BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig532
         (794 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY034946_1559728 Arabidopsis thaliana unknown protein (At5g13...   213   3e-54   
pir|T48566|T48566 hypothetical protein T31B5.10 - Arabidopsis th...   204   2e-51   Arabidopsis thaliana [mouse-ear cress]
gb:AP005497_1852874 Oryza sativa (japonica cultivar-group) genom...   193   3e-48   
gb:CELUNC52X_1366082 Caenorhabditis elegans basement membrane pr...    38   0.19    
gb:CEC38C6_1361090 Caenorhabditis elegans cosmid C38C6, complete...    38   0.19    
gb:CEC38C6_1361088 Caenorhabditis elegans cosmid C38C6, complete...    38   0.19    
pir|C88369|C88369 protein unc-52 [imported] - Caenorhabditis ele...    38   0.19    Caenorhabditis elegans [roundworm]
sp|Q06561|UN52_CAEEL|UN52_CAEEL Basement membrane proteoglycan precursor (P...    38   0.19    Caenorhabditis elegans [roundworm]
gb:AB058634_2462780 Gallus gallus SIMPLE mRNA for small integral...    36   0.95    
gb:AK018578_1159633 Mus musculus adult male colon cDNA, RIKEN fu...    36   0.95    
gb:AE013599_1133347 Drosophila melanogaster chromosome 2R, compl...    35   1.2     
gb:AC116957_1206647 Dictyostelium discoideum chromosome 2 map 16...    34   3.6     
pir|A59249|A59249 class VII unconventional myosin - slime mold (...    34   3.6     Dictyostelium discoideum
gb:BC061403_2553177 Xenopus tropicalis hypothetical protein MGC7...    33   4.7     
gb:BX908798_830138 Parachlamydia-related symbiont UWE25, complet...    33   4.7     
gb:AF083918_477777 Pseudomonas syringae pv. cilantro avirulence ...    33   4.7     
gb:AF466204_1802277 Sorghum bicolor clone SBTXS_0045I19, partial...    33   6.1     
gb:AF322140_1786094 Sorghum bicolor specimen-voucher PI 302105 t...    33   6.1     
gb:AF322132_1786086 Sorghum bicolor teosinte branched1 protein (...    33   6.1     
gb:AE013599_1133352 Drosophila melanogaster chromosome 2R, compl...    33   6.1     
gb:AY603426_635520 Pseudomonas syringae pv. phaseolicola strain ...    33   8.0     
gb:PSU87228_161906 Pseudomonas syringae pv. phaseolicola avrD ge...    33   8.0     
gb:PSU87227_161905 Pseudomonas syringae pv. glycinea avrD gene, ...    33   8.0     
gb:PSU87226_161904 Pseudomonas syringae pv. glycinea avrD gene, ...    33   8.0     
gb:PSU87225_161903 Pseudomonas syringae pv. glycinea avrD gene, ...    33   8.0     
gb:PSEAL2AVRD_160293 Pseudomonas syringae pv. lachrymans (avrD) ...    33   8.0     


>gb:AY034946_1559728 Arabidopsis thaliana unknown protein
           (At5g13190) mRNA, complete cds.>gb:AY062988_1565575
           Arabidopsis thaliana unknown protein (At5g13190) mRNA,
           complete cds.>gb:AY088302_1573322 Arabidopsis thaliana
           clone 5392 mRNA, complete sequence.
          Length = 134

 Score =  213 bits (542), Expect = 3e-54
 Identities = 89/121 (73%), Positives = 105/121 (86%)
 Frame = +2

Query: 149 FVQENPYQAGVIPPNAIVGDPKGIPIQQTMYRDTPAPFNCIHCGNSGLTLVKSKPSLAAC 328
           +  +NPYQAG++PPNAI GDP G PIQQT+YRDTPAPFNC++CGN+GLT ++SKP +AA 
Sbjct: 14  YAGQNPYQAGIVPPNAIYGDPLGAPIQQTIYRDTPAPFNCLYCGNTGLTNLRSKPGVAAV 73

