIQLLTEAGLSYVEVSSFVHPKWVPALADA 62

Query: 819 XDVIQAI 839
            DV   +
Sbjct: 63  NDVFSEL 69



>gb:AE017272_423766 Bacillus cereus ATCC 10987, section 9 of 18 of
           the complete genome.>gb:AE017194_1062185 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 303

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 42/67 (62%), Positives = 48/67 (71%)
 Frame = +3

Query: 639 LPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADA 818
           LP F  I EVGPRDGLQNEK+I+ T  KV+ IQ+L  AGL  VE +SFV PKWVP LADA
Sbjct: 3   LPNFAVIKEVGPRDGLQNEKKIVGTKDKVKWIQLLTEAGLSYVEVSSFVHPKWVPALADA 62

Query: 819 XDVIQAI 839
            DV   +
Sbjct: 63  NDVFSEL 69



>gb:AE017032_382646 Bacillus anthracis str. Ames section 9 of 18 of
           the complete genome.>gb:AE017225_407760 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_452494 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE016879_1012351 Bacillus
           anthracis str. Ames complete genome.
          Length = 303

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 42/67 (62%), Positives = 48/67 (71%)
 Frame = +3

Query: 639 LPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADA 818
           LP F  I EVGPRDGLQNEK+I+ T  KV+ IQ+L  AGL  VE +SFV PKWVP LADA
Sbjct: 3   LPNFAVIKEVGPRDGLQNEKKIVGTKDKVKWIQLLTEAGLSYVEVSSFVHPKWVPALADA 62

Query: 819 XDVIQAI 839
            DV   +
Sbjct: 63  NDVFSEL 69



>gb:AE017006_377402 Bacillus cereus ATCC 14579 section 9 of 18 of
           the complete genome.>gb:AE016877_1017652 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 303

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 42/67 (62%), Positives = 48/67 (71%)
 Frame = +3

Query: 639 LPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADA 818
           LP F  I EVGPRDGLQNEK+I+ T  KV+ IQ+L  AGL  VE +SFV PKWVP LADA
Sbjct: 3   LPNFAVIKEVGPRDGLQNEKKIVGTKDKVKWIQLLTEAGLSYVEVSSFVHPKWVPALADA 62

Query: 819 XDVIQAI 839
            DV   +
Sbjct: 63  NDVFSEL 69



>gb:AE014134_1127935 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003615_1218042 Drosophila melanogaster
           chromosome 2L, section 24 of 83 of the complete
           sequence.
          Length = 323

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 38/69 (55%), Positives = 50/69 (72%)
 Frame = +3

Query: 651 VRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXDVI 830
           VRIVEVGPRDGLQNE +++  + K+ELI  L   GL  +EATSFVS KWVPQ+ D  +V+
Sbjct: 26  VRIVEVGPRDGLQNEPKLLPAATKIELINQLSETGLRTIEATSFVSAKWVPQMGDNAEVL 85

Query: 831 QAIXNIAGV 857
           + I  + G+
Sbjct: 86  KGIRKVTGI 94



>gb:SCO939113_176452 Streptomyces coelicolor A3(2) complete genome;
           segment 10/29.
          Length = 317

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 44/83 (53%), Positives = 52/83 (62%)
 Frame = +3

Query: 600 PRHGVGLNKVLGSLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATS 779
           P  G+ +      LP  VRI EVG RDGLQNEK  + T+VK E I+ L   GL  +EATS
Sbjct: 4   PEPGLPMAVPAEGLPARVRIHEVGARDGLQNEKATVPTAVKAEFIRRLAGTGLTTIEATS 63

Query: 780 FVSPKWVPQLADAXDVIQAIXNI 848
           FV PKWVPQLADA D+   I  +
Sbjct: 64  FVHPKWVPQLADAEDLYPRISGL 86



>gb:BA000030_703163 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 315

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 43/83 (51%), Positives = 52/83 (62%)
 Frame = +3

Query: 600 PRHGVGLNKVLGSLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATS 779
           P  G+ +      LP  VRI EVG RDGLQNEK  + T VK E I+ L  AGL  +EATS
Sbjct: 4   PESGLPMVVPAQDLPARVRIHEVGARDGLQNEKGTVPTEVKAEFIRRLADAGLTTIEATS 63

Query: 780 FVSPKWVPQLADAXDVIQAIXNI 848
           FV PKWVPQLADA  +   + ++
Sbjct: 64  FVHPKWVPQLADAEQLFPLVSDL 86



>gb:AE017355_463632 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 303

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 41/67 (61%), Positives = 48/67 (71%)
 Frame = +3

Query: 639 LPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADA 818
           LP F  I EVGPRDGLQNEK+I+ T  KV+ IQ+L  AGL  VE +SFV PKWVP LADA
Sbjct: 3   LPNFAVIKEVGPRDGLQNEKKIVGTKDKVKWIQLLTEAGLSYVEVSSFVHPKWVPALADA 62

Query: 819 XDVIQAI 839
            +V   +
Sbjct: 63  NEVFSEL 69



>gb:AE016787_332955 Pseudomonas putida KT2440 section 14 of 21 of
           the complete genome.>gb:AE015451_948032 Pseudomonas
           putida KT2440 complete genome.
          Length = 299

 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +3

Query: 636 SLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLAD 815
           SLP+ VR+VEVGPRDGLQNE + IS + KV L+  L  AGL  +E  SFVSPKWVPQ+A 
Sbjct: 2   SLPKHVRLVEVGPRDGLQNEAQPISVADKVRLVNDLTEAGLAYIEVGSFVSPKWVPQMAG 61

Query: 816 AXDVIQAIXNIAGV 857
           + +V   I    GV
Sbjct: 62  SAEVFAGIQQRPGV 75



>gb:RRU41280_167804 Rhodospirillum rubrum HMG-CoA lyase (hmgL) gene,
           complete cds.
          Length = 303

 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 40/72 (55%), Positives = 52/72 (72%)
 Frame = +3

Query: 642 PEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAX 821
           P+ VR+VEVGPRDGLQNE  ++    +V LI  L  AGL V+EA +FV+P+WVPQ+AD+ 
Sbjct: 3   PDAVRLVEVGPRDGLQNEARVVPWPARVALIDALSQAGLPVIEAGAFVAPRWVPQMADSA 62

Query: 822 DVIQAIXNIAGV 857
            V+ AI   AGV
Sbjct: 63  AVLAAIHRRAGV 74



>gb:AY658923_2147933 Synthetic construct Peudomonas aeruginosa clone
           FLH046944.01F PA2011 gene, partial cds.
          Length = 301

 Score = 82.8 bits (203), Expect = 8e-15
 Identities = 40/74 (54%), Positives = 53/74 (71%)
 Frame = +3

Query: 636 SLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLAD 815
           +LP+ VR+VEVGPRDGLQNEK+ I  + K+ L+  L +AGL+ +E  SFVSPKWVPQ+A 
Sbjct: 2   NLPKKVRLVEVGPRDGLQNEKQPIEVADKIRLVDDLSAAGLDYIEVGSFVSPKWVPQMAG 61

