BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig524
         (677 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF417576_1798295 Euphorbia esula growth-on protein GRO10 (Gro...   291   9e-78   
gb:AY086545_1571593 Arabidopsis thaliana clone 2571 mRNA, comple...   270   1e-71   
gb:AY062807_1565463 Arabidopsis thaliana Unknown protein (At1g63...   270   1e-71   
pir|H96661|H96661 unknown protein, 50290-46846 [imported] - Arab...   270   1e-71   Arabidopsis thaliana [mouse-ear cress]
gb:AP005750_1857151 Oryza sativa (japonica cultivar-group) genom...   226   3e-58   
gb:AP004026_1836553 Oryza sativa (japonica cultivar-group) genom...   220   2e-56   
gb:AF417575_1798294 Euphorbia esula growth-on protein GRO11 (Gro...   213   2e-54   
pir|D86147|D86147 T1N6.3 protein - Arabidopsis thaliana>gb:AE005...   142   5e-33   Arabidopsis thaliana [mouse-ear cress]
pir|F84861|F84861 hypothetical protein At2g43070 [imported] - Ar...   125   5e-28   Arabidopsis thaliana [mouse-ear cress]
pir|H86192|H86192 hypothetical protein [imported] - Arabidopsis ...   124   2e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AP003433_1829282 Oryza sativa (japonica cultivar-group) genom...   113   3e-24   
gb:AF161719_1773417 Triticum aestivum vacuolar targeting recepto...    52   7e-06   
gb:AB056693_1521665 Vigna mungo VmVSR mRNA for vacuolar sorting ...    52   1e-05   
gb:AE015813_318119 Shewanella oneidensis MR-1 section 362 of 457...    50   3e-05   
gb:AE011999_278428 Xanthomonas axonopodis pv. citri str. 306, se...    50   5e-05   
gb:AF083788_1767018 Arabidopsis thaliana clone sps857 unknown mRNA.    49   6e-05   
gb:ATU79959_1557291 Arabidopsis thaliana vacuolar sorting recept...    49   6e-05   
pir|T47542|T47542 Spot 3 protein and vacuolar sorting receptor h...    49   6e-05   Arabidopsis thaliana [mouse-ear cress]
gb:BA000045_743162 Gloeobacter violaceus PCC 7421 DNA, complete ...    49   8e-05   
pir|T00044|T00044 vacuolar sorting receptor protein homolog PV72...    49   8e-05   
gb:AE012167_279956 Xanthomonas campestris pv. campestris str. AT...    49   1e-04   
pir|F84706|F84706 probable vacuolar sorting receptor [imported] ...    49   1e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AP005099_1847785 Oryza sativa (japonica cultivar-group) genom...    48   1e-04   
gb:AC079634_1732667 Genomic Sequence for Oryza sativa, Nipponbar...    48   1e-04   
gb:AE016959_1021991 Oryza sativa (japonica cultivar-group) chrom...    48   1e-04   
pir|T04895|T04895 vacuolar sorting receptor protein homolog F18F...    48   2e-04   Arabidopsis thaliana [mouse-ear cress]
gb:BC060718_2104164 Mus musculus RIKEN cDNA 2310050N11 gene, mRN...    47   3e-04   
gb:AY048289_1561750 Arabidopsis thaliana AT3g52850/F8J2_20 mRNA,...    47   4e-04   
gb:HSDJ53A19_2012196 Human DNA sequence from clone RP1-53A19 on ...    46   5e-04   
gb:AY136303_1581804 Arabidopsis thaliana vacuolar sorting recept...    46   5e-04   
gb:HSM800950_1185996 Homo sapiens mRNA; cDNA DKFZp434N126 (from ...    46   5e-04   
pir|T17236|T17236 hypothetical protein DKFZp434N126.1 - human (f...    46   5e-04   Homo sapiens [man]
sp|Q9BZQ6|C122_HUMAN|C122_HUMAN Putative alpha-mannosidase C1orf22 (EC 3.2....    46   5e-04   Homo sapiens [man]
gb:AP003628_1831708 Oryza sativa (japonica cultivar-group) genom...    46   7e-04   
gb:BC072826_2556753 Xenopus laevis MGC80179 protein, mRNA (cDNA ...    45   9e-04   
pir|T02604|T02604 probable vacuolar sorting receptor [imported] ...    45   9e-04   Arabidopsis thaliana [mouse-ear cress]
pir|T02602|T02602 vacuolar sorting receptor protein homolog At2g...    45   9e-04   Arabidopsis thaliana [mouse-ear cress]
pir|B75587|B75587 probable N-glycosidase F - Deinococcus radiodu...    45   0.001   Deinococcus radiodurans
gb:CEZC506_1371361 Caenorhabditis elegans cosmid ZC506, complete...    45   0.002   
gb:AE013201_290160 Thermoanaerobacter tengcongensis MB4, section...    45   0.002   
pir|T00476|T00476 probable vacuolar sorting receptor [imported] ...    45   0.002   Arabidopsis thaliana [mouse-ear cress]
pir|T27626|T27626 hypothetical protein ZC506.2 - Caenorhabditis ...    45   0.002   Caenorhabditis elegans [roundworm]
gb:ATU79960_1557292 Arabidopsis thaliana vacuolar sorting recept...    44   0.003   
sp|P25152|YWAD_BACSU|YWAD_BACSU Hypothetical peptidase ywaD precursor (EC 3...    44   0.003   Bacillus subtilis
pir|T06794|T06794 vacuolar sorting receptor protein BP-80 - gard...    43   0.004   Pisum sativum [garden pea]
gb:AY524793_1611535 Verticillium dahliae subtilisin-like serine ...    43   0.006   
gb:OSJN00088_1694688 Oryza sativa genomic DNA, chromosome 4, BAC...    42   0.010   
gb:HAN311314_1681463 Helianthus annuus partial elrs1 gene for pu...    42   0.013   
gb:AE017351_1759584 Cryptococcus neoformans var. neoformans JEC2...    41   0.017   
pir|T16827|T16827 hypothetical protein T07F12.2 - Caenorhabditis...    41   0.022   Caenorhabditis elegans [roundworm]
gb:AB033040_1866220 Homo sapiens mRNA for KIAA1214 protein, part...    39   0.064   
gb:AX136241_1461999 Sequence 163 from Patent EP1067182.>gb:AK075...    39   0.064   
gb:U29154_1402709 Caenorhabditis elegans cosmid T07F12, complete...    39   0.064   
gb:BA000028_697319 Oceanobacillus iheyensis HTE831 DNA, complete...    39   0.064   
sp|Q8TCT8|PSL2_HUMAN|PSL2_HUMAN Signal peptide peptidase-like 2A (EC 3.4.99...    39   0.064   Homo sapiens [man]
gb:MAN419628_1685623 Metarhizium anisopliae var. anisopliae pr1C...    39   0.084   
gb:AX005312_1456030 Sequence 431 from Patent WO9909186.                39   0.084   
gb:AE017206_405174 Lactobacillus johnsonii NCC 533, section 7 of...    39   0.084   
gb:AE000516_20426 Mycobacterium tuberculosis CDC1551, complete g...    39   0.084   
pir|H70629|H70629 probable AMINOPEPTIDASE - Mycobacterium tuberc...    39   0.084   Mycobacterium tuberculosis
gb:AE013599_1133423 Drosophila melanogaster chromosome 2R, compl...    39   0.11    
gb:BA000028_697370 Oceanobacillus iheyensis HTE831 DNA, complete...    39   0.11    
gb:BC070658_2555633 Xenopus laevis hypothetical protein LOC43198...    38   0.19    
gb:AF133727_482029 Lactobacillus helveticus cell envelope-associ...    38   0.19    
pir|B83278|B83278 probable aminopeptidase PA2939 [imported] - Ps...    38   0.19    Pseudomonas aeruginosa
gb:BX908808_1644536 Neurospora crassa DNA linkage group IV Cosmi...    37   0.24    
gb:SAPURCLUS_171797 S.alboniger napH, pur7, pur10, pur6, pur4, p...    37   0.24    
pir|G86434|G86434 protein F17F8.23 [imported] - Arabidopsis thal...    37   0.24    Arabidopsis thaliana [mouse-ear cress]
gb:AY119116_1300838 Drosophila melanogaster RE16431 full insert ...    37   0.32    
gb:AE014134_1128992 Drosophila melanogaster chromosome 2L, compl...    37   0.32    
gb:AF243528_492091 Streptococcus thermophilus cell envelope prot...    37   0.32    
gb:AE017241_414611 Mycobacterium avium subsp. paratuberculosis s...    37   0.32    
sp|Q02470|P2P_LACPA|P2P_LACPA PII-type proteinase precursor (EC 3.4.21.96)...    37   0.41    Lactobacillus paracasei
gb:AF468027_513919 Lactobacillus pentosus cell-envelope proteina...    36   0.54    
pir|B45764|B45764 lactocepin (EC 3.4.21.96) precursor [validated...    36   0.54    Lactococcus lactis subsp. cremoris
sp|P15293|P2P_LACLC|P2P_LACLC PII-type proteinase precursor (EC 3.4.21.96)...    36   0.54    Lactococcus lactis subsp. cremoris
sp|P16271|P1P_LACLC|P1P_LACLC PI-type proteinase precursor (EC 3.4.21.-) (...    36   0.54    Lactococcus lactis subsp. cremoris
gb:BC056113_2551695 Xenopus laevis hypothetical protein MGC69137...    36   0.71    
gb:AY436357_1606119 Aspergillus fumigatus LAP1 gene, complete cds.     36   0.71    
gb:AY231873_1177166 Drosophila yakuba clone yak-em_CG9849 mRNA s...    36   0.71    
gb:AF247159_492447 Lactococcus lactis subsp. cremoris plasmid pH...    36   0.71    
gb:AX119103_1461609 Sequence 267 from Patent WO0129221.>gb:AY358...    35   0.92    
gb:AK006658_1153673 Mus musculus adult male testis cDNA, RIKEN f...    35   0.92    
gb:LDE512946_140281 Lactobacillus delbrueckii subsp. lactis prtB...    35   0.92    
gb:AE014297_1138178 Drosophila melanogaster chromosome 3R, compl...    35   1.2     
gb:BC026578_2095432 Mus musculus RIKEN cDNA 2010106G01 gene, mRN...    35   1.6     
gb:BT002840_1636433 Arabidopsis thaliana clone RAFL15-01-I16 (R2...    35   1.6     
pir|G86150|G86150 F22M8.3 protein - Arabidopsis thaliana>gb:AE00...    35   1.6     Arabidopsis thaliana [mouse-ear cress]
gb:BC025401_1978499 Homo sapiens intramembrane protease 5, mRNA ...    34   2.1     
gb:BC022041_1977675 Homo sapiens intramembrane protease 5, mRNA ...    34   2.1     
gb:AY169316_1937683 Homo sapiens intramembrane protease (IMP5) g...    34   2.1     
gb:AY337316_611080 Lactobacillus delbrueckii subsp. lactis cell ...    34   2.1     
gb:AE015634_316305 Shewanella oneidensis MR-1 section 183 of 457...    34   2.1     
sp|Q9JJF9|PSL2_MOUSE|PSL2_MOUSE Signal peptide peptidase-like 2A (EC 3.4.99...    34   2.1     Mus musculus [mouse]
gb:AY190520_2078838 Rattus norvegicus Sprague-Dawley liver r-gol...    34   2.7     
gb:AL627187_2071579 Mouse DNA sequence from clone RP23-319B15 on...    34   2.7     
gb:AL627187_2071578 Mouse DNA sequence from clone RP23-319B15 on...    34   2.7     
gb:AF171875_2057708 Mus musculus g1-related zinc finger protein ...    34   2.7     
gb:BC017100_1975908 Homo sapiens ring finger protein 130, mRNA (...    34   2.7     
gb:AX083330_1460809 Sequence 22 from Patent WO0112660.>gb:AY0839...    34   2.7     
pir|C70330|C70330 conserved hypothetical protein aq_340 - Aquife...    34   2.7     Aquifex aeolicus
gb:BC087132_2110022 Rattus norvegicus cDNA clone MGC:95005 IMAGE...    33   3.5     
gb:A67181_1450249 Sequence 1 from Patent EP0810289.                    33   3.5     
gb:A15841_1447632 clone SK112 ClaI-SalI downstream fragment of t...    33   3.5     
gb:AK077122_1171675 Mus musculus adult male testis cDNA, RIKEN f...    33   3.5     
pir|JC6032|JC6032 lactocepin (EC 3.4.21.96) precursor [similarit...    33   3.5     Lactobacillus delbrueckii
pir|A32634|A32634 lactocepin (EC 3.4.21.96) precursor [similarit...    33   3.5     Lactococcus lactis subsp. cremoris
sp|P15292|P3P_LACLC|P3P_LACLC PIII-type proteinase precursor (EC 3.4.21.96...    33   3.5     Lactococcus lactis subsp. cremoris
gb:BC056100_2551682 Xenopus laevis hypothetical protein MGC69113...    33   4.6     
gb:BC029264_1979439 Homo sapiens ring finger protein 148, mRNA (...    33   4.6     
gb:BC028391_1979251 Homo sapiens SPPL2b, mRNA (cDNA clone MGC:33...    33   4.6     
gb:AY169315_1937682 Homo sapiens intramembrane protease (IMP4) m...    33   4.6     
gb:AK098654_1915174 Homo sapiens cDNA FLJ25788 fis, clone TST06884.    33   4.6     
gb:AC005258_1874905 Homo sapiens chromosome 19, cosmid R30783 (L...    33   4.6     
gb:AB040965_1866894 Homo sapiens mRNA for KIAA1532 protein, part...    33   4.6     
gb:AX061659_1458692 Sequence 64 from Patent WO0100806.                 33   4.6     
gb:AE017278_425637 Bacillus cereus ATCC 10987, section 15 of 18 ...    33   4.6     
sp|Q8TCT7|PSL1_HUMAN|PSL1_HUMAN Signal peptide peptidase-like 2B (EC 3.4.99...    33   4.6     Homo sapiens [man]
gb:AP004685_1843358 Oryza sativa (japonica cultivar-group) genom...    33   6.0     
gb:AE017341_1753977 Cryptococcus neoformans var. neoformans JEC2...    33   6.0     
gb:AK008320_1154510 Mus musculus adult male small intestine cDNA...    33   6.0     
gb:AK008294_1154495 Mus musculus adult male small intestine cDNA...    33   6.0     
gb:AE017038_384533 Bacillus anthracis str. Ames section 15 of 18...    33   6.0     
gb:AE017012_379220 Bacillus cereus ATCC 14579 section 15 of 18 o...    33   6.0     
gb:BC044512_2548815 Danio rerio, Similar to SPPL2b, clone IMAGE:...    32   7.8     
gb:AE017352_1759873 Cryptococcus neoformans var. neoformans JEC2...    32   7.8     
gb:AY162834_593902 Streptococcus agalactiae CspA gene, complete ...    32   7.8     
gb:AE014284_307345 Streptococcus agalactiae 2603V/R section 94 o...    32   7.8     
gb:SAG766855_171536 Streptococcus agalactiae NEM316 complete gen...    32   7.8     
pir|F69998|F69998 hypothetical protein ytpI - Bacillus subtilis>...    32   7.8     Bacillus subtilis


>gb:AF417576_1798295 Euphorbia esula growth-on protein GRO10 (Gro10)
           mRNA, complete cds.
          Length = 537

 Score =  291 bits (744), Expect = 9e-78
 Identities = 143/166 (86%), Positives = 153/166 (92%)
 Frame = +3

Query: 180 PSAVTAGDIVHHDDLAPKKPGCENDFVLVKIQTWVDGVEDAEFVGVGARFGTTIVSKEKN 359
           P  V AGDIVH D  APKKPGCENDFVLVK+QTWV+G EDAEFVGVGARFGTTIVSKEKN
Sbjct: 19  PYYVIAGDIVHDDASAPKKPGCENDFVLVKVQTWVNGEEDAEFVGVGARFGTTIVSKEKN 78

Query: 360 AHQTLLTRSNPRDCCSTPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKEL 539
           A+QT LT S+PRDCCS PK K AG++IMVDRGNCKFTAKANYAEAAGA+AVLIINNQKEL
Sbjct: 79  ANQTRLTLSDPRDCCSPPKRKFAGEIIMVDRGNCKFTAKANYAEAAGATAVLIINNQKEL 138

Query: 540 YKMVCDPDETDLDIKIPAVMLPQDAGATLEKMLSSNSSVTVQLYSP 677
           YKMVCDPDETDLDIKIPAVMLPQDAGA+LEKML SN+SV+VQLYSP
Sbjct: 139 YKMVCDPDETDLDIKIPAVMLPQDAGASLEKMLLSNASVSVQLYSP 184