Query: 329 VGCMMPMMLGVCFLCPSMDCLWHKYHYCPSCNEKVADFEKSDPCIVVDPPQWKELSFALP 508
           V CMMP MLG CFLCPSMDCLW+K H+CP C  KVADFEKSDPC+V+DPPQWK+ SFALP
Sbjct: 74  VACMMPFMLGFCFLCPSMDCLWNKQHHCPQCGNKVADFEKSDPCLVMDPPQWKQPSFALP 133

Query: 509 A 511
           A
Sbjct: 134 A 134



>pir|T48566|T48566 hypothetical protein T31B5.10 - Arabidopsis
           thaliana>gb:ATT31B5_1555821 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T31B5 (ESSA project).
          Length = 146

 Score =  204 bits (519), Expect = 2e-51
 Identities = 89/133 (66%), Positives = 105/133 (78%), Gaps = 12/133 (9%)
 Frame = +2

Query: 149 FVQENPYQAGVIPPNAIVGDPKGIPIQQTMYRDTPAPFNCIHCGNSGLTLVKSKPSLAAC 328
           +  +NPYQAG++PPNAI GDP G PIQQT+YRDTPAPFNC++CGN+GLT ++SKP +AA 
Sbjct: 14  YAGQNPYQAGIVPPNAIYGDPLGAPIQQTIYRDTPAPFNCLYCGNTGLTNLRSKPGVAAV 73

Query: 329 VGCMMPMMLGVCFLCPSMDCLWHKYHYCPSCNEK------------VADFEKSDPCIVVD 472
           V CMMP MLG CFLCPSMDCLW+K H+CP C  K            VADFEKSDPC+V+D
Sbjct: 74  VACMMPFMLGFCFLCPSMDCLWNKQHHCPQCGNKVLLYVFFMPATRVADFEKSDPCLVMD 133

Query: 473 PPQWKELSFALPA 511
           PPQWK+ SFALPA
Sbjct: 134 PPQWKQPSFALPA 146



>gb:AP005497_1852874 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBb0071O21.
          Length = 154

 Score =  193 bits (491), Expect = 3e-48
 Identities = 89/151 (58%), Positives = 109/151 (72%), Gaps = 1/151 (0%)
 Frame = +2

Query: 62  EEPAIGIXXXXXXXXXXXXXXXXXXXXXXFVQENPYQAGVIPPNAI-VGDPKGIPIQQTM 238
           +EPAIGI                      +   +PY AG+ PPNAI  G PKG+P+QQTM
Sbjct: 13  DEPAIGIPYHPAAAGAQGGY---------YYAPDPYAAGMPPPNAIYAGAPKGVPLQQTM 63

Query: 239 YRDTPAPFNCIHCGNSGLTLVKSKPSLAACVGCMMPMMLGVCFLCPSMDCLWHKYHYCPS 418
           +RDTPAPF+C  CG + ++ ++SKPSLA+ V CMMP M+GVCFLCPSMDCLWHKYHYCPS
Sbjct: 64  FRDTPAPFHCQACGAAAVSSLRSKPSLASVVACMMPFMMGVCFLCPSMDCLWHKYHYCPS 123

Query: 419 CNEKVADFEKSDPCIVVDPPQWKELSFALPA 511
           C EKVA+F+KSDPC+VVDP +W E SFA+PA
Sbjct: 124 CGEKVAEFKKSDPCLVVDPTRWSEPSFAVPA 154



>gb:CELUNC52X_1366082 Caenorhabditis elegans basement membrane
            proteoglycan (unc-52) homologous gene, exons 1-25,
            complete cds.
          Length = 2481

 Score = 38.1 bits (87), Expect = 0.19
 Identities = 24/56 (42%), Positives = 29/56 (51%), Gaps = 5/56 (8%)
 Frame = +2