Query: 816 AXDVIQAIXNIAGV 857
           + +V   I    GV
Sbjct: 62  SAEVFAGIRQRPGV 75



>gb:CR382128_1661276 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 318

 Score = 82.8 bits (203), Expect = 8e-15
 Identities = 40/62 (64%), Positives = 47/62 (75%)
 Frame = +3

Query: 648 FVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXDV 827
           FVRIVEV PRDGLQNEK+I ST  K  LI  LV+ GL+ VE TSFVSPKWVP +AD   +
Sbjct: 15  FVRIVEVAPRDGLQNEKKIPSTETKTSLIDRLVATGLQTVEVTSFVSPKWVPAMADNEAI 74

Query: 828 IQ 833
           ++
Sbjct: 75  LK 76



>pir|H83394|H83394 hydroxymethylglutaryl-CoA lyase PA2011 [imported]
           - Pseudomonas aeruginosa (strain PAO1)>gb:AE004627_56247
           Pseudomonas aeruginosa PAO1, section 188 of 529 of the
           complete genome.>gb:AE004091_970347 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 300

 Score = 82.8 bits (203), Expect = 8e-15
 Identities = 40/74 (54%), Positives = 53/74 (71%)
 Frame = +3

Query: 636 SLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLAD 815
           +LP+ VR+VEVGPRDGLQNEK+ I  + K+ L+  L +AGL+ +E  SFVSPKWVPQ+A 
Sbjct: 2   NLPKKVRLVEVGPRDGLQNEKQPIEVADKIRLVDDLSAAGLDYIEVGSFVSPKWVPQMAG 61

Query: 816 AXDVIQAIXNIAGV 857
           + +V   I    GV
Sbjct: 62  SAEVFAGIRQRPGV 75



>gb:BA000032_709155 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 2, complete sequence.
          Length = 300

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 43/74 (58%), Positives = 52/74 (70%)
 Frame = +3

Query: 636 SLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLAD 815
           +LP  V IVEVGPRDGLQNE  + ST  K+ LI +L   GL  +EA SFVSPKWVPQ+AD
Sbjct: 2   TLPTNVTIVEVGPRDGLQNESPV-STRTKIRLIDLLSDTGLSHIEAGSFVSPKWVPQMAD 60

Query: 816 AXDVIQAIXNIAGV 857
           + +V+Q I   A V
Sbjct: 61  SKEVMQNITRRASV 74



>gb:AE016916_356720 Chromobacterium violaceum ATCC 12472 section 7
           of 16 of the complete genome.>gb:AE016825_1041874
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 297

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 37/69 (53%), Positives = 50/69 (72%)
 Frame = +3

Query: 651 VRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXDVI 830
           V+IVEVGPRDGLQNEK  +S  +K+ELI+ L   GL  +EA +FVSPKWVPQ+A + +V+
Sbjct: 4   VKIVEVGPRDGLQNEKRPLSAEIKLELIRRLAGTGLSAIEAGAFVSPKWVPQMAGSAEVL 63

Query: 831 QAIXNIAGV 857
            A+     +
Sbjct: 64  AALDTTGAI 72



>pir|T51021|T51021 related to hydroxymethylglutaryl-CoA lyase
           [imported] - Neurospora crassa>gb:NCB7F21_1690150
           Neurospora crassa DNA linkage group II BAC clone B7F21.
          Length = 395

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 35/61 (57%), Positives = 50/61 (81%)
 Frame = +3

Query: 651 VRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXDVI 830
           V+IVEVGPRDGLQNEK+ I  + K+ELI+ L   GL+ +EA +FVSPKWVPQ+A++ +++
Sbjct: 56  VKIVEVGPRDGLQNEKKSIPLATKIELIERLAKTGLQTIEAGAFVSPKWVPQMANSDEIL 115

Query: 831 Q 833
           +
Sbjct: 116 E 116



>gb:AC025726_1205202 Caenorhabditis elegans cosmid Y71G12B, complete
           sequence.
          Length = 318

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 38/68 (55%), Positives = 47/68 (69%)
 Frame = +3

Query: 654 RIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXDVIQ 833
           R+VEVG RDGLQ EK+ + T +KVELI  L   G + VE TSFVSPKWVPQLAD  ++++
Sbjct: 20  RVVEVGARDGLQAEKKFVPTEIKVELIDRLSECGFQTVETTSFVSPKWVPQLADHNEIVK 79

Query: 834 AIXNIAGV 857
                 GV
Sbjct: 80  KHRRFEGV 87



>pir|H98298|H98298 hydroxymethylglutaryl-CoA lyase PA2011 [imported]
           - Agrobacterium tumefaciens (strain C58,
           Cereon)>gb:AE008334_235856 Agrobacterium tumefaciens
           str. C58 linear chromosome, section 138 of 187 of the
           complete sequence.>gb:AE007870_1080969 Agrobacterium
           tumefaciens str. C58 linear chromosome, complete
           sequence.
          Length = 321

 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 39/71 (54%), Positives = 52/71 (73%)
 Frame = +3

Query: 642 PEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAX 821
           P  V+IVEVG RDGLQNE   +ST++K+ELI+ L +AGL  VEA +FVSP+ VPQ+AD+ 
Sbjct: 17  PRNVKIVEVGARDGLQNESAEVSTAIKIELIERLAAAGLPAVEAGAFVSPRKVPQMADSR 76

Query: 822 DVIQAIXNIAG 854
           +V Q +    G
Sbjct: 77  EVFQGLKRWPG 87



>pir|AG2984|AG2984 hydroxymethylglutaryl-CoA lyase hmgL [imported] -
           Agrobacterium tumefaciens (strain C58,
           Dupont)>gb:AE009278_250320 Agrobacterium tumefaciens
           str. C58 linear chromosome, section 48 of 187 of the
           complete sequence.>gb:AE008689_1088163 Agrobacterium
           tumefaciens str. C58 linear chromosome, complete
           sequence.
          Length = 308

 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 39/71 (54%), Positives = 52/71 (73%)
 Frame = +3

Query: 642 PEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAX 821
           P  V+IVEVG RDGLQNE   +ST++K+ELI+ L +AGL  VEA +FVSP+ VPQ+AD+ 
Sbjct: 4   PRNVKIVEVGARDGLQNESAEVSTAIKIELIERLAAAGLPAVEAGAFVSPRKVPQMADSR 63

Query: 822 DVIQAIXNIAG 854
           +V Q +    G
Sbjct: 64  EVFQGLKRWPG 74



>pir|H95929|H95929 probable hydroxymethylglutaryl-CoA lyase (EC
           4.1.3.4) [imported] - Sinorhizobium meliloti (strain
           1021) magaplasmid pSymB>gb:RME591985_165352
           Sinorhizobium meliloti 1021 complete pSymB.
          Length = 289

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 38/70 (54%), Positives = 47/70 (67%)
 Frame = +3

Query: 645 EFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXD 824
           E V IVEV PRDGLQNE  +++T  K+ L+ +L   G E +E TSFVSP+WVPQLADA  
Sbjct: 7   ERVTIVEVAPRDGLQNESRLVATEDKIRLVDLLADCGYERIEVTSFVSPRWVPQLADAPA 66

Query: 825 VIQAIXNIAG 854
           V+  I    G
Sbjct: 67  VMAGIVRRPG 76



>gb:AE017333_447990 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_857793 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 303

