BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig523
         (834 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY085407_1570476 Arabidopsis thaliana clone 15027 mRNA, compl...   135   1e-30   
sp|Q9C7F7|UGP5_ARATH|UGP5_ARATH Uncharacterized GPI-anchored protein At1g27...   134   2e-30   Arabidopsis thaliana [mouse-ear cress]
gb:AJ630658_1812771 Cicer arietinum mRNA for putative lipid tran...   134   3e-30   
gb:AP005529_1853567 Oryza sativa (japonica cultivar-group) genom...   117   3e-25   
gb:AP005529_1853566 Oryza sativa (japonica cultivar-group) genom...   115   8e-25   
pir|T02385|T02385 hypothetical protein At2g44290 [imported] - Ar...    72   1e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AP005257_1849706 Oryza sativa (japonica cultivar-group) genom...    70   5e-11   
pir|T02386|T02386 hypothetical protein At2g44300 [imported] - Ar...    70   5e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AY088620_1573636 Arabidopsis thaliana clone 8461 mRNA, comple...    67   5e-10   
pir|T47408|T47408 lipid-transfer-like protein - Arabidopsis thal...    67   5e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AC090871_1734490 Oryza sativa chromosome 3 BAC OSJNBb0060J21 ...    64   4e-09   
gb:AC135563_1742570 Oryza sativa chromosome 3 BAC OSJNBb0015I02 ...    63   6e-09   
gb:AP003843_1834104 Oryza sativa (japonica cultivar-group) genom...    63   8e-09   
gb:AY804335_1628652 Capsicum annuum cultivar Perennial lipid tra...    62   2e-08   
gb:AY804336_1628653 Capsicum chinense cultivar Peach Savina lipi...    61   2e-08   
gb:AP003843_1834111 Oryza sativa (japonica cultivar-group) genom...    61   3e-08   
gb:AC090871_1734492 Oryza sativa chromosome 3 BAC OSJNBb0060J21 ...    60   5e-08   
gb:AP003843_1834117 Oryza sativa (japonica cultivar-group) genom...    59   9e-08   
gb:AC097175_1736473 Oryza sativa (japonica cultivar-group) chrom...    57   3e-07   
gb:AY087167_1572201 Arabidopsis thaliana clone 32411 mRNA, compl...    57   3e-07   
gb:AP003570_1831029 Oryza sativa (japonica cultivar-group) genom...    57   6e-07   
pir|G84923|G84923 hypothetical protein At2g48130 [imported] - Ar...    57   6e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AF083791_1767021 Arabidopsis thaliana clone sps870 unknown mRNA.    56   1e-06   
gb:AY085883_1570946 Arabidopsis thaliana clone 19287 mRNA, compl...    56   1e-06   
gb:AY045650_1561241 Arabidopsis thaliana AT3g22600/F16J14_17 mRN...    56   1e-06   
gb:AP003843_1834112 Oryza sativa (japonica cultivar-group) genom...    55   2e-06   
gb:AY085177_1570256 Arabidopsis thaliana clone 13599 mRNA, compl...    53   6e-06   
pir|E96594|E96594 unknown protein, 63629-62263 [imported] - Arab...    53   6e-06   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00003_1693111 Oryza sativa genomic DNA, chromosome 4, BAC...    51   3e-05   
gb:AB159560_1528436 Zinnia elegans ZeXYP1 mRNA for xylogen prote...    50   7e-05   
gb:ATT5E8_1556132 Arabidopsis thaliana DNA chromosome 5, BAC clo...    49   1e-04   
gb:BT003062_1636644 Arabidopsis thaliana At2g13820 gene, complet...    49   2e-04   
gb:AY086755_1571798 Arabidopsis thaliana clone 27380 mRNA, compl...    49   2e-04   
pir|B84511|B84511 hypothetical protein At2g13820 [imported] - Ar...    49   2e-04   Arabidopsis thaliana [mouse-ear cress]
pir|T14827|T14827 lipid transfer protein - Norway spruce>gb:AB00...    49   2e-04   Picea abies
pir|T45675|T45675 hypothetical protein F14P22.140 - Arabidopsis ...    49   2e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AC137991_1743840 Oryza sativa chromosome 3 BAC OSJNBa0034D21 ...    48   3e-04   
pir|T00941|T00941 hypothetical protein T3F12.2 - Arabidopsis tha...    48   3e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AY086176_1571231 Arabidopsis thaliana clone 21969 mRNA, compl...    47   3e-04   
gb:AY070743_1566893 Arabidopsis thaliana AT5g64080/MHJ24_6 mRNA,...    45   0.001   
pir|A86162|A86162 protein F10O3.7 [imported] - Arabidopsis thali...    45   0.001   Arabidopsis thaliana [mouse-ear cress]
gb:AY088880_1573888 Arabidopsis thaliana clone 98459 mRNA, compl...    44   0.004   
gb:AE005172_890793 Arabidopsis thaliana chromosome 1, top arm co...    44   0.004   
gb:AP004797_1845233 Oryza sativa (japonica cultivar-group) genom...    44   0.005   
gb:AC137991_1743841 Oryza sativa chromosome 3 BAC OSJNBa0034D21 ...    44   0.005   
gb:AP004315_1840079 Oryza sativa (japonica cultivar-group) genom...    43   0.006   
gb:AY087113_1572148 Arabidopsis thaliana clone 31856 mRNA, compl...    43   0.006   
gb:OSJN00010_1693224 Oryza sativa genomic DNA, chromosome 4, BAC...    43   0.008   
gb:AE016959_1021406 Oryza sativa (japonica cultivar-group) chrom...    42   0.019   
pir|E96766|E96766 hypothetical protein F2P9.24 [imported] - Arab...    42   0.019   Arabidopsis thaliana [mouse-ear cress]
gb:BT011764_1641286 Arabidopsis thaliana At1g62790 mRNA, complet...    41   0.024   
gb:AB008266_1510418 Arabidopsis thaliana genomic DNA, chromosome...    40   0.041   
gb:SLMEN7_1715353 S.latifolia mRNA for Men-7 protein.                  40   0.054   
gb:AY088017_1573041 Arabidopsis thaliana clone 4043 mRNA, comple...    40   0.054   
pir|T10084|T10084 lipid transfer protein precursor - castor bean...    40   0.054   Ricinus communis
pir|S01796|S01796 nonspecific lipid transfer protein - castor bean     40   0.054   Ricinus communis
sp|Q43119|NLTD_RICCO|NLTD_RICCO Nonspecific lipid-transfer protein D, cotyl...    40   0.054   Ricinus communis
sp|P10975|NLTC_RICCO|NLTC_RICCO Nonspecific lipid-transfer protein C, cotyl...    40   0.054   Ricinus communis
gb:AP003509_1830101 Oryza sativa (japonica cultivar-group) genom...    40   0.071   
gb:AY789644_1628464 Triticum aestivum lipid transfer protein 4 (...    40   0.071   
pir|T04093|T04093 phospholipid transfer protein - maize>gb:ZMU66...    40   0.071   Zea mays [maize]
gb:AP004797_1845222 Oryza sativa (japonica cultivar-group) genom...    39   0.092   
gb:AC137991_1743837 Oryza sativa chromosome 3 BAC OSJNBa0034D21 ...    39   0.092   
gb:AC119288_1739629 Oryza sativa (japonica cultivar-group) chrom...    39   0.092   
gb:OSJN00239_1697225 Oryza sativa genomic DNA, chromosome 4, BAC...    39   0.12    
gb:AB005230_1509243 Arabidopsis thaliana genomic DNA, chromosome...    39   0.12    
gb:SVTLP1R_1723264 S.vulgare ltp1 mRNA.                                39   0.16    
pir|S33460|S33460 lipid transfer protein - sorghum (fragment)          39   0.16    Sorghum bicolor [broomcorn]
gb:AP003803_1833587 Oryza sativa (japonica cultivar-group) genom...    38   0.21    
gb:AC146521_1744602 Oryza sativa chromosome 3 B1246D11 genomic s...    38   0.21    
gb:AP004134_1838112 Oryza sativa (japonica cultivar-group) genom...    38   0.27    
gb:AY045643_1561234 Arabidopsis thaliana At2g48140/F11L15.4 mRNA...    38   0.27    
gb:AP004179_1838583 Oryza sativa (japonica cultivar-group) genom...    37   0.35    
gb:AY057932_1564163 Bromus inermis nonspecific lipid transfer pr...    37   0.35    
gb:AF489955_1804665 Physcomitrella patens BIP5 mRNA, partial cds.      37   0.60    
gb:AE016959_1021404 Oryza sativa (japonica cultivar-group) chrom...    37   0.60    
gb:AP003766_1833224 Oryza sativa (japonica cultivar-group) genom...    36   0.78    
gb:AY662492_1620467 Hordeum vulgare subsp. vulgare non-specific ...    36   0.78    
gb:AK128066_1917026 Homo sapiens cDNA FLJ46186 fis, clone TESTI4...    36   1.0     
gb:AE017351_1759600 Cryptococcus neoformans var. neoformans JEC2...    36   1.0     
gb:AP003843_1834116 Oryza sativa (japonica cultivar-group) genom...    35   1.3     
gb:AJ843979_1814671 Plantago major mRNA for hypothetical protein.      35   1.3     
gb:OSJN00010_1693225 Oryza sativa genomic DNA, chromosome 4, BAC...    35   1.3     
pir|S51811|S51811 trypsin inhibitor CMx precursor - wheat              35   1.3     Triticum aestivum [Canadian hard winter wheat]
sp|Q43691|IAX2_WHEAT|IAX2_WHEAT Trypsin/alpha-amylase inhibitor CMX2 precur...    35   1.3     Triticum aestivum [Canadian hard winter wheat]
gb:AF206717_2141948 Shuttle vector pI3 hypothetical proteins, Ht...    35   1.7     
gb:PSALB2A_1702042 P.strobus mRNA for albumin 2.                       35   1.7     
gb:AY804342_1628659 Capsicum chinense cultivar BG2816 lipid tran...    35   1.7     
gb:AY804340_1628657 Capsicum chinense cultivar PI152225 lipid tr...    35   1.7     
gb:AY088619_1573635 Arabidopsis thaliana clone 8450 mRNA, comple...    35   1.7     
pir|D96762|D96762 probable lipid transfer protein F6D5.5 [import...    35   1.7     Arabidopsis thaliana [mouse-ear cress]
sp|Q43193|NLT1_SORBI|NLT1_SORBI Nonspecific lipid-transfer protein 1 precur...    35   1.7     Sorghum bicolor [broomcorn]
sp|O04403|NL22_PARJU|NL22_PARJU Probable nonspecific lipid-transfer protein...    35   1.7     Parietaria judaica
sp|P55958|NL21_PARJU|NL21_PARJU Probable nonspecific lipid-transfer protein...    35   1.7     Parietaria judaica
gb:AP005828_1858600 Oryza sativa (japonica cultivar-group) genom...    35   2.3     
gb:AC005623_1532861 Arabidopsis thaliana chromosome 2 clone T20P...    35   2.3     
gb:AF139114_1244246 Neospora caninum subtilisin-like serine prot...    35   2.3     
gb:AB051576_1196276 Hemicentrotus pulcherrimus mRNA for ryanodin...    35   2.3     
pir|S49915|S49915 extensin-like protein - maize>gb:ZMEXTENS_1731...    35   2.3     Zea mays [maize]
gb:BC057428_2552076 Danio rerio a disintegrin and metalloprotein...    34   3.0     
gb:AL831745_2504556 Zebrafish DNA sequence from clone CH211-217G...    34   3.0     
gb:HSA298317_2003038 Homo sapiens partial mRNA for mucin 5 (MUC5...    34   3.0     
gb:AJ784896_1814011 Triticum aestivum mRNA for type 1 non-specif...    34   3.0     
gb:AB047806_1520666 Arabidopsis thaliana YLS3 mRNA for non-speci...    34   3.0     
gb:AF225924_1252658 Drosophila virilis staufen gene, complete cds.     34   3.0     
pir|T34434|T34434 hypothetical protein K06A9.1a - Caenorhabditis...    34   3.0     Caenorhabditis elegans [roundworm]
pir|E81463|T02857 conserved hypothetical protein L3162.1 [import...    34   3.0     
gb:AJ784901_1814016 Triticum aestivum mRNA for type 1 non-specif...    34   3.9     
gb:AJ784897_1814012 Triticum aestivum mRNA for type 1 non-specif...    34   3.9     
gb:CR380956_1652091 Candida glabrata strain CBS138 chromosome J ...    34   3.9     
gb:BT002886_1636477 Arabidopsis thaliana clone RAFL15-05-B21 (R2...    34   3.9     
gb:AY098530_1576447 Ananas comosus PVR3-like protein mRNA, parti...    34   3.9     
gb:AB020745_1514604 Arabidopsis thaliana genomic DNA, chromosome...    34   3.9     
gb:AE005173_893947 Arabidopsis thaliana chromosome 1, bottom arm...    34   3.9     
pir|D96725|D96725 hypothetical protein F20P5.4 [imported] - Arab...    34   3.9     Arabidopsis thaliana [mouse-ear cress]
sp|P59644|P5PA_MOUSE|P5PA_MOUSE Phosphatidylinositol 4,5-bisphosphate 5-pho...    34   3.9     Mus musculus [mouse]
sp|O65888|NLTP_STRHE|NLTP_STRHE Nonspecific lipid-transfer protein precurso...    34   3.9     Striga hermonthica [purple witchweed]
gb:BC090085_2566316 Xenopus tropicalis cDNA clone MGC:97528 IMAG...    33   5.1     
gb:AP004398_1841187 Oryza sativa (japonica cultivar-group) genom...    33   5.1     
gb:AJ784903_1814018 Triticum turgidum subsp. durum partial mRNA ...    33   5.1     
gb:AC084282_1733414 Oryza sativa chromosome 3 BAC OSJNBb0048A17 ...    33   5.1     
gb:AC012396_1537640 Arabidopsis thaliana chromosome 1 BAC T9L24 ...    33   5.1     
gb:AX155027_1462752 Sequence 73 from Patent WO0138484.                 33   5.1     
gb:AE017232_412349 Mycobacterium avium subsp. paratuberculosis s...    33   5.1     
pir|C96762|C96762 hypothetical protein F6D5.6 [imported] - Arabi...    33   5.1     Arabidopsis thaliana [mouse-ear cress]
sp|Q43194|NLT2_SORBI|NLT2_SORBI Nonspecific lipid-transfer protein 2 precur...    33   5.1     Sorghum bicolor [broomcorn]
gb:AY160969_2516132 Xenopus tropicalis homeodomain transcription...    33   6.6     
gb:AK000226_1907768 Homo sapiens cDNA FLJ20219 fis, clone COLF3371.    33   6.6     
gb:AF301909_1895775 Homo sapiens mu-protocadherin mRNA, complete...    33   6.6     
gb:AF258674_1893389 Homo sapiens MUCDHL (MUCDHL) gene, complete ...    33   6.6     
gb:AY133874_1581694 Arabidopsis thaliana clone U18540 unknown pr...    33   6.6     
sp|P19656|NLTP_MAIZE|NLTP_MAIZE Nonspecific lipid-transfer protein precurso...    33   6.6     Zea mays [maize]
sp|Q9HBB8|MCDL_HUMAN|MCDL_HUMAN Mucin and cadherin-like protein precursor (...    33   6.6     Homo sapiens [man]
sp|O18868|KCB1_PIG|KCB1_PIG Potassium voltage-gated channel subfamily B m...    33   6.6     Sus scrofa [pigs]
sp|Q99074|HA34_BRELC|HA34_BRELC HAM34 protein.>gb:BMHAM34_1633242 Bremia la...    33   6.6     Bremia lactucae
gb:AE017342_1755102 Cryptococcus neoformans var. neoformans JEC2...    33   8.7     
gb:MZEPLTPA_1688015 Maize phospholipid transfer protein mRNA, 3'...    33   8.7     
gb:AY450929_1606692 Chlamydomonas reinhardtii minus agglutinin (...    33   8.7     
gb:AY850310_1180280 Magnaporthe grisea hypothetical protein mRNA...    33   8.7     
gb:AE014297_1138556 Drosophila melanogaster chromosome 3R, compl...    33   8.7     
gb:AE014298_1125167 Drosophila melanogaster chromosome X, comple...    33   8.7     
gb:AE005172_889569 Arabidopsis thaliana chromosome 1, top arm co...    33   8.7     
pir|S51810|S51810 trypsin inhibitor CMx precursor (clones pCMx1 ...    33   8.7     Triticum aestivum [Canadian hard winter wheat]
pir|S45635|S45635 lipid-transfer protein - maize                       33   8.7     Zea mays [maize]
pir|JH0379|JH0379 phospholipid transfer protein 6B6 - maize (fra...    33   8.7     Zea mays [maize]
sp|Q43723|IAX1_WHEAT|IAX1_WHEAT Trypsin/alpha-amylase inhibitor CMX1/CMX3 p...    33   8.7     Triticum aestivum [Canadian hard winter wheat]
sp|Q837V3|GATA_ENTFA|GATA_ENTFA Glutamyl-tRNA(Gln) amidotransferase subunit...    33   8.7     Enterococcus faecalis


>gb:AY085407_1570476 Arabidopsis thaliana clone 15027 mRNA, complete
           sequence.
          Length = 193

 Score =  135 bits (339), Expect = 1e-30
 Identities = 68/126 (53%), Positives = 85/126 (67%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL 371
           KV  CL +A G A  PSKKCCD+V  IKE DP CLC+VIQQ   G  ++  LG++ED+L+
Sbjct: 41  KVTLCLDFATGKATTPSKKCCDAVEDIKERDPKCLCFVIQQAKTGGQALKDLGVQEDKLI 100