>gb:AY086545_1571593 Arabidopsis thaliana clone 2571 mRNA, complete
           sequence.
          Length = 540

 Score =  270 bits (691), Expect = 1e-71
 Identities = 130/165 (78%), Positives = 151/165 (91%)
 Frame = +3

Query: 183 SAVTAGDIVHHDDLAPKKPGCENDFVLVKIQTWVDGVEDAEFVGVGARFGTTIVSKEKNA 362
           S VTAGDIVH D+LAPKKPGCENDFVLVK+QTW+DGVE+ EFVGVGARFG  IVSKEKNA
Sbjct: 23  STVTAGDIVHQDNLAPKKPGCENDFVLVKVQTWIDGVENEEFVGVGARFGKRIVSKEKNA 82

Query: 363 HQTLLTRSNPRDCCSTPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELY 542
           +QT L  +NPRD C+  KNKL+GDV++V+RGNC+FTAKAN AEAAGASA+LIINNQKELY
Sbjct: 83  NQTHLVFANPRDSCTPLKNKLSGDVVIVERGNCRFTAKANNAEAAGASALLIINNQKELY 142

Query: 543 KMVCDPDETDLDIKIPAVMLPQDAGATLEKMLSSNSSVTVQLYSP 677
           KMVC+PDETDLDI+IPAVMLPQDAGA+L+KML+++S V+ QLYSP
Sbjct: 143 KMVCEPDETDLDIQIPAVMLPQDAGASLQKMLANSSKVSAQLYSP 187



>gb:AY062807_1565463 Arabidopsis thaliana Unknown protein
           (At1g63690; F24D7.12) mRNA, complete
           cds.>gb:BT008895_1640091 Arabidopsis thaliana At1g63690
           mRNA, complete cds.
          Length = 540

 Score =  270 bits (691), Expect = 1e-71
 Identities = 130/165 (78%), Positives = 151/165 (91%)
 Frame = +3

Query: 183 SAVTAGDIVHHDDLAPKKPGCENDFVLVKIQTWVDGVEDAEFVGVGARFGTTIVSKEKNA 362
           S VTAGDIVH D+LAPKKPGCENDFVLVK+QTW+DGVE+ EFVGVGARFG  IVSKEKNA
Sbjct: 23  STVTAGDIVHQDNLAPKKPGCENDFVLVKVQTWIDGVENEEFVGVGARFGKRIVSKEKNA 82

Query: 363 HQTLLTRSNPRDCCSTPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELY 542
           +QT L  +NPRD C+  KNKL+GDV++V+RGNC+FTAKAN AEAAGASA+LIINNQKELY
Sbjct: 83  NQTHLVFANPRDSCTPLKNKLSGDVVIVERGNCRFTAKANNAEAAGASALLIINNQKELY 142

Query: 543 KMVCDPDETDLDIKIPAVMLPQDAGATLEKMLSSNSSVTVQLYSP 677
           KMVC+PDETDLDI+IPAVMLPQDAGA+L+KML+++S V+ QLYSP
Sbjct: 143 KMVCEPDETDLDIQIPAVMLPQDAGASLQKMLANSSKVSAQLYSP 187



>pir|H96661|H96661 unknown protein, 50290-46846 [imported] -
           Arabidopsis thaliana>gb:AE005173_894033 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC011622_1537270 Arabidopsis thaliana
           chromosome 1 BAC F24D7 genomic sequence, complete
           sequence.
          Length = 519

 Score =  270 bits (691), Expect = 1e-71
 Identities = 130/165 (78%), Positives = 151/165 (91%)
 Frame = +3

Query: 183 SAVTAGDIVHHDDLAPKKPGCENDFVLVKIQTWVDGVEDAEFVGVGARFGTTIVSKEKNA 362
           S VTAGDIVH D+LAPKKPGCENDFVLVK+QTW+DGVE+ EFVGVGARFG  IVSKEKNA
Sbjct: 23  STVTAGDIVHQDNLAPKKPGCENDFVLVKVQTWIDGVENEEFVGVGARFGKRIVSKEKNA 82

Query: 363 HQTLLTRSNPRDCCSTPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELY 542
           +QT L  +NPRD C+  KNKL+GDV++V+RGNC+FTAKAN AEAAGASA+LIINNQKELY
Sbjct: 83  NQTHLVFANPRDSCTPLKNKLSGDVVIVERGNCRFTAKANNAEAAGASALLIINNQKELY 142

Query: 543 KMVCDPDETDLDIKIPAVMLPQDAGATLEKMLSSNSSVTVQLYSP 677
           KMVC+PDETDLDI+IPAVMLPQDAGA+L+KML+++S V+ QLYSP
Sbjct: 143 KMVCEPDETDLDIQIPAVMLPQDAGASLQKMLANSSKVSAQLYSP 187



>gb:AP005750_1857151 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:OSJNBa0069C14.>gb:AP006616_1862482 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:B1206D04.
          Length = 542

 Score =  226 bits (576), Expect = 3e-58
 Identities = 105/164 (64%), Positives = 134/164 (81%)
 Frame = +3

Query: 186 AVTAGDIVHHDDLAPKKPGCENDFVLVKIQTWVDGVEDAEFVGVGARFGTTIVSKEKNAH 365
           A   GDIVHHDD APK PGC NDF+LVK+Q+WV+G ED E+VGVGARFG  IVSKEK+A+
Sbjct: 20  AAAGGDIVHHDDEAPKIPGCSNDFILVKVQSWVNGKEDDEYVGVGARFGPQIVSKEKHAN 79

Query: 366 QTLLTRSNPRDCCSTPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYK 545
           +T L  ++P DCC++PK K++GD+++V RG CKFT KA +AEAAGAS ++IIN+  ELYK
Sbjct: 80  RTRLMLADPIDCCTSPKEKVSGDILLVQRGKCKFTKKAKFAEAAGASGIIIINHVHELYK 139

Query: 546 MVCDPDETDLDIKIPAVMLPQDAGATLEKMLSSNSSVTVQLYSP 677
           MVC+ +ETDLDI IPAV+LP+DAG  L  +L+S +SV+VQ YSP
Sbjct: 140 MVCEKNETDLDINIPAVLLPRDAGFALHTVLTSGNSVSVQQYSP 183



>gb:AP004026_1836553 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1136_C04.
          Length = 538

 Score =  220 bits (561), Expect = 2e-56
 Identities = 109/160 (68%), Positives = 129/160 (80%)
 Frame = +3

Query: 198 GDIVHHDDLAPKKPGCENDFVLVKIQTWVDGVEDAEFVGVGARFGTTIVSKEKNAHQTLL 377
           GDIVH DD APK PGC NDFVLVK+QTWV+  ED EFVGVGARFG TI SKEK+A++T L
Sbjct: 19  GDIVHQDDEAPKIPGCSNDFVLVKVQTWVNNREDGEFVGVGARFGPTIESKEKHANRTGL 78

Query: 378 TRSNPRDCCSTPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCD 557
             ++P DCC  P  K+AGDV++V RGNCKFT KA  AEAAGASA++IIN+  ELYKMVCD
Sbjct: 79  LLADPIDCCDPPTQKVAGDVLLVQRGNCKFTKKAKNAEAAGASAIIIINHVHELYKMVCD 138

Query: 558 PDETDLDIKIPAVMLPQDAGATLEKMLSSNSSVTVQLYSP 677
            +ETDLDI IPAV+LP+DAG  L+K+L +   V+VQLYSP
Sbjct: 139 RNETDLDINIPAVLLPKDAGNDLQKLL-TRGKVSVQLYSP 177



>gb:AF417575_1798294 Euphorbia esula growth-on protein GRO11 (Gro11)
           mRNA, complete cds.
          Length = 538

 Score =  213 bits (542), Expect = 2e-54
 Identities = 102/162 (62%), Positives = 128/162 (79%)
 Frame = +3

Query: 192 TAGDIVHHDDLAPKKPGCENDFVLVKIQTWVDGVEDAEFVGVGARFGTTIVSKEKNAHQT 371
           +AGDIVH DD +PK+PGC+N+FVLVK+ TWVDGVED E+VGVGARFG T+ +KEK+A++T
Sbjct: 22  SAGDIVHQDDKSPKRPGCDNNFVLVKVPTWVDGVEDIEYVGVGARFGRTLEAKEKDANKT 81

Query: 372 LLTRSNPRDCCSTPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMV 551
            L  ++P D C  PK KL  DVI+V RGNC FT KA  AE A ASA+LIIN + EL KMV
Sbjct: 82  KLVLADPPDLCQPPKFKLNRDVILVHRGNCSFTTKAKIAELANASAILIINTETELLKMV 141

Query: 552 CDPDETDLDIKIPAVMLPQDAGATLEKMLSSNSSVTVQLYSP 677
           C+ +ETD+ I+IPAVMLPQDAG +L   + ++S V+VQLYSP
Sbjct: 142 CEANETDVHIQIPAVMLPQDAGGSLRDYMQNSSQVSVQLYSP 183



>pir|D86147|D86147 T1N6.3 protein - Arabidopsis
           thaliana>gb:AE005172_889213 Arabidopsis thaliana
           chromosome 1, top arm complete sequence.>gb:T1N6_1723673
           Sequence of BAC T1N6 from Arabidopsis thaliana
           chromosome 1, complete sequence.
          Length = 613

 Score =  142 bits (358), Expect = 5e-33
 Identities = 80/171 (46%), Positives = 105/171 (61%), Gaps = 6/171 (3%)
 Frame = +3

Query: 183 SAVTAGDIVHHDDLAPKKPGCENDFVLVKIQTWVDGVEDAEFVGVGARFGTTIVSKEKNA 362
           S V AGDIVHHDD  P++PGC N+FVLVK+ T V+G E  E+VGVGARFG T+ SKEK+A
Sbjct: 22  SFVCAGDIVHHDDSLPQRPGCNNNFVLVKVPTRVNGSEYTEYVGVGARFGPTLESKEKHA 81

Query: 363 HQTLLTRSNPRDCCSTPKNKLAGDVIMVDR----GNCKFTAKANYAEAAGASAVLIINNQ 530
               L  ++P DCCSTPKNK+     +V       +C      ++      S + I+ N 
Sbjct: 82  TLIKLAIADPPDCCSTPKNKVKFPFWLVSLVLIFPSCVIPVSLSFGSLQERSFLFIVVNA 141

Query: 531 --KELYKMVCDPDETDLDIKIPAVMLPQDAGATLEKMLSSNSSVTVQLYSP 677
                 +++    E  LDI IP VMLP DAG +LE ++ SN+ VT+QLYSP
Sbjct: 142 VLPPKLRLLKQLGENVLDITIPVVMLPVDAGRSLENIVKSNAIVTLQLYSP 192



>pir|F84861|F84861 hypothetical protein At2g43070 [imported] -
           Arabidopsis thaliana>gb:AC004450_1531695 Arabidopsis
           thaliana chromosome 2 clone F14B2 map CIC10F02, complete
           sequence.>gb:AC006224_1533702 Arabidopsis thaliana
           chromosome 2 clone MFL8 map CIC10F02, complete sequence.
          Length = 543

 Score =  125 bits (315), Expect = 5e-28
 Identities = 64/165 (38%), Positives = 98/165 (59%)
 Frame = +3

Query: 183 SAVTAGDIVHHDDLAPKKPGCENDFVLVKIQTWVDGVEDAEFVGVGARFGTTIVSKEKNA 362
           S   A D+   +D + + PGC N F +VK+  WVDGVE     G+ A+FG  + S    A
Sbjct: 24  SVAAADDVSWTEDSSLESPGCTNKFQMVKVLNWVDGVEGDFLTGLTAQFGAALPSVPDQA 83

Query: 363 HQTLLTRSNPRDCCSTPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELY 542
            +      +P D CS   ++L G + +  RGNC FT KA +AEAAGASA+L+IN++++L 
Sbjct: 84  LRFPAAFVDPLDSCSHLSSRLDGHIALSIRGNCAFTEKAKHAEAAGASALLVINDKEDLD 143

Query: 543 KMVCDPDETDLDIKIPAVMLPQDAGATLEKMLSSNSSVTVQLYSP 677
           +M C   +T L++ IP +M+ + +G  L K +  N +V + LY+P
Sbjct: 144 EMGCMEKDTSLNVSIPVLMISKSSGDALNKSMVDNKNVELLLYAP 188



>pir|H86192|H86192 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889600 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:T20M3_1723733 Sequence of BAC T20M3 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 536

 Score =  124 bits (311), Expect = 2e-27
 Identities = 59/154 (38%), Positives = 94/154 (61%)
 Frame = +3

Query: 216 DDLAPKKPGCENDFVLVKIQTWVDGVEDAEFVGVGARFGTTIVSKEKNAHQTLLTRSNPR 395
           D  APK PGC N+F +VK++ WV+G     F  + A+FGT + S +  A +  +  + P 
Sbjct: 31  DVTAPKIPGCSNEFQMVKVENWVNGENGETFTAMTAQFGTMLPSDKDKAVKLPVALTTPL 90

Query: 396 DCCSTPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDL 575
           D CS   +KL+  + +  RG C FT KA  A+A GA+A+++IN+++EL +MVC   +T L
Sbjct: 91  DSCSNLTSKLSWSIALSVRGECAFTVKAQVAQAGGAAALVLINDKEELDEMVCGEKDTSL 150

Query: 576 DIKIPAVMLPQDAGATLEKMLSSNSSVTVQLYSP 677
           ++ IP +M+   +G  L+K +  N  V + LY+P
Sbjct: 151 NVSIPILMITTSSGDALKKSIMQNKKVELLLYAP 184



>gb:AP003433_1829282 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0004D12.
          Length = 523

 Score =  113 bits (283), Expect = 3e-24
 Identities = 59/166 (35%), Positives = 91/166 (54%)
 Frame = +3

Query: 180 PSAVTAGDIVHHDDLAPKKPGCENDFVLVKIQTWVDGVEDAEFVGVGARFGTTIVSKEKN 359
           P A  A D    D ++PK PGC+N F  VK+  WVDG E +   G+ ARFG  + +   +
Sbjct: 33  PGAAGA-DSEFEDGVSPKFPGCDNPFQKVKVTYWVDGDERSSLTGITARFGEVLPATGSD 91

Query: 360 AHQTLLTRSNPRDCCSTPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKEL 539
             +       P+  C+     LA  + + +RG C F  KA  AE+ GA+A+L+IN++ +L
Sbjct: 92  GDKRKAVVPAPKTGCAKSSAPLASSIAVAERGECTFLEKAKTAESGGAAALLLINDEDDL 151

Query: 540 YKMVCDPDETDLDIKIPAVMLPQDAGATLEKMLSSNSSVTVQLYSP 677
            KMVC  ++T  +I IP VM+ Q AG  +   +   + V + +Y+P
Sbjct: 152 QKMVCTQNDTVPNIGIPVVMVSQSAGRKILSGMDGGAKVDILMYAP 197



>gb:AF161719_1773417 Triticum aestivum vacuolar targeting receptor
           bp-80 mRNA, complete cds.
          Length = 624

 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 27/81 (33%), Positives = 50/81 (61%), Gaps = 4/81 (4%)
 Frame = +3

Query: 438 IMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDL----DIKIPAVMLP 605
           +++DRG C FT KA  A+ AGA+A+L+++++ E    + +P++T      +I IP+V++ 
Sbjct: 91  VLIDRGECFFTTKAWNAQLAGAAAILVVDSKDEPLITMDNPEDTGTKHLENITIPSVLIT 150

Query: 606 QDAGATLEKMLSSNSSVTVQL 668
           +  G  L+K   +   V+V L
Sbjct: 151 KKLGEDLKKSAENGDMVSVLL 171



>gb:AB056693_1521665 Vigna mungo VmVSR mRNA for vacuolar sorting
           receptor, complete cds.
          Length = 619

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 31/84 (36%), Positives = 50/84 (59%), Gaps = 7/84 (8%)
 Frame = +3

Query: 438 IMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDE---TDLD----IKIPAV 596
           ++VDRG+C FT KA  A+  GA+AVL+ +++ E    +  P+E   TD D    I IP+V
Sbjct: 91  LLVDRGDCYFTLKAWNAQNGGAAAVLVADDKAETLITMDTPEEGKGTDDDYVENISIPSV 150

Query: 597 MLPQDAGATLEKMLSSNSSVTVQL 668
           ++ +  G +++K LS    V + L
Sbjct: 151 LISKSLGDSIKKALSDGEMVNMNL 174



>gb:AE015813_318119 Shewanella oneidensis MR-1 section 362 of 457 of
           the complete genome.>gb:AE014299_953716 Shewanella
           oneidensis MR-1 complete genome.
          Length = 1215

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 32/110 (29%), Positives = 52/110 (47%)
 Frame = +3