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 38/73 (52%), Positives = 50/73 (68%)
 Frame = +3

Query: 639 LPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADA 818
           +P+ + I EVGPRDGLQNE+  +ST+ K+  I ML + GL  +E TSFV PKW+P L+DA
Sbjct: 3   VPKNIFIKEVGPRDGLQNEQTALSTADKITWIDMLSATGLSYIEITSFVHPKWIPALSDA 62

Query: 819 XDVIQAIXNIAGV 857
            DV + I    GV
Sbjct: 63  LDVAKGINRKPGV 75



>pir|AH3492|AH3492 hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4)
           [imported] - Brucella melitensis (strain
           16M)>gb:AE009626_253844 Brucella melitensis 16M
           chromosome I, section 183 of 195 of the complete
           sequence.>gb:AE008917_979756 Brucella melitensis 16M
           chromosome I, complete sequence.
          Length = 287

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 39/73 (53%), Positives = 48/73 (65%)
 Frame = +3

Query: 639 LPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADA 818
           + E V IVE+  RDGLQNEK  + T+ K+ LI  L   G   +EATSFVSPKWVPQLAD+
Sbjct: 1   MAEHVEIVEMAARDGLQNEKRFVPTADKIALINRLSDCGYARIEATSFVSPKWVPQLADS 60

Query: 819 XDVIQAIXNIAGV 857
            +V+  I    GV
Sbjct: 61  REVMAGIRRADGV 73



>gb:AE017340_456640 Idiomarina loihiensis L2TR, complete genome.
          Length = 299

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 39/74 (52%), Positives = 52/74 (70%)
 Frame = +3

Query: 636 SLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLAD 815
           ++ E ++IVEVGPRDGLQNE  + S   KV LI+ L  AG+  +E+ SFVSPKWVPQ+AD
Sbjct: 2   AIAEQIKIVEVGPRDGLQNEAAV-SVDAKVALIEALAEAGVSYIESASFVSPKWVPQMAD 60

Query: 816 AXDVIQAIXNIAGV 857
           +  V++ I    GV
Sbjct: 61  SPAVMKQIKRRPGV 74



>gb:BA000043_738178 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 299

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 40/72 (55%), Positives = 47/72 (65%)
 Frame = +3

Query: 642 PEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAX 821
           P  V I EVGPRDGLQNE   I+T+ K+  I +L   GL  +E TSFV PKW+PQLADA 
Sbjct: 5   PAKVTIKEVGPRDGLQNEATPIATADKIAWINLLSETGLSYIEVTSFVHPKWIPQLADAV 64

Query: 822 DVIQAIXNIAGV 857
           +V   I   AGV
Sbjct: 65  EVGTGIRRKAGV 76



>gb:AE015632_316284 Shewanella oneidensis MR-1 section 181 of 457 of
           the complete genome.>gb:AE014299_951881 Shewanella
           oneidensis MR-1 complete genome.
          Length = 315

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 39/76 (51%), Positives = 54/76 (71%)
 Frame = +3

Query: 630 LGSLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQL 809
           L +  + V + E+GPRDGLQNE  +  T  KV LI+ L +AG++ +EA SFVSPKWVPQ+
Sbjct: 14  LSATSDSVSLFEMGPRDGLQNEAAV-PTQAKVALIEALANAGVKRIEAGSFVSPKWVPQM 72

Query: 810 ADAXDVIQAIXNIAGV 857
           AD+ +V++ I   AGV
Sbjct: 73  ADSGEVLRQIRRQAGV 88



>gb:AY484417_1608309 Emericella nidulans
           3-hydroxy-3-methylglutaryl-coenzyme A
           lyase/3-methylglutaconyl-coenzyme A hydratase (hlyA)
           gene, complete cds.
          Length = 599

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 37/61 (60%), Positives = 49/61 (80%)
 Frame = +3

Query: 651 VRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXDVI 830
           VRIVEVGPRDGLQN  + I +++K++LI+ L  AGL+ +E TSFVSP+ +PQLADA  V+
Sbjct: 8   VRIVEVGPRDGLQNIPQSIDSTIKLDLIRRLRDAGLQTIELTSFVSPRAIPQLADAQVVV 67

Query: 831 Q 833
           Q
Sbjct: 68  Q 68



>gb:AE016865_352155 Pseudomonas syringae pv. tomato str. DC3000
           section 10 of 21 of the complete
           genome.>gb:AE016853_1037330 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 299

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 40/73 (54%), Positives = 48/73 (65%)
 Frame = +3

Query: 639 LPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADA 818
           L + V IVEVGPRDGLQNE + IS   KV L+  L +AGL  +E  SFVSPKWVPQ+A +
Sbjct: 3   LAQQVNIVEVGPRDGLQNEPQPISIEDKVRLVDELTAAGLMHIEVGSFVSPKWVPQMAGS 62

Query: 819 XDVIQAIXNIAGV 857
             V + I    GV
Sbjct: 63  AQVFEQIQRREGV 75



>gb:BAM576102_746892 Bacillus amyloliquefaciens partial genome,
           strain FZB42.
          Length = 299

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 36/66 (54%), Positives = 44/66 (66%)
 Frame = +3

Query: 642 PEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAX 821
           P+ VRI EVGPRDGLQNE   + T  K+E I ML   GL  +E TSFV P+W+P L D+ 
Sbjct: 4   PKHVRINEVGPRDGLQNESAWVDTEDKIEWINMLSKTGLPYIEVTSFVHPRWIPALRDSL 63

Query: 822 DVIQAI 839
           DV + I
Sbjct: 64  DVAKGI 69



>gb:AE011269_271083 Leptospira interrogans serovar lai str. 56601
           chromosome I, section 78 of 397 of the complete
           sequence.>gb:AE017298_434945 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           section 12 of 14 of the complete
           sequence.>gb:AE010300_1004482 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete
           sequence.>gb:AE016823_1067956 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           complete sequence.
          Length = 298

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 37/59 (62%), Positives = 45/59 (76%)
 Frame = +3

Query: 651 VRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXDV 827
           ++I EVGPRDGLQNEK  +ST VK E IQ LV AGL+ +EATSFV    +PQLADA ++
Sbjct: 3   IKITEVGPRDGLQNEKSPVSTEVKAEFIQRLVRAGLKNIEATSFVKKDSIPQLADATEL 61



>gb:CR628336_111909 Legionella pneumophila str. Paris complete
           genome.>gb:AE017354_460195 Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1, complete genome.
          Length = 302

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 36/66 (54%), Positives = 47/66 (71%)
 Frame = +3

Query: 642 PEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAX 821
           P+ V I+EVGPRDGLQNE   + +  K+ELI +L   GL+ +E TSFVS K +PQLAD  
Sbjct: 4   PQHVTIIEVGPRDGLQNEPSFLHSDKKIELINLLSQTGLKEIEVTSFVSAKAIPQLADNE 63

Query: 822 DVIQAI 839
           +V Q+I
Sbjct: 64  EVFQSI 69



>gb:CR628337_114997 Legionella pneumophila str. Lens complete
           genome.
          Length = 302

