BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig451
         (830 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF181683_1774861 Arabidopsis thaliana RPT2 (RPT2) mRNA, compl...   315   7e-85   
gb:AY035063_1559836 Arabidopsis thaliana unknown protein (At2g30...   315   7e-85   
gb:AK175297_1817285 Arabidopsis thaliana mRNA, complete cds, clo...   257   2e-67   
pir|D84709|D84709 hypothetical protein At2g30520 [imported] - Ar...   237   2e-61   Arabidopsis thaliana [mouse-ear cress]
gb:BT015362_1642190 Arabidopsis thaliana At5g67385 gene, complet...   189   7e-47   
gb:AK117251_1815295 Arabidopsis thaliana At5g48800 mRNA for non-...   173   4e-42   
gb:AB012242_1511718 Arabidopsis thaliana genomic DNA, chromosome...   173   4e-42   
pir|D84920|D84920 hypothetical protein At2g47860 [imported] - Ar...   164   2e-39   Arabidopsis thaliana [mouse-ear cress]
pir|G86160|G86160 protein F10O3.17 [imported] - Arabidopsis thal...   160   2e-38   Arabidopsis thaliana [mouse-ear cress]
gb:AC105928_1738265 Oryza sativa (japonica cultivar-group) chrom...   160   4e-38   
gb:AC147427_1744693 Oryza sativa chromosome 3 B1394A07 genomic s...   152   1e-35   
gb:AY144442_1583524 Sorghum bicolor BAC 95A23/98N8.1 Rph region,...   152   1e-35   
gb:AF180390_1774821 Arabidopsis thaliana non-phototropic hypocot...   149   6e-35   
gb:AB008268_1510462 Arabidopsis thaliana genomic DNA, chromosome...   149   6e-35   
gb:AF466200_1802233 Sorghum bicolor putative protein kinase gene...   146   5e-34   
gb:AP004591_1842017 Oryza sativa (japonica cultivar-group) genom...   145   7e-34   
pir|G86428|G86428 F26G16.2 protein - Arabidopsis thaliana>gb:AE0...   143   3e-33   Arabidopsis thaliana [mouse-ear cress]
gb:AC012562_1537714 Arabidopsis thaliana chromosome 3 BAC F17O14...   141   1e-32   
pir|T48346|T48346 photoreceptor-interacting protein-like - Arabi...   140   2e-32   Arabidopsis thaliana [mouse-ear cress]
gb:AP003224_1825592 Oryza sativa (japonica cultivar-group) genom...   137   3e-31   
gb:AY144442_1583522 Sorghum bicolor BAC 95A23/98N8.1 Rph region,...   137   3e-31   
gb:AC012562_1537723 Arabidopsis thaliana chromosome 3 BAC F17O14...   136   6e-31   
gb:AB006704_1509977 Arabidopsis thaliana genomic DNA, chromosome...   135   1e-30   
pir|T50813|T50813 non-phototropic hypocotyl 3-like protein - Ara...   135   1e-30   Arabidopsis thaliana [mouse-ear cress]
gb:AC099043_1737016 Oryza sativa chromosome 3 BAC OSJNBa0079B15 ...   134   2e-30   
gb:OSJN00101_1694921 Oryza sativa genomic DNA, chromosome 4, BAC...   131   2e-29   
gb:AP005426_1851664 Oryza sativa (japonica cultivar-group) genom...   129   5e-29   
pir|T45850|T45850 hypothetical protein F3A4.50 - Arabidopsis tha...   125   1e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AC135500_1742438 Oryza sativa chromosome 3 BAC OSJNBa0034J04 ...   124   2e-27   
gb:AY150514_1585079 Arabidopsis thaliana unknown protein (At4g31...   124   2e-27   