Query: 161  NPYQAGVIPPNAI-----VGDPKGIPIQQTMYRDTPAPFNCIHCGNSGLTLVKSKP 313
            N Y  G  PP  +     V  PK  PI+QT+ RD PA F C   GNS + L  S+P
Sbjct: 1297 NQYGTGQSPPAVLEVKKPVIPPKVDPIRQTVDRDQPARFKCWVPGNSNVQLRWSRP 1352



>gb:CEC38C6_1361090 Caenorhabditis elegans cosmid C38C6, complete
            sequence.>gb:CEZC101_1371227 Caenorhabditis elegans
            cosmid ZC101, complete sequence.
          Length = 2389

 Score = 38.1 bits (87), Expect = 0.19
 Identities = 24/56 (42%), Positives = 29/56 (51%), Gaps = 5/56 (8%)
 Frame = +2

Query: 161  NPYQAGVIPPNAI-----VGDPKGIPIQQTMYRDTPAPFNCIHCGNSGLTLVKSKP 313
            N Y  G  PP  +     V  PK  PI+QT+ RD PA F C   GNS + L  S+P
Sbjct: 1205 NQYGTGQSPPAVLEVKKPVIPPKVDPIRQTVDRDQPARFKCWVPGNSNVQLRWSRP 1260



>gb:CEC38C6_1361088 Caenorhabditis elegans cosmid C38C6, complete
            sequence.>gb:CEZC101_1371229 Caenorhabditis elegans
            cosmid ZC101, complete sequence.
          Length = 2482

 Score = 38.1 bits (87), Expect = 0.19
 Identities = 24/56 (42%), Positives = 29/56 (51%), Gaps = 5/56 (8%)
 Frame = +2

Query: 161  NPYQAGVIPPNAI-----VGDPKGIPIQQTMYRDTPAPFNCIHCGNSGLTLVKSKP 313
            N Y  G  PP  +     V  PK  PI+QT+ RD PA F C   GNS + L  S+P
Sbjct: 1298 NQYGTGQSPPAVLEVKKPVIPPKVDPIRQTVDRDQPARFKCWVPGNSNVQLRWSRP 1353



>pir|C88369|C88369 protein unc-52 [imported] - Caenorhabditis
            elegans>gb:CEC38C6_1361089 Caenorhabditis elegans cosmid
            C38C6, complete sequence.>gb:CEZC101_1371228
            Caenorhabditis elegans cosmid ZC101, complete sequence.
          Length = 2295

 Score = 38.1 bits (87), Expect = 0.19
 Identities = 24/56 (42%), Positives = 29/56 (51%), Gaps = 5/56 (8%)
 Frame = +2

Query: 161  NPYQAGVIPPNAI-----VGDPKGIPIQQTMYRDTPAPFNCIHCGNSGLTLVKSKP 313
            N Y  G  PP  +     V  PK  PI+QT+ RD PA F C   GNS + L  S+P
Sbjct: 1298 NQYGTGQSPPAVLEVKKPVIPPKVDPIRQTVDRDQPARFKCWVPGNSNVQLRWSRP 1353



>sp|Q06561|UN52_CAEEL Basement membrane proteoglycan precursor
            (Perlecan homolog) (Uncoordinated protein
            52).>pir|T19821|T19821 hypothetical protein ZC101.2e -
            Caenorhabditis elegans>gb:CEC38C6_1361087 Caenorhabditis
            elegans cosmid C38C6, complete
            sequence.>gb:CEZC101_1371230 Caenorhabditis elegans
            cosmid ZC101, complete sequence.
          Length = 3375

 Score = 38.1 bits (87), Expect = 0.19
 Identities = 24/56 (42%), Positives = 29/56 (51%), Gaps = 5/56 (8%)
 Frame = +2