Query: 372 KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAG 551
           +LP+ C+L NAS TNCPKLL +   SPDAA+FTN  T+     TP A  G S + PAT+ 
Sbjct: 101 QLPTSCQLHNASITNCPKLLGISPSSPDAAVFTNNATT-----TPVAPAGKSPATPATS- 154

Query: 552 GDSGGS 569
            D GGS
Sbjct: 155 TDKGGS 160



>sp|Q9C7F7|UGP5_ARATH Uncharacterized GPI-anchored protein At1g27950
           precursor.>pir|H86404|H86404 probable lipid transfer
           protein [imported] - Arabidopsis
           thaliana>gb:AE005172_891678 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC069471_1540841 Arabidopsis thaliana
           chromosome 1 BAC F13K9 genomic sequence, complete
           sequence.>gb:AY092956_1574910 Arabidopsis thaliana lipid
           transfer protein, putative (At1g27950) mRNA, complete
           cds.>gb:AY128712_1580792 Arabidopsis thaliana lipid
           transfer protein, putative (At1g27950) mRNA, complete
           cds.
          Length = 193

 Score =  134 bits (338), Expect = 2e-30
 Identities = 68/126 (53%), Positives = 85/126 (67%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL 371
           KV  CL +A G A  PSKKCCD+V  IKE DP CLC+VIQQ   G  ++  LG++ED+L+
Sbjct: 41  KVTLCLDFATGKATIPSKKCCDAVEDIKERDPKCLCFVIQQAKTGGQALKDLGVQEDKLI 100

Query: 372 KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAG 551
           +LP+ C+L NAS TNCPKLL +   SPDAA+FTN  T+     TP A  G S + PAT+ 
Sbjct: 101 QLPTSCQLHNASITNCPKLLGISPSSPDAAVFTNNATT-----TPVAPAGKSPATPATS- 154

Query: 552 GDSGGS 569
            D GGS
Sbjct: 155 TDKGGS 160



>gb:AJ630658_1812771 Cicer arietinum mRNA for putative lipid
           transfer protein GPI-anchored (Ltp2 gene).
          Length = 185

 Score =  134 bits (336), Expect = 3e-30
 Identities = 68/118 (57%), Positives = 82/118 (69%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL 371
           KV+ CL +A G A  P K+CCD+ +SIKETDP CLCY+IQQ HKG     SLGI+ED+LL
Sbjct: 34  KVIPCLDFATGKALTPKKECCDAANSIKETDPECLCYIIQQTHKGSPESKSLGIQEDKLL 93

Query: 372 KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPAT 545
           +LP+ CK+ NA+ T+CPKLL L   SPDAAIF NA+     S TP AS    TS P T
Sbjct: 94  QLPTVCKVKNANLTDCPKLLGLSPSSPDAAIFKNASKLSPPS-TPSAS-ADQTSTPPT 149



>gb:AP005529_1853567 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0702E04.
          Length = 179

 Score =  117 bits (292), Expect = 3e-25
 Identities = 60/124 (48%), Positives = 80/124 (64%), Gaps = 3/124 (2%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL 371
           K+ DC+ YA G  +APS  CC  +S+ ++  P CLCY+IQQVH G + V SLG++ DRLL
Sbjct: 38  KLTDCMDYATGHEEAPSSTCCGDMSATQQARPECLCYIIQQVHGGRNEVQSLGLRFDRLL 97

Query: 372 KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHAT---SKTPGASPGGSTSQPA 542
            +P+ CKL NA+ + C  LL+L   SPD A+F NA+ + AT   S TPGA+        A
Sbjct: 98  AMPTACKLPNANVSLCINLLHLTPSSPDYAVFANASKAAATTPSSTTPGAA-------AA 150

Query: 543 TAGG 554
           TAGG
Sbjct: 151 TAGG 154



>gb:AP005529_1853566 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0702E04.
          Length = 178

 Score =  115 bits (289), Expect = 8e-25
 Identities = 59/123 (47%), Positives = 79/123 (64%), Gaps = 2/123 (1%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL 371
           K+ DC+ YA G  +APS  CC  +S+ ++  P CLCY+IQQVH G + V SLG++ DRLL
Sbjct: 38  KLTDCMDYATGHEEAPSSTCCGDMSATQQARPECLCYIIQQVHGGRNEVQSLGLRFDRLL 97

Query: 372 KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHAT--SKTPGASPGGSTSQPAT 545
            +P+ CKL NA+ + C  LL+L   SPD A+F NA+ +  T  S TPGA+        AT
Sbjct: 98  AMPTACKLPNANVSLCINLLHLTPSSPDYAVFANASKAATTPSSTTPGAA-------AAT 150

Query: 546 AGG 554
           AGG
Sbjct: 151 AGG 153



>pir|T02385|T02385 hypothetical protein At2g44290 [imported] -
           Arabidopsis thaliana>gb:AC004521_1531807 Arabidopsis
           thaliana chromosome 2 clone F4I1 map m336, complete
           sequence.>gb:BT005512_1638452 Arabidopsis thaliana clone
           U50676 unknown protein (At2g44290) mRNA, complete
           cds.>gb:AK118152_1816146 Arabidopsis thaliana At2g44290
           mRNA for putative non-specific lipid transfer protein
           (nLTP), complete cds, clone: RAFL19-45-L01.
          Length = 205

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 42/127 (33%), Positives = 60/127 (47%), Gaps = 6/127 (4%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS 383
           CL Y  G A +P+  CC  +  +  +D  CLC +IQ+ +  D     L +     L LPS
Sbjct: 46  CLPYVQGKAKSPTPDCCSGLKQVINSDMKCLCMIIQERNDPD---LGLQVNVSLALALPS 102

Query: 384 ECKLANASTTNCPKLLNLPAGSPDAAIF------TNATTSHATSKTPGASPGGSTSQPAT 545
            C  A A  T CP LL+L   SPDA +F       N T S +      + P   +S P +
Sbjct: 103 VCH-ATADITKCPALLHLDPNSPDAQVFYQLAKGLNETVSASAPTGSASEPTSMSSTPGS 161

Query: 546 AGGDSGG 566
           + G++ G
Sbjct: 162 SAGNNSG 168



>gb:AP005257_1849706 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0417F02.
          Length = 207

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 48/127 (37%), Positives = 63/127 (49%), Gaps = 5/127 (3%)
 Frame = +3

Query: 204 CLSY----AIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL 371
           CL++    A G A AP+  CC  + ++      CLC +I+     D     L I   + L
Sbjct: 47  CLTFVQDGASGGAAAPTPDCCSGLKAVLAASRKCLCVLIKD---RDDPNLGLKINVTKAL 103

Query: 372 KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTN-ATTSHATSKTPGASPGGSTSQPATA 548
            LP  C  A A+ ++CP+LLNLP  S DA IF   A    A   +P ASPGGS S PA  
Sbjct: 104 SLPQLCN-APANISDCPRLLNLPPNSKDAQIFEQFAKQQAAMQGSPSASPGGS-SAPAAG 161

Query: 549 GGDSGGS 569
              SG +
Sbjct: 162 AQKSGAA 168



>pir|T02386|T02386 hypothetical protein At2g44300 [imported] -
           Arabidopsis thaliana>gb:AC004521_1531808 Arabidopsis
           thaliana chromosome 2 clone F4I1 map m336, complete
           sequence.>gb:BT006196_1639088 Arabidopsis thaliana
           At2g44300 mRNA, complete cds.
          Length = 204

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 46/127 (36%), Positives = 62/127 (48%), Gaps = 5/127 (3%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS 383
           CL Y  G A +P+  CC  +  +  ++  CLC +IQ  +  D     L I     L LPS
Sbjct: 45  CLPYVQGQAKSPTPDCCSGLKQVLNSNKKCLCVIIQDRNDPD---LGLQINVSLALALPS 101

Query: 384 ECKLANASTTNCPKLLNLPAGSPDAAIFTNAT-----TSHATSKTPGASPGGSTSQPATA 548
            C  A A  T CP LL+L   SPDA +F         T  A++ T G+SPG  +  P T+
Sbjct: 102 VCHAA-ADVTKCPALLHLDPNSPDAQVFYQLAKGLNKTGPASAPT-GSSPGPISISP-TS 158

Query: 549 GGDSGGS 569
           G D G +
Sbjct: 159 GSDDGNN 165



>gb:AY088620_1573636 Arabidopsis thaliana clone 8461 mRNA, complete
           sequence.
          Length = 193

 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 46/129 (35%), Positives = 64/129 (49%), Gaps = 7/129 (5%)
 Frame = +3

Query: 204 CLSYAI----GTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--R 365
           CLSY      G A  P K CC +++ + E+ P CLCY++     GD +   LGIK D  +
Sbjct: 48  CLSYVTVGEGGGAAKPDKTCCPALAGLVESSPQCLCYLL----SGDMA-AQLGIKIDKAK 102

Query: 366 LLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGA-SPGGSTSQPA 542
            LKLP  C +     + C  L  +P G+P A     A+ ++A     GA SPGG  S P+
Sbjct: 103 ALKLPGVCGVITPDPSLC-SLFGIPVGAPVAMGDEGASPAYAPGSMSGAESPGGFGSGPS 161

Query: 543 TAGGDSGGS 569
            + G    S
Sbjct: 162 ASRGSDAPS 170



>pir|T47408|T47408 lipid-transfer-like protein - Arabidopsis
           thaliana>gb:ATT28A8_1555546 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T28A8.>gb:AY045908_1561412
           Arabidopsis thaliana putative lipid transfer protein
           (At3g43720) mRNA, complete cds.>gb:AY079420_1568309
           Arabidopsis thaliana putative lipid-transfer protein
           (At3g43720) mRNA, complete cds.
          Length = 193

 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 46/129 (35%), Positives = 64/129 (49%), Gaps = 7/129 (5%)
 Frame = +3

Query: 204 CLSYAI----GTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--R 365
           CLSY      G A  P K CC +++ + E+ P CLCY++     GD +   LGIK D  +
Sbjct: 48  CLSYVTVGEGGGAAKPDKTCCPALAGLVESSPQCLCYLL----SGDMA-AQLGIKIDKAK 102

Query: 366 LLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGA-SPGGSTSQPA 542
            LKLP  C +     + C  L  +P G+P A     A+ ++A     GA SPGG  S P+
Sbjct: 103 ALKLPGVCGVITPDPSLC-SLFGIPVGAPVAMGDEGASPAYAPGSMSGAESPGGFGSGPS 161

Query: 543 TAGGDSGGS 569
            + G    S
Sbjct: 162 ASRGSDAPS 170



>gb:AC090871_1734490 Oryza sativa chromosome 3 BAC OSJNBb0060J21
           genomic sequence, complete sequence.
          Length = 189

 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 41/124 (33%), Positives = 56/124 (45%), Gaps = 2/124 (1%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--RLLKL 377
           C+ Y  G A AP+  CC ++S +  + P CLC V+        +  SLG+  D  R   L
Sbjct: 57  CMGYMSGNATAPAAACCSALSGVLRSSPRCLCMVL------GGTAASLGVAVDTARAALL 110

Query: 378 PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAGGD 557
           P  C +     + C     +P  SP      N TTS  T  TP  +PG  T+ PA+    
Sbjct: 111 PGACSVQAPPASQC-NAAGVPVSSP-----ANPTTSGGTPATPAGTPGSKTT-PASTTQY 163

Query: 558 SGGS 569
           S GS
Sbjct: 164 SDGS 167



>gb:AC135563_1742570 Oryza sativa chromosome 3 BAC OSJNBb0015I02
           genomic sequence, complete sequence.
          Length = 195

 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 41/128 (32%), Positives = 60/128 (46%), Gaps = 8/128 (6%)
 Frame = +3

Query: 204 CLSYAI--GTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKL 377
           CL+Y     TA AP++ CC  +  +      CLC +++     D       I   R + L
Sbjct: 44  CLTYVEEKATARAPTRDCCAGLGQVVAGSKKCLCVLVKD---RDEPALGFRINVTRAMDL 100

Query: 378 PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSH----ATSKTPGASPG--GSTSQP 539
           PS C +A A+ ++CPK+LN+   S +A IF      H    AT   P A+    GS  + 
Sbjct: 101 PSGCSIA-ATFSDCPKMLNMSPDSKEAEIFKQYAREHESNNATKPAPAAAAAATGSAGKA 159

Query: 540 ATAGGDSG 563
             A GD+G
Sbjct: 160 TAATGDAG 167



>gb:AP003843_1834104 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1656_E11.>gb:AP004670_1843068 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0496D04.
          Length = 188

 Score = 62.8 bits (151), Expect = 8e-09
 Identities = 40/122 (32%), Positives = 57/122 (46%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS 383
           CL Y  G + AP   CC ++SS+  + P CLC V+     G +S   + I   R L+LP+
Sbjct: 49  CLGYMSGNSSAPKPSCCTALSSVVTSKPACLCAVL----GGGASSLGVTINNTRALELPA 104

Query: 384 ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAGGDSG 563
            C +     + C   + +P  SP  A           S+TP A  GGS + P TA   +G
Sbjct: 105 ACNVKTPPASQC-STVGVPMPSP--ATPATPAAPAVPSETP-AGTGGSKATPTTATTTTG 160

Query: 564 GS 569
            S
Sbjct: 161 QS 162



>gb:AY804335_1628652 Capsicum annuum cultivar Perennial lipid
           transfer protein gene, complete cds.
          Length = 172

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 38/119 (31%), Positives = 54/119 (45%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS 383
           CLS+  G+A  P   CC S+S + +++P CLC ++     G  S   + I + + L LPS
Sbjct: 41  CLSFVTGSAKTPPASCCSSLSGVLQSNPRCLCVIV----NGGGSSLGVQINQTQALALPS 96

Query: 384 ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAGGDS 560
            C L     + C    N P  SP+ A     T     S T  A  G   S  +T+ G S
Sbjct: 97  ACNLQTPPVSRC-YAGNAPVMSPEGA----PTEGTPDSSTGVAVTGSKASGSSTSDGSS 150



>gb:AY804336_1628653 Capsicum chinense cultivar Peach Savina lipid
           transfer protein gene, complete cds.>gb:AY804337_1628654
           Capsicum chinense cultivar PI159234 lipid transfer
           protein gene, promoter region and complete
           cds.>gb:AY804338_1628655 Capsicum annuum cultivar RNaky
           lipid transfer protein gene, complete
           cds.>gb:AY804339_1628656 Capsicum annuum cultivar Super
           Hot lipid transfer protein gene, complete cds.
          Length = 172

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 38/119 (31%), Positives = 54/119 (45%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS 383
           CLS+  G+A  P   CC S+S + +++P CLC ++     G  S   + I + + L LPS
Sbjct: 41  CLSFVTGSAKTPPASCCSSLSGVLQSNPRCLCVIV----NGGGSSLGVQINQTQALALPS 96

Query: 384 ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAGGDS 560
            C L     + C    N P  SP+ A     T     S T  A  G   S  +T+ G S
Sbjct: 97  ACNLQTPPVSRC-YAGNAPVISPEGA----PTEGTPDSSTGVAVTGSKASGSSTSDGSS 150



>gb:AP003843_1834111 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1656_E11.
          Length = 171

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 37/121 (30%), Positives = 58/121 (47%), Gaps = 5/121 (4%)
 Frame = +3

Query: 183 ESPKVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED 362
           E   +  CL Y  G A  P+  CC ++SS+ ++ P CLC V+     G +S   + +   
Sbjct: 34  EMVSLAPCLDYMQGNASRPTASCCAALSSVVKSRPECLCAVL----GGGASSLGVTVNTT 89

Query: 363 RLLKLPSECKLANASTTNCPKL-LNLPAGSPDAAIFTNAT----TSHATSKTPGASPGGS 527
           R L+LP+ C +     + C K+   +P+ +P  A   NA     T   T+ T GAS  G 
Sbjct: 90  RALELPAACGVKTPPPSECSKVGAPIPSPAPGGAAAPNAPPAAGTGSKTTPTTGASSAGE 149

Query: 528 T 530
           +
Sbjct: 150 S 150



>gb:AC090871_1734492 Oryza sativa chromosome 3 BAC OSJNBb0060J21
           genomic sequence, complete sequence.
          Length = 177

 Score = 60.1 bits (144), Expect = 5e-08
 Identities = 35/110 (31%), Positives = 56/110 (50%), Gaps = 2/110 (1%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--RLLKL 377
           CL+Y  G   +P++ CC  ++++ ++ P CLC  I     GDSS +  G+  D  R L+L
Sbjct: 42  CLNYISGNETSPTRTCCSQLATVVQSQPQCLCAAI----SGDSSSSIGGVTIDKTRALEL 97

Query: 378 PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGS 527
           P  C +     + C    N   G+   A    ATT+   ++TPGA+  G+
Sbjct: 98  PKACNVVTPPASRC----NSAGGNTPGA----ATTTSPATQTPGATGAGT 139



>gb:AP003843_1834117 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1656_E11.>gb:AP004307_1839953 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0534H07.
          Length = 170

 Score = 59.3 bits (142), Expect = 9e-08
 Identities = 36/112 (32%), Positives = 49/112 (43%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS 383
           CL+Y  G   APS  CC  +  + ++ P CLC  +      D++   L I   R L LP 
Sbjct: 45  CLNYLTGNETAPSASCCGKLGEVVKSQPECLCVAL----NADTAALGLSINRTRALGLPD 100