pir|T02594|T02594 hypothetical protein At2g14820 [imported] - Ar...   124   2e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AP005919_1860143 Oryza sativa (japonica cultivar-group) genom...   124   3e-27   
pir|T08405|T08405 hypothetical protein F18B3.120 - Arabidopsis t...   123   4e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AY094473_1575768 Arabidopsis thaliana AT3g50840/F18B3_120 mRN...   122   8e-27   
gb:AY091021_1574252 Arabidopsis thaliana unknown protein (At4g31...   121   1e-26   
gb:AY054694_1563348 Arabidopsis thaliana photoreceptor-interacti...   121   1e-26   
gb:AB186127_1529351 Oryza sativa (japonica cultivar-group) mRNA ...   121   1e-26   
gb:AB007645_1510162 Arabidopsis thaliana genomic DNA, chromosome...   121   1e-26   
gb:AB013389_1512060 Arabidopsis thaliana genomic DNA, chromosome...   118   2e-25   
gb:AP006068_1860884 Oryza sativa (japonica cultivar-group) genom...   116   6e-25   
gb:AC117988_1739426 Oryza sativa chromosome 3 BAC OSJNBa0057G07 ...   116   6e-25   
pir|T04716|T04716 hypothetical protein F19F18.80 - Arabidopsis t...   113   5e-24   Arabidopsis thaliana [mouse-ear cress]
gb:AY054668_1563322 Arabidopsis thaliana putative protein (At4g3...   112   1e-23   
gb:AY448010S4_1606587 Ipomoea trifida haplotype S1 self-incompat...   107   2e-22   
gb:AB023039_1515419 Arabidopsis thaliana genomic DNA, chromosome...   106   5e-22   
gb:AB016886_1513138 Arabidopsis thaliana genomic DNA, chromosome...   106   5e-22   
pir|T51779|T51779 non-phototropic hypocotyl 3-like protein - Ara...   106   6e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AP003747_1832804 Oryza sativa (japonica cultivar-group) genom...   103   5e-21   
gb:AY049300_1561942 Arabidopsis thaliana AT5g66560/K1F13_23 mRNA...   103   5e-21   
gb:OSJN00035_1693653 Oryza sativa genomic DNA, chromosome 4, BAC...   102   1e-20   
pir|G96701|G96701 unknown protein, 76653-74502 [imported] - Arab...   102   1e-20   Arabidopsis thaliana [mouse-ear cress]
pir|H84619|H84619 hypothetical protein At2g23050 [imported] - Ar...   102   1e-20   Arabidopsis thaliana [mouse-ear cress]
pir|T06304|T06304 hypothetical protein F11C18.20 - Arabidopsis t...    88   2e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AP001298_1820987 Arabidopsis thaliana genomic DNA, chromosome...    86   1e-15   
gb:AP005903_1859850 Oryza sativa (japonica cultivar-group) genom...    79   8e-14   
pir|C84709|C84709 hypothetical protein At2g30510 [imported] - Ar...    76   9e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AP005292_1850005 Oryza sativa (japonica cultivar-group) genom...    74   4e-12   
gb:AB025631_1516560 Arabidopsis thaliana genomic DNA, chromosome...    67   4e-10   
gb:AY080713_1568435 Arabidopsis thaliana unknown protein (At1g50...    63   6e-09   
gb:BT012660_1641730 Arabidopsis thaliana At3g19850 gene, complet...    62   1e-08   
pir|T51462|T51462 hypothetical protein K10A8_60 - Arabidopsis th...    60   4e-08   Arabidopsis thaliana [mouse-ear cress]