Query: 161  NPYQAGVIPPNAI-----VGDPKGIPIQQTMYRDTPAPFNCIHCGNSGLTLVKSKP 313
            N Y  G  PP  +     V  PK  PI+QT+ RD PA F C   GNS + L  S+P
Sbjct: 1298 NQYGTGQSPPAVLEVKKPVIPPKVDPIRQTVDRDQPARFKCWVPGNSNVQLRWSRP 1353



>gb:AB058634_2462780 Gallus gallus SIMPLE mRNA for small integral
           membrane protein of lysosome/late endosome, complete
           cds.>gb:AB061737_2462918 Gallus gallus SIMPLE gene for
           small integral membrane protein of lysosome/late
           endosome, complete cds.>gb:AY765397_2546135 Gallus
           gallus TNF-alpha factor mRNA, complete cds.
          Length = 148

 Score = 35.8 bits (81), Expect = 0.95
 Identities = 21/101 (20%), Positives = 43/101 (42%), Gaps = 6/101 (5%)
 Frame = +2

Query: 164 PYQAGVIPPNAIVGDPKGIPIQQ--TMYRDTPAPFNCIHCGNSGLTLVKSKPSLAACVGC 337
           P  +G   P +     + + +QQ   ++ D P   +C  C    +T +  +      + C
Sbjct: 47  PQYSGQPMPTSTPVTVQTVYVQQPVVLFYDRPVQMSCPSCNQMIVTRLCYESGALTWLSC 106

Query: 338 ----MMPMMLGVCFLCPSMDCLWHKYHYCPSCNEKVADFEK 448
               ++  + G C +   +D L    H+CP+CN  V  +++
Sbjct: 107 GGLFLLGCIAGCCLIPFCVDALKDVEHFCPNCNAHVGSYKR 147



>gb:AK018578_1159633 Mus musculus adult male colon cDNA, RIKEN
           full-length enriched library, clone:9030625G09
           product:LPS-induced TNF-alpha factor, full insert
           sequence.>gb:AK076162_1171277 Mus musculus 14, 17 days
           embryo head cDNA, RIKEN full-length enriched library,
           clone:3222402J11 product:LPS-induced TNF-alpha factor,
           full insert sequence.>gb:AF171100_2057693 Mus musculus
           TBX1 protein mRNA, complete cds.>gb:AF230522_2060023 Mus
           musculus LITAF-like protein mRNA, complete
           cds.>gb:BC018559_2092780 Mus musculus LPS-induced TN
           factor, mRNA (cDNA clone MGC:6569 IMAGE:2812674),
           complete cds.
          Length = 161

 Score = 35.8 bits (81), Expect = 0.95
 Identities = 23/99 (23%), Positives = 41/99 (41%), Gaps = 5/99 (5%)
 Frame = +2

Query: 167 YQAGVIPPNAIVGDPKGIPIQQTM-YRDTPAPFNCIHCGNSGLTLVKSKPSLAACVGC-- 337
           Y   V  PNA     + + +QQ + + D P    C  C    +T +         + C  
Sbjct: 62  YTQPVPVPNANAIAVQTVYVQQPVSFYDRPVQMCCPSCSKMIVTQLSYNAGALTWLSCGS 121

Query: 338 --MMPMMLGVCFLCPSMDCLWHKYHYCPSCNEKVADFEK 448
             ++  + G CF+   +D L    HYCP+C   +  +++
Sbjct: 122 LCLLGCVAGCCFIPFCVDALQDVDHYCPNCKALLGTYKR 160



>gb:AE013599_1133347 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003458_1210646 Drosophila melanogaster
           chromosome 2R, section 66 of 74 of the complete
           sequence.
          Length = 129

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 4/69 (5%)
 Frame = +2

Query: 251 PAPFNCIHCGNSGLTLVKSKPSLAACVGCMMPMMLGVCFLCPS----MDCLWHKYHYCPS 418
           P    C  C    LT VKS PS       ++ + L +C+ C      MD   +  HYCP+
Sbjct: 61  PTRIRCPSCHAEVLTTVKSTPSGRTHCWALI-LCLFICWPCVCLPYCMDSCQNANHYCPN 119