Query: 384 ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQP 539
            CK+     +NC       A +P A   T  T +   SK   A+P GS   P
Sbjct: 101 ACKVQTPPVSNCKS----GAAAPPAG-QTPTTPAGTGSKATPATPVGSGVAP 147



>gb:AC097175_1736473 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1119_H02, complete sequence.
          Length = 210

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 39/132 (29%), Positives = 62/132 (46%), Gaps = 6/132 (4%)
 Frame = +3

Query: 201 DCLSYAIGTADA--PSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLK 374
           DCL+Y    + A  P K CC  ++ + E++PVCLC ++     GDS    + +   R L 
Sbjct: 61  DCLTYVQNGSRARRPDKPCCPELAGLVESNPVCLCELLSGA--GDS--YGIAVDYSRALA 116

Query: 375 LPSECKLANASTTNCPKL-LNLPAGSPDAAIFTNATTSHATSKTPGASPGG---STSQPA 542
           LP+ C+++    + C     N+P G   +      + S    + PG SP     ST+ P+
Sbjct: 117 LPAICRVSTPPVSTCAAFGFNVPMGPTPSPSPAAVSPSGEGPQFPGTSPFASPPSTATPS 176

Query: 543 TAGGDSGGSFKH 578
           T    +G S  H
Sbjct: 177 TNAAAAGRSGDH 188



>gb:AY087167_1572201 Arabidopsis thaliana clone 32411 mRNA, complete
           sequence.
          Length = 183

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 37/126 (29%), Positives = 57/126 (45%), Gaps = 7/126 (5%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDR--LLKL 377
           CLSY  G +  PS+ CC  + S+ ++ P C+C  +      +S + ++G+  +R   L+L
Sbjct: 40  CLSYITGNSTTPSQPCCSRLDSVIKSSPQCICSAV------NSPIPNIGLNINRTQALQL 93

Query: 378 PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKT--PGASP---GGSTSQPA 542
           P+ C +     T C      P   P A   T  T     + T  PGA     GGS + P+
Sbjct: 94  PNACNIQTPPLTQCNAATG-PTAQPPAPSPTEKTPDVTLTPTSLPGARSGVGGGSKTVPS 152

Query: 543 TAGGDS 560
              G S
Sbjct: 153 VGNGSS 158



>gb:AP003570_1831029 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0432B10.>gb:AP004331_1840307 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OSJNBa0085D07.
          Length = 187

 Score = 56.6 bits (135), Expect = 6e-07
 Identities = 38/117 (32%), Positives = 56/117 (47%), Gaps = 6/117 (5%)
 Frame = +3

Query: 201 DCLSYAIG--TADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLK 374
           DCL+Y +   TA  P + CC  ++ + E+ PVCLC    Q+  G +S   + +   R + 
Sbjct: 54  DCLTYVMNGSTARKPDEPCCPELAGLLESKPVCLC----QLLAGGASSYDISVDYKRAMA 109

Query: 375 LPSECKLANASTTNCPKL----LNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTS 533
           LP  C LA    T C  L       P+ SP A +   +T      K+P ASP  S++
Sbjct: 110 LPGICGLAAPPVTACALLGVPVPMAPSASPMAGL-GPSTEPQMPEKSPSASPSESSN 165



>pir|G84923|G84923 hypothetical protein At2g48130 [imported] -
           Arabidopsis thaliana>gb:AY065446_1566552 Arabidopsis
           thaliana unknown protein (At2g48130) mRNA, complete
           cds.>gb:AY117278_1579319 Arabidopsis thaliana unknown
           protein (At2g48130) mRNA, complete cds.
          Length = 183

 Score = 56.6 bits (135), Expect = 6e-07
 Identities = 37/126 (29%), Positives = 57/126 (45%), Gaps = 7/126 (5%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDR--LLKL 377
           CLSY  G +  PS+ CC  + S+ ++ P C+C  +      +S + ++G+  +R   L+L
Sbjct: 40  CLSYITGNSTTPSQPCCSRLDSVIKSSPQCICSAV------NSPIPNIGLNINRTQALQL 93

Query: 378 PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKT--PGASP---GGSTSQPA 542
           P+ C +     T C      P   P A   T  T     + T  PGA     GGS + P+
Sbjct: 94  PNACNIQTPPLTQCNAATG-PTAQPPAPSPTEKTPDVTLTPTSLPGARSGVGGGSKTVPS 152

Query: 543 TAGGDS 560
              G S
Sbjct: 153 VGTGSS 158



>gb:AF083791_1767021 Arabidopsis thaliana clone sps870 unknown mRNA.
          Length = 168

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 31/120 (25%), Positives = 56/120 (46%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS 383
           CL+Y  G + +P+++CC+ +S + ++ P CLC    QV  G  S   + + + + L LP 
Sbjct: 36  CLNYITGNSTSPNQQCCNQLSRVVQSSPDCLC----QVLNGGGSQLGINVNQTQALGLPR 91

Query: 384 ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAGGDSG 563
            C +     + C    N   G          +TS + +++P +S  G+ S+    G   G
Sbjct: 92  ACNVQTPPVSRC----NTGGGG-------GGSTSDSPAESPNSSGPGNGSKTVPVGEGDG 140



>gb:AY085883_1570946 Arabidopsis thaliana clone 19287 mRNA, complete
           sequence.
          Length = 166

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 31/120 (25%), Positives = 56/120 (46%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS 383
           CL+Y  G + +P+++CC+ +S + ++ P CLC    QV  G  S   + + + + L LP 
Sbjct: 34  CLNYITGNSTSPNQQCCNQLSRVVQSSPDCLC----QVLNGGGSQLGINVNQTQALGLPR 89

Query: 384 ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAGGDSG 563
            C +     + C    N   G          +TS + +++P +S  G+ S+    G   G
Sbjct: 90  ACNVQTPPVSRC----NTGGGG-------GGSTSDSPAESPNSSGPGNGSKTVPVGEGDG 138



>gb:AY045650_1561241 Arabidopsis thaliana AT3g22600/F16J14_17 mRNA,
           complete cds.>gb:AY079122_1568183 Arabidopsis thaliana
           AT3g22600/F16J14_17 mRNA, complete
           cds.>gb:AP000731_1820540 Arabidopsis thaliana genomic
           DNA, chromosome 3, BAC clone:F16J14.
          Length = 170

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 31/120 (25%), Positives = 56/120 (46%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS 383
           CL+Y  G + +P+++CC+ +S + ++ P CLC    QV  G  S   + + + + L LP 
Sbjct: 38  CLNYITGNSTSPNQQCCNQLSRVVQSSPDCLC----QVLNGGGSQLGINVNQTQALGLPR 93

Query: 384 ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAGGDSG 563
            C +     + C    N   G          +TS + +++P +S  G+ S+    G   G
Sbjct: 94  ACNVQTPPVSRC----NTGGGG-------GGSTSDSPAESPNSSGPGNGSKTVPVGEGDG 142



>gb:AP003843_1834112 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1656_E11.
          Length = 181

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 32/116 (27%), Positives = 50/116 (43%), Gaps = 2/116 (1%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS 383
           CL Y  G +  P   CC +++ + ++DP CLC V+     G ++   + I   R L+LP 
Sbjct: 47  CLDYISGKSPIPEFTCCTTLAGVVQSDPRCLCMVLD----GSAASFGISINHTRALELPG 102

Query: 384 ECKLANASTTNCPKLLNLPAG--SPDAAIFTNATTSHATSKTPGASPGGSTSQPAT 545
            CK+     + C  +   P    +P  A     T     S  P  S G + +  AT
Sbjct: 103 VCKVQAPPISQCTAVPTPPPAPDTPTLADEPAETNEDEPSPPPAGSAGSNKTSSAT 158



>gb:AY085177_1570256 Arabidopsis thaliana clone 13599 mRNA, complete
           sequence.
          Length = 168

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 37/125 (29%), Positives = 55/125 (44%), Gaps = 8/125 (6%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL--KL 377
           C+ Y  G A AP+K CC     +      C+C +++     D     LGIK +  L   L
Sbjct: 27  CIPYVGGDAKAPTKDCCAGFGQVIRKSEKCVCILVR-----DKDDPQLGIKINATLAAHL 81

Query: 378 PSECKLANASTTNCPKLLNLPAGSPDAAIFTN----ATTSHATSKTP--GASPGGSTSQP 539
           PS C +   + T+C  +L+LP  S  A  F N        ++TS T       GG  ++P
Sbjct: 82  PSACHITAPNITDCISILHLPRNSTLAKEFENLGRIEDNYNSTSPTQIHKDGTGGGKAEP 141

Query: 540 ATAGG 554
             + G
Sbjct: 142 VKSNG 146



>pir|E96594|E96594 unknown protein, 63629-62263 [imported] -
           Arabidopsis thaliana>gb:AE005173_893409 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC027034_1539777 Arabidopsis thaliana
           chromosome 1 BAC F7A10 genomic sequence, complete
           sequence.>gb:AY090262_1574014 Arabidopsis thaliana
           At1g55260/F7A10_16 mRNA, complete
           cds.>gb:AF412076_1797329 Arabidopsis thaliana
           At1g55260/F7A10_16 mRNA, complete cds.
          Length = 184

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 37/125 (29%), Positives = 55/125 (44%), Gaps = 8/125 (6%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL--KL 377
           C+ Y  G A AP+K CC     +      C+C +++     D     LGIK +  L   L
Sbjct: 43  CIPYVGGDAKAPTKDCCAGFGQVIRKSEKCVCILVR-----DKDDPQLGIKINATLAAHL 97

Query: 378 PSECKLANASTTNCPKLLNLPAGSPDAAIFTN----ATTSHATSKTP--GASPGGSTSQP 539
           PS C +   + T+C  +L+LP  S  A  F N        ++TS T       GG  ++P
Sbjct: 98  PSACHITAPNITDCISILHLPRNSTLAKEFENLGRIEDNYNSTSPTQIHKDGTGGGKAEP 157

Query: 540 ATAGG 554
             + G
Sbjct: 158 VKSNG 162



>gb:OSJN00003_1693111 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0072F16, complete
           sequence.>gb:OSJN00299_1698197 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: B1358B12, complete sequence.
          Length = 200

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 34/127 (26%), Positives = 58/127 (45%), Gaps = 8/127 (6%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL 371
           +++ CL +  G   APS  CC ++ S+   +P+CLC  + Q   G      + +   R +
Sbjct: 45  RLLPCLGFVGGNNAAPSNTCCANLGSMVHDEPLCLCQALSQ--SGGGGAIPVPVNRTRAV 102

Query: 372 KLPSECKL-ANASTTNCPKLLNLPAGSPDAAIFTNATTSHATS-KTP------GASPGGS 527
           +LP  C+L    + T CP   +L   +P   +    +T ++T+  TP       A P   
Sbjct: 103 QLPLLCRLDLPPAATACPG-FDLGGAAPSPPVSVPRSTPNSTAPSTPTPVTVTRAPPQQM 161

Query: 528 TSQPATA 548
           T  P T+
Sbjct: 162 TPSPKTS 168



>gb:AB159560_1528436 Zinnia elegans ZeXYP1 mRNA for xylogen protein
           1, complete cds.
          Length = 183

 Score = 49.7 bits (117), Expect = 7e-05
 Identities = 34/120 (28%), Positives = 49/120 (40%), Gaps = 11/120 (9%)
 Frame = +3

Query: 201 DCLSY--AIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLK 374
           DCLSY  A  T   P   CC  + ++ +TD  CLC   +     +S+   + +   + L 
Sbjct: 46  DCLSYVTAGSTVKKPEGTCCSGLKTVLKTDAECLCEAFK-----NSAQLGVSLNITKALA 100

Query: 375 LPSECKLANASTTNC---------PKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGS 527
           LPS C +   S TNC         P L  +  G   +        S A + TP +   GS
Sbjct: 101 LPSACHINAPSATNCGISPGTAVAPALAPIGVGMAPSGAAVAFGPSMAVAPTPASQTSGS 160



>gb:ATT5E8_1556132 Arabidopsis thaliana DNA chromosome 5, BAC clone
           T5E8 (ESSA project).>gb:AK118479_1816452 Arabidopsis
           thaliana At5g09370 mRNA for putative lipid transfer
           protein, complete cds, clone: RAFL19-71-J05.
          Length = 158

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 30/102 (29%), Positives = 44/102 (43%)
 Frame = +3

Query: 222 GTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPSECKLAN 401
           GTAD P+  CC S+ +I +T P+CLC  +++   G      + +   +   LP  CKL  
Sbjct: 46  GTADTPTASCCSSLKNILDTKPICLCEGLKKAPLG------IKLNVTKSATLPVACKLNA 99

Query: 402 ASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGS 527
              + C    +LP  SP  A           +  P  S G S
Sbjct: 100 PPVSACD---SLPPASPPTANGQAPVWGSGWAPAPSPSKGNS 138



>gb:BT003062_1636644 Arabidopsis thaliana At2g13820 gene, complete
           cds.
          Length = 169

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 34/117 (29%), Positives = 49/117 (41%), Gaps = 8/117 (6%)
 Frame = +3

Query: 201 DCLSYAIG--TADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLK 374
           DCLS+     T   P   CC  + ++  T P CLC   +     +S    L +   +   
Sbjct: 36  DCLSFVTSGSTVVKPEGTCCSGLKTVVRTGPECLCEAFK-----NSGSLGLTLDLSKAAS 90

Query: 375 LPSECKLANASTTNCPKLLN------LPAGSPDAAIFTNATTSHATSKTPGASPGGS 527
           LPS CK+A   +  C   ++       P  SP A     A +S A + TP +SP  S
Sbjct: 91  LPSVCKVAAPPSARCGLSVSGDPPATAPGLSPTAGAGAPALSSGANAATPVSSPRSS 147



>gb:AY086755_1571798 Arabidopsis thaliana clone 27380 mRNA, complete
           sequence.
          Length = 165

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 37/106 (34%), Positives = 50/106 (47%), Gaps = 4/106 (3%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDS--VSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--RLL 371
           CL +    A AP   CC +  V   K     CLC +++     D     LG K D  R +
Sbjct: 36  CLPFVTNKAKAPDSTCCSTLKVKIDKGQTRKCLCTLVK-----DRDDPGLGFKVDANRAM 90

Query: 372 KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPG 509
            LPS C +  A+ + CP LL+L   SP + IF   T S  +S+T G
Sbjct: 91  SLPSACHVP-ANISQCPDLLHLLPDSPASQIFKQFTES--SSQTVG 133



>pir|B84511|B84511 hypothetical protein At2g13820 [imported] -
           Arabidopsis thaliana>gb:AC006218_1533643 Arabidopsis
           thaliana chromosome 2 clone F17L24 map GPC6, complete
           sequence.>gb:AC006436_1534248 Arabidopsis thaliana
           chromosome 2 clone F13J11 map mi398, complete
           sequence.>gb:AY086354_1571404 Arabidopsis thaliana clone
           24286 mRNA, complete sequence.
          Length = 169

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 34/117 (29%), Positives = 49/117 (41%), Gaps = 8/117 (6%)
 Frame = +3

Query: 201 DCLSYAIG--TADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLK 374
           DCLS+     T   P   CC  + ++  T P CLC   +     +S    L +   +   
Sbjct: 36  DCLSFVTSGSTVVKPEGTCCSGLKTVVRTGPECLCEAFK-----NSGSLGLTLDLSKAAS 90

Query: 375 LPSECKLANASTTNCPKLLN------LPAGSPDAAIFTNATTSHATSKTPGASPGGS 527
           LPS CK+A   +  C   ++       P  SP A     A +S A + TP +SP  S
Sbjct: 91  LPSVCKVAAPPSARCGLSVSGDPPATAPGLSPTAGAGAPALSSGANAATPVSSPRSS 147



>pir|T14827|T14827 lipid transfer protein - Norway
           spruce>gb:AB007843_1510327 Picea abies mRNA for lipid
           transfer protein, complete cds.
          Length = 173

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 31/114 (27%), Positives = 50/114 (43%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS 383
           C  Y   T   P   CC ++ S+ + D  CLC ++        +V  LG+   + +K+P+
Sbjct: 40  CAPYLNATTK-PDSSCCSALISVIDKDSQCLCNLL-----NSDTVKQLGVNVTQAMKMPA 93

Query: 384 ECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPAT 545
           EC   N S T C K              T  +   +  KTP ++P  S++ P+T
Sbjct: 94  ECG-KNVSATQCNK--------------TATSGGSSVGKTPTSTPPPSSATPST 132



>pir|T45675|T45675 hypothetical protein F14P22.140 - Arabidopsis
           thaliana>gb:ATF14P22_1548623 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F14P22.>gb:BT003738_1636937
           Arabidopsis thaliana At3g58550 mRNA, complete
           cds.>gb:AK119080_1817025 Arabidopsis thaliana At3g58550
           mRNA for predicted GPI-anchored protein (by homology),
           complete cds, clone: RAFL21-43-J24.
          Length = 177

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 37/106 (34%), Positives = 50/106 (47%), Gaps = 4/106 (3%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDS--VSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--RLL 371
           CL +    A AP   CC +  V   K     CLC +++     D     LG K D  R +
Sbjct: 48  CLPFVTNKAKAPDSTCCSTLKVKIDKGQTRKCLCTLVK-----DRDDPGLGFKVDANRAM 102

Query: 372 KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPG 509
            LPS C +  A+ + CP LL+L   SP + IF   T S  +S+T G
Sbjct: 103 SLPSACHVP-ANISQCPDLLHLLPDSPASQIFKQFTES--SSQTVG 145



>gb:AC137991_1743840 Oryza sativa chromosome 3 BAC OSJNBa0034D21
           genomic sequence, complete sequence.
          Length = 212