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 36/66 (54%), Positives = 46/66 (69%)
 Frame = +3

Query: 642 PEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAX 821
           P+ V I+EVGPRDGLQNE   + +  K+ELI +L   GL+ +E TSFVS K +PQLAD  
Sbjct: 4   PQHVTIIEVGPRDGLQNEPSFLHSDKKIELINLLSQTGLKEIEVTSFVSAKAIPQLADNE 63

Query: 822 DVIQAI 839
           +V Q I
Sbjct: 64  EVFQCI 69



>gb:CP000031_86793 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 284

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 36/71 (50%), Positives = 46/71 (64%)
 Frame = +3

Query: 645 EFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXD 824
           ++V I E+GPRDGLQNEK  I  + KV L+  L  AG   +E  SFVSPKWVPQ+A + +
Sbjct: 3   DWVEIFEMGPRDGLQNEKREIPVAEKVALVDCLSRAGFRRIEVASFVSPKWVPQMAGSAE 62

Query: 825 VIQAIXNIAGV 857
           V+  I    GV
Sbjct: 63  VLSGITRAEGV 73



>gb:BA000040_732682 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 303

 Score = 73.9 bits (180), Expect = 4e-12
 Identities = 33/72 (45%), Positives = 51/72 (70%)
 Frame = +3

Query: 639 LPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADA 818
           + E VRI+E+GPRDGLQNE+  +S   ++  ++ LV+AGL  VE  +FVSPK +PQ+A +
Sbjct: 1   MSEPVRIIEMGPRDGLQNERTPVSVEARIAFVEALVAAGLNTVEVGAFVSPKAIPQMASS 60

Query: 819 XDVIQAIXNIAG 854
             V++ + +I G
Sbjct: 61  DAVLRGVGHITG 72



>gb:BA000028_695730 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 300

 Score = 73.9 bits (180), Expect = 4e-12
 Identities = 35/64 (54%), Positives = 49/64 (76%)
 Frame = +3

Query: 636 SLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLAD 815
           SLP +V++ EVGPRDGLQNEK  I+T  KV  I ML ++G++ +E +SFV+PK +P L+D
Sbjct: 3   SLPSYVQLKEVGPRDGLQNEKSWITTEDKVNWINMLSTSGIKEIEYSSFVNPKMIPALSD 62

Query: 816 AXDV 827
           A +V
Sbjct: 63  AREV 66



>gb:CR378678_97966 Photobacterium profundum SS9 chromosome 2;
           segment 4/7.
          Length = 300

 Score = 73.9 bits (180), Expect = 4e-12
 Identities = 38/70 (54%), Positives = 48/70 (68%)
 Frame = +3

Query: 630 LGSLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQL 809
           +  LP+ V IVE+G RDGLQNE  + ST  K+ LI  L   GL  +EA SFVSPKWVPQ+
Sbjct: 4   INKLPKAVTIVEMGARDGLQNEAAV-STEAKINLINQLSLTGLTHIEAGSFVSPKWVPQM 62

Query: 810 ADAXDVIQAI 839
           AD+  V++ I
Sbjct: 63  ADSKHVLEKI 72



>pir|F83791|F83791 hydroxymethylglutaryl-CoA lyase BH1134 [imported]
           - Bacillus halodurans (strain C-125)>gb:BA000004_655080
           Bacillus halodurans C-125 DNA, complete genome.
          Length = 303

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 37/69 (53%), Positives = 44/69 (63%)
 Frame = +3

Query: 651 VRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXDVI 830
           V I EVGPRDGLQNE   I T  K+E I  L   GL  +E +SFV PKW+P LADA +V+
Sbjct: 7   VSIREVGPRDGLQNESTWIDTEQKIEWINHLSRTGLPYIEVSSFVHPKWIPALADAEEVL 66

Query: 831 QAIXNIAGV 857
             I  + GV
Sbjct: 67  ARIDRVDGV 75



>pir|D69893|D69893 hydroxymethylglutaryl-CoA lyase homolog yngG -
           Bacillus subtilis>gb:BSUB0010_753788 Bacillus subtilis
           complete genome (section 10 of 21): from 1807106 to
           2014934.>gb:BSY13917_756180 Bacillus subtilis ppsE,
           yngL, yngK, yotB, yngJ, yngI, yngH, yngG and yngF genes,
           ppsD and yngE partial genes.
          Length = 299

 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 38/72 (52%), Positives = 44/72 (61%)
 Frame = +3

Query: 642 PEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAX 821
           P+ V I EVGPRDGLQNE   I+T  K+  I  L   GL  +E TSFV PKW+P L DA 
Sbjct: 4   PKKVTIKEVGPRDGLQNEPVWIATEDKITWINQLSRTGLSYIEITSFVHPKWIPALRDAI 63

Query: 822 DVIQAIXNIAGV 857
           DV + I    GV
Sbjct: 64  DVAKGIDREKGV 75



>gb:BX572601_802153 Rhodopseudomonas palustris CGA009 complete
           genome; segment 9/16.
          Length = 301

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 33/72 (45%), Positives = 51/72 (70%)
 Frame = +3

Query: 639 LPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADA 818
           + + +RIVEVGPRDGLQNEK  +S + ++  ++ LV+AGL  VE  +FVSPK +PQ+  +
Sbjct: 1   MTDTIRIVEVGPRDGLQNEKTPVSVADRIAFVEALVAAGLSTVEVGAFVSPKAIPQMIGS 60

Query: 819 XDVIQAIXNIAG 854
            +V++A   + G
Sbjct: 61  DEVLRASLKLPG 72



>gb:BX640439_813368 Bordetella bronchiseptica strain RB50, complete
           genome; segment 3/16.
          Length = 332

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 36/71 (50%), Positives = 47/71 (66%)
 Frame = +3

Query: 645 EFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXD 824
           E + I EVGPRDGLQN + ++ T  K++ I  L +AGL  VE  SFV PKW+PQ+ADA  
Sbjct: 2   EKILISEVGPRDGLQNVQAVMPTEAKLQWIGALAAAGLREVEVGSFVHPKWLPQMADADA 61

Query: 825 VIQAIXNIAGV 857
           V+     IAG+
Sbjct: 62  VVPRARAIAGL 72



>sp|P13703|HMGL_PSEMV Hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4)
           (HMG-CoA lyase) (HL) (3- hydroxy-3-methylglutarate-CoA
           lyase).>pir|A43714|A30578 hydroxymethylglutaryl-CoA
           lyase (EC 4.1.3.4) - Pseudomonas sp.>gb:PSEMVAAB_160748
           P.mevalonii HMG-CoA-reductase (mvaA) gene, 3' end, and
           HMG-CoA-lyase (mvbB) gene, complete
           cds.>gb:PSEMVAB_160749 P.mevaloni HMG-CoA lyase (mvaB)
           gene, complete cds.
          Length = 301

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 33/69 (47%), Positives = 50/69 (72%)
 Frame = +3

Query: 651 VRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXDVI 830
           V++ EVGPRDGLQNE++ +S + +V LI  L   GL  +EA +FVSP+WVPQ+A + +V+
Sbjct: 4   VKVFEVGPRDGLQNERQPLSVAARVGLIGELAGTGLRHIEAGAFVSPRWVPQMAGSDEVL 63