pir|T46056|T46056 hypothetical protein T16K5.250 - Arabidopsis t...    59   9e-08   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00002_1693082 Oryza sativa genomic DNA, chromosome 4, BAC...    59   1e-07   
gb:AC130732_1740965 Oryza sativa (japonica cultivar-group) chrom...    59   1e-07   
pir|B96539|B96539 hypothetical protein F14I3.11 [imported] - Ara...    56   7e-07   Arabidopsis thaliana [mouse-ear cress]
gb:ATAC009895_1543071 Arabidopsis thaliana chromosome III BAC T2...    52   2e-05   
gb:AY040058_1560556 Arabidopsis thaliana unknown protein (At3g22...    46   0.001   
gb:BC077331_2560044 Xenopus laevis kelch-like 15 (Drosophila), m...    45   0.002   
gb:BX664740_1991918 Human DNA sequence from clone WI2-85598E4 on...    45   0.002   
gb:BC032544_1980525 Homo sapiens intracisternal A particle-promo...    45   0.002   
sp|Q9Y573|IPP_HUMAN|IPP_HUMAN Actin-binding protein IPP (MIPP protein).>gb...    45   0.002   Homo sapiens [man]
gb:BC077093_2559814 Danio rerio zgc:101051, mRNA (cDNA clone MGC...    44   0.005   
gb:BC044333_2548644 Xenopus laevis hypothetical protein MGC53639...    44   0.005   
gb:AJ719545_2501732 Gallus gallus mRNA for hypothetical protein,...    44   0.005   
gb:CR858790_1182940 Pongo pygmaeus mRNA; cDNA DKFZp468I1913 (fro...    44   0.005   
pir|A48752|A48752 B-cell CLL/lymphoma 6 (BCL6) protein - human>g...    44   0.005   Homo sapiens [man]
sp|P41182|BCL6_HUMAN|BCL6_HUMAN B-cell lymphoma 6 protein (BCL-6) (Zinc fin...    44   0.005   Homo sapiens [man]
gb:MMU41465_2121330 Mus musculus BCL-6 mRNA, complete cds.             43   0.006   
gb:AK173321_2070255 Mus musculus mRNA for mKIAA1993 protein.           43   0.006   
gb:AL354944_1923595 Human DNA sequence from clone RP11-106H5 on ...    43   0.006   
gb:AB082524_1871803 Homo sapiens mRNA for KIAA1993 protein.            43   0.006   
gb:AK036975_1164699 Mus musculus adult female vagina cDNA, RIKEN...    43   0.006   
sp|Q90W33|HIC2_BRARE|HIC2_BRARE Hypermethylated in cancer 2 protein.>gb:DRE...    43   0.006   Danio rerio [leopard danio]
sp|P41183|BCL6_MOUSE|BCL6_MOUSE B-cell lymphoma 6 protein homolog.>gb:AK039...    43   0.006   Mus musculus [mouse]
gb:AJ720342_2502529 Gallus gallus mRNA for hypothetical protein,...    42   0.011   
gb:AK057298_1911966 Homo sapiens cDNA FLJ32736 fis, clone TESTI2...    42   0.011   
gb:CET27E9_1368280 Caenorhabditis elegans cosmid T27E9, complete...    42   0.011   
gb:AK081546_1173304 Mus musculus 16 days embryo head cDNA, RIKEN...    42   0.011   
gb:BC052269_1984780 Homo sapiens BTB (POZ) domain containing 4, ...    42   0.014   
gb:AK131482_1918016 Homo sapiens cDNA FLJ16656 fis, clone TESTI4...    42   0.014   
sp|Q86UZ6|BTB4_HUMAN|BTB4_HUMAN BTB/POZ domain containing protein 4 (Zinc f...    42   0.014   Homo sapiens [man]
gb:BC078108_2560744 Xenopus laevis BTB (POZ) domain containing 4...    41   0.024   
gb:AY350736_2083969 Mus musculus kelch-like protein KLHL6 mRNA, ...    41   0.024   
gb:AE014297_1139985 Drosophila melanogaster chromosome 3R, compl...    41   0.024   