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 40/136 (29%), Positives = 57/136 (41%), Gaps = 14/136 (10%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKL-- 377
           C+SY IG +  PS  CC+ + ++ ++   CLC  +       + V  LG  +  L     
Sbjct: 66  CVSYFIGNSSTPSDACCEQMRAMFQSQAPCLCAAVASAPSPLAPV--LGGVQSLLPTACN 123

Query: 378 --PSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASP-----GGSTSQ 536
             P+ C  A  ST+      + PAG   A   T AT +    +  G  P     GGS S 
Sbjct: 124 LPPNACADATGSTSG-----SAPAGGSSATPSTGATAAAPAMEPAGMDPAMTAGGGSKSV 178

Query: 537 P-----ATAGGDSGGS 569
           P     A AG   GG+
Sbjct: 179 PGMPYSAAAGVHGGGA 194



>pir|T00941|T00941 hypothetical protein T3F12.2 - Arabidopsis
           thaliana>gb:AC002983_1530904 Arabidopsis thaliana BAC
           T3F12 from chromosome IV near 24 cM, complete
           sequence.>gb:ATCHRIV24_1544583 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 24.
          Length = 194

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 35/120 (29%), Positives = 52/120 (43%), Gaps = 2/120 (1%)
 Frame = +3

Query: 195 VMDCLSY-AIGTADA-PSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRL 368
           +MDCL Y  +G+ +  P K CC  + ++ + +P C+C  +  V  G+  +    +   R 
Sbjct: 55  MMDCLGYLGVGSNETKPEKSCCTGIETVLQYNPQCICAGL--VSAGEMGIE---LNSTRA 109

Query: 369 LKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATA 548
           L  P  CKL+ A               P   I T+  T      TPGASP  S    AT+
Sbjct: 110 LATPKACKLSIA--------------PPHCGIITSGAT------TPGASPAKSPETSATS 149



>gb:AY086176_1571231 Arabidopsis thaliana clone 21969 mRNA, complete
           sequence.
          Length = 129

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 26/80 (32%), Positives = 39/80 (48%)
 Frame = +3

Query: 222 GTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPSECKLAN 401
           GTAD P+  CC S+ +I +T P+CLC  +++   G      + +   +   LP  CKL  
Sbjct: 46  GTADTPTASCCSSLKNILDTKPICLCEGLKKAPLG------IKLNVTKSATLPVACKLNA 99

Query: 402 ASTTNCPKLLNLPAGSPDAA 461
              + C    +LP  SP  A
Sbjct: 100 PPVSACD---SLPPASPPTA 116



>gb:AY070743_1566893 Arabidopsis thaliana AT5g64080/MHJ24_6 mRNA,
           complete cds.>gb:AY093740_1575400 Arabidopsis thaliana
           AT5g64080/MHJ24_6 mRNA, complete cds.
          Length = 182

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 35/121 (28%), Positives = 48/121 (39%), Gaps = 4/121 (3%)
 Frame = +3

Query: 201 DCLSYAI--GTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--RL 368
           DCLS+    GT   P   CC  + ++ + D  CLC   +       S  SLG+  +  + 
Sbjct: 52  DCLSFVSSGGTVAKPEGTCCSGLKTVLKADSQCLCEAFK-------SSASLGVTLNITKA 104

Query: 369 LKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATA 548
             LP+ CKL   S   C                     S A S  PG +PG + + P TA
Sbjct: 105 STLPAACKLHAPSIATC-------------------GLSVAPSTAPGLAPGVAAAGPETA 145

Query: 549 G 551
           G
Sbjct: 146 G 146



>pir|A86162|A86162 protein F10O3.7 [imported] - Arabidopsis
           thaliana>gb:AE005172_889330 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F10O3_1677285 Arabidopsis thaliana
           chromosome 1 BAC F10O3 sequence, complete sequence.
          Length = 129

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 23/72 (31%), Positives = 34/72 (47%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS 383
           CL Y  G + +PS  CC   S++ ++ P CLC V   V+  +SS           L LP+
Sbjct: 35  CLYYLNGGSSSPSWSCCRQFSTVVQSSPECLCSV---VNSNESSFYGFKFNRTLALNLPT 91

Query: 384 ECKLANASTTNC 419
            C +   S + C
Sbjct: 92  ACNVQTPSPSLC 103



>gb:AY088880_1573888 Arabidopsis thaliana clone 98459 mRNA, complete
           sequence.
          Length = 182

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 34/121 (28%), Positives = 47/121 (38%), Gaps = 4/121 (3%)
 Frame = +3

Query: 201 DCLSYAI--GTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--RL 368
           DCLS+    GT   P   CC  + ++ + D  CLC   +       S  SLG+  +  + 
Sbjct: 52  DCLSFVSSGGTVAKPEGTCCSGLKTVLKADSQCLCEAFK-------SSASLGVTLNITKA 104

Query: 369 LKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATA 548
             LP+ CKL   S   C                     S A S  PG +PG + + P T 
Sbjct: 105 STLPAACKLHAPSIATC-------------------GLSVAPSTAPGLAPGVAAAGPETV 145

Query: 549 G 551
           G
Sbjct: 146 G 146



>gb:AE005172_890793 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC013354_1537908 Genomic sequence
           for Arabidopsis thaliana BAC F15H18 from chromosome I,
           complete sequence.>gb:AC069551_1540966 Genomic sequence
           for Arabidopsis thaliana BAC T10O22 from chromosome I,
           complete sequence.>gb:AY086971_1572009 Arabidopsis
           thaliana clone 30040 mRNA, complete sequence.
          Length = 180

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 39/126 (30%), Positives = 54/126 (42%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL 371
           K+M C  Y +  A  P   CC  ++ I   D  CLC V   V      + SL + ++  L
Sbjct: 44  KLMPCQPY-LHLATPPPATCCMPLNEIVAKDATCLCAVFNNV----DMLKSLNLTKENAL 98

Query: 372 KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAG 551
            LP  C  A A  + C       AG+       +++T  AT KTP   P  STS   T  
Sbjct: 99  DLPKACG-AKADVSLC----KTSAGT------NSSSTPPATPKTP---PASSTS-TGTGS 143

Query: 552 GDSGGS 569
           G +G +
Sbjct: 144 GSTGNA 149



>gb:AP004797_1845233 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0547F09.
          Length = 270

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 34/114 (29%), Positives = 47/114 (41%), Gaps = 6/114 (5%)
 Frame = +3

Query: 195 VMDCLSYAIGT-ADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGD-SSVTSLGIKEDRL 368
           +M C  Y   + A  P   CC+   S+  T P+CLC+ I     GD S    L +   ++
Sbjct: 172 MMSCADYLTNSSAQTPPGTCCEGFKSLVSTAPICLCHGI----NGDLSKFLPLPVDMMKM 227

Query: 369 LKLPSEC----KLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASP 518
           + LP+ C     L   S  N P +  L   SP AA           +  PG SP
Sbjct: 228 MTLPNTCGATVPLQTFSMCNTPSVPPLMPQSPSAA-----------APAPGVSP 270



>gb:AC137991_1743841 Oryza sativa chromosome 3 BAC OSJNBa0034D21
           genomic sequence, complete sequence.
          Length = 243

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 30/122 (24%), Positives = 54/122 (44%), Gaps = 8/122 (6%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS 383
           C+SY IG +  PS  CC+ + ++ ++   CLC  +       + V   G++      LP+
Sbjct: 66  CVSYFIGNSSTPSDACCEQMRAMFQSQAPCLCAAVASAPSPLAPVLG-GVQS----LLPT 120

Query: 384 ECKLANASTTNCPKLLNLP-------AGSPDAAIFTNATTSHATSKTPGASP-GGSTSQP 539
            C L   +    P +  +P       + +           + AT  T G++P GGS++ P
Sbjct: 121 ACNLPPNACAGKPFVRAVPILTCGLNSRTHGVIAVAGVVFADATGSTSGSAPAGGSSATP 180

Query: 540 AT 545
           +T
Sbjct: 181 ST 182



>gb:AP004315_1840079 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0571D04.
          Length = 273

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 29/95 (30%), Positives = 44/95 (46%), Gaps = 6/95 (6%)
 Frame = +3

Query: 195 VMDCLSYAI-GTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL 371
           +M C+ Y       AP   CCD   S+ E  P+CLC+    ++   S +    I   R++
Sbjct: 173 LMPCMEYVTKADVPAPPSVCCDGFKSLVEKAPICLCH---GINGNISKLMPAPIDLTRIM 229

Query: 372 KLPSECKLAN--ASTTNC---PKLLNLPAGSPDAA 461
            LP+ C +A    + T C   P    +PA +P AA
Sbjct: 230 SLPATCGVAPPVEALTKCFTGPVPPLMPASTPAAA 264



>gb:AY087113_1572148 Arabidopsis thaliana clone 31856 mRNA, complete
           sequence.
          Length = 156

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 20/72 (27%), Positives = 32/72 (44%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS 383
           CLS+       PS++CC+ ++ +      CLC    QV  G  S   + + E + L LP 
Sbjct: 36  CLSFITQNTSLPSQQCCNQLAHVVRYSSECLC----QVLDGGGSQLGINVNETQALALPK 91

Query: 384 ECKLANASTTNC 419
            C +     + C
Sbjct: 92  ACHVQTPPASRC 103



>gb:OSJN00010_1693224 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OJ991214_12, complete sequence.
          Length = 116

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 22/70 (31%), Positives = 34/70 (48%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL 371
           K+  C S A      PS  CC +V +I +  P CLC V+       S+  + GIK +  +
Sbjct: 39  KLAPCASAAKDPKSTPSSGCCTAVHTIGKQSPKCLCAVML-----SSTTRNAGIKPEVAI 93

Query: 372 KLPSECKLAN 401
            +P  C +A+
Sbjct: 94  TIPKRCNIAD 103



>gb:AE016959_1021406 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC104322_1737572
           Oryza sativa chromosome 10 BAC OSJNBb0005F01 genomic
           sequence, complete sequence.>gb:AE017068_1751225 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           22 of 77 of the complete sequence.
          Length = 188

 Score = 41.6 bits (96), Expect = 0.019
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 2/78 (2%)
 Frame = +3

Query: 198 MDCLSYAIGTADAPSK--KCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL 371
           MD L      +D P+    CC++V+ + ++DP CLC V +        + S+    D   
Sbjct: 56  MDDLMPCATVSDDPTMLTPCCEAVAEVLKSDPECLCKVAEMSRNNTRKLASVSNNLDSDQ 115

Query: 372 KLPSECKLANASTTNCPK 425
           +L ++CK+   S+  C K
Sbjct: 116 QLFAQCKITGVSSDVCHK 133



>pir|E96766|E96766 hypothetical protein F2P9.24 [imported] -
           Arabidopsis thaliana>gb:AE005173_894935 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC016662_1538236 Arabidopsis thaliana
           chromosome 1 BAC F2P9 genomic sequence, complete
           sequence.
          Length = 193

 Score = 41.6 bits (96), Expect = 0.019
 Identities = 30/114 (26%), Positives = 50/114 (43%), Gaps = 1/114 (0%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS 383
           C  +  G A  P++ CCDS++ I   +  CLC  +       +   +  I +   L+LP 
Sbjct: 40  CGPFVQGFAQLPAQPCCDSLNQIYSQEATCLCLFLNNT---STLSPAFPINQTLALQLPP 96

Query: 384 ECKL-ANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPA 542
            C + AN+ST +     + P  +P        + S + +  P +S G   SQ A
Sbjct: 97  LCNIPANSSTCSS----SFPGEAP--------SDSSSVAPPPSSSTGSQISQGA 138



>gb:BT011764_1641286 Arabidopsis thaliana At1g62790 mRNA, complete
           cds.>gb:BT012377_1641528 Arabidopsis thaliana At1g62790
           mRNA, complete cds.
          Length = 150

 Score = 41.2 bits (95), Expect = 0.024
 Identities = 30/125 (24%), Positives = 50/125 (40%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL 371
           K++ C +  + T   P K+CCDS+    E +  CLC     ++     +    +  ++ L
Sbjct: 32  KLVPCFN-DLNTTTTPVKECCDSIKEAVEKELTCLC----TIYTSPGLLAQFNVTTEKAL 86

Query: 372 KLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAG 551
            L   C +    TT+        A SP A++             P  +P G+T + A AG
Sbjct: 87  GLSRRCNV----TTDLSACTAKGAPSPKASL-------------PPPAPAGNTKKDAGAG 129

Query: 552 GDSGG 566
               G
Sbjct: 130 NKLAG 134



>gb:AB008266_1510418 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MHJ24.
          Length = 173

 Score = 40.4 bits (93), Expect = 0.041
 Identities = 29/94 (30%), Positives = 41/94 (43%), Gaps = 5/94 (5%)
 Frame = +3

Query: 201 DCLSYAI--GTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED--RL 368
           DCLS+    GT   P   CC  + ++ + D  CLC   +       S  SLG+  +  + 
Sbjct: 52  DCLSFVSSGGTVAKPEGTCCSGLKTVLKADSQCLCEAFK-------SSASLGVTLNITKA 104

Query: 369 LKLPSECKLANASTTNCPKLL-NLPAGSPDAAIF 467
             LP+ CKL   S   C  L   + A  P+ A F
Sbjct: 105 STLPAACKLHAPSIATCGCLAPGVAAAGPETAGF 138



>gb:SLMEN7_1715353 S.latifolia mRNA for Men-7 protein.
          Length = 129

 Score = 40.0 bits (92), Expect = 0.054
 Identities = 26/87 (29%), Positives = 39/87 (44%), Gaps = 9/87 (10%)
 Frame = +3

Query: 189 PKVMDCLSYAIGTADAPSKKCCDSVSSIKET-----DPVCLCYVIQ----QVHKGDSSVT 341
           PKV  CL Y  G + +PS  CC+ + ++  T     D V +C  ++     +    S + 
Sbjct: 30  PKVTFCLLYITGGSPSPSDACCNGIKTVASTVKDKNDAVLVCNCLKDKLVDLQYQPSLIA 89

Query: 342 SLGIKEDRLLKLPSECKLANASTTNCP 422
           SL  K     KLP+  K  + S  N P
Sbjct: 90  SLSDKCSVSFKLPAISKATDCSKVNPP 116



>gb:AY088017_1573041 Arabidopsis thaliana clone 4043 mRNA, complete
           sequence.
          Length = 147

 Score = 40.0 bits (92), Expect = 0.054
 Identities = 28/102 (27%), Positives = 43/102 (42%), Gaps = 1/102 (0%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL 371
           K++ C  Y       P   CC  +  I E D  CLC            + +L + ++  L
Sbjct: 36  KLLPCQPYIHSLNPPPPPSCCGPMKEIVEKDAPCLC----TAFNNPEVLKALNLTKENAL 91

Query: 372 KLPSECKLANASTTNCPKLLN-LPAGSPDAAIFTNATTSHAT 494
            LP+ C + N   + C K+    P  SP +   TN T+S +T
Sbjct: 92  LLPNACGV-NPDVSLCSKIATPSPIASPGS---TNGTSSAST 129



>pir|T10084|T10084 lipid transfer protein precursor - castor
           bean>gb:RCCLTPB_1703331 Ricinus communis lipid transfer
           protein mRNA, complete cds.
          Length = 116

 Score = 40.0 bits (92), Expect = 0.054
 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 9/85 (10%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSIKET-----DPVCLCYVIQQVHKGDSSVTSLGIK 356
           K   C+ +A G    PS+ CC  +  + +T     D   +C  ++      +S  SLGIK
Sbjct: 34  KAAACVGFATGKDSKPSQACCTGLQQLAQTVKTVDDKKAICRCLK------ASSKSLGIK 87

Query: 357 EDRLLKLPSECKL----ANASTTNC 419
           +  L K+P+ C +      ++ TNC
Sbjct: 88  DQFLSKIPAACNIKVGFPVSTNTNC 112



>pir|S01796|S01796 nonspecific lipid transfer protein - castor bean
          Length = 92

 Score = 40.0 bits (92), Expect = 0.054
 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 9/85 (10%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSIKET-----DPVCLCYVIQQVHKGDSSVTSLGIK 356
           K   C+ +A G    PS+ CC  +  + +T     D   +C  ++      +S  SLGIK
Sbjct: 10  KAAACVGFATGKDSKPSQACCTGLQQLAQTVKTVDDKKAICRCLK------ASSKSLGIK 63

Query: 357 EDRLLKLPSECKL----ANASTTNC 419
           +  L K+P+ C +      ++ TNC
Sbjct: 64  DQFLSKIPAACNIKVGFPVSTNTNC 88



>sp|Q43119|NLTD_RICCO Nonspecific lipid-transfer protein D,
           cotyledon-specific isoform precursor (NS-LTP
           D).>pir|T10080|T10080 lipid transfer protein precursor -
           castor bean>gb:RCCLTPA_1703330 Ricinus communis lipid
           transfer protein mRNA, complete cds.
          Length = 116

 Score = 40.0 bits (92), Expect = 0.054
 Identities = 25/87 (28%), Positives = 38/87 (43%), Gaps = 11/87 (12%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCC-------DSVSSIKETDPVCLCYVIQQVHKGDSSVTSLG 350
           K   C+ +A G    PS  CC        +V S+ +   +C C          +S  SLG
Sbjct: 34  KAAACVGFATGKDSKPSSACCTGLQQLAQTVKSVDDKKAICRCL--------KASSKSLG 85

Query: 351 IKEDRLLKLPSECKL----ANASTTNC 419
           IK+  L K+P+ C +      ++ TNC
Sbjct: 86  IKDQFLSKIPAACNIKVGFPVSTATNC 112



