BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig600
         (640 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB023041_1515466 Arabidopsis thaliana genomic DNA, chromosome...   100   2e-20   
gb:AP004092_1837573 Oryza sativa (japonica cultivar-group) genom...    83   3e-15   
gb:BX248418_2567119 Zebrafish DNA sequence from clone DKEY-181I3...    33   4.1     
sp|P55465|Y4GI_RHISN|Y4GI_RHISN Hypothetical 102.8 kDa protein y4gI.>gb:AE0...    33   4.1     Rhizobium sp.


>gb:AB023041_1515466 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MPE11.
          Length = 532

 Score =  100 bits (250), Expect = 2e-20
 Identities = 51/81 (62%), Positives = 61/81 (75%)
 Frame = +2

Query: 305 MDTTASGTPSVQYCNIAEQPIATLVTSPVPTFQKQQRHCLGNARPGEFPLSANPSIVLHV 484
           MD T SGTPS+QY N+ EQ ++T  + PV  FQ+ +RHC G+  PGEFPL+ANPSIVLHV
Sbjct: 1   MDAT-SGTPSLQYINLPEQSVST-TSPPVSPFQRPKRHCFGDTTPGEFPLAANPSIVLHV 58

Query: 485 LTGCNLDPQDLAILEACVSTF 547
           LT C LDP+DLA LEA  S F
Sbjct: 59  LTECRLDPRDLANLEATCSFF 79



>gb:AP004092_1837573 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1568_B05.
          Length = 537

 Score = 83.2 bits (204), Expect = 3e-15
 Identities = 44/84 (52%), Positives = 59/84 (70%), Gaps = 2/84 (2%)
 Frame = +2

Query: 302 PMDTTASGT-PSVQYCNIAEQPIATLVTSPVPT-FQKQQRHCLGNARPGEFPLSANPSIV 475
           PMD  ASGT P +Q+  I ++P +   +SP+ T  ++ QRHC G+  PGEFPL+ +PSIV
Sbjct: 4   PMDAAASGTSPVMQFHGIVDEPPSH--SSPLHTALERSQRHCYGHETPGEFPLAVSPSIV 61

Query: 476 LHVLTGCNLDPQDLAILEACVSTF 547
           LHVL+ C LDP+DLA LEA  + F
Sbjct: 62  LHVLSTCELDPKDLAALEATCTFF 85



>gb:BX248418_2567119 Zebrafish DNA sequence from clone DKEY-181I3 in
           linkage group 20 Contains the 3' end of the gene for a
           novel protein similar to vertebrate gamma-aminobutyric
           acid (GABA) receptors, the gene for a novel protein
           similar to vertebrate gamma-aminobutyric acid (GABA)
           receptor rho subunit family, two novel genes
           (zgc:63554), the ankrd6 gene for ankyrin repeat domain
           6, the gene for a novel protein similar to vertebrate
           LATS large tumor suppressor homolog 1 (Drosophila)
           (LATS1), the hsd3b1 gene, the gene for a novel protein
           similar to vertebrate low density lipoprotein
           receptor-related protein 11 (LRP11) and a CpG island,
           complete sequence.
          Length = 426

 Score = 33.1 bits (74), Expect = 4.1
 Identities = 17/36 (47%), Positives = 22/36 (61%)
 Frame = -1

Query: 457 RQRELPGTSVSKTMPLLLLKRGHGRGDESSNGLLGY 350
           RQ+ LPGT    +M  ++L   +GR D  SNGL GY
Sbjct: 322 RQKTLPGTCDISSMRTMMLNEAYGRPD--SNGLAGY 355



>sp|P55465|Y4GI_RHISN Hypothetical 102.8 kDa protein
           y4gI.>gb:AE000074_19686 Rhizobium sp. NGR234 plasmid
           pNGR234a, section 11 of 46 of the complete plasmid
           sequence.
          Length = 909

 Score = 33.1 bits (74), Expect = 4.1
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = -3

Query: 353 LCYSIEHSGFHSLWCPWALLYSAVP*SSRGDED 255
           LC  +  +G++++W PWA LY     +SRG ED
Sbjct: 824 LCLKVRAAGYNNVWTPWAELYHHES-ASRGHED 855


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 613,571,773
Number of Sequences: 1806583
Number of extensions: 12699794
Number of successful extensions: 29848
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 29057
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29841
length of database: 581,917,975
effective HSP length: 119
effective length of database: 366,934,598
effective search space used: 34124917614
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)