Query: 831 QAIXNIAGV 857
           + + +  GV
Sbjct: 64  RQLPSNDGV 72



>gb:BA000032_709669 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 2, complete sequence.
          Length = 309

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 37/67 (55%), Positives = 45/67 (67%)
 Frame = +3

Query: 639 LPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADA 818
           LP  V IVEVG RDGLQNE  +     K+ LI +L + GL+ +EA SFVSPKWVPQ+AD+
Sbjct: 11  LPAKVNIVEVGARDGLQNETAVTLVD-KIRLINLLSNCGLKHIEAGSFVSPKWVPQMADS 69

Query: 819 XDVIQAI 839
             V   I
Sbjct: 70  DQVFAGI 76



>gb:AE016809_338240 Vibrio vulnificus CMCP6 chromosome II section 2
           of 6 of the complete sequence.>gb:AE016796_1047964
           Vibrio vulnificus CMCP6 chromosome II complete sequence.
          Length = 179

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 41/74 (55%), Positives = 48/74 (64%)
 Frame = +3

Query: 636 SLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLAD 815
           +LPE V IVEVGPRDGLQNE  + ST  KV LI  L   GL  +EA +FVS K VPQ+AD
Sbjct: 10  TLPEHVTIVEVGPRDGLQNEGAV-STDSKVALINALSQTGLTRIEAGAFVSAKRVPQMAD 68

Query: 816 AXDVIQAIXNIAGV 857
           +  V + I    GV
Sbjct: 69  SLAVFEQIHRSLGV 82



>pir|B87307|B87307 3-hydroxy-3-methylglutarate-CoA lyase [imported]
           - Caulobacter crescentus>gb:AE005720_74484 Caulobacter
           crescentus CB15 section 46 of 359 of the complete
           genome.>gb:AE005673_921516 Caulobacter crescentus CB15
           complete genome.
          Length = 299

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 33/67 (49%), Positives = 47/67 (70%)
 Frame = +3

Query: 639 LPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADA 818
           +  F++IVEVGPRDGLQNEK ++S   K++LI  L +AG    E  SFV+P  VPQ+A A
Sbjct: 1   MSRFIQIVEVGPRDGLQNEKTVLSVEEKLDLIAKLEAAGARRTEVVSFVNPSRVPQMAGA 60

Query: 819 XDVIQAI 839
            +++ A+
Sbjct: 61  EEIMAAL 67



>gb:BX640431_811047 Bordetella parapertussis strain 12822, complete
           genome; segment 9/14.>gb:BX640446_815770 Bordetella
           bronchiseptica strain RB50, complete genome; segment
           10/16.
          Length = 308

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 32/67 (47%), Positives = 47/67 (70%)
 Frame = +3

Query: 639 LPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADA 818
           + E + I +V PRDGLQN+   + T  K+ LI++L  AG+  VEATSFVSP+ VPQ+ADA
Sbjct: 1   MQERIHITDVSPRDGLQNQPAQVPTQEKLRLIRLLAEAGVRSVEATSFVSPRAVPQMADA 60

Query: 819 XDVIQAI 839
            +++  +
Sbjct: 61  AELVAQV 67



>gb:BX640424_808762 Bordetella parapertussis strain 12822, complete
           genome; segment 2/14.
          Length = 315

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 34/72 (47%), Positives = 46/72 (63%)
 Frame = +3

Query: 642 PEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAX 821
           P+ + I EVGPRDGLQ E+ +++T  KV  +  L + G   +E TSF SPK +P LADA 
Sbjct: 4   PQRIEINEVGPRDGLQIERALVATDDKVAFVDALSACGFARIEVTSFTSPKAIPALADAQ 63

Query: 822 DVIQAIXNIAGV 857
           DV++ I    GV
Sbjct: 64  DVMRRIARRPGV 75



>gb:BA000038_725137 Vibrio vulnificus YJ016 DNA, chromosome II,
           complete sequence.
          Length = 305

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 39/74 (52%), Positives = 48/74 (64%)
 Frame = +3

Query: 636 SLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLAD 815
           +LP+ V IVEVGPRDGLQNE+ + ST  KV LI  L   GL  +E  +FVS K VPQ+AD
Sbjct: 10  TLPKHVTIVEVGPRDGLQNERAV-STDSKVALINALSQTGLTRIEVGAFVSAKRVPQMAD 68

Query: 816 AXDVIQAIXNIAGV 857
           +  V + I    GV
Sbjct: 69  SLAVFEQIHRSLGV 82



>gb:AF218939_489308 Bacillus subtilis FenH (fenH), FenI (fenI), FenJ
           (fenJ), acyl-CoA dehydrogenase (fenK), long chain fatty
           acid acyl-CoA ligase (fenL), acetyl-CoA carboxylase
           (fenM), hydroxymethylglutaryl-CoA lyase (fenN),
           hydroxybutyryl-dehydratase (fenO), and b-propionyl-CoA
           carboxylase (fenP) genes, complete cds.
          Length = 300

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 35/74 (47%), Positives = 44/74 (59%)
 Frame = +3

Query: 636 SLPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLAD 815
           S P+   + EVGPRDGLQNE   ++T  K+  I  L   GL  +E TSFV PK +P L D
Sbjct: 2   SYPKKAMLREVGPRDGLQNEPVWLATEDKIAWINQLSQTGLSYIEITSFVHPKVIPALRD 61

Query: 816 AXDVIQAIXNIAGV 857
           A DV + I  + GV
Sbjct: 62  ALDVAKGISRVKGV 75



>gb:BX640422_808080 Bordetella pertussis strain Tohama I, complete
           genome; segment 12/12.
          Length = 315

 Score = 67.8 bits (164), Expect = 3e-10
 Identities = 34/72 (47%), Positives = 45/72 (62%)
 Frame = +3

Query: 642 PEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAX 821
           P  + I EVGPRDGLQ E+ +++T  KV  +  L + G   +E TSF SPK +P LADA 
Sbjct: 4   PPRIEINEVGPRDGLQIERALVATDDKVAFVDALSACGFARIEVTSFTSPKAIPALADAQ 63

Query: 822 DVIQAIXNIAGV 857
           DV++ I    GV
Sbjct: 64  DVMRRIARRPGV 75



>gb:BA000028_697617 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 318

 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 34/70 (48%), Positives = 43/70 (61%)
 Frame = +3

Query: 639 LPEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADA 818
           LP    I EV PRDG Q E E I T  KVE+I+ L   G+  +E TSFV PK +PQL DA
Sbjct: 8   LPTKAIICEVAPRDGFQAEPEWIPTDKKVEMIRSLAKTGITTMEVTSFVHPKAIPQLKDA 67

Query: 819 XDVIQAIXNI 848
            +V+  + +I
Sbjct: 68  EEVVSRVHDI 77



>gb:BX842656_826327 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 11/11.
          Length = 311

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 31/61 (50%), Positives = 42/61 (68%)
 Frame = +3

Query: 651 VRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXDVI 830
           V IVE+G RDGLQNEK ++    +VE  + L+ AG + VE  +FVSP WVPQ+A   +V+
Sbjct: 5   VVIVEMGLRDGLQNEKTVLDADTRVEFARRLILAGTKRVEIGAFVSPTWVPQMAGTAEVV 64