>sp|P10975|NLTC_RICCO Nonspecific lipid-transfer protein C,
           cotyledon-specific isoform precursor (NS-LTP C)
           (Phospholipid transfer protein)
           (PLTP).>pir|T10098|T10098 nonspecific lipid transfer
           protein C precursor - castor bean>gb:RCCNLTP_1703333
           Ricinus communis nsLTP mRNA for non specific lipid
           transfer protein-C, complete cds.
          Length = 116

 Score = 40.0 bits (92), Expect = 0.054
 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 9/85 (10%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSIKET-----DPVCLCYVIQQVHKGDSSVTSLGIK 356
           K   C+ +A G    PS+ CC  +  + +T     D   +C  ++      +S  SLGIK
Sbjct: 34  KAAACVGFATGKDSKPSQACCTGLQQLAQTVKTVDDKKAICRCLK------ASSKSLGIK 87

Query: 357 EDRLLKLPSECKL----ANASTTNC 419
           +  L K+P+ C +      ++ TNC
Sbjct: 88  DQFLSKIPAACNIKVGFPVSTNTNC 112



>gb:AP003509_1830101 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0525F01.
          Length = 116

 Score = 39.7 bits (91), Expect = 0.071
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 1/66 (1%)
 Frame = +3

Query: 195 VMDCLSYAIGT-ADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL 371
           +M C+ YA  T   AP   CCD   S+ E  P+CLC+    ++          I   R++
Sbjct: 3   LMPCVEYATKTDVPAPPSVCCDGFKSLVEMAPICLCH---GINGNIGKFMPAPIDLTRMM 59

Query: 372 KLPSEC 389
            LP+ C
Sbjct: 60  SLPATC 65



>gb:AY789644_1628464 Triticum aestivum lipid transfer protein 4
           (LTP4) mRNA, complete cds.
          Length = 114

 Score = 39.7 bits (91), Expect = 0.071
 Identities = 25/86 (29%), Positives = 38/86 (44%), Gaps = 11/86 (12%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCD-------SVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED 362
           CLSYA G   +PS  CC         V +  +    CLC              + G+KE 
Sbjct: 39  CLSYARGNGASPSAACCSGVRRLAGQVQTAADKKAACLCI----------KSAAGGVKEG 88

Query: 363 RLLKLPSECKLA----NASTTNCPKL 428
              ++PS+C+++     +ST NC K+
Sbjct: 89  TAAEIPSKCRVSVPYKISSTVNCNKI 114



>pir|T04093|T04093 phospholipid transfer protein -
           maize>gb:ZMU66105_1732208 Zea mays phospholipid transfer
           protein mRNA, complete cds.
          Length = 121

 Score = 39.7 bits (91), Expect = 0.071
 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 9/90 (10%)
 Frame = +3

Query: 186 SPKVMDCLSYAIGTADAPSKKCCDSVSSIKE-----TDPVCLCYVIQQVHKGDSSVTSLG 350
           S  +  CLSYA GT   PS  CC  V ++K       D    C  ++   +G S     G
Sbjct: 36  SSAIAPCLSYARGTGSGPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVS-----G 90

Query: 351 IKEDRLLKLPSECKLA----NASTTNCPKL 428
           +       +PS+C ++     +++T+C ++
Sbjct: 91  LNAGNAASIPSKCGVSIPYTISTSTDCSRV 120



>gb:AP004797_1845222 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0547F09.
          Length = 268

 Score = 39.3 bits (90), Expect = 0.092
 Identities = 29/96 (30%), Positives = 43/96 (44%), Gaps = 7/96 (7%)
 Frame = +3

Query: 195 VMDCLSYAIGT-ADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGD-SSVTSLGIKEDRL 368
           +M C  Y   + A  P   CC+   S+  T P+CLC+ I     GD S    L +   ++
Sbjct: 172 MMSCADYLTNSSAQTPPGTCCEGFKSLVSTAPICLCHGI----NGDLSKFLPLPVDMMKM 227

Query: 369 LKLPSEC----KLANASTTNCPKLLNL-PAGSPDAA 461
           + LP+ C     L   S  N P +  L P+ +P  A
Sbjct: 228 MTLPNTCGATVPLQTFSMCNTPSVPPLMPSAAPAPA 263



>gb:AC137991_1743837 Oryza sativa chromosome 3 BAC OSJNBa0034D21
           genomic sequence, complete sequence.
          Length = 228

 Score = 39.3 bits (90), Expect = 0.092
 Identities = 38/131 (29%), Positives = 53/131 (40%), Gaps = 9/131 (6%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKE---DRLLK 374
           C+ YA G   A    CC  + +   +   CLC   +    G   +  LG  +     +  
Sbjct: 57  CIGYAFGVGSATLSSCCSELRAFLRSQGPCLCAASRLAAAGPFGL-FLGQAQAIVPNVCN 115

Query: 375 LPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGAS---PGGSTSQPA- 542
           LPS      A+ ++ P+     A +P AA  T A T  A    P AS   P  +   PA 
Sbjct: 116 LPSNPCDDVAAKSSEPRSATPAALAPAAAPDTPAMTPSAAPAEPEASEAPPVPADDSPAA 175

Query: 543 --TAGGDSGGS 569
             TA GD+G S
Sbjct: 176 TVTAPGDAGSS 186



>gb:AC119288_1739629 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0017J22, complete
           sequence.>gb:AC137614_1743572 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBa0034O12,
           complete sequence.
          Length = 117

 Score = 39.3 bits (90), Expect = 0.092
 Identities = 21/70 (30%), Positives = 36/70 (51%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL 371
           ++  C+S A     APS  CC +V +I ++ P CLC V+       ++    GIK +  +
Sbjct: 41  RLAPCVSAADDPQSAPSSSCCSAVHTIGQS-PSCLCAVML-----SNTARVAGIKPEVAI 94

Query: 372 KLPSECKLAN 401
            +P  C +A+
Sbjct: 95  TIPKRCNMAD 104



>gb:OSJN00239_1697225 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0039G19, complete sequence.
          Length = 392

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 32/97 (32%), Positives = 46/97 (47%), Gaps = 7/97 (7%)
 Frame = +3

Query: 192 KVMDCLSYAIGTAD-APSKKCCDSVSSIKETDPVCLCYVIQQVHKGD-SSVTSLGIKEDR 365
           ++M C+ Y     + AP    CDS  S+ E  P+CLC+ I     GD S      I   R
Sbjct: 245 QLMPCMEYLTKADEPAPPSIGCDSFKSLVEKAPICLCHGI----NGDISKFMPAPIDFAR 300

Query: 366 LLKLPSECKLAN--ASTTNC---PKLLNLPAGSPDAA 461
           ++ LP+ C +A    + T C   P    +PA +P AA
Sbjct: 301 MMSLPATCGVAPPVEALTKCFTGPVPPLMPAPTPAAA 337



>gb:AB005230_1509243 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MAC12.>gb:BT015106_1642076 Arabidopsis thaliana
           At5g13900 gene, complete cds.>gb:AF463514_1801992
           Arabidopsis thaliana lipid transfer protein-like VAS
           (VAS) gene, complete cds.>gb:AK175242_1817230
           Arabidopsis thaliana mRNA for predicted GPI-anchored
           protein, complete cds, clone: RAFL21-67-F10.
          Length = 151

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 20/62 (32%), Positives = 32/62 (51%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPS 383
           CL+Y  GT + P + CC+ + S+   +P CLC +I   ++  S     GI  +    LP+
Sbjct: 39  CLNYLNGTKEVP-QVCCNPLKSVIRNNPECLCRMIS--NRWSSQAERAGIDVNDAQMLPA 95

Query: 384 EC 389
            C
Sbjct: 96  RC 97



>gb:SVTLP1R_1723264 S.vulgare ltp1 mRNA.
          Length = 101

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 8/89 (8%)
 Frame = +3

Query: 186 SPKVMDCLSYAIGTADAPSKKCCDSVSSI----KETDPVCLCYVIQQVHKGDSSVTSLGI 353
           S  +  CLSYA G   APS  CC  V S+    + T     C  ++   +G S     G+
Sbjct: 17  SSAIAPCLSYARGQGSAPSAGCCSGVRSLNSAARTTADAAACNCLKNAARGIS-----GL 71

Query: 354 KEDRLLKLPSECKLA----NASTTNCPKL 428
                  +PS+C ++     +++T+C ++
Sbjct: 72  NAGNAASIPSKCGVSVPYTISTSTDCSRV 100



>pir|S33460|S33460 lipid transfer protein - sorghum (fragment)
          Length = 101

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 8/89 (8%)
 Frame = +3

Query: 186 SPKVMDCLSYAIGTADAPSKKCCDSVSSI----KETDPVCLCYVIQQVHKGDSSVTSLGI 353
           S  +  CLSYA G   APS  CC  V S+    + T     C  ++   +G S     G+
Sbjct: 17  SSAIAPCLSYARGQGSAPSAGCCSGVRSLNSAARTTADAAACNCLKNAARGIS-----GL 71

Query: 354 KEDRLLKLPSECKLA----NASTTNCPKL 428
                  +PS+C ++     +++T+C ++
Sbjct: 72  NAGNAASIPSKCGVSVPYTISTSTDCSRV 100



>gb:AP003803_1833587 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1060_D03.
          Length = 170

 Score = 38.1 bits (87), Expect = 0.21
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 1/67 (1%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGD-SSVTSLGIKEDRL 368
           +++ C+ Y    A AP   CCD   S+  +  +CLC+ I     GD S + S  I   R+
Sbjct: 79  ELLPCVDYLTNDATAPPGACCDGFRSLVGSALICLCHGI----NGDMSRMISRPIDPVRM 134

Query: 369 LKLPSEC 389
           + LP+ C
Sbjct: 135 VLLPAMC 141



>gb:AC146521_1744602 Oryza sativa chromosome 3 B1246D11 genomic
           sequence, complete sequence.
          Length = 178

 Score = 38.1 bits (87), Expect = 0.21
 Identities = 39/128 (30%), Positives = 54/128 (42%), Gaps = 6/128 (4%)
 Frame = +3

Query: 183 ESPKVMDCLSYAIGTADA---PSKKCCDSV-SSIKETDPV-CLCYVIQQVHKGDSSVTSL 347
           E+ K+ DCL Y      A   PSK CC  V  ++K++  V CLC          S    L
Sbjct: 43  EALKLADCLDYVTPGKTAPSRPSKLCCGEVKGALKDSAAVGCLCAAF------TSKTLPL 96

Query: 348 GIKEDRLLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNA-TTSHATSKTPGASPGG 524
            I   R L LP+ C    ++ + C      PA SP  A  T++ +   A +   GA+   
Sbjct: 97  PINITRALHLPAACGADASAFSKC----LAPAPSPSVAPGTSSGSGGAAAAPAKGAAAAR 152

Query: 525 STSQPATA 548
           S     TA
Sbjct: 153 SPMASTTA 160



>gb:AP004134_1838112 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1116_C12.
          Length = 81

 Score = 37.7 bits (86), Expect = 0.27
 Identities = 23/81 (28%), Positives = 39/81 (48%), Gaps = 6/81 (7%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKE--TDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKL 377
           C+ YA G   AP+  CCD V ++     D    C  I+Q   G       G++ D +  +
Sbjct: 5   CIMYATGRVSAPTGGCCDGVRTLNSAAADHQTTCACIKQQTSGMG-----GLRPDLVAGI 59

Query: 378 PSECKL----ANASTTNCPKL 428
           PS+C +    A + +T+C ++
Sbjct: 60  PSKCGVNIPYAISPSTDCSRV 80



>gb:AY045643_1561234 Arabidopsis thaliana At2g48140/F11L15.4 mRNA,
           complete cds.>gb:AY059652_1564564 Arabidopsis thaliana
           At2g48140/F11L15.4 mRNA, complete
           cds.>gb:AY088054_1573078 Arabidopsis thaliana clone 4074
           mRNA, complete sequence.
          Length = 200

 Score = 37.7 bits (86), Expect = 0.27
 Identities = 28/122 (22%), Positives = 49/122 (40%), Gaps = 3/122 (2%)
 Frame = +3

Query: 204 CLSYAIGTADA---PSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLK 374
           CL++  G++     P+  CCDS+ ++  T   C C ++      +  + +  I     L 
Sbjct: 38  CLNFITGSSGGSVTPTAGCCDSLKTLTNTGMGCACLIL----TANVPLPTGFINRTLALA 93

Query: 375 LPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAGG 554
           LP  CK+       C +    P  +P    F  A     ++ +PGAS    T+       
Sbjct: 94  LPRACKMGGV-PIQC-QAAGTPLPAPGQVPFLIAPPPQVSAFSPGASKAAGTTPTQAPAP 151

Query: 555 DS 560
           D+
Sbjct: 152 DT 153



>gb:AP004179_1838583 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1124_G07.>gb:AP005113_1848089 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0685G12.
          Length = 279

 Score = 37.4 bits (85), Expect = 0.35
 Identities = 22/67 (32%), Positives = 31/67 (46%), Gaps = 2/67 (2%)
 Frame = +3

Query: 195 VMDCLSYAIGTA-DAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGD-SSVTSLGIKEDRL 368
           VM C  Y   TA   P   CCD   S+  T P+CLC+ +     GD +S     +   ++
Sbjct: 179 VMPCADYLTNTAVPTPPATCCDGFRSLVSTAPICLCHGM----NGDLNSFLPTPVDPMKM 234

Query: 369 LKLPSEC 389
           + LP  C
Sbjct: 235 MLLPITC 241



>gb:AY057932_1564163 Bromus inermis nonspecific lipid transfer
           protein (BG14) mRNA, complete cds.
          Length = 124

 Score = 37.4 bits (85), Expect = 0.35
 Identities = 25/84 (29%), Positives = 38/84 (45%), Gaps = 9/84 (10%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIK-----ETDPVCLCYVIQQVHKGDSSVTSLGIKEDRL 368
           C++YA G A  P+  CC  V S+        D    C  ++Q   G       GIK D +
Sbjct: 45  CITYATGRAPGPNGGCCSGVRSLNAAASTTADRQATCSCLKQQTSGMG-----GIKPDLV 99

Query: 369 LKLPSECKL----ANASTTNCPKL 428
             +PS+C +    A   +T+C K+
Sbjct: 100 AGIPSKCGVNIPYAIKPSTDCTKV 123



>gb:AF489955_1804665 Physcomitrella patens BIP5 mRNA, partial cds.
          Length = 76

 Score = 36.6 bits (83), Expect = 0.60
 Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 2/70 (2%)
 Frame = +3

Query: 216 AIGTADAPSKKCCDSVSSIKE--TDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPSEC 389
           A+ T  AP+  CC  + ++      P CLC  +       +   S+G+  +   KLP EC
Sbjct: 6   AVTTGTAPTADCCAHIQTVLAGANGPQCLCDALTS-----NLAKSIGVNFELASKLPQEC 60

Query: 390 KLANASTTNC 419
           +L      NC
Sbjct: 61  RLNYIHNYNC 70



>gb:AE016959_1021404 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC104322_1737570
           Oryza sativa chromosome 10 BAC OSJNBb0005F01 genomic
           sequence, complete sequence.>gb:AE017068_1751223 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           22 of 77 of the complete sequence.
          Length = 193

 Score = 36.6 bits (83), Expect = 0.60
 Identities = 16/57 (28%), Positives = 30/57 (52%)
 Frame = +3

Query: 249 CCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPSECKLANASTTNC 419
           CCD++  + ++D  CLC + +        V S  +  D+  ++ + CK+  AS+T C
Sbjct: 65  CCDALGKVFKSDRACLCQIWEMARNDTRQVGSNALDGDQ--QMFARCKIPGASSTIC 119



>gb:AP003766_1833224 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0009H10.>gb:AP005395_1851038 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0623A10.
          Length = 125

 Score = 36.2 bits (82), Expect = 0.78
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 3/95 (3%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLC--YVIQQVHKGDSSVTSLGIKEDR 365
           K++ C  Y  GT D P   CCD +    + +  CLC  Y   ++ K      +  I    
Sbjct: 38  KLVPCAQYMNGT-DTPPAACCDPLKEAVKNELKCLCDLYASPEIFK------AFNINISD 90

Query: 366 LLKLPSECKLANASTTNCP-KLLNLPAGSPDAAIF 467
            L+L + C ++  +T+ CP   L LP+ S    +F
Sbjct: 91  ALRLSTRCGISQ-TTSMCPGNQLILPSSSSFYPLF 124



>gb:AY662492_1620467 Hordeum vulgare subsp. vulgare non-specific
           lipid transfer protein 6 (Ltp6) gene, promoter and
           complete cds.
          Length = 124

 Score = 36.2 bits (82), Expect = 0.78
 Identities = 25/84 (29%), Positives = 37/84 (44%), Gaps = 9/84 (10%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIK-----ETDPVCLCYVIQQVHKGDSSVTSLGIKEDRL 368
           C+ YA+G   AP   CC  V S+        D    C  ++Q   G       GIK D +
Sbjct: 45  CIGYAMGRERAPGGGCCTGVRSLNAAAATPADRQATCTCLKQQTSGMG-----GIKPDLV 99

Query: 369 LKLPSECKL----ANASTTNCPKL 428
             +PS+C +    A +  T+C K+
Sbjct: 100 AGIPSKCGVNIPYAISPRTDCSKV 123



>gb:AK128066_1917026 Homo sapiens cDNA FLJ46186 fis, clone
           TESTI4005013.
          Length = 652

 Score = 35.8 bits (81), Expect = 1.0
 Identities = 26/86 (30%), Positives = 38/86 (44%), Gaps = 6/86 (6%)
 Frame = +1