Query: 315 VGARFGTTIVSKEKNAHQTLLTRSNPRDCCSTPKNKLAGDVIMVDRGNCKFTAKANYAEA 494
           VGA F  +      N    ++  +  ++ C+     L G  +++DRG C F  K   A+ 
Sbjct: 366 VGAGFNKSNAYSFTNTVAPIVYPAANKNGCTAYTEDLTGKTVLIDRGTCGFVVKVLNAQL 425

Query: 495 AGASAVLIINNQKELYKMVCDPDETDLDIKIPAVMLPQDAGATLEKMLSS 644
            GAS V++ NN       V     TD  I IP+VM+ ++ G  ++  L+S
Sbjct: 426 KGASFVIVANNAANAGAFVM--GGTDDKITIPSVMVSKEDGDAIKTALAS 473



>gb:AE011999_278428 Xanthomonas axonopodis pv. citri str. 306,
           section 377 of 469 of the complete
           genome.>gb:AE008923_920203 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 557

 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 35/96 (36%), Positives = 48/96 (50%), Gaps = 4/96 (4%)
 Frame = +3

Query: 396 DCCSTP---KNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKM-VCDPD 563
           D C TP      +AG V ++DRG C F  K   A+  GA  V++ NN   +  M    P 
Sbjct: 318 DGCETPFVNAADVAGKVALIDRGTCAFAIKVKNAQLNGAVGVIVANNAAGVQTMGNASPP 377

Query: 564 ETDLDIKIPAVMLPQDAGATLEKMLSSNSSVTVQLY 671
            T  DI IPA+M+ Q  GA L+     +++V   LY
Sbjct: 378 IT--DITIPAIMVSQADGARLK----GSTAVVAALY 407



>gb:AF083788_1767018 Arabidopsis thaliana clone sps857 unknown mRNA.
          Length = 216

 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 26/83 (31%), Positives = 48/83 (57%), Gaps = 6/83 (7%)
 Frame = +3

Query: 438 IMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDLD------IKIPAVM 599
           +++DRG+C FT KA  A+ AGA+A+L+ +++ E    +  P+E   D      I IP+ +
Sbjct: 91  VLIDRGDCYFTLKAWIAQQAGAAAILVADSKAEPLITMDTPEEDKSDADYLQNITIPSAL 150

Query: 600 LPQDAGATLEKMLSSNSSVTVQL 668
           + +  G +++  LS    V ++L
Sbjct: 151 ITKTLGDSIKSALSGGDMVNMKL 173



>gb:ATU79959_1557291 Arabidopsis thaliana vacuolar sorting receptor
           homolog mRNA, complete cds.
          Length = 623

 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 26/83 (31%), Positives = 48/83 (57%), Gaps = 6/83 (7%)
 Frame = +3

Query: 438 IMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDLD------IKIPAVM 599
           +++DRG+C FT KA  A+ AGA+A+L+ +++ E    +  P+E   D      I IP+ +
Sbjct: 91  VLIDRGDCYFTLKAWIAQQAGAAAILVADSKAEPLITMDTPEEDKSDADYLQNITIPSAL 150

Query: 600 LPQDAGATLEKMLSSNSSVTVQL 668
           + +  G +++  LS    V ++L
Sbjct: 151 ITKTLGDSIKSALSGGDMVNMKL 173



>pir|T47542|T47542 Spot 3 protein and vacuolar sorting receptor
           homolog - Arabidopsis thaliana>gb:ATSPOT3PR_1554168
           A.thaliana mRNA for Spot 3 protein.>gb:ATU86700_1557353
           Arabidopsis thaliana EGF receptor like protein mRNA,
           complete cds.
          Length = 623

 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 26/83 (31%), Positives = 48/83 (57%), Gaps = 6/83 (7%)
 Frame = +3

Query: 438 IMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDLD------IKIPAVM 599
           +++DRG+C FT KA  A+ AGA+A+L+ +++ E    +  P+E   D      I IP+ +
Sbjct: 91  VLIDRGDCYFTLKAWIAQQAGAAAILVADSKAEPLITMDTPEEDKSDADYLQNITIPSAL 150

Query: 600 LPQDAGATLEKMLSSNSSVTVQL 668
           + +  G +++  LS    V ++L
Sbjct: 151 ITKTLGDSIKSALSGGDMVNMKL 173



>gb:BA000045_743162 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 1054

 Score = 48.9 bits (115), Expect = 8e-05
 Identities = 29/91 (31%), Positives = 46/91 (50%)
 Frame = +3

Query: 387 NPRDCCSTPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDE 566
           NP      P   L+G   + DRG+C+F+ K    + AGA A LI+NN   +  M   P  
Sbjct: 450 NPPAPAEPPIADLSGSTGIADRGDCEFSEKVYNLQQAGALAGLIVNNAPGVLTMA--PGA 507

Query: 567 TDLDIKIPAVMLPQDAGATLEKMLSSNSSVT 659
               + IP+ ++ Q+ G TL+  L+ +  +T
Sbjct: 508 AASLVTIPSFIIDQEQGTTLKAALAGDPGLT 538



>pir|T00044|T00044 vacuolar sorting receptor protein homolog PV72 -
           cucurbit>gb:AB006809_1510077 Cucurbita cv. Kurokawa
           Amakuri mRNA for PV72, complete cds.
          Length = 624

 Score = 48.9 bits (115), Expect = 8e-05
 Identities = 26/83 (31%), Positives = 46/83 (55%), Gaps = 6/83 (7%)
 Frame = +3

Query: 438 IMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDL------DIKIPAVM 599
           ++ DRG+C FT KA  A+  GA+A+L+ +++ E    +  P+E         DI IP+ +
Sbjct: 93  VLADRGDCYFTLKAWNAQNGGAAAILVADDRLEPLITMDSPEEAKADANYLKDITIPSAL 152

Query: 600 LPQDAGATLEKMLSSNSSVTVQL 668
           + +  G  ++K LS+   V + L
Sbjct: 153 ISKSLGDEIKKALSNGEMVNINL 175



>gb:AE012167_279956 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 75 of 460 of the complete
           genome.>gb:AE008922_913238 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 552

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 35/96 (36%), Positives = 48/96 (50%), Gaps = 4/96 (4%)
 Frame = +3

Query: 396 DCCSTP---KNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKM-VCDPD 563
           D C TP      +AG V ++DRG C F  K   A+  GA  V++ NN   +  M    P 
Sbjct: 313 DGCETPFVNAAAVAGKVALIDRGTCAFAIKVKNAQLNGAVGVIVANNAAGVQTMGNAAPP 372

Query: 564 ETDLDIKIPAVMLPQDAGATLEKMLSSNSSVTVQLY 671
            T  DI IPA+M+ Q  GA L+     +++V   LY
Sbjct: 373 IT--DITIPAIMVSQADGARLK----GSAAVVAGLY 402



>pir|F84706|F84706 probable vacuolar sorting receptor [imported] -
           Arabidopsis thaliana>gb:AC002338_1530485 Arabidopsis
           thaliana chromosome 2 clone T9D9 map m283, complete
           sequence.
          Length = 625

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 31/93 (33%), Positives = 54/93 (58%), Gaps = 8/93 (8%)
 Frame = +3

Query: 414 KNKLAG--DVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKE-LYKMVCDPDET-DLD- 578
           ++++AG    ++VDRG+C FT KA  A+ AGA+ +L+ +N+ E L  M    DET D D 
Sbjct: 85  RSRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEQLITMDAPEDETSDADY 144

Query: 579 ---IKIPAVMLPQDAGATLEKMLSSNSSVTVQL 668
              I IP+ ++ +  G+ ++  ++    V + L
Sbjct: 145 LQNITIPSALVSRSLGSAIKTAIAHGDPVHISL 177



>gb:AP005099_1847785 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OSJNBa0008J01.>gb:AP005243_1849395 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OJ1205_F02.
          Length = 626

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 27/81 (33%), Positives = 46/81 (56%), Gaps = 4/81 (4%)
 Frame = +3

Query: 438 IMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDLD----IKIPAVMLP 605
           ++VDRG+C FT K   A+ AGA+AVL+ +++ E    +  P+ +  D    I +P+ ++ 
Sbjct: 94  LLVDRGDCYFTTKGWNAQTAGAAAVLVADDRLEPLITMDSPESSGTDYIEKITVPSALVT 153

Query: 606 QDAGATLEKMLSSNSSVTVQL 668
           +  G  L+K L +   V V L
Sbjct: 154 KKFGDDLKKALENGDMVNVLL 174



>gb:AC079634_1732667 Genomic Sequence for Oryza sativa, Nipponbare
           strain, clone OSJNBa0045C13, from Chromosome 10,
           complete sequence.
          Length = 631

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 28/83 (33%), Positives = 45/83 (54%), Gaps = 6/83 (7%)
 Frame = +3

Query: 438 IMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETD------LDIKIPAVM 599
           +++DRGNC F  K   A+ AGASAVL+++++ E    +  P E D       +I IP+ +
Sbjct: 98  LLIDRGNCLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAAKYIQNITIPSAL 157

Query: 600 LPQDAGATLEKMLSSNSSVTVQL 668
           + +  G  L+K +     V V L
Sbjct: 158 IDKKFGEQLKKAIKDGEMVNVNL 180



>gb:AE016959_1021991 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC091666_1734870
           Oryza sativa (japonica cultivar-group) chromosome 10
           clone OSJNBb0078C13, complete
           sequence.>gb:AE017080_1751810 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 34 of 77 of the
           complete sequence.
          Length = 643

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 28/83 (33%), Positives = 45/83 (54%), Gaps = 6/83 (7%)
 Frame = +3

Query: 438 IMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETD------LDIKIPAVM 599
           +++DRGNC F  K   A+ AGASAVL+++++ E    +  P E D       +I IP+ +
Sbjct: 98  LLIDRGNCLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAAKYIQNITIPSAL 157

Query: 600 LPQDAGATLEKMLSSNSSVTVQL 668
           + +  G  L+K +     V V L
Sbjct: 158 IDKKFGEQLKKAIKDGEMVNVNL 180



>pir|T04895|T04895 vacuolar sorting receptor protein homolog
           F18F4.210 - Arabidopsis thaliana>gb:ATCHRIV52_1545849
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 52.>gb:ATF18F4_1549154 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F18F4 (ESSA project).
          Length = 626

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 6/84 (7%)
 Frame = +3

Query: 435 VIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDET-DLD-----IKIPAV 596
           ++++DRG C F  KA +A+ AGA+AVL+ +N  E    +  P+E+ D D     + IP+V
Sbjct: 93  ILLLDRGGCYFALKAWHAQQAGAAAVLVADNVDEPLLTMDSPEESKDADGFIEKLTIPSV 152

Query: 597 MLPQDAGATLEKMLSSNSSVTVQL 668
           ++ +  G  L +      ++ ++L
Sbjct: 153 LIDKSFGDDLRQGFQKGKNIVIKL 176



>gb:BC060718_2104164 Mus musculus RIKEN cDNA 2310050N11 gene, mRNA
           (cDNA clone IMAGE:6405539), partial cds.
          Length = 696

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 38/125 (30%), Positives = 60/125 (48%), Gaps = 9/125 (7%)
 Frame = +3

Query: 321 ARFGTTIVSKEKNAHQTLLTRSNPRDCCSTPKNKLA--GDVIMVDRGNCKFTAKANYAEA 494
           A+FG  + SK K   +  +  S P + CS   N  A  G + ++ RG C F  KA   + 
Sbjct: 434 AQFGLDL-SKHKET-RGFVASSKPYNGCSELTNPEAVMGKIALIQRGQCMFAEKARNIQN 491

Query: 495 AGASAVLIINNQK-------ELYKMVCDPDETDLDIKIPAVMLPQDAGATLEKMLSSNSS 653
           AGA   ++I++ +        L++M  D  +TD DIKIP + L    G+ +   +  +  
Sbjct: 492 AGAIGGIVIDDNEGSSSDTAPLFQMAGDGKDTD-DIKIPMLFLFSKEGSIILDAIREHEQ 550

Query: 654 VTVQL 668
           V V L
Sbjct: 551 VEVLL 555



>gb:AY048289_1561750 Arabidopsis thaliana AT3g52850/F8J2_20 mRNA,
           complete cds.
          Length = 623

 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 25/83 (30%), Positives = 47/83 (56%), Gaps = 6/83 (7%)
 Frame = +3

Query: 438 IMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDLD------IKIPAVM 599
           +++DRG+C FT KA  A+ AGA+A+L+ +++ E    +  P+E   D      I IP+ +
Sbjct: 91  VLIDRGDCYFTLKAWIAQQAGAAAILVADSKAEPLITMDTPEEDKSDADYLQNITIPSAL 150

Query: 600 LPQDAGATLEKMLSSNSSVTVQL 668
           + +  G +++  LS      ++L
Sbjct: 151 ITKTLGDSIKSALSGGDMGNMKL 173



>gb:HSDJ53A19_2012196 Human DNA sequence from clone RP1-53A19 on
            chromosome 1q25.1-31.1 Contains the C1orf22 gene for
            chromosome 1 open reading frame 22, the 3' end of the
            C1orf24 gene for chromosome 1 open reading frame 24 and a
            CpG island, complete sequence.
          Length = 932

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 38/125 (30%), Positives = 59/125 (47%), Gaps = 9/125 (7%)
 Frame = +3

Query: 321  ARFGTTIVSKEKNAHQTLLTRSNPRDCCSTPKNKLA--GDVIMVDRGNCKFTAKANYAEA 494
            A+FG  + SK K   +  +  S P + CS   N  A  G + ++ RG C F  KA   + 
Sbjct: 668  AQFGLDL-SKHKET-RGFVASSKPSNGCSELTNPEAVMGKIALIQRGQCMFAEKARNIQN 725

Query: 495  AGASAVLIINNQK-------ELYKMVCDPDETDLDIKIPAVMLPQDAGATLEKMLSSNSS 653
            AGA   ++I++ +        L++M  D  +TD DIKIP + L    G+ +   +     
Sbjct: 726  AGAIGGIVIDDNEGSSSDTAPLFQMAGDGKDTD-DIKIPMLFLFSKEGSIILDAIREYEE 784

Query: 654  VTVQL 668
            V V L
Sbjct: 785  VEVLL 789



>gb:AY136303_1581804 Arabidopsis thaliana vacuolar sorting
           receptor-like protein (At4g20110) mRNA, complete
           cds.>gb:BT000395_1634673 Arabidopsis thaliana vacuolar
           sorting receptor-like protein (At4g20110) mRNA, complete
           cds.
          Length = 625

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 26/84 (30%), Positives = 46/84 (54%), Gaps = 6/84 (7%)
 Frame = +3

Query: 435 VIMVDRGNCKFTAKANYAEAAGASAVLIINNQKE-LYKMVCDPDETDLD-----IKIPAV 596
           ++++DRG C F  KA +A+ AGA+AVL+ +N  E L  M    +  D D     + IP+V
Sbjct: 93  ILLLDRGGCYFALKAWHAQQAGAAAVLVADNVDEPLLTMDSTEESKDADGFIEKLTIPSV 152

Query: 597 MLPQDAGATLEKMLSSNSSVTVQL 668
           ++ +  G  L +      ++ ++L
Sbjct: 153 LIDKSFGDDLRQGFQKGKNIVIKL 176



>gb:HSM800950_1185996 Homo sapiens mRNA; cDNA DKFZp434N126 (from
           clone DKFZp434N126).
          Length = 380

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 38/125 (30%), Positives = 59/125 (47%), Gaps = 9/125 (7%)
 Frame = +3

Query: 321 ARFGTTIVSKEKNAHQTLLTRSNPRDCCSTPKNKLA--GDVIMVDRGNCKFTAKANYAEA 494
           A+FG  + SK K   +  +  S P + CS   N  A  G + ++ RG C F  KA   + 
Sbjct: 116 AQFGLDL-SKHKET-RGFVASSKPSNGCSELTNPEAVMGKIALIQRGQCMFAEKARNIQN 173

Query: 495 AGASAVLIINNQK-------ELYKMVCDPDETDLDIKIPAVMLPQDAGATLEKMLSSNSS 653
           AGA   ++I++ +        L++M  D  +TD DIKIP + L    G+ +   +     
Sbjct: 174 AGAIGGIVIDDNEGSSSDTAPLFQMAGDGKDTD-DIKIPMLFLFSKEGSIILDAIREYEE 232

Query: 654 VTVQL 668
           V V L
Sbjct: 233 VEVLL 237



>pir|T17236|T17236 hypothetical protein DKFZp434N126.1 - human
           (fragment)
          Length = 380

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 38/125 (30%), Positives = 59/125 (47%), Gaps = 9/125 (7%)
 Frame = +3