Query: 831 Q 833
           Q
Sbjct: 65  Q 65



>gb:AP006627_562871 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 309

 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 32/69 (46%), Positives = 45/69 (65%)
 Frame = +3

Query: 651 VRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXDVI 830
           V I EVGPRDGLQNE+  +S   K+E+++    +G+  +EA SFV+ K VP +ADA +V+
Sbjct: 13  VEICEVGPRDGLQNEQVRLSVEQKIEMMEHAARSGISKIEAVSFVNKKLVPAMADAEEVM 72

Query: 831 QAIXNIAGV 857
            A     GV
Sbjct: 73  AAWHRREGV 81



>gb:AE017343_1755260 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 529

 Score = 62.8 bits (151), Expect = 8e-09
 Identities = 32/70 (45%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +3

Query: 648 FVRIVEVGPRDGLQNEK-EIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXD 824
           +VRIV+V PRDGLQN K + + T VK EL++ L+ AG+  +E  SFV   WVPQ+AD   
Sbjct: 166 YVRIVDVSPRDGLQNLKGKPVPTEVKRELVERLLEAGVRNIEVGSFVRSDWVPQMADTPQ 225

Query: 825 VIQAIXNIAG 854
           ++  +    G
Sbjct: 226 LLPLLPPFTG 235



>gb:BX640422_808230 Bordetella pertussis strain Tohama I, complete
           genome; segment 12/12.
          Length = 335

 Score = 62.8 bits (151), Expect = 8e-09
 Identities = 29/72 (40%), Positives = 45/72 (62%)
 Frame = +3

Query: 642 PEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAX 821
           P FV   E GPR+G Q+EK +   + +V L+  L + GL+ ++  SFV+P+ VP +ADA 
Sbjct: 12  PRFVEFHEEGPREGFQSEKTLYPLASRVALVDALTATGLKKIQVASFVNPRMVPAMADAA 71

Query: 822 DVIQAIXNIAGV 857
           ++  AI   +GV
Sbjct: 72  ELFGAIRKKSGV 83



>gb:AF173167_485467 Pseudomonas alcaligenes putative transposase,
           putative transposase, gentisate 1,2-dioxygenase (xlnE),
           xlnF, hypothetical protein (xlnG), hypothetical protein
           (xlnH), xlnI, probable 3-hydroxybenzoate 6-hydroxylase
           (xlnD), transposase subunit (tnpA1), transposase subunit
           (tnpA2), transposase subunit, and putative transposase
           genes, complete cds.
          Length = 305

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 31/61 (50%), Positives = 41/61 (67%)
 Frame = +3

Query: 651 VRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXDVI 830
           + +VEV PRDG Q+  E I T  K+ +I+ LVSAG + VE  SFV+PK VPQ+AD   + 
Sbjct: 7   IEVVEVSPRDGFQSICEPIETQKKISIIEDLVSAGCKRVEIGSFVNPKAVPQMADTSLIA 66

Query: 831 Q 833
           Q
Sbjct: 67  Q 67



>gb:BA000040_734624 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 311

 Score = 60.1 bits (144), Expect = 5e-08
 Identities = 31/70 (44%), Positives = 42/70 (60%)
 Frame = +3

Query: 645 EFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXD 824
           E   + EVGPRDGLQ    I+ T  K+   + +V+AG+  +E TSFV PK +PQ  DA +
Sbjct: 3   EKAHVREVGPRDGLQMVGTILPTERKLAWCRRVVAAGIHEIEVTSFVPPKLIPQFGDAEE 62

Query: 825 VIQAIXNIAG 854
           V +    IAG
Sbjct: 63  VARGAMAIAG 72



>gb:CR543861_104650 Acinetobacter sp. ADP1 complete genome.
          Length = 326

 Score = 59.7 bits (143), Expect = 7e-08
 Identities = 29/69 (42%), Positives = 42/69 (60%)
 Frame = +3

Query: 651 VRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXDVI 830
           + + EVGPRDGLQ+ K+ + T +K   I  L  AG+  +E  SFV PK +PQ+AD  D++
Sbjct: 23  ILVSEVGPRDGLQSIKQTMPTDMKKMWISALSEAGVREIEVGSFVPPKLLPQMADCADLV 82

Query: 831 QAIXNIAGV 857
           Q    +  V
Sbjct: 83  QHALTLENV 91



>gb:AE017305_436796 Thermus thermophilus HB27 section 5 of 7 of the
           complete genome.>gb:AP008226_578983 Thermus thermophilus
           HB8 genomic DNA, complete genome.>gb:AE017221_1078774
           Thermus thermophilus HB27 complete genome.
          Length = 286

 Score = 56.2 bits (134), Expect = 8e-07
 Identities = 30/63 (47%), Positives = 39/63 (61%)
 Frame = +3

Query: 651 VRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXDVI 830
           VR VE  PRD  Q     I T  KV  +  L+ AG   ++ TSFVSPKWVPQ+ DA +V+
Sbjct: 5   VRWVEC-PRDAWQGFSRFIPTEEKVAFLNELLEAGFAHLDLTSFVSPKWVPQMQDAEEVL 63

Query: 831 QAI 839
           +A+
Sbjct: 64  KAL 66



>gb:AE017238_413899 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 12 of 16 of the complete
           genome.>gb:AE016958_1057303 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 301

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 29/59 (49%), Positives = 38/59 (64%)
 Frame = +3

Query: 651 VRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXDV 827
           V I EV  RDGLQ E  I   S K+EL+  + + G+  VEAT+FVSP  VP +ADA ++
Sbjct: 5   VAIREVALRDGLQIEAPI-PLSAKLELLAAVAATGVREVEATAFVSPSKVPSMADAAEL 62



>gb:BA000040_728958 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 315

 Score = 49.7 bits (117), Expect = 7e-05
 Identities = 28/68 (41%), Positives = 37/68 (54%)
 Frame = +3

Query: 651 VRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXDVI 830
           V + EVG RDGLQ  K+  ST  K   ++   +AG+   E  SF+  K  PQ  D  DVI
Sbjct: 13  VSLREVGLRDGLQLVKKFPSTEAKQRWVREEYAAGVRHFEVGSFLPAKTFPQFVDVRDVI 72

Query: 831 QAIXNIAG 854
            A+ N+ G
Sbjct: 73  GAVANLPG 80



>gb:AE016786_332812 Pseudomonas putida KT2440 section 13 of 21 of
           the complete genome.>gb:AE015451_947889 Pseudomonas
           putida KT2440 complete genome.
          Length = 309

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 25/60 (41%), Positives = 37/60 (61%)
 Frame = +3

Query: 651 VRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXDVI 830
           + I EVG RDGLQ+ + I+ T+ K   I     AG+  +E  SFV  + +PQ+ADA +V+
Sbjct: 4   ITINEVGLRDGLQSLQVIMPTAAKRRWIDAAYGAGVRHMEVASFVPARLLPQMADAREVV 63



>gb:AP006618_561070 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 316

 Score = 41.6 bits (96), Expect = 0.020
 Identities = 20/59 (33%), Positives = 36/59 (61%)
 Frame = +3