Query: 457 PPSSLTLQLVTPLRKPPAHLPAAQRHSR-PPLAVTLVGRSSTPRSSPECPCWPLPSPSFS 633
           PP +  +  V P    P  L  +  HS  PP  V L    STPR  P+  C P+  P  +
Sbjct: 420 PPCNTHICSVVPSTPHPCPLSGSLNHSTGPPPIVPLCDTYSTPRGPPQPRCQPVMPPCST 479

Query: 634 GLF-----QVWFELQGDVL*PAVRSY 696
            ++     +  F+ Q   + P VR+Y
Sbjct: 480 HIYSFIPLRTPFDPQSLPIVPRVRAY 505



>gb:AE017351_1759600 Cryptococcus neoformans var. neoformans JEC21
            chromosome 11, complete sequence.
          Length = 968

 Score = 35.8 bits (81), Expect = 1.0
 Identities = 31/86 (36%), Positives = 40/86 (46%), Gaps = 10/86 (11%)
 Frame = +3

Query: 342  SLGIKEDRLLKLPSECKLANASTTNCPKLLNL------PAGS--PDAAIFTNATTSHATS 497
            S+   ED     PS+  LAN S T+  +LL        P+ S  P  + F + T + A S
Sbjct: 829  SVHADEDTDRSEPSQLDLANTSLTDLEQLLRQAFPFTNPSSSSLPSVSSFVSPTAASANS 888

Query: 498  --KTPGASPGGSTSQPATAGGDSGGS 569
               +  AS  GS S P  A G SGGS
Sbjct: 889  APTSGSASAPGSGSGPGPASGVSGGS 914



>gb:AP003843_1834116 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1656_E11.>gb:AP004307_1839952 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0534H07.
          Length = 201

 Score = 35.4 bits (80), Expect = 1.3
 Identities = 32/109 (29%), Positives = 46/109 (42%), Gaps = 4/109 (3%)
 Frame = +3

Query: 234 APSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL--KLPSECKLANAS 407
           AP+ +CC SV+++  T   C C V+       +    LGI  +R L   LP  C  + + 
Sbjct: 67  APTAECCQSVAAMINTSASCACLVL-------TGNVPLGIPINRTLAVTLPKACN-SMSV 118

Query: 408 TTNCPKLLNLP-AGSPDAAIFTNATTSHATSKTPGA-SPGGSTSQPATA 548
              C     +P AG P A              T GA SP  + + PAT+
Sbjct: 119 PLQCKTSAQIPAAGVPVAVSPAMPPLPSPPESTAGAGSPTATATPPATS 167



>gb:AJ843979_1814671 Plantago major mRNA for hypothetical protein.
          Length = 118

 Score = 35.4 bits (80), Expect = 1.3
 Identities = 21/73 (28%), Positives = 36/73 (49%)
 Frame = +3

Query: 183 ESPKVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED 362
           E+ K++ C S A  +    S  CC  V ++   +P CLC V+       ++  S G+K +
Sbjct: 39  EAMKLIPCASAASDSNAPVSSGCCAQVKTLGH-NPKCLCAVMLS-----NTAKSSGVKPE 92

Query: 363 RLLKLPSECKLAN 401
             + +P  C LA+
Sbjct: 93  VAVTIPKRCNLAD 105



>gb:OSJN00010_1693225 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OJ991214_12, complete sequence.
          Length = 123

 Score = 35.4 bits (80), Expect = 1.3
 Identities = 22/71 (30%), Positives = 30/71 (42%), Gaps = 1/71 (1%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSI-KETDPVCLCYVIQQVHKGDSSVTSLGIKEDRL 368
           K+  C   A      P   CC +V  I       CLC V+       S+V   G+K +  
Sbjct: 41  KLAPCAKAAQDPGARPPAACCAAVRDIGTHQSHACLCAVLLS-----STVRRSGVKPEVA 95

Query: 369 LKLPSECKLAN 401
           + +P  CKLAN
Sbjct: 96  ITIPKRCKLAN 106



>pir|S51811|S51811 trypsin inhibitor CMx precursor - wheat
          Length = 146

 Score = 35.4 bits (80), Expect = 1.3
 Identities = 19/56 (33%), Positives = 32/56 (57%)
 Frame = +3

Query: 225 TADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPSECK 392
           +A+   ++CCD +S + E   +C C V++ +   D  VT  G+ +D LL+  S CK
Sbjct: 57  SAERQKRRCCDELSKVPE---LCWCEVLRILM--DRRVTKEGVVKDSLLQDMSRCK 107



>sp|Q43691|IAX2_WHEAT Trypsin/alpha-amylase inhibitor CMX2 precursor
           (ITRL-2).>gb:YACMX2_1727873 T.aestivum Itrl-2 mRNA for
           CMx.
          Length = 121

 Score = 35.4 bits (80), Expect = 1.3
 Identities = 19/56 (33%), Positives = 32/56 (57%)
 Frame = +3

Query: 225 TADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPSECK 392
           +A+   ++CCD +S + E   +C C V++ +   D  VT  G+ +D LL+  S CK
Sbjct: 57  SAERQKRRCCDELSKVPE---LCWCEVLRILM--DRRVTKEGVVKDSLLQDMSRCK 107



>gb:AF206717_2141948 Shuttle vector pI3 hypothetical proteins, HtrU
           (htrU), ArdU (ardU), RepU (repU), and ResU (resU) genes,
           complete cds.
          Length = 153

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 26/64 (40%), Positives = 30/64 (46%), Gaps = 3/64 (4%)
 Frame = +1

Query: 445 ALRTPPSSLT---LQLVTPLRKPPAHLPAAQRHSRPPLAVTLVGRSSTPRSSPECPCWPL 615
           AL TPP  L        TP   PPA        +RPP +  + GRSSTP   P  PC+P 
Sbjct: 28  ALTTPPPLLPPPPCSAYTPT--PPACACFVPLVTRPPTSPPVPGRSSTP--PPPSPCFPR 83

Query: 616 PSPS 627
           P  S
Sbjct: 84  PGRS 87



>gb:PSALB2A_1702042 P.strobus mRNA for albumin 2.
          Length = 171

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 4/64 (6%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQV----HKGDSSVTSLGIKE 359
           ++  C  Y     + PS++CC+    ++   P C C  IQQV    H  DS+   L +  
Sbjct: 59  RLSQCRDYMEMRREQPSERCCE---ELERMSPQCRCRAIQQVLDQSHSYDSTTEDLSMDS 115

Query: 360 DRLL 371
           D  L
Sbjct: 116 DAAL 119



>gb:AY804342_1628659 Capsicum chinense cultivar BG2816 lipid
           transfer protein gene, partial cds.>gb:AY804347_1628664
           Capsicum chinense cultivar Scotch Bonnet lipid transfer
           protein gene, partial cds.
          Length = 70

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVC 293
           CLS+  G+A  P   CC S+S + +++P C
Sbjct: 41  CLSFVTGSAKTPPASCCSSLSGVLQSNPRC 70



>gb:AY804340_1628657 Capsicum chinense cultivar PI152225 lipid
           transfer protein gene, partial cds.>gb:AY804341_1628658
           Capsicum chinense cultivar PI209590 lipid transfer
           protein gene, partial cds.>gb:AY804343_1628660 Capsicum
           chinense cultivar Grif9270 lipid transfer protein gene,
           partial cds.>gb:AY804344_1628661 Capsicum chinense
           cultivar LBV lipid transfer protein gene, partial
           cds.>gb:AY804345_1628662 Capsicum chinense cultivar LER
           lipid transfer protein gene, partial
           cds.>gb:AY804346_1628663 Capsicum annuum cultivar Maor
           lipid transfer protein gene, partial
           cds.>gb:AY804348_1628665 Capsicum chinense cultivar LAL
           lipid transfer protein gene, partial
           cds.>gb:AY804349_1628666 Capsicum chinense cultivar KZA
           lipid transfer protein gene, partial cds.
          Length = 70

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKETDPVC 293
           CLS+  G+A  P   CC S+S + +++P C
Sbjct: 41  CLSFVTGSAKTPPASCCSSLSGVLQSNPRC 70



>gb:AY088619_1573635 Arabidopsis thaliana clone 8450 mRNA, complete
           sequence.
          Length = 177

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 27/96 (28%), Positives = 45/96 (46%), Gaps = 7/96 (7%)
 Frame = +3

Query: 195 VMDCLSYA-IGTADA-PSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED-- 362
           V DC SY  +G+ +  P   CC  ++ + ++ P C+C +      G  +    G+K D  
Sbjct: 48  VSDCFSYVQVGSNEIKPEAACCPELAGMVQSSPECVCNLY-----GGGASPXFGVKLDKQ 102

Query: 363 RLLKLPSECKLANASTTNCPKL---LNLPAGSPDAA 461
           R  +L + C +   S + C  L      PAGS D++
Sbjct: 103 RAEQLSTICGVKAPSPSLCSVLGFPTISPAGSEDSS 138



>pir|D96762|D96762 probable lipid transfer protein F6D5.5 [imported]
           - Arabidopsis thaliana>gb:AE005173_894902 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC012396_1537639 Arabidopsis thaliana
           chromosome 1 BAC T9L24 genomic sequence, complete
           sequence.>gb:AC079676_1732693 Arabidopsis thaliana
           chromosome 1 BAC F6D5 genomic sequence, complete
           sequence.
          Length = 112

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 20/79 (25%), Positives = 31/79 (39%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL 371
           K++ C  Y       P   CC  +  I E D  CLC            + +L + ++  L
Sbjct: 36  KLLPCQPYIHSLNPPPPPSCCGPMKEIVEKDAPCLCIAF----NNPEVLKALNLTKENAL 91

Query: 372 KLPSECKLANASTTNCPKL 428
            LP  C + N   + C K+
Sbjct: 92  LLPKACGV-NPDVSLCSKI 109



>sp|Q43193|NLT1_SORBI Nonspecific lipid-transfer protein 1 precursor
           (LTP 1).>pir|S33459|S33459 lipid transfer protein -
           sorghum>gb:SVLTP1_1723247 S.vulgare ltp1 gene.
          Length = 118

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 9/84 (10%)
 Frame = +3

Query: 204 CLSYAIGTADAPSKKCCDSVSSIKE-----TDPVCLCYVIQQVHKGDSSVTSLGIKEDRL 368
           CLSYA G   APS  CC  V S+        D    C  ++   +G S     G+     
Sbjct: 39  CLSYARGQGFAPSAGCCSGVRSLNSAARTTADRRAACNCLKNAARGIS-----GLNAGNA 93

Query: 369 LKLPSECKLA----NASTTNCPKL 428
             +PS+C ++     +++T+C ++
Sbjct: 94  ASIPSKCGVSVPYTISTSTDCSRV 117



>sp|O04403|NL22_PARJU Probable nonspecific lipid-transfer protein 2
           precursor (LTP 2) (Major pollen allergen Par j 2.0102)
           (Par j II) (P8 protein).>gb:PJP8PROT_1700515 P.judaica
           mRNA for P8 protein.
          Length = 133

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 26/98 (26%), Positives = 42/98 (42%), Gaps = 7/98 (7%)
 Frame = +3

Query: 195 VMDCLSYAIGTADAPSKKCC-------DSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGI 353
           +M CL +  G    PSK CC       + V + ++    C C V     KG S     GI
Sbjct: 42  IMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIV--AATKGIS-----GI 94

Query: 354 KEDRLLKLPSECKLANASTTNCPKLLNLPAGSPDAAIF 467
           K + + ++P +C +   +TT  P   +      ++ IF
Sbjct: 95  KNELVAEVPKKCGI---TTTLPPITADFDCSKIESTIF 129



>sp|P55958|NL21_PARJU Probable nonspecific lipid-transfer protein 2
           precursor (LTP 2) (Major pollen allergen Par j 2.0101)
           (Par j II) (P2 protein).>gb:PJP2PROT_1700514 P.judaica
           mRNA for P2 protein.
          Length = 133

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 7/74 (9%)
 Frame = +3

Query: 195 VMDCLSYAIGTADAPSKKCC-------DSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGI 353
           +M CL +  G    PSK+CC       + V + ++    C C V  +  KG S     GI
Sbjct: 42  IMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIV--RATKGIS-----GI 94

Query: 354 KEDRLLKLPSECKL 395
           K + + ++P +C +
Sbjct: 95  KNELVAEVPKKCDI 108



>gb:AP005828_1858600 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0702F05.>gb:AP007223_1863281 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0046E09.
          Length = 126

 Score = 34.7 bits (78), Expect = 2.3
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 7/72 (9%)
 Frame = +3

Query: 201 DCLSYAIGTADAPSKKCCDSVSSIK-------ETDPVCLCYVIQQVHKGDSSVTSLGIKE 359
           +C +Y  G   A S++CC ++  I+       E   VC C + + +  GD  V S     
Sbjct: 43  ECTAYVAGGEPAVSRRCCRALGDIRDLAATAAERRAVCACILSEMLAAGDGRVDS----- 97

Query: 360 DRLLKLPSECKL 395
            R   LP+ C +
Sbjct: 98  GRAAGLPAACNV 109



>gb:AC005623_1532861 Arabidopsis thaliana chromosome 2 clone T20P8
           map B68, complete sequence.>gb:AK175830_1817818
           Arabidopsis thaliana mRNA for predicted GPI-anchored
           protein, complete cds, clone:
           RAFL22-43-L04.>gb:AK175855_1817843 Arabidopsis thaliana
           mRNA for predicted GPI-anchored protein, complete cds,
           clone: RAFL22-47-M12.>gb:AK175860_1817848 Arabidopsis
           thaliana mRNA for predicted GPI-anchored protein,
           complete cds, clone: RAFL22-48-D12.
          Length = 176

 Score = 34.7 bits (78), Expect = 2.3
 Identities = 27/96 (28%), Positives = 45/96 (46%), Gaps = 7/96 (7%)
 Frame = +3

Query: 195 VMDCLSYA-IGTADA-PSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKED-- 362
           V DC SY  +G+ +  P   CC  ++ + ++ P C+C +      G  +    G+K D  
Sbjct: 47  VSDCFSYVQVGSNEIKPEAACCPELAGMVQSSPECVCNLY-----GGGASPRFGVKLDKQ 101

Query: 363 RLLKLPSECKLANASTTNCPKL---LNLPAGSPDAA 461
           R  +L + C +   S + C  L      PAGS D++
Sbjct: 102 RAEQLSTICGVKAPSPSLCSVLGFPTISPAGSEDSS 137



>gb:AF139114_1244246 Neospora caninum subtilisin-like serine
           protease mRNA, partial cds.
          Length = 865

 Score = 34.7 bits (78), Expect = 2.3
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 1/59 (1%)
 Frame = +1

Query: 454 TPPSSLTLQLVTPLRKPP-AHLPAAQRHSRPPLAVTLVGRSSTPRSSPECPCWPLPSPS 627
           +PP   + ++ +P R P  + LP+A   S PP +       S P +SP  P  P PSPS
Sbjct: 754 SPPEGSSPRVPSPHRHPSRSRLPSAVEPSPPPASPQPSPHPSPPDTSPTKPSTPPPSPS 812



>gb:AB051576_1196276 Hemicentrotus pulcherrimus mRNA for ryanodine
            receptor, complete cds.
          Length = 5317

 Score = 34.7 bits (78), Expect = 2.3
 Identities = 28/103 (27%), Positives = 49/103 (47%), Gaps = 7/103 (6%)
 Frame = +3

Query: 273  KETDPVCLCYVIQQVH-------KGDSSVTSLGIKEDRLLKLPSECKLANASTTNCPKLL 431
            KETD     Y++QQ+H       +  + +T+LG  +  +   PS       S ++ P   
Sbjct: 3728 KETDKEVRDYLLQQLHLHEKEKVEETARLTALGHAQSSISPKPS------VSFSSSPPSS 3781

Query: 432  NLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAGGDS 560
            + PA +P  A  +++ TS  TS +  +S   S+S P++    S
Sbjct: 3782 SSPASAPALATSSSSATS-TTSTSSSSSSSSSSSSPSSPPSSS 3823



>pir|S49915|S49915 extensin-like protein - maize>gb:ZMEXTENS_1731842
            Z.mays (B73) gene for extensin-like protein.
          Length = 1188

 Score = 34.7 bits (78), Expect = 2.3
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 4/60 (6%)
 Frame = +1

Query: 457  PPSSLTLQLVTPL-RKPPAHL---PAAQRHSRPPLAVTLVGRSSTPRSSPECPCWPLPSP 624
            PP+ ++   +TP    PPAH+   P   + S PP   T++   S P+SSP      LP P
Sbjct: 851  PPAPVSSPPLTPKPASPPAHVSSPPEVVKPSTPPAPTTVISPPSEPKSSPPPTPVSLPPP 910



>gb:BC057428_2552076 Danio rerio a disintegrin and metalloproteinase
           domain 8, mRNA (cDNA clone MGC:64059 IMAGE:6794087),
           complete cds.
          Length = 843

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 20/56 (35%), Positives = 26/56 (46%), Gaps = 2/56 (3%)
 Frame = +1

Query: 457 PPSSLTLQLVTPLRKP--PAHLPAAQRHSRPPLAVTLVGRSSTPRSSPECPCWPLP 618
           PPS+++  +  P  KP  PA  P       PPLA   V +S +P   P  P  P P
Sbjct: 768 PPSAISKNIYPPQAKPLLPAAKPLPPSRPLPPLASKAVTKSKSPPVPPVKPSGPQP 823