Query: 419 CNEKVADFE 445
           C+  +  +E
Sbjct: 120 CSAYIGTYE 128



>gb:AC116957_1206647 Dictyostelium discoideum chromosome 2 map
            1685067-2090751 strain AX4, complete sequence.
          Length = 2357

 Score = 33.9 bits (76), Expect = 3.6
 Identities = 19/40 (47%), Positives = 24/40 (60%)
 Frame = -3

Query: 468  TTIQGSDFSKSATFSLQLGQ**YLCQRQSIEGQRKQTPSI 349
            TTIQ SD SKS   S Q     ++ QR ++ G RKQ PS+
Sbjct: 1269 TTIQQSDVSKSVKDSAQASY--FILQRFTLNGARKQVPSV 1306



>pir|A59249|A59249 class VII unconventional myosin - slime mold
            (Dictyostelium discoideum)>gb:DDMYOVII_1377218
            Dictyostelium discoideum class VII unconventional myosin
            (myoI) gene, complete cds.
          Length = 2357

 Score = 33.9 bits (76), Expect = 3.6
 Identities = 19/40 (47%), Positives = 24/40 (60%)
 Frame = -3

Query: 468  TTIQGSDFSKSATFSLQLGQ**YLCQRQSIEGQRKQTPSI 349
            TTIQ SD SKS   S Q     ++ QR ++ G RKQ PS+
Sbjct: 1269 TTIQQSDVSKSVKDSAQASY--FILQRFTLNGARKQVPSV 1306



>gb:BC061403_2553177 Xenopus tropicalis hypothetical protein
           MGC75991, mRNA (cDNA clone MGC:75991 IMAGE:5384451),
           complete cds.
          Length = 148

 Score = 33.5 bits (75), Expect = 4.7
 Identities = 26/81 (32%), Positives = 41/81 (50%), Gaps = 6/81 (7%)
 Frame = +2

Query: 224 IQQTM-YRDTPAPFNCIHCGNSGLT--LVKSKPSLA--ACVG-CMMPMMLGVCFLCPSMD 385
           +QQ M   D P    C  C NS +T  L  S  +LA  +C G C++  + G C +   +D
Sbjct: 68  VQQAMTLYDRPVQMCCRSC-NSMITTRLEYSSGALAWLSCGGLCLLGCIGGCCLIPFCID 126

Query: 386 CLWHKYHYCPSCNEKVADFEK 448
            L    HYCP+C+  +  +++
Sbjct: 127 SLKDVDHYCPNCHALLGSYKR 147



>gb:BX908798_830138 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 290

 Score = 33.5 bits (75), Expect = 4.7
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 2/49 (4%)
 Frame = +2

Query: 365 FLCPSMDCLWHKYHYCPSCNEKVAD-FEKSDPCIVVDPP-QWKELSFAL 505
           F+   +D LW ++ Y  SC E +A+   KS  C++ D    W E+ F L
Sbjct: 155 FVYEHLDRLWERFKYTQSCREIIAECMNKSKECLMFDQNLPWLEIFFEL 203



>gb:AF083918_477777 Pseudomonas syringae pv. cilantro avirulence D
           protein (avrD) gene, complete cds.
          Length = 311

 Score = 33.5 bits (75), Expect = 4.7
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 2/69 (2%)
 Frame = +2

Query: 488 ELSFALPA*SISNCCPYSIVLNCHSIHSSIKYSFLVDELIYSPAVFFT*VFVKYGTES-- 661
           +L F +PA         S   +C+S+H   +  F+ D + YSP    + +FV Y  E   
Sbjct: 145 QLEFIMPAAHEIETVKDSAEKSCYSLHFKNRTQFIDDIIFYSPLNAISTLFVAYDKEPNF 204