Query: 321 ARFGTTIVSKEKNAHQTLLTRSNPRDCCSTPKNKLA--GDVIMVDRGNCKFTAKANYAEA 494
           A+FG  + SK K   +  +  S P + CS   N  A  G + ++ RG C F  KA   + 
Sbjct: 116 AQFGLDL-SKHKET-RGFVASSKPSNGCSELTNPEAVMGKIALIQRGQCMFAEKARNIQN 173

Query: 495 AGASAVLIINNQK-------ELYKMVCDPDETDLDIKIPAVMLPQDAGATLEKMLSSNSS 653
           AGA   ++I++ +        L++M  D  +TD DIKIP + L    G+ +   +     
Sbjct: 174 AGAIGGIVIDDNEGSSSDTAPLFQMAGDGKDTD-DIKIPMLFLFSKEGSIILDAIREYEE 232

Query: 654 VTVQL 668
           V V L
Sbjct: 233 VEVLL 237



>sp|Q9BZQ6|C122_HUMAN Putative alpha-mannosidase C1orf22 (EC
           3.2.1.-).>gb:AF288393_1895098 Homo sapiens C1orf22 mRNA,
           complete cds.
          Length = 889

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 38/125 (30%), Positives = 59/125 (47%), Gaps = 9/125 (7%)
 Frame = +3

Query: 321 ARFGTTIVSKEKNAHQTLLTRSNPRDCCSTPKNKLA--GDVIMVDRGNCKFTAKANYAEA 494
           A+FG  + SK K   +  +  S P + CS   N  A  G + ++ RG C F  KA   + 
Sbjct: 625 AQFGLDL-SKHKET-RGFVASSKPSNGCSELTNPEAVMGKIALIQRGQCMFAEKARNIQN 682

Query: 495 AGASAVLIINNQK-------ELYKMVCDPDETDLDIKIPAVMLPQDAGATLEKMLSSNSS 653
           AGA   ++I++ +        L++M  D  +TD DIKIP + L    G+ +   +     
Sbjct: 683 AGAIGGIVIDDNEGSSSDTAPLFQMAGDGKDTD-DIKIPMLFLFSKEGSIILDAIREYEE 741

Query: 654 VTVQL 668
           V V L
Sbjct: 742 VEVLL 746



>gb:AP003628_1831708 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0473H04.
          Length = 637

 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 5/78 (6%)
 Frame = +3

Query: 435 VIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETD----LD-IKIPAVM 599
           ++++DRG C F  KA  A+ AGA+AVLI +N  E    +  P+E+     +D I IP+ +
Sbjct: 100 ILLLDRGECYFALKAWNAQQAGAAAVLIADNVDEQLLTMDTPEESPETEYIDRISIPSAL 159

Query: 600 LPQDAGATLEKMLSSNSS 653
           + +  G +L++M S + S
Sbjct: 160 VNRAFGESLKRMSSPSPS 177



>gb:BC072826_2556753 Xenopus laevis MGC80179 protein, mRNA (cDNA clone
            MGC:80179 IMAGE:4970511), complete cds.
          Length = 900

 Score = 45.4 bits (106), Expect = 9e-04
 Identities = 37/125 (29%), Positives = 56/125 (44%), Gaps = 9/125 (7%)
 Frame = +3

Query: 321  ARFGTTIVSKEKNAHQTLLTRSNPRDCCSTPKNKLA--GDVIMVDRGNCKFTAKANYAEA 494
            A+FG  + SK     Q L+ R+ P   CS   N  A  G + ++ RG C F  KA   + 
Sbjct: 641  AQFGMDL-SKHLAGAQGLVARAEPYSGCSDITNGQAIQGKIALMQRGQCMFAEKARNVQK 699

Query: 495  AGASAVLIINNQK-------ELYKMVCDPDETDLDIKIPAVMLPQDAGATLEKMLSSNSS 653
            AGA   ++I++ +        L++M  D   TD D+ IP + L    G  +   +     
Sbjct: 700  AGAIGGIVIDDNEGSSSDTAPLFQMAGDGKSTD-DVTIPMLFLFSKEGNIILDAIREYQQ 758

Query: 654  VTVQL 668
            V V L
Sbjct: 759  VEVLL 763



>pir|T02604|T02604 probable vacuolar sorting receptor [imported] -
           Arabidopsis thaliana>gb:AC004705_1532126 Arabidopsis
           thaliana chromosome 2 clone F26C24 map mi398, complete
           sequence.>gb:AC005398_1532680 Arabidopsis thaliana
           chromosome 2 clone T6B13 map mi398, complete
           sequence.>gb:AY062744_1565400 Arabidopsis thaliana
           putative vacuolar sorting receptor (At2g14720;
           F26C24.14) mRNA, complete cds.>gb:BT008390_1639607
           Arabidopsis thaliana At2g14720 gene, complete cds.
          Length = 628

 Score = 45.4 bits (106), Expect = 9e-04
 Identities = 29/84 (34%), Positives = 45/84 (53%), Gaps = 7/84 (8%)
 Frame = +3

Query: 438 IMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDL-------DIKIPAV 596
           ++VDRG+C F  K   A+ AGASAVL+ +N  E   +  D  E D+       +I IP+ 
Sbjct: 96  LLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPL-ITMDTPEEDVSSAKYIENITIPSA 154

Query: 597 MLPQDAGATLEKMLSSNSSVTVQL 668
           ++ +  G  L+K +S    V + L
Sbjct: 155 LVTKGFGEKLKKAISGGDMVNLNL 178



>pir|T02602|T02602 vacuolar sorting receptor protein homolog
           At2g14740 - Arabidopsis thaliana>gb:AC004705_1532124
           Arabidopsis thaliana chromosome 2 clone F26C24 map
           mi398, complete sequence.>gb:AC005398_1532678
           Arabidopsis thaliana chromosome 2 clone T6B13 map mi398,
           complete sequence.
          Length = 628

 Score = 45.4 bits (106), Expect = 9e-04
 Identities = 29/84 (34%), Positives = 45/84 (53%), Gaps = 7/84 (8%)
 Frame = +3

Query: 438 IMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDL-------DIKIPAV 596
           ++VDRG+C F  K   A+ AGASAVL+ +N  E   +  D  E D+       +I IP+ 
Sbjct: 96  LLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPL-ITMDTPEEDVSSAKYIENITIPSA 154

Query: 597 MLPQDAGATLEKMLSSNSSVTVQL 668
           ++ +  G  L+K +S    V + L
Sbjct: 155 LVTKGFGEKLKKAISGGDMVNLNL 178



>pir|B75587|B75587 probable N-glycosidase F - Deinococcus
           radiodurans (strain R1)>gb:AE001863_40249 Deinococcus
           radiodurans R1 section 2 of 2 of the complete chromosome
           2.>gb:AE001825_885571 Deinococcus radiodurans R1
           complete chromosome 2.
          Length = 654

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 32/95 (33%), Positives = 42/95 (44%), Gaps = 4/95 (4%)
 Frame = +3

Query: 396 DCCS--TPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKEL--YKMVCDPD 563
           D C    P N +AG   ++ RG C FT K   A   GA+AVL+INN   L   +  CD  
Sbjct: 176 DACGDKAPVNDVAGKAAVILRGTCGFTDKVKAATKRGAAAVLLINNDSPLGVIRGACD-- 233

Query: 564 ETDLDIKIPAVMLPQDAGATLEKMLSSNSSVTVQL 668
             D        +LP   G  L   L S  +  V++
Sbjct: 234 --DTCKSAILALLPNKEGTQLVGALQSGKTARVEV 266



>gb:CEZC506_1371361 Caenorhabditis elegans cosmid ZC506, complete
            sequence.
          Length = 931

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 33/131 (25%), Positives = 62/131 (47%), Gaps = 10/131 (7%)
 Frame = +3

Query: 312  GVGARFGTTIVSKEKNAHQTLLTRSNPRDCCSTPKN--KLAGDVIMVDRGNCKFTAKANY 485
            G  A+FG  I + +    +    ++ P   C    N  ++ G + +V+R +C F  KA +
Sbjct: 649  GSAAQFGRDIAATKALVGRA--AKTIPFRACDKILNADQVVGKIAVVERSDCVFQDKARF 706

Query: 486  AEAAGASAVLIINNQ--------KELYKMVCDPDETDLDIKIPAVMLPQDAGATLEKMLS 641
             + AGA  +++I+++        +  + M  D D  D DI IP++ L +  G  L + L 
Sbjct: 707  VQQAGAIGMVVIDHESNSQYVGDRPTFSMAVDKDGKD-DIGIPSIFLFRAEGDHLLRSLK 765

Query: 642  SNSSVTVQLYS 674
             +S   + + S
Sbjct: 766  MHSETVISISS 776



>gb:AE013201_290160 Thermoanaerobacter tengcongensis MB4, section
           228 of 244 of the complete genome.>gb:AE008691_1112225
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 1999

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 28/81 (34%), Positives = 38/81 (46%)
 Frame = +3

Query: 423 LAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDLDIKIPAVML 602
           L G V ++ RG   F AK   A+ AGA A +I NN      M           KIPAV +
Sbjct: 501 LTGKVALISRGAITFNAKTINAQNAGAVAAIIFNNTSGTISMALGE-----GTKIPAVSI 555

Query: 603 PQDAGATLEKMLSSNSSVTVQ 665
            Q AG  ++ +L    +V V+
Sbjct: 556 LQSAGLAIKALLDQGQTVKVK 576



>pir|T00476|T00476 probable vacuolar sorting receptor [imported] -
           Arabidopsis thaliana>gb:AC004238_1531566 Arabidopsis
           thaliana chromosome 2 clone F19I3 map ve016, complete
           sequence.>gb:BT004565_1637599 Arabidopsis thaliana
           At2g34940 gene, complete cds.
          Length = 618

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 24/82 (29%), Positives = 45/82 (54%), Gaps = 4/82 (4%)
 Frame = +3

Query: 435 VIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDLD----IKIPAVML 602
           ++++DRG C F  K    + +GA+AVL+ +N  E    +  P + D D    +KIP+ ++
Sbjct: 93  ILLIDRGVCNFALKIWNGQQSGAAAVLLADNIVEPLITMDTPQDEDPDFIDKVKIPSALI 152

Query: 603 PQDAGATLEKMLSSNSSVTVQL 668
            +  G +L+K L     V +++
Sbjct: 153 LRSFGDSLKKALKRGEEVILKM 174



>pir|T27626|T27626 hypothetical protein ZC506.2 - Caenorhabditis
           elegans
          Length = 385

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 33/131 (25%), Positives = 62/131 (47%), Gaps = 10/131 (7%)
 Frame = +3

Query: 312 GVGARFGTTIVSKEKNAHQTLLTRSNPRDCCSTPKN--KLAGDVIMVDRGNCKFTAKANY 485
           G  A+FG  I + +    +    ++ P   C    N  ++ G + +V+R +C F  KA +
Sbjct: 88  GSAAQFGRDIAATKALVGRA--AKTIPFRACDKILNADQVVGKIAVVERSDCVFQDKARF 145

Query: 486 AEAAGASAVLIINNQ--------KELYKMVCDPDETDLDIKIPAVMLPQDAGATLEKMLS 641
            + AGA  +++I+++        +  + M  D D  D DI IP++ L +  G  L + L 
Sbjct: 146 VQQAGAIGMVVIDHESNSQYVGDRPTFSMAVDKDGKD-DIGIPSIFLFRAEGDHLLRSLK 204

Query: 642 SNSSVTVQLYS 674
            +S   + + S
Sbjct: 205 MHSETVISISS 215



>gb:ATU79960_1557292 Arabidopsis thaliana vacuolar sorting receptor
           homolog mRNA, complete cds.
          Length = 630

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 28/84 (33%), Positives = 45/84 (53%), Gaps = 7/84 (8%)
 Frame = +3

Query: 438 IMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDL-------DIKIPAV 596
           ++VDRG+C F  K   A+ AGASAVL+ +N  E   +  D  E D+       +I IP+ 
Sbjct: 98  LLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPL-ITMDTPEEDVSSAKYIENITIPSA 156

Query: 597 MLPQDAGATLEKMLSSNSSVTVQL 668
           ++ +  G  L++ +S    V + L
Sbjct: 157 LVTKGFGEKLKQAISGGDMVNLNL 180



>sp|P25152|YWAD_BACSU Hypothetical peptidase ywaD precursor (EC
           3.4.11.-).>pir|S39663|S39663 aminopeptidase homolog ywaD
           - Bacillus subtilis>gb:BSGENR_750526 B.subtilis genomic
           region (325 to 333).>gb:BSUB0020_755812 Bacillus
           subtilis complete genome (section 20 of 21): from
           3809641 to 4010779.
          Length = 455

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 24/66 (36%), Positives = 38/66 (57%)
 Frame = +3

Query: 429 GDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDLDIKIPAVMLPQ 608
           G + ++ RG+  +  KA  AEAAGA AV+I NN++ L  M   P+ +   + IP V + +
Sbjct: 146 GKIALISRGDLTYYEKAKNAEAAGAKAVIIYNNKESLVPMT--PNLSGNKVGIPVVGIKK 203

Query: 609 DAGATL 626
           + G  L
Sbjct: 204 EDGEAL 209



>pir|T06794|T06794 vacuolar sorting receptor protein BP-80 - garden
           pea>gb:PSU79958_1702556 Pisum sativum BP-80 vacuolar
           sorting receptor mRNA, complete cds.
          Length = 623

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 27/85 (31%), Positives = 46/85 (54%), Gaps = 7/85 (8%)
 Frame = +3

Query: 435 VIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDL-------DIKIPA 593
           ++++DRG+C F  K   A+ AGASAVL+ ++ +E   +  D  E D+       +I IP+
Sbjct: 90  ILLLDRGSCFFALKVWNAQKAGASAVLVADDIEEPL-ITMDTPEEDVSSAKYIENITIPS 148

Query: 594 VMLPQDAGATLEKMLSSNSSVTVQL 668
            ++ +  G  L+  +S    V V L
Sbjct: 149 ALIGKSFGEKLKDAISGGDMVNVNL 173



>gb:AY524793_1611535 Verticillium dahliae subtilisin-like serine
           protease mRNA, complete cds.
          Length = 898

 Score = 42.7 bits (99), Expect = 0.006
 Identities = 28/96 (29%), Positives = 42/96 (43%), Gaps = 2/96 (2%)
 Frame = +3

Query: 396 DCCSTPKNK--LAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDET 569
           D C  P +   L+G V++V +G C    K +  E  GA  +L+ NN    +  V      
Sbjct: 368 DACKLPADTRDLSGSVVLVRKGTCNLYDKQDNLERFGARWILLYNNDDRPFSTVMTSTR- 426

Query: 570 DLDIKIPAVMLPQDAGATLEKMLSSNSSVTVQLYSP 677
               K   VM+    GAT+   + + +SVTV    P
Sbjct: 427 ----KSQMVMIDAKTGATIIDAIKAGASVTVDFTVP 458



>gb:OSJN00088_1694688 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0085I10, complete
           sequence.>gb:OSJN00255_1697478 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0070C17, complete
           sequence.
          Length = 663

 Score = 42.0 bits (97), Expect = 0.010
 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 7/85 (8%)
 Frame = +3

Query: 435 VIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDLD------IKIPAV 596
           V++VDRG C F  K  +A+ AGA+AVL+ +   E    +  P+E   D      I +P+ 
Sbjct: 96  VLLVDRGGCYFALKTWHAQLAGAAAVLVADGVDEPLLTMDSPEEETPDMAFLANITVPSA 155

Query: 597 MLPQDAGATLEKMLS-SNSSVTVQL 668
           ++ +  G  L    S ++  V V+L
Sbjct: 156 LVTKQFGDALRAAASAADDEVVVRL 180



>gb:HAN311314_1681463 Helianthus annuus partial elrs1 gene for
           putative EGF receptor-like protein, exons 1-3.
          Length = 285

 Score = 41.6 bits (96), Expect = 0.013
 Identities = 30/90 (33%), Positives = 48/90 (53%), Gaps = 5/90 (5%)
 Frame = +3

Query: 384 SNPRDCCSTPKNKLAGDV-IMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVC-- 554
           +N  D    P N  A  V ++VDRG C FT KA  A+ AG +A+L+ +   +L  M    
Sbjct: 1   NNFTDVSFKPDNPGALPVFLLVDRGGCYFTNKAWNAQNAGVAAILVTHETDDLITMDMPE 60

Query: 555 -DPDETDL-DIKIPAVMLPQDAGATLEKML 638
            DP+ T L ++ + +V +    G +L+K +
Sbjct: 61  HDPNATYLQNLTLSSVFITHSLGVSLKKKI 90



>gb:AE017351_1759584 Cryptococcus neoformans var. neoformans JEC21
           chromosome 11, complete sequence.
          Length = 813