gb:AE014297_1139984 Drosophila melanogaster chromosome 3R, compl...    41   0.024   
gb:BC071523_2556259 Danio rerio kelch-like 18 (Drosophila), mRNA...    41   0.032   
gb:BC045319_2549162 Danio rerio kelch-like 18 (Drosophila), mRNA...    41   0.032   
gb:AST577207_1285695 Anopheles stephensi mRNA for putative kelch...    41   0.032   
gb:AST577207_1285694 Anopheles stephensi mRNA for putative kelch...    41   0.032   
gb:AK173029_2069963 Mus musculus mRNA for mKIAA0795 protein.           40   0.041   
gb:HSM806080_2018165 Homo sapiens mRNA; cDNA DKFZp686M0586 (from...    40   0.041   
gb:AL136170_1919003 Human DNA sequence from clone RP5-1198E17 on...    40   0.041   
gb:AL136170_1919002 Human DNA sequence from clone RP5-1198E17 on...    40   0.041   
gb:AL136170_1919001 Human DNA sequence from clone RP5-1198E17 on...    40   0.041   
gb:AK057310_1911973 Homo sapiens cDNA FLJ32748 fis, clone TESTI2...    40   0.041   
gb:AK084871_1174350 Mus musculus 13 days embryo lung cDNA, RIKEN...    40   0.041   
gb:AK078748_1172427 Mus musculus 15 days embryo male testis cDNA...    40   0.041   
gb:YDI293568_2459758 Yaba-like disease virus (YLDV), complete ge...    40   0.054   
gb:BC077434_2560143 Xenopus laevis MGC82233 protein, mRNA (cDNA ...    40   0.070   
gb:AK011461_1156415 Mus musculus 10 days embryo whole body cDNA,...    40   0.070   
sp|Q8BID6|BTB4_MOUSE|BTB4_MOUSE BTB/POZ domain containing protein 4.              40   0.070   Mus musculus [mouse]
gb:BC059515_2552492 Danio rerio B-cell CLL/lymphoma 6 (zinc fing...    39   0.092   
gb:BC083577_2108662 Rattus norvegicus zinc finger protein 100 (p...    39   0.092   
gb:BC060055_2103856 Mus musculus zinc finger and BTB domain cont...    39   0.092   
pir|S59069|S59069 Z13 protein - mouse>gb:MMU14556_2118508 Mus mu...    39   0.092   Mus musculus [mouse]
sp|Q60821|Z151_MOUSE|Z151_MOUSE Zinc finger protein 151 (Zinc finger protei...    39   0.092   Mus musculus [mouse]
gb:BC084912_2564148 Xenopus laevis hypothetical LOC495412, mRNA ...    39   0.12    
gb:AJ720960_2503147 Gallus gallus mRNA for hypothetical protein,...    39   0.12    
gb:AB197694_2467329 Takifugu rubripes bcl6 mRNA for B-cell lymph...    39   0.12    
gb:HSM806800_2018446 Homo sapiens mRNA; cDNA DKFZp686G17262 (fro...    39   0.12    
gb:HSM806379_2018308 Homo sapiens mRNA; cDNA DKFZp686P15123 (fro...    39   0.12    
gb:AY157873_1937320 Homo sapiens BTB/POZ and zinc-finger domain ...    39   0.12    
gb:AK097125_1914769 Homo sapiens cDNA FLJ39806 fis, clone SPLEN2...    39   0.12    
gb:AF548353_1906558 Homo sapiens BTB/POZ and zinc-finger domains...    39   0.12    
gb:AF441792_1902260 Homo sapiens kelch-like protein KLHL6 (KLHL6...    39   0.12    
gb:AB037799_1866590 Homo sapiens mRNA for KIAA1378 protein, part...    39   0.12    
gb:CQ783479_1452482 Sequence 3619 from Patent EP1396543.>gb:AK07...    39   0.12    
sp|Q9P2G9|KHL8_HUMAN|KHL8_HUMAN Kelch-like protein 8.>gb:BC041384_1983034 H...    39   0.12    Homo sapiens [man]