Query: 662 IPSYIEVRY 688
           +P  IE  Y
Sbjct: 205 LPGGIEANY 213



>gb:AF466204_1802277 Sorghum bicolor clone SBTXS_0045I19, partial
           sequence.
          Length = 370

 Score = 33.1 bits (74), Expect = 6.1
 Identities = 12/39 (30%), Positives = 20/39 (51%)
 Frame = +2

Query: 173 AGVIPPNAIVGDPKGIPIQQTMYRDTPAPFNCIHCGNSG 289
           A  IPP A++  P+ +P+Q  M +    P   + C + G
Sbjct: 53  AAAIPPQAVINSPEDLPVQPLMEQAPAPPTELVACASGG 91



>gb:AF322140_1786094 Sorghum bicolor specimen-voucher PI 302105
           teosinte branched1 protein (tb1) gene, partial cds.
          Length = 358

 Score = 33.1 bits (74), Expect = 6.1
 Identities = 12/39 (30%), Positives = 20/39 (51%)
 Frame = +2

Query: 173 AGVIPPNAIVGDPKGIPIQQTMYRDTPAPFNCIHCGNSG 289
           A  IPP A++  P+ +P+Q  M +    P   + C + G
Sbjct: 68  AAAIPPQAVINSPEDLPVQPLMEQAPAPPTELVACASGG 106



>gb:AF322132_1786086 Sorghum bicolor teosinte branched1 protein
           (tb1) gene, partial cds.
          Length = 358

 Score = 33.1 bits (74), Expect = 6.1
 Identities = 12/39 (30%), Positives = 20/39 (51%)
 Frame = +2

Query: 173 AGVIPPNAIVGDPKGIPIQQTMYRDTPAPFNCIHCGNSG 289
           A  IPP A++  P+ +P+Q  M +    P   + C + G
Sbjct: 68  AAAIPPQAVINSPEDLPVQPLMEQAPAPPTELVACASGG 106



>gb:AE013599_1133352 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003458_1210651 Drosophila melanogaster
           chromosome 2R, section 66 of 74 of the complete
           sequence.
          Length = 144

 Score = 33.1 bits (74), Expect = 6.1
 Identities = 19/74 (25%), Positives = 31/74 (41%), Gaps = 4/74 (5%)
 Frame = +2

Query: 239 YRDTPAPFNCIHCGNSGLTLVKSKPS----LAACVGCMMPMMLGVCFLCPSMDCLWHKYH 406
           Y   P    C +C N   T V  KP+    L A + C+  +   VC       C+ +  H
Sbjct: 71  YGPEPMDVQCPYCHNYARTRVSFKPNSRTHLIALILCLFQLYCCVCLPYCISSCM-NTNH 129

Query: 407 YCPSCNEKVADFEK 448
           YC  C+  +  +++
Sbjct: 130 YCGMCDRYLGTYDR 143



>gb:AY603426_635520 Pseudomonas syringae pv. phaseolicola strain
           1449B plasmid pAV520, partial sequence.
          Length = 311

 Score = 32.7 bits (73), Expect = 8.0
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 2/69 (2%)
 Frame = +2

Query: 488 ELSFALPA*SISNCCPYSIVLNCHSIHSSIKYSFLVDELIYSPAVFFT*VFVKYGTES-- 661
           +L F +PA    +    S   NC+S+H   +  F+ D + YSP    + +FV    E   
Sbjct: 145 QLEFIIPAAHEVDTIKDSTEKNCYSLHFKNRTQFIDDIIFYSPLNAISKLFVANDNEPHF 204

Query: 662 IPSYIEVRY 688
           +P  IE  Y
Sbjct: 205 LPGGIEANY 213



>gb:PSU87228_161906 Pseudomonas syringae pv. phaseolicola avrD gene,
           complete cds.
          Length = 311

 Score = 32.7 bits (73), Expect = 8.0
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 2/69 (2%)
 Frame = +2