 Score = 41.2 bits (95), Expect = 0.017
 Identities = 23/53 (43%), Positives = 30/53 (56%), Gaps = 3/53 (5%)
 Frame = +3

Query: 372 LLTRSNPRDCCSTPKNKLAGD---VIMVDRGNCKFTAKANYAEAAGASAVLII 521
           +L   NP D CS P      D   ++++DRGNC F  KA  AE  GAS +LI+
Sbjct: 639 ILVLPNPSDGCS-PLTLSTPDYPFILLLDRGNCTFAEKAQNAETIGASGLLIV 690



>pir|T16827|T16827 hypothetical protein T07F12.2 - Caenorhabditis
           elegans
          Length = 310

 Score = 40.8 bits (94), Expect = 0.022
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 6/84 (7%)
 Frame = +3

Query: 384 SNPRDCCSTPKNKL-AGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQK-----ELYK 545
           ++P   C   +N++ A  VI+++RG C FT KA   E AGA+ +++ ++Q        Y 
Sbjct: 161 ADPVHGCEALRNEIFAPSVILMERGECSFTVKALNGEKAGATVIMVTDSQNYEYSYHQYY 220

Query: 546 MVCDPDETDLDIKIPAVMLPQDAG 617
           +   PDE+     +P V +    G
Sbjct: 221 VNMIPDESLDRANVPCVYVAPVTG 244



>gb:AB033040_1866220 Homo sapiens mRNA for KIAA1214 protein, partial
           cds.
          Length = 462

 Score = 39.3 bits (90), Expect = 0.064
 Identities = 29/121 (23%), Positives = 52/121 (42%), Gaps = 6/121 (4%)
 Frame = +3

Query: 324 RFGTTIVSKEKNAHQTLLTRSNPRDCCSTPKNKLAGD------VIMVDRGNCKFTAKANY 485
           R+G     ++      + + ++ R  C  P  K A        + ++ +GNC +  K   
Sbjct: 142 RYGEHSPKQDARGEVVMASSAHDRLACD-PNTKFAAPTRGKNWIALIPKGNCTYRDKIRN 200

Query: 486 AEAAGASAVLIINNQKELYKMVCDPDETDLDIKIPAVMLPQDAGATLEKMLSSNSSVTVQ 665
           A    ASAV+I N      + +  P     D  I A+M+P+  G  +  +L  N +VT+ 
Sbjct: 201 AFLQNASAVVIFNVGSNTNETITMPHAGVED--IVAIMIPEPKGKEIVSLLERNITVTMY 258

Query: 666 L 668
           +
Sbjct: 259 I 259



>gb:AX136241_1461999 Sequence 163 from Patent
           EP1067182.>gb:AK075454_1913116 Homo sapiens cDNA
           PSEC0147 fis, clone PLACE1007190.
          Length = 520

 Score = 39.3 bits (90), Expect = 0.064
 Identities = 32/120 (26%), Positives = 53/120 (44%), Gaps = 3/120 (2%)
 Frame = +3

Query: 327 FGTTIVSKEKNAHQTLLTRSNPRDCCST---PKNKLAGDVIMVDRGNCKFTAKANYAEAA 497
           + T + S  +NA    L        C+    P   +    ++V  G+C F  KA  A+  
Sbjct: 48  YWTALPSTLENATSISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLEKARIAQKG 107

Query: 498 GASAVLIINNQKELYKMVCDPDETDLDIKIPAVMLPQDAGATLEKMLSSNSSVTVQLYSP 677
           GA A+L++NN   L+    +  E   D+KI    +       + + L  N  +TV++YSP
Sbjct: 108 GAEAMLVVNN-SVLFPPSGNRSEFP-DVKILIAFISYKDFRDMNQTLGDN--ITVKMYSP 163



>gb:U29154_1402709 Caenorhabditis elegans cosmid T07F12, complete
           sequence.
          Length = 220

 Score = 39.3 bits (90), Expect = 0.064
 Identities = 18/50 (36%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = +3

Query: 384 SNPRDCCSTPKNKL-AGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQ 530
           ++P   C   +N++ A  VI+++RG C FT KA   E AGA+ +++ ++Q
Sbjct: 161 ADPVHGCEALRNEIFAPSVILMERGECSFTVKALNGEKAGATVIMVTDSQ 210



>gb:BA000028_697319 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 1257

 Score = 39.3 bits (90), Expect = 0.064
 Identities = 24/78 (30%), Positives = 36/78 (46%)
 Frame = +3

Query: 429 GDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDLDIKIPAVMLPQ 608
           G   ++ RG   FT KA  A+ AGA   +I NN   +  M  DP      I IP + + +
Sbjct: 448 GKYALIQRGGNPFTEKALNAQQAGAVGAIIYNNTDGIVNMATDP-----AITIPQLFMLK 502

Query: 609 DAGATLEKMLSSNSSVTV 662
             G  L + L    +V++
Sbjct: 503 SNGDQLAQALQDGQAVSI 520



>sp|Q8TCT8|PSL2_HUMAN Signal peptide peptidase-like 2A (EC 3.4.99.-)
           (SPP-like 2A protein) (SPPL2a protein) (Intramembrane
           protease 3) (IMP3) (Presenilin-like protein
           2).>gb:AY169314_1937681 Homo sapiens intramembrane
           protease (IMP3) mRNA, complete cds.>gb:BC025740_1978570
           Homo sapiens putative intramembrane cleaving protease,
           mRNA (cDNA clone MGC:34080 IMAGE:5223715), complete
           cds.>gb:HSA345028_2004096 Homo sapiens mRNA for
           presenilin-like protein 2 (PSL2 gene).
          Length = 520

 Score = 39.3 bits (90), Expect = 0.064
 Identities = 32/120 (26%), Positives = 53/120 (44%), Gaps = 3/120 (2%)
 Frame = +3

Query: 327 FGTTIVSKEKNAHQTLLTRSNPRDCCST---PKNKLAGDVIMVDRGNCKFTAKANYAEAA 497
           + T + S  +NA    L        C+    P   +    ++V  G+C F  KA  A+  
Sbjct: 48  YWTALPSTLENATSISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLEKARIAQKG 107

Query: 498 GASAVLIINNQKELYKMVCDPDETDLDIKIPAVMLPQDAGATLEKMLSSNSSVTVQLYSP 677
           GA A+L++NN   L+    +  E   D+KI    +       + + L  N  +TV++YSP
Sbjct: 108 GAEAMLVVNN-SVLFPPSGNRSEFP-DVKILIAFISYKDFRDMNQTLGDN--ITVKMYSP 163



>gb:MAN419628_1685623 Metarhizium anisopliae var. anisopliae pr1C
           gene for subtilisin-like serine protease PR1C.
          Length = 825

 Score = 38.9 bits (89), Expect = 0.084
 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 3/99 (3%)
 Frame = +3

Query: 390 PRDCCST-PKNK--LAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDP 560
           P D C   P N   L+  ++++ RG+C F  K N A A GA  V++ NN   +  +  D 
Sbjct: 320 PDDGCDPFPANTPDLSKYIVLIRRGSCSFAQKVNNAVAKGAKYVIVYNN-NAVGAIPMDL 378

Query: 561 DETDLDIKIPAVMLPQDAGATLEKMLSSNSSVTVQLYSP 677
                     A M+    GAT    L     +T+++ SP
Sbjct: 379 TGVPAGSIKAASMIDGTTGATFINALKDGKKLTLKMVSP 417



>gb:AX005312_1456030 Sequence 431 from Patent WO9909186.
          Length = 527

 Score = 38.9 bits (89), Expect = 0.084
 Identities = 23/68 (33%), Positives = 37/68 (54%)
 Frame = +3

Query: 423 LAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDLDIKIPAVML 602
           ++G V++VDRG C F  K + A   GA A++I +N  E  + +      + D+KIP V +
Sbjct: 192 VSGAVVLVDRGVCPFAQKEDAAAQRGAVALIIADNIDE--QAMGGTLGANTDVKIPVVSV 249

Query: 603 PQDAGATL 626
            +  G  L
Sbjct: 250 TKSVGFQL 257



>gb:AE017206_405174 Lactobacillus johnsonii NCC 533, section 7 of 7
           of the complete genome.>gb:AE017198_1123661
           Lactobacillus johnsonii NCC 533, complete genome.
          Length = 2209

 Score = 38.9 bits (89), Expect = 0.084
 Identities = 17/33 (51%), Positives = 23/33 (69%)
 Frame = +3

Query: 429 GDVIMVDRGNCKFTAKANYAEAAGASAVLIINN 527
           G V +V RG   FT K  YA+AAGA+ ++I+NN
Sbjct: 480 GKVAVVSRGEITFTDKQKYAQAAGAAGLIIVNN 512



>gb:AE000516_20426 Mycobacterium tuberculosis CDC1551, complete
           genome.
          Length = 493

 Score = 38.9 bits (89), Expect = 0.084
 Identities = 23/68 (33%), Positives = 37/68 (54%)
 Frame = +3

Query: 423 LAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDLDIKIPAVML 602
           ++G V++VDRG C F  K + A   GA A++I +N  E  + +      + D+KIP V +
Sbjct: 158 VSGAVVLVDRGVCPFAQKEDAAAQRGAVALIIADNIDE--QAMGGTLGANTDVKIPVVSV 215

Query: 603 PQDAGATL 626
            +  G  L
Sbjct: 216 TKSVGFQL 223



>pir|H70629|H70629 probable AMINOPEPTIDASE - Mycobacterium
           tuberculosis (strain H37RV)>gb:BX248335_757784
           Mycobacterium bovis subsp. bovis AF2122/97 complete
           genome; segment 2/14.>gb:BX842573_818460 Mycobacterium
           tuberculosis H37Rv complete genome; segment
           2/13.>gb:AX005310_1456029 Sequence 429 from Patent
           WO9909186.
          Length = 500

 Score = 38.9 bits (89), Expect = 0.084
 Identities = 23/68 (33%), Positives = 37/68 (54%)
 Frame = +3

Query: 423 LAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDLDIKIPAVML 602
           ++G V++VDRG C F  K + A   GA A++I +N  E  + +      + D+KIP V +
Sbjct: 165 VSGAVVLVDRGVCPFAQKEDAAAQRGAVALIIADNIDE--QAMGGTLGANTDVKIPVVSV 222

Query: 603 PQDAGATL 626
            +  G  L
Sbjct: 223 TKSVGFQL 230



>gb:AE013599_1133423 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003459_1210722 Drosophila melanogaster
           chromosome 2R, section 67 of 74 of the complete
           sequence.>gb:AY071051_1295136 Drosophila melanogaster
           RE13814 full length cDNA.
          Length = 196

 Score = 38.5 bits (88), Expect = 0.11
 Identities = 29/94 (30%), Positives = 42/94 (44%), Gaps = 6/94 (6%)
 Frame = +3

Query: 375 LTRSNPRDCCSTPKNK--LAGDVIMVDRGNCKFTAKANYAEAAGASAVLII----NNQKE 536
           L  ++P   C   +N   L G V ++DRG C F  K   AEAAGA A +I     ++ + 
Sbjct: 71  LVITDPPGACQEIRNARDLNGGVALIDRGECSFLTKTLRAEAAGALAAIITEYNPSSPEF 130

Query: 537 LYKMVCDPDETDLDIKIPAVMLPQDAGATLEKML 638
            + +    D +  D  IPA  L    G  +   L
Sbjct: 131 EHYIEMIHDNSQQDANIPAGFLLGKNGVIIRSTL 164



>gb:BA000028_697370 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 735

 Score = 38.5 bits (88), Expect = 0.11
 Identities = 23/76 (30%), Positives = 39/76 (51%)
 Frame = +3

Query: 423 LAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDLDIKIPAVML 602
           L+G + +V RG   F   A  AE  GA AVLI NN+   ++     +  D  ++IP   +
Sbjct: 341 LSGKIALVQRGKIPFYQLAKKAEELGAEAVLIYNNEAGPFQ--GSVEFRDDPVQIPVAAI 398

Query: 603 PQDAGATLEKMLSSNS 650
            ++ G  L++ +  N+
Sbjct: 399 SKEDGEWLKQQVEENN 414



>gb:BC070658_2555633 Xenopus laevis hypothetical protein LOC431982,
           mRNA (cDNA clone IMAGE:4030926), partial cds.
          Length = 195

 Score = 37.7 bits (86), Expect = 0.19
 Identities = 25/98 (25%), Positives = 44/98 (44%), Gaps = 4/98 (4%)
 Frame = +3

Query: 366 QTLLTRSNPRDCCSTPKNK--LAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKEL 539
           Q  L  ++P + C    N   + G++ +V+RG C F +K    +  G  AV+I +N  + 
Sbjct: 69  QIHLVPADPLEACGELNNGAFIQGEIALVERGGCSFLSKTRVIQEHGGLAVIIADNAADN 128

Query: 540 YKMVCD--PDETDLDIKIPAVMLPQDAGATLEKMLSSN 647
                D   D +     IPA+ L    G  +++ L  +
Sbjct: 129 DSRYVDMINDNSGRTADIPALFLLGRDGYMIQRSLEQH 166



>gb:AF133727_482029 Lactobacillus helveticus cell
           envelope-associated proteinase (prtH) gene, complete
           cds.>gb:CQ778450_1451928 Sequence 1 from Patent
           WO2004015125.>gb:CQ887653_1454848 Sequence 1 from Patent
           EP1466529.>gb:CQ895941_1455090 Sequence 1 from Patent
           WO2004089097.
          Length = 1849

 Score = 37.7 bits (86), Expect = 0.19
 Identities = 23/63 (36%), Positives = 35/63 (55%)
 Frame = +3

Query: 342 VSKEKNAHQTLLTRSNPRDCCSTPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLII 521
           V K+KN +   L   + +   S  K K+A    +V RG   FT K  YA+ AGA+ ++I+
Sbjct: 455 VVKDKNGN---LGTGSAKQYTSAVKGKIA----IVKRGELTFTDKQKYAQEAGAAGLIIV 507

Query: 522 NNQ 530
           NN+
Sbjct: 508 NNK 510



>pir|B83278|B83278 probable aminopeptidase PA2939 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004720_57175
           Pseudomonas aeruginosa PAO1, section 281 of 529 of the
           complete genome.>gb:AE004091_971275 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 536

 Score = 37.7 bits (86), Expect = 0.19
 Identities = 16/33 (48%), Positives = 21/33 (63%)
 Frame = +3

Query: 426 AGDVIMVDRGNCKFTAKANYAEAAGASAVLIIN 524
           AG + ++ RG C F  KA  A AAGA+ V+I N
Sbjct: 186 AGSIALIQRGTCNFEQKAENAAAAGAAGVIIFN 218



>gb:BX908808_1644536 Neurospora crassa DNA linkage group IV Cosmid
           contig G21B4.
          Length = 508

 Score = 37.4 bits (85), Expect = 0.24
 Identities = 16/34 (47%), Positives = 24/34 (70%)
 Frame = +3

Query: 426 AGDVIMVDRGNCKFTAKANYAEAAGASAVLIINN 527
           +G++++V RGNC F  KA  A+ AGA  ++I NN
Sbjct: 148 SGNIVLVSRGNCTFGQKALSAKEAGAVGLVIYNN 181



>gb:SAPURCLUS_171797 S.alboniger napH, pur7, pur10, pur6, pur4, pur5
           and pur3 genes.
          Length = 485

 Score = 37.4 bits (85), Expect = 0.24
 Identities = 25/83 (30%), Positives = 39/83 (46%), Gaps = 1/83 (1%)
 Frame = +3

Query: 429 GDVIMVDRGNCKFTAKANYAEAAGASAVLIIN-NQKELYKMVCDPDETDLDIKIPAVMLP 605
           G + +VD G C    K   A  AGA+AV++ N    EL+  + DP+      +IP   + 
Sbjct: 161 GRIALVDAGGCSMDDKQRVAADAGAAAVIVANTGPGELHTWLADPEAA----RIPIGGVT 216

Query: 606 QDAGATLEKMLSSNSSVTVQLYS 674
           Q+ G  L     +  +V + L S
Sbjct: 217 QETGRLLAAEARAGRTVQLTLRS 239



>pir|G86434|G86434 protein F17F8.23 [imported] - Arabidopsis
           thaliana>gb:AE005172_891945 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC000107_1530048 Genomic sequence for
           Arabidopsis thaliana BAC F17F8 from chromosome I,
           complete sequence.
          Length = 649

 Score = 37.4 bits (85), Expect = 0.24
 Identities = 21/84 (25%), Positives = 43/84 (51%), Gaps = 6/84 (7%)
 Frame = +3