sp|Q8WZ60|KHL6_HUMAN|KHL6_HUMAN Kelch-like protein 6.>gb:BC032348_1980416 H...    39   0.12    Homo sapiens [man]
gb:BC017614_2092511 Mus musculus RIKEN cDNA 2410081M15 gene, mRN...    39   0.16    
gb:HS134O19_1997087 Human DNA sequence from clone RP1-134O19 on ...    39   0.16    
gb:AK010736_1155965 Mus musculus ES cells cDNA, RIKEN full-lengt...    39   0.16    
pir|T41321|T41321 BTB domain and Ankaryin repeat containing prot...    39   0.16    Schizosaccharomyces pombe
sp|Q9WTY8|ZB10_RAT|ZB10_RAT Zinc finger and BTB domain containing protein...    38   0.20    Rattus norvegicus [brown rat]
gb:BC084492_2563863 Xenopus tropicalis hypothetical LOC496558, m...    38   0.27    
gb:BC077915_2560561 Xenopus laevis B-cell CLL/lymphoma 6 (zinc f...    38   0.27    
gb:AF111712_2474475 Danio rerio hypermethylated in cancer zinc f...    38   0.27    
gb:AK085310_1174470 Mus musculus 0 day neonate kidney cDNA, RIKE...    38   0.27    
sp|Q13105|Z151_HUMAN|Z151_HUMAN Zinc finger protein 151 (Myc-interacting zi...    38   0.27    Homo sapiens [man]
gb:OSJN00056_1694017 Oryza sativa genomic DNA, chromosome 4, BAC...    37   0.35    
gb:BX255917_2567174 Zebrafish DNA sequence from clone DKEY-1H6 i...    37   0.46    
gb:BC080910_2561824 Xenopus tropicalis MGC79538 protein, mRNA (c...    37   0.46    
gb:BC046953_2549820 Xenopus laevis similar to ectodermal-neural ...    37   0.46    
gb:AY577006_2538250 Danio rerio clone RZ151A3D10 zinc finger and...    37   0.46    
gb:AY216791_2519635 Xenopus laevis ectoderm neural cortex relate...    37   0.46    
gb:AY101769_2076223 Mus musculus kelch-like protein mRNA, partia...    37   0.46    
gb:AF395817_1900720 Homo sapiens NAC1 protein mRNA, complete cds...    37   0.46    
gb:AK034618_1163817 Mus musculus 12 days embryo embryonic body b...    37   0.46    
gb:AK031028_1162263 Mus musculus adult male thymus cDNA, RIKEN f...    37   0.46    
sp|P59280|KHL8_MOUSE|KHL8_MOUSE Kelch-like protein 8.>gb:AK049960_1169056 M...    37   0.46    Mus musculus [mouse]
gb:BC077406_2560116 Xenopus laevis MGC81737 protein, mRNA (cDNA ...    37   0.60    
gb:BC073388_2557230 Xenopus laevis MGC80829 protein, mRNA (cDNA ...    37   0.60    
gb:AY693992_2087822 Rattus norvegicus zinc finger and BTB domain...    37   0.60    
gb:HSA507398_2007994 Homo sapiens RINZFC gene for putative RIN z...    37   0.60    
gb:BC050719_1984502 Homo sapiens zinc finger and BTB domain cont...    37   0.60    
gb:AY598321_1957276 Homo sapiens L2 mRNA, complete cds.                37   0.60    
gb:AK056913_1911860 Homo sapiens cDNA FLJ32351 fis, clone PROST2...    37   0.60    
gb:AB023214_1865536 Homo sapiens mRNA for KIAA0997 protein, part...    37   0.60    
gb:CNSLT1IBG_1180715 human full-length cDNA 5-PRIME end of clone...    37   0.60    
gb:AK029762_1161646 Mus musculus adult male testis cDNA, RIKEN f...    37   0.60    
sp|Q91VL9|ZBT1_MOUSE|ZBT1_MOUSE Zinc finger and BTB domain containing prote...    37   0.60    Mus musculus [mouse]