Query: 488 ELSFALPA*SISNCCPYSIVLNCHSIHSSIKYSFLVDELIYSPAVFFT*VFVKYGTES-- 661
           +L F +PA    +    S   NC+S+H   +  F+ D + YSP    + +FV    E   
Sbjct: 145 QLEFIIPAAHEVDTIKDSTEKNCYSLHFKNRTQFIDDIIFYSPLNAISKLFVANDNEPHF 204

Query: 662 IPSYIEVRY 688
           +P  IE  Y
Sbjct: 205 LPGGIEANY 213



>gb:PSU87227_161905 Pseudomonas syringae pv. glycinea avrD gene,
           complete cds.
          Length = 311

 Score = 32.7 bits (73), Expect = 8.0
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 2/69 (2%)
 Frame = +2

Query: 488 ELSFALPA*SISNCCPYSIVLNCHSIHSSIKYSFLVDELIYSPAVFFT*VFVKYGTES-- 661
           +L F +PA    +    S   NC+S+H   +  F+ D + YSP    + +FV    E   
Sbjct: 145 QLEFIIPAAHEVDTIKDSTEKNCYSLHFKNRTQFIDDIIFYSPLNAISKLFVANDNEPHF 204

Query: 662 IPSYIEVRY 688
           +P  IE  Y
Sbjct: 205 LPGGIEANY 213



>gb:PSU87226_161904 Pseudomonas syringae pv. glycinea avrD gene,
           complete cds.
          Length = 311

 Score = 32.7 bits (73), Expect = 8.0
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 2/69 (2%)
 Frame = +2

Query: 488 ELSFALPA*SISNCCPYSIVLNCHSIHSSIKYSFLVDELIYSPAVFFT*VFVKYGTES-- 661
           +L F +PA    +    S   NC+S+H   +  F+ D + YSP    + +FV    E   
Sbjct: 145 QLEFIIPAAHEVDTIKDSTEKNCYSLHFKNRTQFIDDIIFYSPLNAISKLFVANDNEPHF 204

Query: 662 IPSYIEVRY 688
           +P  IE  Y
Sbjct: 205 LPGGIEANY 213



>gb:PSU87225_161903 Pseudomonas syringae pv. glycinea avrD gene,
           complete cds.
          Length = 293

 Score = 32.7 bits (73), Expect = 8.0
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 2/69 (2%)
 Frame = +2

Query: 488 ELSFALPA*SISNCCPYSIVLNCHSIHSSIKYSFLVDELIYSPAVFFT*VFVKYGTES-- 661
           +L F +PA    +    S   NC+S+H   +  F+ D + YSP    + +FV    E   
Sbjct: 145 QLEFIIPAAHEVDTIKDSTEKNCYSLHFKNRTQFIDDIIFYSPLNAISKLFVANDNEPHF 204

Query: 662 IPSYIEVRY 688
           +P  IE  Y
Sbjct: 205 LPGGIEANY 213



>gb:PSEAL2AVRD_160293 Pseudomonas syringae pv. lachrymans (avrD)
           gene, allele 2, partial cds.
          Length = 311

 Score = 32.7 bits (73), Expect = 8.0
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 2/69 (2%)
 Frame = +2

Query: 488 ELSFALPA*SISNCCPYSIVLNCHSIHSSIKYSFLVDELIYSPAVFFT*VFVKYGTES-- 661
           +L F +PA    +    S   NC+S+H   +  F+ D + YSP    + +FV    E   
Sbjct: 145 QLEFIIPAAHEVDTIKDSTEKNCYSLHFKNRTQFIDDIIFYSPLNAISKLFVANDNEPHF 204

Query: 662 IPSYIEVRY 688
           +P  IE  Y
Sbjct: 205 LPGGIEANY 213


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 822,820,012
Number of Sequences: 1806583
Number of extensions: 17477900
Number of successful extensions: 53194
Number of sequences better than 10.0: 26
Number of HSP's better than 10.0 without gapping: 51057
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 53174
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 51335108558
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)