Query: 435 VIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDET-DLD-----IKIPAV 596
           ++++DRG C F  K    + +G +AVL+ +N  E    +  P+E+ + D     + IP+ 
Sbjct: 92  ILIIDRGECYFALKVWNGQQSGVAAVLVADNVDEPLITMDSPEESKEADDFIEKLNIPSA 151

Query: 597 MLPQDAGATLEKMLSSNSSVTVQL 668
           ++      TL++ L     V +++
Sbjct: 152 LIDFSFANTLKQALKKGEEVVLKI 175



>gb:AY119116_1300838 Drosophila melanogaster RE16431 full insert
           cDNA.
          Length = 801

 Score = 37.0 bits (84), Expect = 0.32
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 4/62 (6%)
 Frame = +3

Query: 429 GDVIMVDRGNCKFTAKANYAEAAGASAVLIINN----QKELYKMVCDPDETDLDIKIPAV 596
           G V++ +RG+C F +KA  A+  GA+A+++ +N      E   M     +   D+ IP V
Sbjct: 686 GKVLVAERGDCTFVSKARLAQKVGAAALIVCDNVPGSSGETQPMFAMSGDGKDDVLIPVV 745

Query: 597 ML 602
            +
Sbjct: 746 FM 747



>gb:AE014134_1128992 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003639_1219099 Drosophila melanogaster
           chromosome 2L, section 48 of 83 of the complete
           sequence.
          Length = 801

 Score = 37.0 bits (84), Expect = 0.32
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 4/62 (6%)
 Frame = +3

Query: 429 GDVIMVDRGNCKFTAKANYAEAAGASAVLIINN----QKELYKMVCDPDETDLDIKIPAV 596
           G V++ +RG+C F +KA  A+  GA+A+++ +N      E   M     +   D+ IP V
Sbjct: 686 GKVLVAERGDCTFVSKARLAQKVGAAALIVCDNVPGSSGETQPMFAMSGDGKDDVLIPVV 745

Query: 597 ML 602
            +
Sbjct: 746 FM 747



>gb:AF243528_492091 Streptococcus thermophilus cell envelope
           proteinase (prtS) gene, complete cds.
          Length = 1585

 Score = 37.0 bits (84), Expect = 0.32
 Identities = 23/68 (33%), Positives = 35/68 (51%)
 Frame = +3

Query: 423 LAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDLDIKIPAVML 602
           L G + ++ RG   F+ K   A AAGA  V+I N++     +    D+T   I IP+V +
Sbjct: 438 LTGKLALIKRGTITFSEKIANATAAGAVGVVIFNSRPGEANVSMQLDDT--AIAIPSVFI 495

Query: 603 PQDAGATL 626
           P + G  L
Sbjct: 496 PLEFGEAL 503



>gb:AE017241_414611 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 15 of 16 of the complete
           genome.>gb:AE016958_1058015 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 498

 Score = 37.0 bits (84), Expect = 0.32
 Identities = 21/66 (31%), Positives = 34/66 (51%)
 Frame = +3

Query: 429 GDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDLDIKIPAVMLPQ 608
           G VI++DRG C F  K + A   GA A++I +N  E  + +        ++KIP + + +
Sbjct: 165 GAVILLDRGTCPFAQKEDVAAQRGAVALIIADNVDE--QQMGGTLGPSTEVKIPVLSVTK 222

Query: 609 DAGATL 626
             G  L
Sbjct: 223 SVGVQL 228



>sp|Q02470|P2P_LACPA PII-type proteinase precursor (EC 3.4.21.96)
           (Lactocepin) (Cell wall- associated serine proteinase)
           (LP151).>pir|B44858|B44858 lactocepin (EC 3.4.21.96)
           precursor [validated] - Lactobacillus paracasei (strain
           NCDO 151)>gb:LBAMPRO_140096 Lactobacillus paracasei
           proteinase (prtP) gene, complete cds; maturation protein
           (prtM) gene, complete cds.
          Length = 1902

 Score = 36.6 bits (83), Expect = 0.41
 Identities = 15/33 (45%), Positives = 22/33 (66%)
 Frame = +3

Query: 429 GDVIMVDRGNCKFTAKANYAEAAGASAVLIINN 527
           G + +V RG   F  K  YA+AAGA+ ++I+NN
Sbjct: 487 GKIAIVKRGELNFADKQKYAQAAGAAGLIIVNN 519



>gb:AF468027_513919 Lactobacillus pentosus cell-envelope proteinase
           (prtP) gene, partial cds.
          Length = 413

 Score = 36.2 bits (82), Expect = 0.54
 Identities = 15/33 (45%), Positives = 22/33 (66%)
 Frame = +3

Query: 429 GDVIMVDRGNCKFTAKANYAEAAGASAVLIINN 527
           G + +V RG   F  K  YA+AAGA+ ++I+NN
Sbjct: 278 GKIAIVKRGELTFADKQKYAQAAGAAGLIIVNN 310



>pir|B45764|B45764 lactocepin (EC 3.4.21.96) precursor [validated] -
           Lactococcus lactis subsp. cremoris (strain Wg2) plasmid
           pWV05
          Length = 1902

 Score = 36.2 bits (82), Expect = 0.54
 Identities = 15/33 (45%), Positives = 22/33 (66%)
 Frame = +3

Query: 429 GDVIMVDRGNCKFTAKANYAEAAGASAVLIINN 527
           G + +V RG   F  K  YA+AAGA+ ++I+NN
Sbjct: 487 GKIAIVKRGELSFDDKQKYAQAAGAAGLIIVNN 519



>sp|P15293|P2P_LACLC PII-type proteinase precursor (EC 3.4.21.96)
           (Lactocepin) (Cell wall- associated serine proteinase)
           (LP151).>pir|S06997|S06997 lactocepin (EC 3.4.21.96)
           precursor [similarity] - Lactococcus lactis plasmid
           pLP763>gb:SLPRT763_183723 Streptococcus lactis plasmid
           pLP763 prt gene for cell wall-associated serine
           proteinase.
          Length = 1902

 Score = 36.2 bits (82), Expect = 0.54
 Identities = 15/33 (45%), Positives = 22/33 (66%)
 Frame = +3

Query: 429 GDVIMVDRGNCKFTAKANYAEAAGASAVLIINN 527
           G + +V RG   F  K  YA+AAGA+ ++I+NN
Sbjct: 487 GKIAIVKRGELTFADKQKYAQAAGAAGLIIVNN 519



>sp|P16271|P1P_LACLC PI-type proteinase precursor (EC 3.4.21.-)
           (Wall-associated serine proteinase).>gb:STRWGPROT_193630
           S. cremoris Wg2 proteinase gene, complete cds.
          Length = 1902

 Score = 36.2 bits (82), Expect = 0.54
 Identities = 15/33 (45%), Positives = 22/33 (66%)
 Frame = +3

Query: 429 GDVIMVDRGNCKFTAKANYAEAAGASAVLIINN 527
           G + +V RG   F  K  YA+AAGA+ ++I+NN
Sbjct: 487 GKIAIVKRGELSFDDKQKYAQAAGAAGLIIVNN 519



>gb:BC056113_2551695 Xenopus laevis hypothetical protein MGC69137,
           mRNA (cDNA clone MGC:69137 IMAGE:5048403), complete cds.
          Length = 336

 Score = 35.8 bits (81), Expect = 0.71
 Identities = 27/90 (30%), Positives = 44/90 (48%), Gaps = 6/90 (6%)
 Frame = +3

Query: 375 LTRSNPRDCCST--PKNKLAGD---VIMVDRGNCKFTAKANYAEAAGASAVLIIN-NQKE 536
           L  + P + CS   P   LA D   ++++ R +C F  K  +A+ AG +A ++ N     
Sbjct: 64  LVEAVPSNGCSPILPPPTLANDTSFIVLIRRYDCHFDTKVLHAQLAGYAAAIVHNVGSDS 123

Query: 537 LYKMVCDPDETDLDIKIPAVMLPQDAGATL 626
           L  M  + + T   I IP+V   + AG +L
Sbjct: 124 LLHMSRNDETTWRHITIPSVFTGETAGNSL 153



>gb:AY436357_1606119 Aspergillus fumigatus LAP1 gene, complete cds.
          Length = 498

 Score = 35.8 bits (81), Expect = 0.71
 Identities = 33/147 (22%), Positives = 56/147 (38%)
 Frame = +3

Query: 231 KKPGCENDFVLVKIQTWVDGVEDAEFVGVGARFGTTIVSKEKNAHQTLLTRSNPRDCCST 410
           KK G  + +   ++  W    +     G      T   S   NA   L   +N     + 
Sbjct: 78  KKTGYYDVYKQPQVHQWTRADQALTVDGQSYDATTMTYSPSVNATAPLAVVNNLGCVEAD 137

Query: 411 PKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDLDIKIP 590
               L G + ++ RG C F  K+  +  AGA+A L+ NN +           ++L    P
Sbjct: 138 YPADLTGKIALISRGECTFATKSVLSAKAGAAAALVYNNIEGSMAGTLGGATSELGAYAP 197

Query: 591 AVMLPQDAGATLEKMLSSNSSVTVQLY 671
              +    G  L +M+ +  +VT  L+
Sbjct: 198 IAGISLADGQALIQMIQA-GTVTANLW 223



>gb:AY231873_1177166 Drosophila yakuba clone yak-em_CG9849 mRNA
           sequence.
          Length = 114

 Score = 35.8 bits (81), Expect = 0.71
 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 4/76 (5%)
 Frame = +3

Query: 423 LAGDVIMVDRGNCKFTAKANYAEAAGASAVLII----NNQKELYKMVCDPDETDLDIKIP 590
           L G V ++DRG C F  K   AEAAGA A +I     ++ +  + +    D +  D  IP
Sbjct: 7   LNGAVALIDRGECSFLTKTLRAEAAGALAAIITEYNPSSPEFEHYIEMIHDNSQKDANIP 66

Query: 591 AVMLPQDAGATLEKML 638
           A  L    G  +   L
Sbjct: 67  AGFLLGKNGVIIRSTL 82



>gb:AF247159_492447 Lactococcus lactis subsp. cremoris plasmid
           pHP003, complete sequence.
          Length = 1902

 Score = 35.8 bits (81), Expect = 0.71
 Identities = 15/33 (45%), Positives = 22/33 (66%)
 Frame = +3

Query: 429 GDVIMVDRGNCKFTAKANYAEAAGASAVLIINN 527
           G + +V RG   F  K  YA+AAGA+ ++I+NN
Sbjct: 487 GKIAIVKRGELTFDDKQKYAQAAGAAGLIIVNN 519



>gb:AX119103_1461609 Sequence 267 from Patent
           WO0129221.>gb:AY358605_1947484 Homo sapiens clone
           DNA76532 C2orf7 (UNQ833) mRNA, complete
           cds.>gb:BC005069_1969573 Homo sapiens chromosome 2 open
           reading frame 7, mRNA (cDNA clone MGC:13004
           IMAGE:3530601), complete cds.
          Length = 188

 Score = 35.4 bits (80), Expect = 0.92
 Identities = 24/98 (24%), Positives = 41/98 (41%), Gaps = 4/98 (4%)
 Frame = +3

Query: 366 QTLLTRSNPRDCCSTPKNK--LAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINN--QK 533
           Q  L  + P + C    N   +   + +V+RG C F +K    +  G  AV+I +N    
Sbjct: 62  QIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDN 121

Query: 534 ELYKMVCDPDETDLDIKIPAVMLPQDAGATLEKMLSSN 647
           + + +    D T     IPA+ L    G  + + L  +
Sbjct: 122 DSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQH 159



>gb:AK006658_1153673 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:1700040I03
           product:hypothetical Protease associated (PA) domain
           containing protein, full insert sequence.
          Length = 188

 Score = 35.4 bits (80), Expect = 0.92
 Identities = 24/98 (24%), Positives = 41/98 (41%), Gaps = 4/98 (4%)
 Frame = +3

Query: 366 QTLLTRSNPRDCCSTPKNK--LAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINN--QK 533
           Q  L  + P + C    N   +   + +V+RG C F +K    +  G  AV+I +N    
Sbjct: 62  QIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDN 121

Query: 534 ELYKMVCDPDETDLDIKIPAVMLPQDAGATLEKMLSSN 647
           + + +    D T     IPA+ L    G  + + L  +
Sbjct: 122 DSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQH 159



>gb:LDE512946_140281 Lactobacillus delbrueckii subsp. lactis prtB
           gene for proteinase B.
          Length = 1942

 Score = 35.4 bits (80), Expect = 0.92
 Identities = 24/91 (26%), Positives = 43/91 (47%), Gaps = 1/91 (1%)
 Frame = +3

Query: 396 DCCSTPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKE-LYKMVCDPDETD 572
           D  +  K ++ G + +V RG+  F+ K   A+AAGA+ ++I NN  + L  M  D     
Sbjct: 496 DYTAEKKAEVKGQLAVVKRGSYTFSEKVANAKAAGAAGIVIYNNNDDGLLSMALD----- 550

Query: 573 LDIKIPAVMLPQDAGATLEKMLSSNSSVTVQ 665
            D   P + + +  G  L +      S+ ++
Sbjct: 551 -DKTFPTLGMSKADGEVLAQAAKDGKSIKLK 580



>gb:AE014297_1138178 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE014297_1138179 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE014297_1138180
           Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003675_1220336 Drosophila melanogaster
           chromosome 3R, section 9 of 118 of the complete
           sequence.>gb:AE003675_1220337 Drosophila melanogaster
           chromosome 3R, section 9 of 118 of the complete
           sequence.>gb:AE003675_1220338 Drosophila melanogaster
           chromosome 3R, section 9 of 118 of the complete
           sequence.
          Length = 536

 Score = 35.0 bits (79), Expect = 1.2
 Identities = 21/64 (32%), Positives = 33/64 (51%)
 Frame = +3

Query: 435 VIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDLDIKIPAVMLPQDA 614
           V +V RG C F  K   A+ A  SAV++ NN+ +  + +   + T   I+IP+V +    
Sbjct: 90  VALVARGECVFERKIRVAQNASYSAVIVYNNEGDDLEQMSAENIT--GIRIPSVFVGHTT 147

Query: 615 GATL 626
           G  L
Sbjct: 148 GKAL 151



>gb:BC026578_2095432 Mus musculus RIKEN cDNA 2010106G01 gene, mRNA
           (cDNA clone MGC:36779 IMAGE:5059823), complete cds.
          Length = 333

 Score = 34.7 bits (78), Expect = 1.6
 Identities = 31/118 (26%), Positives = 50/118 (42%), Gaps = 3/118 (2%)
 Frame = +3

Query: 333 TTIVSKEKNAHQTLLTRSNPRDCC---STPKNKLAGDVIMVDRGNCKFTAKANYAEAAGA 503
           T + S  +NA    L        C     P + +    ++V  G C F  KA  A+  GA
Sbjct: 53  TRLPSSLENATSLSLMNLTGTPLCHLSDIPPDGIRNKAVVVHWGPCHFLEKARIAQEGGA 112

Query: 504 SAVLIINNQKELYKMVCDPDETDLDIKIPAVMLPQDAGATLEKMLSSNSSVTVQLYSP 677
           +A+LI NN   +          ++ + I AV+  +D     E +      +TV++YSP
Sbjct: 113 AALLIANNSVLIPSSRNKSTFQNVTVLI-AVITQKDFKDMKETL---GDDITVKMYSP 166



>gb:BT002840_1636433 Arabidopsis thaliana clone RAFL15-01-I16
           (R20307) putative subtilisin-like serine protease
           (At1g01900) mRNA, complete cds.
          Length = 774

 Score = 34.7 bits (78), Expect = 1.6
 Identities = 22/88 (25%), Positives = 43/88 (48%)
 Frame = +3

Query: 405 STPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDLDIK 584
           S  +  + G +++  RG    TAK    + +G +A+L+++ + E  +++ DP        
Sbjct: 401 SLKRELVEGKIVICLRGASGRTAKGEEVKRSGGAAMLLVSTEAEGEELLADPH------V 454

Query: 585 IPAVMLPQDAGATLEKMLSSNSSVTVQL 668
           +PAV L    G TL   L+  ++ T  +
Sbjct: 455 LPAVSLGFSDGKTLLNYLAGAANATASV 482



>pir|G86150|G86150 F22M8.3 protein - Arabidopsis
           thaliana>gb:AE005172_889240 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F22M8_1677894 Sequence of BAC F22M8 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 756

 Score = 34.7 bits (78), Expect = 1.6
 Identities = 22/88 (25%), Positives = 43/88 (48%)
 Frame = +3

Query: 405 STPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDLDIK 584
           S  +  + G +++  RG    TAK    + +G +A+L+++ + E  +++ DP        
Sbjct: 383 SLKRELVEGKIVICLRGASGRTAKGEEVKRSGGAAMLLVSTEAEGEELLADPH------V 436