Query: 663 EVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEATSFVSPKWVPQLADAXDVIQAI 839
           +V  RDGLQ   + + T+ K+E+++ L++ G+  +E  S   P  VP +AD  D++ A+
Sbjct: 9   DVTLRDGLQLTGKPLPTARKIEIVRALLALGVPELEIGSMARPDLVPPMADTLDLVAAL 67



>pir|T25031|T25031 hypothetical protein T20D3.3 - Caenorhabditis
           elegans
          Length = 401

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 16/18 (88%), Positives = 17/18 (94%)
 Frame = +1

Query: 19  KIGTIQRRLAWPLRKDDT 72
           +IGTIQRRLAWPLR DDT
Sbjct: 149 RIGTIQRRLAWPLRTDDT 166



>pir|F88778|F88778 protein T20D3.3 [imported] - Caenorhabditis
           elegans
          Length = 391

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 16/18 (88%), Positives = 17/18 (94%)
 Frame = +1

Query: 19  KIGTIQRRLAWPLRKDDT 72
           +IGTIQRRLAWPLR DDT
Sbjct: 149 RIGTIQRRLAWPLRTDDT 166



>gb:BX640438_813286 Bordetella bronchiseptica strain RB50, complete
           genome; segment 2/16.
          Length = 294

 Score = 37.0 bits (84), Expect = 0.48
 Identities = 16/39 (41%), Positives = 26/39 (66%)
 Frame = +3

Query: 741 LVSAGLEVVEATSFVSPKWVPQLADAXDVIQAIXNIAGV 857
           L + GL+ ++  SFV+P+ VP +ADA ++  AI   +GV
Sbjct: 4   LTATGLKKIQVASFVNPRMVPAMADAAELFGAIQKKSGV 42



>gb:BX640424_808881 Bordetella parapertussis strain 12822, complete
           genome; segment 2/14.
          Length = 294

 Score = 37.0 bits (84), Expect = 0.48
 Identities = 16/39 (41%), Positives = 26/39 (66%)
 Frame = +3

Query: 741 LVSAGLEVVEATSFVSPKWVPQLADAXDVIQAIXNIAGV 857
           L + GL+ ++  SFV+P+ VP +ADA ++  AI   +GV
Sbjct: 4   LTATGLKKIQVASFVNPRMVPAMADAAELFGAIQKKSGV 42



>gb:AY538390_1612429 Mitragyna rubrostipulata maturase K (matK)
           gene, partial cds; chloroplast.
          Length = 474

 Score = 35.4 bits (80), Expect = 1.4
 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 2/40 (5%)
 Frame = -1

Query: 803 WYPLR*HKTSSFDDFQPRRNKHL--Y*FNFHTCRYDLLFI 690
           W  L   K SSFD F P+RNK L  + +N H C Y+ +F+
Sbjct: 159 WNTLIARKKSSFD-FSPKRNKRLLFFLYNSHVCEYESIFV 197



>gb:AE017283_431191 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 839

 Score = 35.4 bits (80), Expect = 1.4
 Identities = 26/87 (29%), Positives = 42/87 (48%), Gaps = 6/87 (6%)
 Frame = +3

Query: 612 VGLNKVLGSLPEFVRIVEVGPRDGLQNE--KEIISTSVKVE-LIQMLVSAGLEVV---EA 773
           VG   V+G +PE        PR  +  +    I+ T V  E +I++L  +G++V    ++
Sbjct: 411 VGEPTVVGEVPEM-------PRQTINADLPNRILGTKVPTEEVIEILTRSGVKVTALGDS 463

Query: 774 TSFVSPKWVPQLADAXDVIQAIXNIAG 854
              V+P W P L DA D ++ I    G
Sbjct: 464 LHLVAPTWRPDLVDAYDYVEEIGRKIG 490



>gb:AF499596_2266583 Phthorimaea operculella granulovirus, complete
           genome.
          Length = 796

 Score = 34.7 bits (78), Expect = 2.4
 Identities = 39/156 (25%), Positives = 64/156 (41%), Gaps = 6/156 (3%)
 Frame = +3

Query: 279 TLSCDPMLSHKAVRKFSRLRFGACSVFGNDILGSVPEMELQNFKGEQGKRFSSSKMDREE 458
           T +C  MLS+    + + L+F +C+++         E  +     + G R  +  M    
Sbjct: 564 TENCGAMLSYSKFSELNDLQFKSCTLYY--------EEGMYQLYYQLGVRDGTLTM---- 611

Query: 459 DNGRVYLWQRQTNRVSHNPAFTRE-----TSVTGTTHNAFHMLHHCYSTQLNPRHGVGLN 623
            NGRV +  R TN+ +  P+F+ +         GTTHN           +  P  G  + 
Sbjct: 612 -NGRVVVLARDTNQPTSEPSFSAQRENYGNDSDGTTHNG-------VVCRRVPVDGFNVA 663

Query: 624 KVLGSLPEFVRIVE-VGPRDGLQNEKEIISTSVKVE 728
            +   +   V IVE V   D L N + + S  + VE
Sbjct: 664 SLTTRMQGDVEIVEQVIHFDALHNNRGVCSYKLNVE 699



>gb:AY042658_1560840 Suaeda vera maturase K (matK) gene, partial
           cds.
          Length = 280

 Score = 34.7 bits (78), Expect = 2.4
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 10/64 (15%)
 Frame = -1

Query: 770 FDDFQPRRNKHLY*F--NFHTCRYDLLFI--------LQPISWTYFYYPHKFRQRSQYLI 621
           F  F  +RN+ L+ F  NFH C Y+ LF+        L+  S+        F +R QYL+
Sbjct: 53  FSSFLKKRNQRLFVFLYNFHVCEYESLFVYLRNQSSYLRSTSFAALLERIHFYERLQYLV 112

Query: 620 *AYT 609
             +T
Sbjct: 113 KVFT 116



>sp|Q8M9A9|MATK_MANZA Maturase K (Intron
           maturase).>gb:MZA429295_1687808 Manilkara zapota
           chloroplast partial matK gene for maturase.
          Length = 508

 Score = 34.7 bits (78), Expect = 2.4
 Identities = 29/120 (24%), Positives = 52/120 (43%), Gaps = 11/120 (9%)
 Frame = -1

Query: 833 LNYILCISKLWYPLR*HKTSSFDDFQPRRNKHLY*FNFHTCRYDLLFI--------LQPI 678
           L + L   + W  L   K SSF   +  +   L+ +N+H C Y+ +FI        L+ I
Sbjct: 180 LRFFLYEYRNWNSLITPKKSSFSFSKRNQRLFLFLYNYHVCEYESIFIFLRNQSSHLRSI 239

Query: 677 SWTYFYYPHKFRQRSQYLI*AYTMSW---IQLCAITMMQHMESIMCGSSNTSFSGKGRIM 507
           S   F+    F ++ ++ +  +T  +   + LC    M ++     G S  +  GK  +M
Sbjct: 240 SSGTFFEQIDFYEKIEHFVEVFTKDFQAILWLCKDPFMHYIR--YQGKSLLASKGKSLLM 297