>gb:AL831745_2504556 Zebrafish DNA sequence from clone CH211-217G15
           in linkage group 13 Contains a novel gene similar to
           ECHS1 (vertebrate mitochondrial enoyl Coenzyme A
           hydratase 1), four novel genes, the msxc gene for muscle
           segment homeobox protein C and a novel gene for a
           protein similar to reprolysin zinc metalloproteases,
           complete sequence.
          Length = 697

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 20/56 (35%), Positives = 26/56 (46%), Gaps = 2/56 (3%)
 Frame = +1

Query: 457 PPSSLTLQLVTPLRKP--PAHLPAAQRHSRPPLAVTLVGRSSTPRSSPECPCWPLP 618
           PPS+++  +  P  KP  PA  P       PPLA   V +S +P   P  P  P P
Sbjct: 622 PPSAISKNIYPPQAKPLLPAAKPLPPSRPLPPLASKAVTKSKSPPVPPVKPSGPQP 677



>gb:HSA298317_2003038 Homo sapiens partial mRNA for mucin 5 (MUC5AC
            gene).
          Length = 2448

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 2/55 (3%)
 Frame = +3

Query: 381  SECKLANASTTNCP--KLLNLPAGSPDAAIFTNATTSHATSKTPGASPGGSTSQP 539
            S    A  ST + P     ++P  +P + + T +TTS  T++T  ASP G+TS P
Sbjct: 2315 STTSAATTSTISAPTTSTTSVPGTTP-SPVLTTSTTSAPTTRTTSASPAGTTSGP 2368



>gb:AJ784896_1814011 Triticum aestivum mRNA for type 1 non-specific
           lipid transfer protein precursor (ltp9.5 gene).
          Length = 115

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 25/89 (28%), Positives = 36/89 (40%), Gaps = 11/89 (12%)
 Frame = +3

Query: 195 VMDCLSYAIGTADAPSKKCCDSVSSI--KETDP-----VCLCYVIQQVHKGDSSVTSLGI 353
           V  C+SYA G A APS  CC  V ++  K + P      C C           ++   GI
Sbjct: 35  VAPCMSYASGKASAPSGACCSGVRTLNAKASTPADRKAACNCL---------KNLAGSGI 85

Query: 354 KEDRLLKLPSEC----KLANASTTNCPKL 428
                  +P +C     +  ++ TNC  L
Sbjct: 86  SMGNAASIPGKCGVSVSIPISTKTNCNNL 114



>gb:AB047806_1520666 Arabidopsis thaliana YLS3 mRNA for non-specific
           lipid transfer protein (nLTP) like protein, partial cds.
          Length = 94

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 6/56 (10%)
 Frame = +3

Query: 417 CPKLLNLPAGSPDAAIF------TNATTSHATSKTPGASPGGSTSQPATAGGDSGG 566
           CP LL+L   SPDA +F       N T S +      + P   +S P ++ G++ G
Sbjct: 2   CPALLHLDPNSPDAQVFYQLAKGLNETVSASAPTGSASEPTSMSSTPGSSAGNNSG 57



>gb:AF225924_1252658 Drosophila virilis staufen gene, complete cds.
          Length = 1062

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 20/78 (25%), Positives = 36/78 (46%)
 Frame = +3

Query: 333  SVTSLGIKEDRLLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHATSKTPGA 512
            ++ +  + E +  +  S    +NA        LN   GS  + + +N++ + A+S    A
Sbjct: 894  AIITATVTEGKSSRNSSSNNESNAHEAANESSLNTSTGSNTSGVSSNSSNAPASSSGNNA 953

Query: 513  SPGGSTSQPATAGGDSGG 566
            S GG  S  +  GG +GG
Sbjct: 954  SGGGDGSSSSAGGGSAGG 971



>pir|T34434|T34434 hypothetical protein K06A9.1a - Caenorhabditis
            elegans>gb:U80846_1406495 Caenorhabditis elegans cosmid
            K06A9, complete sequence.
          Length = 2232

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 28/85 (32%), Positives = 43/85 (50%), Gaps = 3/85 (3%)
 Frame = +3

Query: 324  GDSSVTSLGIKEDRLLKLPSECKLANASTTNCPKLLNLPAGS--PDAAIFTNATTSHATS 497
            G SS TSL         +PS  +  N ST+        P+ S  P  +  T   TSH ++
Sbjct: 1245 GSSSATSLSSSSP----VPSTSQSPNPSTSGSSTPTPNPSQSTSPVVSTTTGEMTSHGST 1300

Query: 498  KTPGASPGGSTSQPAT-AGGDSGGS 569
            +TP ++ G + +QP+T +G +S GS
Sbjct: 1301 QTP-STIGSTVTQPSTVSGSNSSGS 1324



>pir|E81463|T02857 conserved hypothetical protein L3162.1 [imported] -
            Leishmania major (strain Friedlin)>gb:AE001274_1208538
            Leishmania major chromosome 1, complete sequence.
          Length = 2241

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 28/87 (32%), Positives = 41/87 (47%), Gaps = 4/87 (4%)
 Frame = +3

Query: 306  IQQVHKGDSSVTSLGIKEDRLLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTS 485
            I  VH+ DSSVT  G  +     L S+ +       + P+   LP GSP A   T+A+ S
Sbjct: 901  IPVVHRVDSSVTYDGQVDRHGASLGSQPQQQGNPRVSSPRSFVLPPGSPPAQPSTSASAS 960

Query: 486  ----HATSKTPGASPGGSTSQPATAGG 554
                 ATS + G +  G +S  ++  G
Sbjct: 961  PLLGPATSVSSGEAGVGDSSTDSSGRG 987



>gb:AJ784901_1814016 Triticum aestivum mRNA for type 1 non-specific
           lipid transfer protein precursor (ltp9.2 gene).
          Length = 115

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 23/86 (26%), Positives = 38/86 (44%), Gaps = 5/86 (5%)
 Frame = +3

Query: 186 SPKVMDCLSYAIGTADAPSKKCCDSVSSIKET-----DPVCLCYVIQQVHKGDSSVTSLG 350
           S  +  C+SYA G   +PS  CC  V S+  +     D    C  I+    G ++  + G
Sbjct: 33  SSALSPCISYARGNGASPSAACCSGVRSLASSARSTADKQAACKCIKSAAAGLNAGKAAG 92

Query: 351 IKEDRLLKLPSECKLANASTTNCPKL 428
           I     + +P     A +S+ +C K+
Sbjct: 93  IPTKCGVSIP----YAISSSVDCSKI 114



>gb:AJ784897_1814012 Triticum aestivum mRNA for type 1 non-specific
           lipid transfer protein precursor (ltp9.6 gene).
          Length = 129

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 25/88 (28%), Positives = 40/88 (45%), Gaps = 10/88 (11%)
 Frame = +3

Query: 195 VMDCLSYAIGT-ADAPSKKCCDSVSSIKETDPV-----CLCYVIQQVHKGDSSVTSLGIK 356
           ++ C S+ +G  A APS+ CC     ++           LC  ++Q      S  S G+ 
Sbjct: 47  LIPCGSFLVGAVAGAPSESCCRGAQGLRRMAGTPGARRALCRCLEQ------SGPSFGVL 100

Query: 357 EDRLLKLPSECKLA----NASTTNCPKL 428
            DR  +LP+ CKL      +  T+C K+
Sbjct: 101 PDRARQLPALCKLGISIPVSPHTDCDKI 128



>gb:CR380956_1652091 Candida glabrata strain CBS138 chromosome J
           complete sequence.
          Length = 895

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 17/43 (39%), Positives = 19/43 (44%)
 Frame = +3

Query: 441 AGSPDAAIFTNATTSHATSKTPGASPGGSTSQPATAGGDSGGS 569
           AG P AA    A      +  PGA  GG + QP    GD  GS
Sbjct: 603 AGQPGAAGQPGAAGQPGAAGQPGAGSGGGSEQPTPGAGDGSGS 645



>gb:BT002886_1636477 Arabidopsis thaliana clone RAFL15-05-B21
           (R20382) unknown protein (At5g48490) mRNA, partial cds.
          Length = 100

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 20/59 (33%), Positives = 27/59 (45%)
 Frame = +3

Query: 234 APSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPSECKLANAST 410
           +PS  CC++   +K  D  CLC      +K    + S G+       LP EC L NA T
Sbjct: 49  SPSLLCCNA---LKHADYTCLCG-----YKNSPWLGSFGVDPKLASSLPKECDLTNAPT 99



>gb:AY098530_1576447 Ananas comosus PVR3-like protein mRNA, partial
           cds.
          Length = 112

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 21/61 (34%), Positives = 32/61 (52%)
 Frame = +3

Query: 237 PSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPSECKLANASTTN 416
           PSK+CC +++     D  CLC      ++    + SLGI  D  L+LP++C L   +T  
Sbjct: 62  PSKECCAALAG---ADLPCLCS-----YRHSFLLPSLGIDPDLALQLPAKCNL--TATPG 111

Query: 417 C 419
           C
Sbjct: 112 C 112



>gb:AB020745_1514604 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MJE7.>gb:AY087218_1572252 Arabidopsis thaliana
           clone 32925 mRNA, complete sequence.
          Length = 101

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 20/59 (33%), Positives = 27/59 (45%)
 Frame = +3

Query: 234 APSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPSECKLANAST 410
           +PS  CC++   +K  D  CLC      +K    + S G+       LP EC L NA T
Sbjct: 50  SPSLLCCNA---LKHADYTCLCG-----YKNSPWLGSFGVDPKLASSLPKECDLTNAPT 100



>gb:AE005173_893947 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC007190_1535516 Genomic sequence
           for Arabidopsis thaliana BAC F23N19 from chromosome I,
           complete sequence.
          Length = 114

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 16/68 (23%), Positives = 30/68 (44%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL 371
           K++ C +  + T   P K+CCDS+    E +  CLC     ++     +    +  ++ L
Sbjct: 32  KLVPCFN-DLNTTTTPVKECCDSIKEAVEKELTCLC----TIYTSPGLLAQFNVTTEKAL 86

Query: 372 KLPSECKL 395
            L   C +
Sbjct: 87  GLSRRCNV 94



>pir|D96725|D96725 hypothetical protein F20P5.4 [imported] -
           Arabidopsis thaliana>gb:AE005173_894606 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:F20P5_1677758 Sequence of BAC F20P5 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 104

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 22/82 (26%), Positives = 34/82 (41%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL 371
           K++ C  + + T   PS  CC+S+    E D  CLC     ++     +    I  D+ L
Sbjct: 21  KIVPCFRF-LNTTTKPSTDCCNSIKEAMEKDFSCLC----TIYNTPGLLAQFNITTDQAL 75

Query: 372 KLPSECKLANASTTNCPKLLNL 437
            L   C + N   + C   L L
Sbjct: 76  GLNLRCGV-NTDLSACSGTLIL 96



>sp|P59644|P5PA_MOUSE Phosphatidylinositol 4,5-bisphosphate
           5-phosphatase A (EC 3.1.3.56).>gb:AK034272_1163699 Mus
           musculus adult male diencephalon cDNA, RIKEN full-length
           enriched library, clone:9330171B07 product:PROLINE-RICH
           INOSITOL POLYPHOSPHATE 5-PHOSPHATASE homolog [Rattus
           norvegicus], full insert sequence.
          Length = 1003

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 20/55 (36%), Positives = 23/55 (41%)
 Frame = +1

Query: 454 TPPSSLTLQLVTPLRKPPAHLPAAQRHSRPPLAVTLVGRSSTPRSSPECPCWPLP 618
           TPP+   L        P    P AQ  S P L+ +   R   PR SPE P  P P
Sbjct: 247 TPPADKCLYTPERAAGPATSPPRAQAFSDPRLSPSFRARPEAPRHSPEDPVLPPP 301



>sp|O65888|NLTP_STRHE Nonspecific lipid-transfer protein precursor
           (LTP) (Fragment).>gb:SHY16247_1715148 Striga hermonthica
           mRNA for non-specific lipid transfer protein.
          Length = 118

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 6/74 (8%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSIKET-----DPVCLCYVIQQVHKGDSSVTSLGIK 356
           K   C+S+A G    PS  CC  +  + +T     D   +C  ++   K  S V      
Sbjct: 16  KAASCISFATGKDKKPSAACCSGLHPLAQTVKTVEDNKAICRCLKTAIKNFSRV------ 69

Query: 357 EDRLL-KLPSECKL 395
           +DR L ++P+ CK+
Sbjct: 70  QDRFLGQIPTPCKI 83



>gb:BC090085_2566316 Xenopus tropicalis cDNA clone MGC:97528
           IMAGE:5382658, complete cds.
          Length = 311

 Score = 33.5 bits (75), Expect = 5.1
 Identities = 23/67 (34%), Positives = 33/67 (49%)
 Frame = +1

Query: 421 LNC*TFRRALRTPPSSLTLQLVTPLRKPPAHLPAAQRHSRPPLAVTLVGRSSTPRSSPEC 600
           +N   ++RA   PPSSL L+++ P  K PA+   A R + PP   + +     P      
Sbjct: 88  INLIAYQRACHYPPSSLDLRVLAPF-KLPAYEEVACRPTTPPPPYSSILNPFGP------ 140

Query: 601 PCWPLPS 621
           PC P PS
Sbjct: 141 PCSPPPS 147



>gb:AP004398_1841187 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC
           clone:P0438G07.>gb:AP005674_1855779 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:B1126F07.
          Length = 104

 Score = 33.5 bits (75), Expect = 5.1
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 4/60 (6%)
 Frame = +3

Query: 228 ADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSS----VTSLGIKEDRLLKLPSECKL 395
           AD PS +CCD++++    D  CLC      +KG +     V   GI  +R + LP +C L
Sbjct: 47  ADTPSSECCDALAA---ADLPCLCR-----YKGSAGARVWVRFYGIDLNRAMTLPGKCGL 98



>gb:AJ784903_1814018 Triticum turgidum subsp. durum partial mRNA for
           type 1 non-specific lipid transfer protein precursor
           (ltp9.2 gene).
          Length = 103

 Score = 33.5 bits (75), Expect = 5.1
 Identities = 23/86 (26%), Positives = 38/86 (44%), Gaps = 5/86 (5%)
 Frame = +3

Query: 186 SPKVMDCLSYAIGTADAPSKKCCDSVSSIKET-----DPVCLCYVIQQVHKGDSSVTSLG 350
           S  +  C+SYA G   +PS  CC  V S+  +     D    C  I+    G ++  + G
Sbjct: 21  SSALSPCISYARGNGASPSAACCSGVRSLASSARSTADKQAACKCIKSAAAGLNAGKAAG 80

Query: 351 IKEDRLLKLPSECKLANASTTNCPKL 428
           I     + +P     A +S+ +C K+
Sbjct: 81  IPTKCGVSVP----YAISSSVDCSKI 102



>gb:AC084282_1733414 Oryza sativa chromosome 3 BAC OSJNBb0048A17
           genomic sequence, complete sequence.
          Length = 306

 Score = 33.5 bits (75), Expect = 5.1
 Identities = 24/63 (38%), Positives = 28/63 (44%), Gaps = 2/63 (3%)
 Frame = +1

Query: 442 RALRTPPSSLTLQLVTPLRKPPAHLP--AAQRHSRPPLAVTLVGRSSTPRSSPECPCWPL 615
           R  R PPSS       PLR PP   P  AA   S PP +  +   +S P S+P  P  P 
Sbjct: 180 RLRRRPPSSSG-----PLRHPPLAPPPRAAVLTSPPPRSSAVSASASVPTSTPSAPSSPT 234

Query: 616 PSP 624
             P
Sbjct: 235 ARP 237



>gb:AC012396_1537640 Arabidopsis thaliana chromosome 1 BAC T9L24
           genomic sequence, complete sequence.
          Length = 134

 Score = 33.5 bits (75), Expect = 5.1
 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 1/91 (1%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL 371
           K+M C  Y I  +  P   CC+ +  I E D  CLC       K    +  L + ++  +
Sbjct: 38  KLMPCQPY-IHLSIPPPPLCCNPMKQIAEKDVSCLC----TAFKHPDLLRFLALTKENAI 92

Query: 372 KLPSECKLANASTTNCPKL-LNLPAGSPDAA 461
           K+   C + N   + C K   + PA  P+AA
Sbjct: 93  KILDSCGI-NHDPSVCNKTNPSSPAALPEAA 122



>gb:AX155027_1462752 Sequence 73 from Patent WO0138484.
          Length = 119

 Score = 33.5 bits (75), Expect = 5.1
 Identities = 21/71 (29%), Positives = 29/71 (40%), Gaps = 5/71 (7%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSIKET-----DPVCLCYVIQQVHKGDSSVTSLGIK 356
           K+M CL Y   T  A    CC  V+++        D    C  ++  +   S     GIK
Sbjct: 36  KIMPCLGYLRSTGGAVPPACCTGVTALNAAAQTTPDRKIACGCLKSAYASYS-----GIK 90

Query: 357 EDRLLKLPSEC 389
            D  L LP +C
Sbjct: 91  PDNALVLPGKC 101



>gb:AE017232_412349 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 6 of 16 of the complete
           genome.>gb:AE016958_1055753 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 153

 Score = 33.5 bits (75), Expect = 5.1
 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 2/43 (4%)
 Frame = +3

Query: 444 GSPDAAIFTNATTSHATSKTPGASPGGSTSQPA--TAGGDSGG 566
           G P     T  TT+ +TS  P  +PGG  + P   T GG  GG
Sbjct: 30  GGPSTTSTTTPTTTPSTSVVPSTTPGGGGTVPGGPTGGGGPGG 72