Query: 585 IPAVMLPQDAGATLEKMLSSNSSVTVQL 668
           +PAV L    G TL   L+  ++ T  +
Sbjct: 437 LPAVSLGFSDGKTLLNYLAGAANATASV 464



>gb:BC025401_1978499 Homo sapiens intramembrane protease 5, mRNA
           (cDNA clone MGC:27096 IMAGE:4829763), complete cds.
          Length = 684

 Score = 34.3 bits (77), Expect = 2.1
 Identities = 27/99 (27%), Positives = 39/99 (39%), Gaps = 8/99 (8%)
 Frame = +3

Query: 405 STPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVC--------DP 560
           S  +  L     MV RGNC F  K   A+  GA  +LI++   +     C        DP
Sbjct: 83  SPSQRPLRQTTAMVMRGNCSFHTKGWLAQGQGAHGLLIVSRVSD---QQCSDTTLAPQDP 139

Query: 561 DETDLDIKIPAVMLPQDAGATLEKMLSSNSSVTVQLYSP 677
            +   D+ IP  ML       +       + V V +Y+P
Sbjct: 140 RQPLADLTIPVAMLHYADMLDILSHTRGEAVVRVAMYAP 178



>gb:BC022041_1977675 Homo sapiens intramembrane protease 5, mRNA
           (cDNA clone IMAGE:4825062), partial cds.
          Length = 690

 Score = 34.3 bits (77), Expect = 2.1
 Identities = 27/99 (27%), Positives = 39/99 (39%), Gaps = 8/99 (8%)
 Frame = +3

Query: 405 STPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVC--------DP 560
           S  +  L     MV RGNC F  K   A+  GA  +LI++   +     C        DP
Sbjct: 89  SPSQRPLRQTTAMVMRGNCSFHTKGWLAQGQGAHGLLIVSRVSD---QQCSDTTLAPQDP 145

Query: 561 DETDLDIKIPAVMLPQDAGATLEKMLSSNSSVTVQLYSP 677
            +   D+ IP  ML       +       + V V +Y+P
Sbjct: 146 RQPLADLTIPVAMLHYADMLDILSHTRGEAVVRVAMYAP 184



>gb:AY169316_1937683 Homo sapiens intramembrane protease (IMP5)
           gene, complete cds.
          Length = 684

 Score = 34.3 bits (77), Expect = 2.1
 Identities = 27/99 (27%), Positives = 39/99 (39%), Gaps = 8/99 (8%)
 Frame = +3

Query: 405 STPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVC--------DP 560
           S  +  L     MV RGNC F  K   A+  GA  +LI++   +     C        DP
Sbjct: 83  SPSQRPLRQTTAMVMRGNCSFHTKGWLAQGQGAHGLLIVSRVSD---QQCSDTTLAPQDP 139

Query: 561 DETDLDIKIPAVMLPQDAGATLEKMLSSNSSVTVQLYSP 677
            +   D+ IP  ML       +       + V V +Y+P
Sbjct: 140 RQPLADLTIPVAMLHYADMLDILSHTRGEAVVRVAMYAP 178



>gb:AY337316_611080 Lactobacillus delbrueckii subsp. lactis cell
           envelope proteinase (prtB) gene, partial cds.
          Length = 813

 Score = 34.3 bits (77), Expect = 2.1
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = +3

Query: 396 DCCSTPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKE-LYKMVCD 557
           D  +  K ++ G + +V RG+  F+ K   A+AAGA+ ++I NN  + L  M  D
Sbjct: 478 DYTAEKKAEVKGQLAVVKRGSYTFSEKVANAKAAGAAGIVIYNNNDDGLLSMALD 532



>gb:AE015634_316305 Shewanella oneidensis MR-1 section 183 of 457 of
           the complete genome.>gb:AE014299_951902 Shewanella
           oneidensis MR-1 complete genome.
          Length = 1300

 Score = 34.3 bits (77), Expect = 2.1
 Identities = 25/95 (26%), Positives = 42/95 (44%), Gaps = 1/95 (1%)
 Frame = +3

Query: 375 LTRSNPRDCCSTPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVC 554
           L  +N   C +   +   G + ++ RG C F  K   A  AGA  V++ N + E    + 
Sbjct: 494 LDSTNFEACKAFATDAFKGKIAVIKRGGCTFDVKVAAALNAGAKGVVVFNREGEGNTRL- 552

Query: 555 DPDETDLD-IKIPAVMLPQDAGATLEKMLSSNSSV 656
               + L+   IPAV +    G  L   +++N S+
Sbjct: 553 --SMSGLEKFNIPAVFIGNTDGLALIDAITANPSL 585



>sp|Q9JJF9|PSL2_MOUSE Signal peptide peptidase-like 2A (EC 3.4.99.-)
           (SPP-like 2A protein) (SPPL2a protein) (Intramembrane
           protease 3) (IMP3) (Presenilin-like protein
           2).>gb:AB041547_2045417 Mus musculus brain cDNA, clone
           MNCb-3763, similar to AC004410 fos39554_1 (Homo
           sapiens).
          Length = 523

 Score = 34.3 bits (77), Expect = 2.1
 Identities = 25/89 (28%), Positives = 42/89 (47%)
 Frame = +3

Query: 411 PKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDLDIKIP 590
           P + +    ++V  G C F  KA  A+  GA+A+LI NN   +          ++ + I 
Sbjct: 82  PPDGIRNKAVVVHWGPCHFLEKARIAQEGGAAALLIANNSVLIPSSRNKSTFQNVTVLI- 140

Query: 591 AVMLPQDAGATLEKMLSSNSSVTVQLYSP 677
           AV+  +D     E +      +TV++YSP
Sbjct: 141 AVITQKDFKDMKETL---GDDITVKMYSP 166



>gb:AY190520_2078838 Rattus norvegicus Sprague-Dawley liver
           r-goliath mRNA, complete cds; nuclear gene for
           mitochondrial product.
          Length = 419

 Score = 33.9 bits (76), Expect = 2.7
 Identities = 26/79 (32%), Positives = 38/79 (48%), Gaps = 1/79 (1%)
 Frame = +3

Query: 435 VIMVDRGNCKFTAKANYAEAAGASAVLIINNQ-KELYKMVCDPDETDLDIKIPAVMLPQD 611
           + ++ RGNC F  K + A    A AV+I NN+ KE    +  P   D    I AVM+ + 
Sbjct: 105 IALLQRGNCTFKEKISRAAFHNAVAVVIYNNKSKEEPVTMTHPGTGD----IIAVMITEL 160

Query: 612 AGATLEKMLSSNSSVTVQL 668
            G  +   L  N SV + +
Sbjct: 161 RGKDILSYLEKNISVQMTI 179



>gb:AL627187_2071579 Mouse DNA sequence from clone RP23-319B15 on
           chromosome 11 Contains the 3' end of the Rnf130 gene for
           ring finger protein 130, a heterogeneous nuclear
           ribonucleoprotein A family pseudogene, a novel gene,
           genes 2700008N14Rik and 3010026O09Rik, the Sqstm1 gene
           for sequestosome 1, the Mgat4b gene for mannoside
           acetylglucosaminyltransferase 4 isoenzyme B, the Ltc4s
           gene for leukotriene C4 synthase and four CpG islands,
           complete sequence.>gb:AL645913_2072011 Mouse DNA
           sequence from clone RP23-194G14 on chromosome 11
           Contains the 3' end of gene 9130006A14Rik, the 5' end of
           the Rnf130 gene for ring finger protein 130 and a CpG
           island, complete sequence.
          Length = 384

 Score = 33.9 bits (76), Expect = 2.7
 Identities = 26/79 (32%), Positives = 38/79 (48%), Gaps = 1/79 (1%)
 Frame = +3

Query: 435 VIMVDRGNCKFTAKANYAEAAGASAVLIINNQ-KELYKMVCDPDETDLDIKIPAVMLPQD 611
           + ++ RGNC F  K + A    A AV+I NN+ KE    +  P   D    I AVM+ + 
Sbjct: 105 IALLQRGNCTFKEKISRAAFHNAVAVVIYNNKSKEEPVTMTHPGTGD----IIAVMITEL 160

Query: 612 AGATLEKMLSSNSSVTVQL 668
            G  +   L  N SV + +
Sbjct: 161 RGKDILSYLEKNISVQMTI 179



>gb:AL627187_2071578 Mouse DNA sequence from clone RP23-319B15 on
           chromosome 11 Contains the 3' end of the Rnf130 gene for
           ring finger protein 130, a heterogeneous nuclear
           ribonucleoprotein A family pseudogene, a novel gene,
           genes 2700008N14Rik and 3010026O09Rik, the Sqstm1 gene
           for sequestosome 1, the Mgat4b gene for mannoside
           acetylglucosaminyltransferase 4 isoenzyme B, the Ltc4s
           gene for leukotriene C4 synthase and four CpG islands,
           complete sequence.>gb:AL645913_2072012 Mouse DNA
           sequence from clone RP23-194G14 on chromosome 11
           Contains the 3' end of gene 9130006A14Rik, the 5' end of
           the Rnf130 gene for ring finger protein 130 and a CpG
           island, complete sequence.>gb:BC018199_2092578 Mus
           musculus ring finger protein 130, mRNA (cDNA clone
           MGC:25596 IMAGE:4017435), complete
           cds.>gb:BC048901_2099861 Mus musculus ring finger
           protein 130, mRNA (cDNA clone MGC:56732 IMAGE:6390079),
           complete cds.
          Length = 419

 Score = 33.9 bits (76), Expect = 2.7
 Identities = 26/79 (32%), Positives = 38/79 (48%), Gaps = 1/79 (1%)
 Frame = +3

Query: 435 VIMVDRGNCKFTAKANYAEAAGASAVLIINNQ-KELYKMVCDPDETDLDIKIPAVMLPQD 611
           + ++ RGNC F  K + A    A AV+I NN+ KE    +  P   D    I AVM+ + 
Sbjct: 105 IALLQRGNCTFKEKISRAAFHNAVAVVIYNNKSKEEPVTMTHPGTGD----IIAVMITEL 160

Query: 612 AGATLEKMLSSNSSVTVQL 668
            G  +   L  N SV + +
Sbjct: 161 RGKDILSYLEKNISVQMTI 179



>gb:AF171875_2057708 Mus musculus g1-related zinc finger protein
           (G1rp) mRNA, complete cds.
          Length = 419

 Score = 33.9 bits (76), Expect = 2.7
 Identities = 26/79 (32%), Positives = 38/79 (48%), Gaps = 1/79 (1%)
 Frame = +3

Query: 435 VIMVDRGNCKFTAKANYAEAAGASAVLIINNQ-KELYKMVCDPDETDLDIKIPAVMLPQD 611
           + ++ RGNC F  K + A    A AV+I NN+ KE    +  P   D    I AVM+ + 
Sbjct: 105 IALLQRGNCTFKEKISRAAFHNAVAVVIYNNKSKEEPVTMTHPGTGD----IIAVMITEL 160

Query: 612 AGATLEKMLSSNSSVTVQL 668
            G  +   L  N SV + +
Sbjct: 161 RGKDILSYLEKNISVQMTI 179



>gb:BC017100_1975908 Homo sapiens ring finger protein 130, mRNA
           (cDNA clone IMAGE:3535930), partial cds.
          Length = 418

 Score = 33.9 bits (76), Expect = 2.7
 Identities = 26/79 (32%), Positives = 38/79 (48%), Gaps = 1/79 (1%)
 Frame = +3

Query: 435 VIMVDRGNCKFTAKANYAEAAGASAVLIINNQ-KELYKMVCDPDETDLDIKIPAVMLPQD 611
           + ++ RGNC F  K + A    A AV+I NN+ KE    +  P   D    I AVM+ + 
Sbjct: 104 IALLQRGNCTFKEKISRAAFHNAVAVVIYNNKSKEEPVTMTHPGTGD----IIAVMITEL 159

Query: 612 AGATLEKMLSSNSSVTVQL 668
            G  +   L  N SV + +
Sbjct: 160 RGKDILSYLEKNISVQMTI 178



>gb:AX083330_1460809 Sequence 22 from Patent
           WO0112660.>gb:AY083998_1936176 Homo sapiens goliath
           protein mRNA, complete cds.
          Length = 419

 Score = 33.9 bits (76), Expect = 2.7
 Identities = 26/79 (32%), Positives = 38/79 (48%), Gaps = 1/79 (1%)
 Frame = +3

Query: 435 VIMVDRGNCKFTAKANYAEAAGASAVLIINNQ-KELYKMVCDPDETDLDIKIPAVMLPQD 611
           + ++ RGNC F  K + A    A AV+I NN+ KE    +  P   D    I AVM+ + 
Sbjct: 105 IALLQRGNCTFKEKISRAAFHNAVAVVIYNNKSKEEPVTMTHPGTGD----IIAVMITEL 160

Query: 612 AGATLEKMLSSNSSVTVQL 668
            G  +   L  N SV + +
Sbjct: 161 RGKDILSYLEKNISVQMTI 179



>pir|C70330|C70330 conserved hypothetical protein aq_340 - Aquifex
           aeolicus>gb:AE000684_26022 Aquifex aeolicus VF5 section
           16 of 109 of the complete genome.>gb:AE000657_976553
           Aquifex aeolicus VF5 complete genome.
          Length = 585

 Score = 33.9 bits (76), Expect = 2.7
 Identities = 22/74 (29%), Positives = 33/74 (44%)
 Frame = +3

Query: 414 KNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDLDIKIPA 593
           KN  AG V  +D        K   A      A+  +  +KELYK VC+    +LDIK   
Sbjct: 323 KNSYAGLVFFIDITKEVLYQKLYKALRNVNRAIATVLTEKELYKTVCETLVKELDIKFAW 382

Query: 594 VMLPQDAGATLEKM 635
           + +P +   T + +
Sbjct: 383 IGVPDEKTKTFKSI 396



>gb:BC087132_2110022 Rattus norvegicus cDNA clone MGC:95005
           IMAGE:7121303, complete cds.
          Length = 577

 Score = 33.5 bits (75), Expect = 3.5
 Identities = 13/41 (31%), Positives = 22/41 (53%)
 Frame = +3

Query: 411 PKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQK 533
           P       + +V RGNC F  K   A+ +GA  +LI++ ++
Sbjct: 76  PVEDFTNQIALVARGNCTFYEKVRLAQGSGAHGLLIVSKER 116



>gb:A67181_1450249 Sequence 1 from Patent EP0810289.
          Length = 1946

 Score = 33.5 bits (75), Expect = 3.5
 Identities = 16/47 (34%), Positives = 29/47 (61%)
 Frame = +3

Query: 396 DCCSTPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKE 536
           D  +  K ++ G + +V RG   F+AK   A+AAGA+ ++I N++ +
Sbjct: 478 DYTAEKKAEVKGQLAVVKRGAYTFSAKVANAKAAGAAGIVIYNSEDD 524



>gb:A15841_1447632 clone SK112 ClaI-SalI downstream fragment of the
           proteinase gene from pSKIII.
          Length = 1570

 Score = 33.5 bits (75), Expect = 3.5
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = +3

Query: 429 GDVIMVDRGNCKFTAKANYAEAAGASAVLIIN 524
           G + +V RG   F  K  YA+AAGA+ ++I+N
Sbjct: 497 GKIAIVKRGEFSFDDKQKYAQAAGAAGLIIVN 528



>gb:AK077122_1171675 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4933407P14
           product:weakly similar to HYPOTHETICAL 75.1 KDA PROTEIN
           (FRAGMENT) [Homo sapiens], full insert sequence.
          Length = 545

 Score = 33.5 bits (75), Expect = 3.5
 Identities = 25/97 (25%), Positives = 43/97 (44%), Gaps = 6/97 (6%)
 Frame = +3

Query: 405 STPKNK-LAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQK-----ELYKMVCDPDE 566
           S+P+ + L     MV RGNC F AK   A+  GA  +LI++  +     +      DP +
Sbjct: 88  SSPRQRPLHQTTTMVTRGNCSFYAKGWLAQDQGAQGLLIVSRARNQQCSDTISKPQDPSK 147

Query: 567 TDLDIKIPAVMLPQDAGATLEKMLSSNSSVTVQLYSP 677
               + IP  +L       +      ++ V V +++P
Sbjct: 148 PWPALTIPVAVLRYTDMLDIVSHTYGDTDVRVAMFAP 184



>pir|JC6032|JC6032 lactocepin (EC 3.4.21.96) precursor [similarity]
           - Lactobacillus delbrueckii subsp.
           bulgaricus>gb:LBAPRTB_140113 Lactobacillus delbrueckii
           proteinase precursor (prtB) gene, complete cds.
          Length = 1946

 Score = 33.5 bits (75), Expect = 3.5
 Identities = 16/47 (34%), Positives = 29/47 (61%)
 Frame = +3