>sp|O04973|LU1A_LYCPN 2-isopropylmalate synthase A (EC 2.3.3.13)
           (Alpha-isopropylmalate synthase A) (Alpha-IPM synthetase
           A).>gb:AF004165_1760673 Lycopersicon pennellii
           2-isopropylmalate synthase (lp-ipmsa) mRNA, complete
           cds.
          Length = 589

 Score = 34.7 bits (78), Expect = 2.4
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 5/78 (6%)
 Frame = +3

Query: 555 NAFHMLHHCYSTQL-----NPRHGVGLNKVLGSLPEFVRIVEVGPRDGLQNEKEIISTSV 719
           + F    H YST +     N R     +K+  S P++VRI +   RDG Q+    ++T  
Sbjct: 13  SVFQSKKHYYSTFIRCSISNRRPEYVPSKI--SDPKYVRIFDTTLRDGEQSPGATMTTKE 70

Query: 720 KVELIQMLVSAGLEVVEA 773
           K+++ + L   G++++EA
Sbjct: 71  KLDVARQLAKLGVDIIEA 88



>gb:ACU61345_1745466 Arbutus canariensis ribosomal maturase (matK)
           gene, complete cds; chloroplast gene for chloroplast
           product.
          Length = 506

 Score = 33.9 bits (76), Expect = 4.1
 Identities = 15/48 (31%), Positives = 24/48 (50%)
 Frame = -1

Query: 833 LNYILCISKLWYPLR*HKTSSFDDFQPRRNKHLY*FNFHTCRYDLLFI 690
           L + L   + W  L   K SSF   +  +   L+ +NFH C Y+ +F+
Sbjct: 180 LRFFLHAYRNWNSLMTQKKSSFSFSKTNKRLFLFLYNFHVCEYESIFV 227



>gb:SPAPB1E7_1718665 S.pombe chromosome I BAC pB1E7.
          Length = 1236

 Score = 33.9 bits (76), Expect = 4.1
 Identities = 20/59 (33%), Positives = 33/59 (55%)
 Frame = -2

Query: 784 TKLVASTTSSPAETSICISSTFTLVDMISFSFCNPSLGPTSTILTNSGKDPNTLFKPTP 608
           + +++S+TSSP+ TS+ ISS+ T     S +F + S    S+I ++       L  PTP
Sbjct: 577 SSILSSSTSSPSSTSLSISSSST-----SSTFSSASTSSPSSISSSISSSSTILSSPTP 630



>gb:AY596500_1616765 Helicosporidium sp. ex Simulium jonesii plastid
           isopropylmalate synthase gene, partial cds; nuclear gene
           for plastid product.
          Length = 313

 Score = 33.9 bits (76), Expect = 4.1
 Identities = 14/44 (31%), Positives = 27/44 (61%)
 Frame = +3

Query: 642 PEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEA 773
           P +VRI +   RDG Q+    +++  K+E+ + L   G++++EA
Sbjct: 2   PNYVRIFDTTLRDGEQSPGATLTSKEKMEIAKQLAKLGVDIIEA 45



>gb:AY596499_1616764 Helicosporidium sp. ex Simulium jonesii plastid
           isopropylmalate synthase mRNA, partial cds; nuclear gene
           for plastid product.
          Length = 185

 Score = 33.9 bits (76), Expect = 4.1
 Identities = 14/44 (31%), Positives = 27/44 (61%)
 Frame = +3

Query: 642 PEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEA 773
           P +VRI +   RDG Q+    +++  K+E+ + L   G++++EA
Sbjct: 54  PNYVRIFDTTLRDGEQSPGATLTSKEKMEIAKQLAKLGVDIIEA 97



>pir|S45338|S45338 myb-related protein MIXTA - garden
           snapdragon>gb:AMMIXTA_1819232 A.majus mixta mRNA.
          Length = 321

 Score = 33.5 bits (75), Expect = 5.3
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 2/53 (3%)
 Frame = +1

Query: 4   SETSDKIGTIQRRLAWPLRKDDTHKSRNGXXXXXXXXXXTLM--NLFANFSIK 156
           ++ ++KIGTIQRRL WPL  D+   +              L   N F N+S +
Sbjct: 169 AQNNNKIGTIQRRLTWPLCLDNEQSNHYHSALLNSTSAVGLNQDNSFTNYSAR 221



>gb:AK118569_1816538 Arabidopsis thaliana At1g74040 mRNA for
           putative 2-isopropylmalate synthase, complete cds,
           clone: RAFL19-80-C13.
          Length = 338

 Score = 32.7 bits (73), Expect = 9.1
 Identities = 13/44 (29%), Positives = 27/44 (61%)
 Frame = +3

Query: 642 PEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEA 773
           P +VRI +   RDG Q+    +++  K+++ + L   G++++EA
Sbjct: 84  PNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEA 127



>gb:AF440411_1800072 Arctostaphylos uva-ursi maturase K (matK) gene,
           complete cds; chloroplast gene for chloroplast product.
          Length = 506

 Score = 32.7 bits (73), Expect = 9.1
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = -1

Query: 833 LNYILCISKLWYPLR*HKTSSFDDFQPRRNKHLY*FNFHTCRYDLLFI 690
           L + L     W  L   K SSF   +  +   L+ +NFH C Y+ +F+
Sbjct: 180 LRFFLHAYHNWNSLMTQKKSSFSFSKKNKRLFLFLYNFHVCEYESIFV 227



>gb:AC152123_1745202 Genomic sequence for broccoli [Brassica
           oleracea L. (Italica group)] BAC clone B21F5, complete
           sequence.
          Length = 623

 Score = 32.7 bits (73), Expect = 9.1
 Identities = 13/44 (29%), Positives = 27/44 (61%)
 Frame = +3

Query: 642 PEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEA 773
           P +VR+ +   RDG Q+    +++  K+++ + L   G++V+EA
Sbjct: 78  PNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDVIEA 121



>pir|C96768|C96768 hypothetical protein F2P9.9 [imported] -
           Arabidopsis thaliana>gb:AE005173_894949 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC016662_1538222 Arabidopsis thaliana
           chromosome 1 BAC F2P9 genomic sequence, complete
           sequence.>gb:AY057659_1564072 Arabidopsis thaliana
           At1g74040/F2P9_9 mRNA, complete cds.>gb:BT000815_1635070
           Arabidopsis thaliana putative 2-isopropylmalate synthase
           (At1g74040/F2P9_9) mRNA, complete
           cds.>gb:AF327647_1786820 Arabidopsis thaliana
           2-isopropylmalate synthase (IMS1) mRNA, complete cds.
          Length = 631

 Score = 32.7 bits (73), Expect = 9.1
 Identities = 13/44 (29%), Positives = 27/44 (61%)
 Frame = +3

Query: 642 PEFVRIVEVGPRDGLQNEKEIISTSVKVELIQMLVSAGLEVVEA 773
           P +VRI +   RDG Q+    +++  K+++ + L   G++++EA
Sbjct: 84  PNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEA 127


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 905,663,045
Number of Sequences: 1806583
Number of extensions: 19118468
Number of successful extensions: 44590
Number of sequences better than 10.0: 114
Number of HSP's better than 10.0 without gapping: 43119
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 44550
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 58272739092
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)