>pir|C96762|C96762 hypothetical protein F6D5.6 [imported] -
           Arabidopsis thaliana>gb:AE005173_894901 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC079676_1732694 Arabidopsis thaliana
           chromosome 1 BAC F6D5 genomic sequence, complete
           sequence.
          Length = 124

 Score = 33.5 bits (75), Expect = 5.1
 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 1/91 (1%)
 Frame = +3

Query: 192 KVMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLL 371
           K+M C  Y I  +  P   CC+ +  I E D  CLC       K    +  L + ++  +
Sbjct: 38  KLMPCQPY-IHLSIPPPPLCCNPMKQIAEKDVSCLC----TAFKHPDLLRFLALTKENAI 92

Query: 372 KLPSECKLANASTTNCPKL-LNLPAGSPDAA 461
           K+   C + N   + C K   + PA  P+AA
Sbjct: 93  KILDSCGI-NHDPSVCNKTNPSSPAALPEAA 122



>sp|Q43194|NLT2_SORBI Nonspecific lipid-transfer protein 2 precursor
           (LTP 2).>pir|S33461|S33461 lipid transfer protein -
           sorghum>gb:SVLTP2_1723248 S.vulgare ltp2 gene.
          Length = 122

 Score = 33.5 bits (75), Expect = 5.1
 Identities = 22/90 (24%), Positives = 39/90 (43%), Gaps = 9/90 (10%)
 Frame = +3

Query: 186 SPKVMDCLSYAIGTADAPSKKCCDSVSSIKE-----TDPVCLCYVIQQVHKGDSSVTSLG 350
           S  +  CLSYA G    PS  CC  V S+        D    C  ++   +G       G
Sbjct: 37  SSAIGPCLSYARGQGSGPSAGCCSGVRSLNSAARTTADRRAACNCLKNAARG-----IRG 91

Query: 351 IKEDRLLKLPSECKLA----NASTTNCPKL 428
           +   +   +PS+C ++     +++T+C ++
Sbjct: 92  LNVGKAASIPSKCGVSIPYTISTSTDCSRV 121



>gb:AY160969_2516132 Xenopus tropicalis homeodomain transcription
           factor (Hex) mRNA, complete cds.
          Length = 274

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 22/58 (37%), Positives = 26/58 (44%)
 Frame = +1

Query: 460 PSSLTLQLVTPLRKPPAHLPAAQRHSRPPLAVTLVGRSSTPRSSPECPCWPLPSPSFS 633
           PSS  L L  PL  P    P    H  P     ++GRSS    +P  P   LPSP+ S
Sbjct: 6   PSSSALGLSVPLYAPTPLQPV---HPTPFYIDDILGRSSASNGTPALPTPTLPSPNSS 60



>gb:AK000226_1907768 Homo sapiens cDNA FLJ20219 fis, clone COLF3371.
          Length = 651

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 17/34 (50%), Positives = 19/34 (55%), Gaps = 3/34 (8%)
 Frame = +3

Query: 468 TNATTSHATSKTPGASPGGSTS---QPATAGGDS 560
           +  T    TS TPG SPG   S   QPAT GGD+
Sbjct: 340 SGTTLRPPTSSTPGGSPGAENSTSHQPATPGGDT 373



>gb:AF301909_1895775 Homo sapiens mu-protocadherin mRNA, complete
           cds.
          Length = 845

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 17/34 (50%), Positives = 19/34 (55%), Gaps = 3/34 (8%)
 Frame = +3

Query: 468 TNATTSHATSKTPGASPGGSTS---QPATAGGDS 560
           +  T    TS TPG SPG   S   QPAT GGD+
Sbjct: 506 SGTTLRPPTSSTPGGSPGAENSTSHQPATPGGDT 539



>gb:AF258674_1893389 Homo sapiens MUCDHL (MUCDHL) gene, complete
           cds, alternatively spliced.
          Length = 845

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 17/34 (50%), Positives = 19/34 (55%), Gaps = 3/34 (8%)
 Frame = +3

Query: 468 TNATTSHATSKTPGASPGGSTS---QPATAGGDS 560
           +  T    TS TPG SPG   S   QPAT GGD+
Sbjct: 506 SGTTLRPPTSSTPGGSPGAENSTSHQPATPGGDT 539



>gb:AY133874_1581694 Arabidopsis thaliana clone U18540 unknown
           protein (At2g45005) mRNA, complete cds.
          Length = 739

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 15/36 (41%), Positives = 23/36 (63%)
 Frame = +3

Query: 438 PAGSPDAAIFTNATTSHATSKTPGASPGGSTSQPAT 545
           PA S   A+F+ ATT+  +S TP A+   ++S PA+
Sbjct: 384 PASSTSGAVFSIATTTTTSSSTPAATSAPASSAPAS 419



>sp|P19656|NLTP_MAIZE Nonspecific lipid-transfer protein precursor
           (LTP) (Phospholipid transfer protein) (PLTP) (Allergen
           Zea m 14).>pir|A31779|A31779 phospholipid transfer
           protein 9C2 precursor - maize>gb:MZEPLTP_1688014 Maize
           phospholipid transfer protein mRNA, complete cds. of
           clone 9C2.
          Length = 120

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 21/87 (24%), Positives = 37/87 (42%), Gaps = 9/87 (10%)
 Frame = +3

Query: 195 VMDCLSYAIGTADAPSKKCCDSVSSIKE-----TDPVCLCYVIQQVHKGDSSVTSLGIKE 359
           +  C+SYA G    PS  CC  V S+        D    C  ++    G S     G+  
Sbjct: 38  IAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS-----GLNA 92

Query: 360 DRLLKLPSECKLA----NASTTNCPKL 428
                +PS+C ++     +++T+C ++
Sbjct: 93  GNAASIPSKCGVSIPYTISTSTDCSRV 119



>sp|Q9HBB8|MCDL_HUMAN Mucin and cadherin-like protein precursor
           (Mu-protocadherin)
           (UNQ2781/PRO7168).>gb:AF258676_1893391 Homo sapiens
           MUCDHL-FL (MUCDHL) mRNA, complete cds, alternatively
           spliced.
          Length = 845

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 17/34 (50%), Positives = 19/34 (55%), Gaps = 3/34 (8%)
 Frame = +3

Query: 468 TNATTSHATSKTPGASPGGSTS---QPATAGGDS 560
           +  T    TS TPG SPG   S   QPAT GGD+
Sbjct: 506 SGTTLRPPTSSTPGGSPGAENSTSHQPATPGGDT 539



>sp|O18868|KCB1_PIG Potassium voltage-gated channel subfamily B
           member 1 (Voltage-gated potassium channel subunit Kv2.1)
           (DRK1).>gb:AF026006_1411937 Sus scrofa delayed rectifier
           potassium channel Kv2.1 (DRK1) mRNA, complete cds.
          Length = 858

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 29/92 (31%), Positives = 45/92 (48%), Gaps = 2/92 (2%)
 Frame = +3

Query: 264 SSIKETDPVCLCYVIQQVHKGDSS--VTSLGIKEDRLLKLPSECKLANASTTNCPKLLNL 437
           SS+K T+P+ L  +     +GD S  V  LG+  D L         A  +   C  LL+ 
Sbjct: 659 SSMKTTNPLKLRALKVNFMEGDPSPLVPVLGMYHDPLRNRGGAA--AAVAGLECATLLDR 716

Query: 438 PAGSPDAAIFTNATTSHATSKTPGASPGGSTS 533
           P  SP+++I+T      A+++TP  SP   T+
Sbjct: 717 PVLSPESSIYTT-----ASARTPPRSPEKHTA 743



>sp|Q99074|HA34_BRELC HAM34 protein.>gb:BMHAM34_1633242 Bremia
           lactucae ham34 gene.
          Length = 173

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 3/47 (6%)
 Frame = +3

Query: 438 PAGSPDAAIFTN--ATTSHATSKTPGASPG-GSTSQPATAGGDSGGS 569
           PA +PD A  T   A T+  T+ TP A  G  ST Q  TAG ++ G+
Sbjct: 24  PATTPDTATATTPAAATTTTTTTTPAADAGTASTEQTTTAGPEAAGA 70



>gb:AE017342_1755102 Cryptococcus neoformans var. neoformans JEC21
           chromosome 2, complete sequence.
          Length = 488

 Score = 32.7 bits (73), Expect = 8.7
 Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 1/70 (1%)
 Frame = +1

Query: 460 PSSLTLQLVTPLRKP-PAHLPAAQRHSRPPLAVTLVGRSSTPRSSPECPCWPLPSPSFSG 636
           P  L+L   +P   P PA    A R    PLA+ L+  S+ P S+P       PSP+ + 
Sbjct: 145 PGPLSLLFPSPSPPPSPAPQTNAIRMPSHPLALALIAHSNLPLSAPSANSSGRPSPTKAQ 204

Query: 637 LFQVWFELQG 666
              VW +L G
Sbjct: 205 --HVWNDLNG 212



>gb:MZEPLTPA_1688015 Maize phospholipid transfer protein mRNA, 3'
           end.
          Length = 99

 Score = 32.7 bits (73), Expect = 8.7
 Identities = 21/86 (24%), Positives = 36/86 (41%), Gaps = 9/86 (10%)
 Frame = +3

Query: 195 VMDCLSYAIGTADAPSKKCCDSVSSIKE-----TDPVCLCYVIQQVHKGDSSVTSLGIKE 359
           +  C+SYA G    PS  CC  V S+        D    C  ++    G S     G+  
Sbjct: 9   IAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS-----GLNA 63

Query: 360 DRLLKLPSECKLA----NASTTNCPK 425
                +PS+C ++     +++T+C +
Sbjct: 64  GNAASIPSKCGVSIPYTISTSTDCSR 89



>gb:AY450929_1606692 Chlamydomonas reinhardtii minus agglutinin (SAD1)
            gene, complete cds.
          Length = 3889

 Score = 32.7 bits (73), Expect = 8.7
 Identities = 19/61 (31%), Positives = 25/61 (40%)
 Frame = +1

Query: 448  LRTPPSSLTLQLVTPLRKPPAHLPAAQRHSRPPLAVTLVGRSSTPRSSPECPCWPLPSPS 627
            L+  P   + Q  +P   PP   P+      PP    L      P  +P+ P  PLPSP 
Sbjct: 1408 LQPSPDPPSPQPPSPAPGPPPSPPSPPSTPSPPSPAPLAPAPPVPPMAPQPPSPPLPSPP 1467

Query: 628  F 630
            F
Sbjct: 1468 F 1468



>gb:AY850310_1180280 Magnaporthe grisea hypothetical protein mRNA,
           complete cds.
          Length = 367

 Score = 32.7 bits (73), Expect = 8.7
 Identities = 24/78 (30%), Positives = 34/78 (43%)
 Frame = +3

Query: 312 QVHKGDSSVTSLGIKEDRLLKLPSECKLANASTTNCPKLLNLPAGSPDAAIFTNATTSHA 491
           +V KGD    S    ++     PS  K +N + T              + + T+AT    
Sbjct: 270 KVIKGDGKDNSSKDGDNNTTTSPSSTKASNGTATG------------PSTMATSATRPSN 317

Query: 492 TSKTPGASPGGSTSQPAT 545
           TS T G+S  GSTS PA+
Sbjct: 318 TSATGGSSTNGSTSTPAS 335



>gb:AE014297_1138556 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003680_1220549 Drosophila melanogaster
           chromosome 3R, section 18 of 118 of the complete
           sequence.
          Length = 1167

 Score = 32.7 bits (73), Expect = 8.7
 Identities = 21/66 (31%), Positives = 28/66 (42%)
 Frame = -3

Query: 556 SPPAVAGCDVEPPGDAPGVFEXXXXXXXXVKMAASGEPAGRFNSLGQLVVLALASLHSDG 377
           +P A A   VEPPG AP + +            ASG  AG   S         AS++ D 
Sbjct: 57  TPSAAASATVEPPGSAPSLTKRKLSAVASSGSTASGGSAGSGGSGSS----RCASVNGDA 112

Query: 376 SLSNRS 359
           +  +RS
Sbjct: 113 NCDSRS 118



>gb:AE014298_1125167 Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE003485_1212176 Drosophila melanogaster
            chromosome X, section 37 of 74 of the complete sequence.
          Length = 3539

 Score = 32.7 bits (73), Expect = 8.7
 Identities = 22/60 (36%), Positives = 29/60 (48%), Gaps = 2/60 (3%)
 Frame = +1

Query: 451  RTPPSSLTLQLVTPLRKPPAHLPAAQRHSRPPLAVTL--VGRSSTPRSSPECPCWPLPSP 624
            RTP  +   Q+  P  KPPA L A +++  PPL  TL     +S P      P  P+P P
Sbjct: 1325 RTPTKAAAKQMGAPPPKPPASLAALKQY--PPLEATLPVPPTNSAPPVPVAVPLVPVPVP 1382



>gb:AE005172_889569 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC005106_1532180 Genomic sequence
           for Arabidopsis thaliana BAC T25N20 from chromosome I,
           complete sequence.
          Length = 233

 Score = 32.7 bits (73), Expect = 8.7
 Identities = 17/65 (26%), Positives = 26/65 (40%)
 Frame = +3

Query: 195 VMDCLSYAIGTADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLK 374
           V  C S+  G    P+  CC ++ S+  T   CLC ++           S+ I     + 
Sbjct: 41  VTGCTSFLTGGGSFPTSDCCGALKSLTGTGMDCLCLIVTA-----GVPISIPINRTLAIS 95

Query: 375 LPSEC 389
           LP  C
Sbjct: 96  LPRAC 100



>pir|S51810|S51810 trypsin inhibitor CMx precursor (clones pCMx1 and
           pCMx3) - wheat
          Length = 146

 Score = 32.7 bits (73), Expect = 8.7
 Identities = 18/56 (32%), Positives = 31/56 (55%)
 Frame = +3

Query: 225 TADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPSECK 392
           +A+   ++CCD +S + E   +C C V++ +   D  VT  G+ +  LL+  S CK
Sbjct: 57  SAERQKRRCCDELSKVPE---LCWCEVLRILM--DRRVTKEGVVKGSLLQDMSRCK 107



>pir|S45635|S45635 lipid-transfer protein - maize
          Length = 94

 Score = 32.7 bits (73), Expect = 8.7
 Identities = 21/88 (23%), Positives = 37/88 (42%), Gaps = 10/88 (11%)
 Frame = +3

Query: 195 VMDCLSYAIGTADAPSKKCCDSVSSIKET------DPVCLCYVIQQVHKGDSSVTSLGIK 356
           +  C+SYA G    PS  CC  V S+         D    C  ++    G S     G+ 
Sbjct: 11  IAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADDRRAACNCLKNAAAGVS-----GLN 65

Query: 357 EDRLLKLPSECKLA----NASTTNCPKL 428
                 +PS+C ++     +++T+C ++
Sbjct: 66  AGNAASIPSKCGVSIPYTISTSTDCSRV 93



>pir|JH0379|JH0379 phospholipid transfer protein 6B6 - maize
           (fragment)
          Length = 99

 Score = 32.7 bits (73), Expect = 8.7
 Identities = 21/86 (24%), Positives = 36/86 (41%), Gaps = 9/86 (10%)
 Frame = +3

Query: 195 VMDCLSYAIGTADAPSKKCCDSVSSIKE-----TDPVCLCYVIQQVHKGDSSVTSLGIKE 359
           +  C+SYA G    PS  CC  V S+        D    C  ++    G S     G+  
Sbjct: 9   IAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS-----GLNA 63

Query: 360 DRLLKLPSECKLA----NASTTNCPK 425
                +PS+C ++     +++T+C +
Sbjct: 64  GNAASIPSKCGVSIPYTISTSTDCSR 89



>sp|Q43723|IAX1_WHEAT Trypsin/alpha-amylase inhibitor CMX1/CMX3
           precursor (ITRL-1/ITRL-3).>gb:TACMX1_1724250 T.aestivum
           Itrl-1 mRNA for CMx.>gb:TACMX3_1724251 T.aestivum Itrl-3
           mRNA for CMx.
          Length = 121

 Score = 32.7 bits (73), Expect = 8.7
 Identities = 18/56 (32%), Positives = 31/56 (55%)
 Frame = +3

Query: 225 TADAPSKKCCDSVSSIKETDPVCLCYVIQQVHKGDSSVTSLGIKEDRLLKLPSECK 392
           +A+   ++CCD +S + E   +C C V++ +   D  VT  G+ +  LL+  S CK
Sbjct: 57  SAERQKRRCCDELSKVPE---LCWCEVLRILM--DRRVTKEGVVKGSLLQDMSRCK 107



>sp|Q837V3|GATA_ENTFA Glutamyl-tRNA(Gln) amidotransferase subunit A
           (EC 6.3.5.-) (Glu-ADT subunit A).>gb:AE016949_364806
           Enterococcus faecalis V583, section 3 of 11 of the
           complete genome.>gb:AE016830_991294 Enterococcus
           faecalis V583, complete genome.
          Length = 489

 Score = 32.7 bits (73), Expect = 8.7
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 6/50 (12%)
 Frame = +3

Query: 444 GSPDAAIFTNATTSHATSKTPGASPGGSTSQ------PATAGGDSGGSFK 575
           GS + + F     +   +K PG S GGS S       P + G D+GGS +
Sbjct: 130 GSTETSYFKKTKNAWDQTKVPGGSSGGSASAVAAGQVPVSLGSDTGGSIR 179


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 667,548,448
Number of Sequences: 1806583
Number of extensions: 12573545
Number of successful extensions: 55282
Number of sequences better than 10.0: 147
Number of HSP's better than 10.0 without gapping: 46978
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 54576
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 55395072964
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)