Query: 396 DCCSTPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKE 536
           D  +  K ++ G + +V RG   F+AK   A+AAGA+ ++I N++ +
Sbjct: 478 DYTAEKKAEVKGQLAVVKRGAYTFSAKVANAKAAGAAGIVIYNSEDD 524



>pir|A32634|A32634 lactocepin (EC 3.4.21.96) precursor [similarity]
           - Lactococcus lactis subsp. cremoris (strain SK11)
           plasmid pSK111>gb:LACPRASE_139977 Lactococcus lactis
           PIII-type proteinase (prtP) and maturation protein
           (prtM) genes, complete cds.>gb:A30032_1448364 L.lactis
           SK11 protease gene from patent EP0411715.
          Length = 1962

 Score = 33.5 bits (75), Expect = 3.5
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = +3

Query: 429 GDVIMVDRGNCKFTAKANYAEAAGASAVLIIN 524
           G + +V RG   F  K  YA+AAGA+ ++I+N
Sbjct: 487 GKIAIVKRGEFSFDDKQKYAQAAGAAGLIIVN 518



>sp|P15292|P3P_LACLC PIII-type proteinase precursor (EC 3.4.21.96)
           (Lactocepin) (Cell wall- associated serine proteinase).
          Length = 1902

 Score = 33.5 bits (75), Expect = 3.5
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = +3

Query: 429 GDVIMVDRGNCKFTAKANYAEAAGASAVLIIN 524
           G + +V RG   F  K  YA+AAGA+ ++I+N
Sbjct: 487 GKIAIVKRGEFSFDDKQKYAQAAGAAGLIIVN 518



>gb:BC056100_2551682 Xenopus laevis hypothetical protein MGC69113,
           mRNA (cDNA clone MGC:69113 IMAGE:5047635), complete cds.
          Length = 606

 Score = 33.1 bits (74), Expect = 4.6
 Identities = 27/98 (27%), Positives = 41/98 (41%), Gaps = 9/98 (9%)
 Frame = +3

Query: 411 PKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIIN---------NQKELYKMVCDPD 563
           P+      + MV RGNC F  K   A+  GA  +LI++         NQ +        +
Sbjct: 54  PEGGFINRIPMVMRGNCTFYEKVRLAQINGARGLLIVSRETLVPPGGNQSQF-------E 106

Query: 564 ETDLDIKIPAVMLPQDAGATLEKMLSSNSSVTVQLYSP 677
           E D+ + + +     D G T  K      SV V +Y+P
Sbjct: 107 EIDIPVALLSYSDMLDIGKTFGK------SVKVAMYAP 138



>gb:BC029264_1979439 Homo sapiens ring finger protein 148, mRNA
           (cDNA clone MGC:35222 IMAGE:5172102), complete cds.
          Length = 305

 Score = 33.1 bits (74), Expect = 4.6
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = +3

Query: 441 MVDRGNCKFTAKANYAEAAGASAVLIINNQ 530
           +++RG C FT K N A   GA+ V+I N Q
Sbjct: 104 LIERGGCTFTHKINVAAEKGANGVIIYNYQ 133



>gb:BC028391_1979251 Homo sapiens SPPL2b, mRNA (cDNA clone MGC:33336
           IMAGE:4822524), complete cds.
          Length = 483

 Score = 33.1 bits (74), Expect = 4.6
 Identities = 13/41 (31%), Positives = 23/41 (56%)
 Frame = +3

Query: 411 PKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQK 533
           P    +  + +V RGNC F  K   A+ +GA  +LI++ ++
Sbjct: 54  PARGFSNQIPLVARGNCTFYEKVRLAQGSGARGLLIVSRER 94



>gb:AY169315_1937682 Homo sapiens intramembrane protease (IMP4)
           mRNA, complete cds.>gb:HSA345027_2004095 Homo sapiens
           mRNA for presenilin-like protein 1 (PSL1 gene).
          Length = 592

 Score = 33.1 bits (74), Expect = 4.6
 Identities = 13/41 (31%), Positives = 23/41 (56%)
 Frame = +3

Query: 411 PKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQK 533
           P    +  + +V RGNC F  K   A+ +GA  +LI++ ++
Sbjct: 82  PARGFSNQIPLVARGNCTFYEKVRLAQGSGARGLLIVSRER 122



>gb:AK098654_1915174 Homo sapiens cDNA FLJ25788 fis, clone TST06884.
          Length = 305

 Score = 33.1 bits (74), Expect = 4.6
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = +3

Query: 441 MVDRGNCKFTAKANYAEAAGASAVLIINNQ 530
           +++RG C FT K N A   GA+ V+I N Q
Sbjct: 104 LIERGGCTFTHKINVAAEKGANGVIIYNYQ 133



>gb:AC005258_1874905 Homo sapiens chromosome 19, cosmid R30783
           (LLNLR-269E7) and 3' overlapping PCR product, complete
           sequence.
          Length = 243

 Score = 33.1 bits (74), Expect = 4.6
 Identities = 13/41 (31%), Positives = 23/41 (56%)
 Frame = +3

Query: 411 PKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQK 533
           P    +  + +V RGNC F  K   A+ +GA  +LI++ ++
Sbjct: 91  PARGFSNQIPLVARGNCTFYEKVRLAQGSGARGLLIVSRER 131



>gb:AB040965_1866894 Homo sapiens mRNA for KIAA1532 protein, partial
           cds.
          Length = 601

 Score = 33.1 bits (74), Expect = 4.6
 Identities = 13/41 (31%), Positives = 23/41 (56%)
 Frame = +3

Query: 411 PKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQK 533
           P    +  + +V RGNC F  K   A+ +GA  +LI++ ++
Sbjct: 91  PARGFSNQIPLVARGNCTFYEKVRLAQGSGARGLLIVSRER 131



>gb:AX061659_1458692 Sequence 64 from Patent WO0100806.
          Length = 305

 Score = 33.1 bits (74), Expect = 4.6
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = +3

Query: 441 MVDRGNCKFTAKANYAEAAGASAVLIINNQ 530
           +++RG C FT K N A   GA+ V+I N Q
Sbjct: 104 LIERGGCTFTHKINVAAEKGANGVIIYNYQ 133



>gb:AE017278_425637 Bacillus cereus ATCC 10987, section 15 of 18 of
           the complete genome.>gb:AE017194_1064056 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 917

 Score = 33.1 bits (74), Expect = 4.6
 Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 1/86 (1%)
 Frame = +3

Query: 387 NPRDCCSTPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDE 566
           NP D     K  + G   +V +G      KA  A+ AGA  VL+I+N+KE+  M   P+ 
Sbjct: 393 NPSDYA---KQDVKGKFALVLQGTSNTLVKAEQAKQAGAIGVLLISNEKEINIM---PEY 446

Query: 567 -TDLDIKIPAVMLPQDAGATLEKMLS 641
               ++ +P + L    G  L+ +++
Sbjct: 447 FARENLALPVMQLSNANGEELKNLIT 472



>sp|Q8TCT7|PSL1_HUMAN Signal peptide peptidase-like 2B (EC 3.4.99.-)
           (SPP-like 2B protein) (SPPL2b protein) (Intramembrane
           protease 4) (IMP4) (Presenilin-like protein
           1).>gb:HSA420897_2006806 Homo sapiens mRNA for SPPL2b
           protein.
          Length = 564

 Score = 33.1 bits (74), Expect = 4.6
 Identities = 13/41 (31%), Positives = 23/41 (56%)
 Frame = +3

Query: 411 PKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQK 533
           P    +  + +V RGNC F  K   A+ +GA  +LI++ ++
Sbjct: 54  PARGFSNQIPLVARGNCTFYEKVRLAQGSGARGLLIVSRER 94



>gb:AP004685_1843358 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0017G10.
          Length = 479

 Score = 32.7 bits (73), Expect = 6.0
 Identities = 15/29 (51%), Positives = 19/29 (65%)
 Frame = -2

Query: 649 ELLDSIFSKVAPASWGSMTAGIFISRSVS 563
           E L S+F   AP  W S+TAGIF+  S+S
Sbjct: 5   EQLYSVFRSYAPPIWASITAGIFVITSLS 33



>gb:AE017341_1753977 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 950

 Score = 32.7 bits (73), Expect = 6.0
 Identities = 25/94 (26%), Positives = 43/94 (45%), Gaps = 7/94 (7%)
 Frame = +3

Query: 402 CSTPKN--KLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDETDL 575
           C+ P +   L+  +++V RG C  + KA     AG +A+ ++N            DET L
Sbjct: 396 CTLPDDVPDLSPYLVVVRRGGCSLSEKAQNVYNAGGTAIFVVN------------DETSL 443

Query: 576 DI-----KIPAVMLPQDAGATLEKMLSSNSSVTV 662
            I      I   ++  D G  L   L+++++ TV
Sbjct: 444 PIYQNFPLIDFALISDDDGNYLLNQLNTSANTTV 477



>gb:AK008320_1154510 Mus musculus adult male small intestine cDNA,
           RIKEN full-length enriched library, clone:2010106G01
           product:hypothetical Transferrin receptor ectodomain,
           apical domain structure containing protein, full insert
           sequence.
          Length = 144

 Score = 32.7 bits (73), Expect = 6.0
 Identities = 15/39 (38%), Positives = 22/39 (56%)
 Frame = +3

Query: 411 PKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINN 527
           P + +    ++V  G C F  KA  A+  GA+A+LI NN
Sbjct: 82  PPDGIRNKAVVVHWGPCHFLEKARIAQEGGAAALLIANN 120



>gb:AK008294_1154495 Mus musculus adult male small intestine cDNA,
           RIKEN full-length enriched library, clone:2010100B16
           product:hypothetical Transferrin receptor ectodomain,
           apical domain structure containing protein, full insert
           sequence.>gb:AK008328_1154517 Mus musculus adult male
           small intestine cDNA, RIKEN full-length enriched
           library, clone:2010107A19 product:hypothetical
           Transferrin receptor ectodomain, apical domain structure
           containing protein, full insert sequence.
          Length = 144

 Score = 32.7 bits (73), Expect = 6.0
 Identities = 15/39 (38%), Positives = 22/39 (56%)
 Frame = +3

Query: 411 PKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINN 527
           P + +    ++V  G C F  KA  A+  GA+A+LI NN
Sbjct: 82  PPDGIRNKAVVVHWGPCHFLEKARIAQEGGAAALLIANN 120



>gb:AE017038_384533 Bacillus anthracis str. Ames section 15 of 18 of
           the complete genome.>gb:AE017225_409627 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_454380 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE016879_1014238 Bacillus
           anthracis str. Ames complete genome.
          Length = 917

 Score = 32.7 bits (73), Expect = 6.0
 Identities = 25/86 (29%), Positives = 41/86 (47%), Gaps = 1/86 (1%)
 Frame = +3

Query: 387 NPRDCCSTPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDE 566
           NP D     K  + G   +V +G      KA  A+ AGA  VL I+ +KE+  M   P+ 
Sbjct: 393 NPSDYA---KQDVKGKFALVLQGTSSTLVKAEQAKQAGAIGVLFISTEKEMNSM---PEY 446

Query: 567 -TDLDIKIPAVMLPQDAGATLEKMLS 641
            T  ++ +P + L    G  L+ +++
Sbjct: 447 FTRENLALPVMQLSNVNGEELKNLIT 472



>gb:AE017012_379220 Bacillus cereus ATCC 14579 section 15 of 18 of
           the complete genome.>gb:AE016877_1019470 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 917

 Score = 32.7 bits (73), Expect = 6.0
 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 1/86 (1%)
 Frame = +3

Query: 387 NPRDCCSTPKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQKELYKMVCDPDE 566
           NP D     K  + G   ++ +G      KA  A+ AGA  VL+I+++KE+  M   P+ 
Sbjct: 393 NPSDYA---KQDVKGKFALILQGTSSTLVKAEQAKQAGALGVLLISSEKEINMM---PEY 446

Query: 567 TDLD-IKIPAVMLPQDAGATLEKMLS 641
              + + +P + L    G  L+ +++
Sbjct: 447 FSREHLAVPVMQLSNTNGEELKTLIT 472



>gb:BC044512_2548815 Danio rerio, Similar to SPPL2b, clone
           IMAGE:3818244, mRNA, partial cds.
          Length = 571

 Score = 32.3 bits (72), Expect = 7.8
 Identities = 14/41 (34%), Positives = 21/41 (51%)
 Frame = +3

Query: 411 PKNKLAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQK 533
           P+      + MV RGNC F  K   A+  GA  +LI++  +
Sbjct: 91  PEGGFTNSIPMVMRGNCTFYEKVRLAQINGAKGLLIVSKDR 131



>gb:AE017352_1759873 Cryptococcus neoformans var. neoformans JEC21
           chromosome 12, complete sequence.
          Length = 616

 Score = 32.3 bits (72), Expect = 7.8
 Identities = 22/84 (26%), Positives = 40/84 (47%), Gaps = 12/84 (14%)
 Frame = +3

Query: 435 VIMVDRGNCKFTAKANYAEAAGASAVLI------------INNQKELYKMVCDPDETDLD 578
           + +++RG C F  KA  A+  GA AV++               ++E    +  P ETD  
Sbjct: 175 IALIERGTCDFATKAMAAQDRGAHAVIVGDTKARAGETDAEGRKREGLITMFSPQETD-S 233

Query: 579 IKIPAVMLPQDAGATLEKMLSSNS 650
           + IPAV + + +   L  +L++ +
Sbjct: 234 LYIPAVFVSRASYLGLRDLLANQT 257



>gb:AY162834_593902 Streptococcus agalactiae CspA gene, complete
           cds.
          Length = 1571

 Score = 32.3 bits (72), Expect = 7.8
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 2/72 (2%)
 Frame = +3

Query: 423 LAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQ--KELYKMVCDPDETDLDIKIPAV 596
           L G + +++RG+  FT K   A   GA   +I NN+  +    M  DP+ +     IPA+
Sbjct: 437 LNGKIALIERGDITFTKKVVNAINHGAVGAIIFNNKAGEANLTMSLDPEAS----AIPAI 492

Query: 597 MLPQDAGATLEK 632
              ++ G  L K
Sbjct: 493 FTQKEFGDVLAK 504



>gb:AE014284_307345 Streptococcus agalactiae 2603V/R section 94 of
           100 of the complete genome.>gb:AE009948_937458
           Streptococcus agalactiae 2603V/R complete genome.
          Length = 1570

 Score = 32.3 bits (72), Expect = 7.8
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 2/72 (2%)
 Frame = +3

Query: 423 LAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQ--KELYKMVCDPDETDLDIKIPAV 596
           L G + +++RG+  FT K   A   GA   +I NN+  +    M  DP+ +     IPA+
Sbjct: 436 LNGKIALIERGDITFTKKVVNAINHGAVGAIIFNNKAGEANLTMSLDPEAS----AIPAI 491

Query: 597 MLPQDAGATLEK 632
              ++ G  L K
Sbjct: 492 FTQKEFGDVLAK 503



>gb:SAG766855_171536 Streptococcus agalactiae NEM316 complete
           genome, segment 13.
          Length = 1570

 Score = 32.3 bits (72), Expect = 7.8
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 2/72 (2%)
 Frame = +3

Query: 423 LAGDVIMVDRGNCKFTAKANYAEAAGASAVLIINNQ--KELYKMVCDPDETDLDIKIPAV 596
           L G + +++RG+  FT K   A   GA   +I NN+  +    M  DP+ +     IPA+
Sbjct: 436 LNGKIALIERGDITFTKKVVNAINHGAVGAIIFNNKAGEANLTMSLDPEAS----AIPAI 491

Query: 597 MLPQDAGATLEK 632
              ++ G  L K
Sbjct: 492 FTQKEFGDVLAK 503



>pir|F69998|F69998 hypothetical protein ytpI - Bacillus
           subtilis>gb:AF008220_468115 Bacillus subtilis rrnB-dnaB
           genomic region.>gb:BSUB0015_754891 Bacillus subtilis
           complete genome (section 15 of 21): from 2812801 to
           3013507.
          Length = 100

 Score = 32.3 bits (72), Expect = 7.8
 Identities = 15/41 (36%), Positives = 22/41 (53%)
 Frame = -1

Query: 353 LLRHNCSAKSSTNTNKLSIFYPINPCLNFHQHKIILTAGLF 231
           L +  CSAKSS     L +FY +N  + FH    ++  G+F
Sbjct: 29  LAKEICSAKSSMALGSLVLFYGLNQMILFHSVLTLVIGGIF 69


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 634,592,436
Number of Sequences: 1806583
Number of extensions: 11739163
Number of successful extensions: 27852
Number of sequences better than 10.0: 130
Number of HSP's better than 10.0 without gapping: 27008
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27845
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 38338441575
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)