sp|Q9Y2K1|ZBT1_HUMAN|ZBT1_HUMAN Zinc finger and BTB domain containing prote...    37   0.60    Homo sapiens [man]
sp|Q96DT7|ZB10_HUMAN|ZB10_HUMAN Zinc finger and BTB domain containing prote...    37   0.60    Homo sapiens [man]
gb:AJ719971_2502158 Gallus gallus mRNA for hypothetical protein,...    36   0.78    
gb:BC067753_1987461 Homo sapiens kelch-like 10 (Drosophila), mRN...    36   0.78    
gb:BC059404_1985639 Homo sapiens B-cell CLL/lymphoma 6, member B...    36   0.78    
gb:AY495339_1954816 Homo sapiens KLHL10 (KLHL10) mRNA, complete ...    36   0.78    
gb:AK057224_1911938 Homo sapiens cDNA FLJ32662 fis, clone TESTI1...    36   0.78    
gb:AX970133_1485442 Sequence 936 from Patent EP1104808.                36   0.78    
pir|JC7812|JC7812 BCL6 homologous zinc finger protein BAZF - hum...    36   0.78    Homo sapiens [man]
gb:BC071011_2555885 Xenopus laevis hypothetical protein MGC81277...    36   1.0     
gb:AK129374_2069605 Mus musculus mRNA for mKIAA1489 protein.           36   1.0     
gb:AB011665_2043670 Mus musculus mRNA for BAZF, complete cds.>gb...    36   1.0     
gb:AK127065_1916578 Homo sapiens cDNA FLJ45122 fis, clone BRAWH3...    36   1.0     
gb:AK028396_1160974 Mus musculus 18 days pregnant adult female p...    36   1.0     
gb:AL591589_2504004 Zebrafish DNA sequence from clone BUSM1-198M...    35   1.3     
gb:AJ720925_2503112 Gallus gallus mRNA for hypothetical protein,...    35   1.3     
gb:BC064049_2105302 Mus musculus cDNA clone MGC:73573 IMAGE:6391...    35   1.7     
gb:AY495338_2085606 Rattus norvegicus KLHL10 (Klhl10) mRNA, comp...    35   1.7     
gb:AK077202_1171730 Mus musculus adult male testis cDNA, RIKEN f...    35   1.7     
gb:AK014906_1158188 Mus musculus adult male testis cDNA, RIKEN f...    35   1.7     
gb:AK006288_1153491 Mus musculus adult male testis cDNA, RIKEN f...    35   1.7     
gb:CP000011_868247 Burkholderia mallei ATCC 23344 chromosome 2, ...    35   1.7     
gb:DRE429491_2571128 Danio rerio mRNA for HIC1 protein.                35   2.3     
gb:MMU132691_2118437 Mus musculus (strain 129) partial HIC-1 gen...    35   2.3     
gb:AL603905_2071226 Mouse DNA sequence from clone RP23-143A14 on...    35   2.3     
gb:BC039585_1982579 Homo sapiens kelch-like 7 (Drosophila), mRNA...    35   2.3     
gb:AP005869_1859341 Oryza sativa (japonica cultivar-group) genom...    35   2.3     
sp|Q9R1Y5|HIC1_MOUSE|HIC1_MOUSE Hypermethylated in cancer 1 protein (Hic-1)...    35   2.3     Mus musculus [mouse]
gb:BC063745_2553596 Danio rerio zgc:63520, mRNA (cDNA clone MGC:...    34   3.0     
gb:BC049490_2550291 Danio rerio zgc:56572, mRNA (cDNA clone MGC:...    34   3.0     
gb:BC052706_2101226 Mus musculus BTB (POZ) domain containing 14B...    34   3.0     
gb:BC048157_2099555 Mus musculus BTB (POZ) domain containing 14B...    34   3.0     
gb:AF036334_2051803 Mus musculus hypermethylated in cancer 1 (Hi...    34   3.0     
gb:AF015911_2050874 Rattus norvegicus NAC-1 protein (NAC-1) mRNA...    34   3.0     
gb:BC063290_1986131 Homo sapiens zinc finger protein 295, mRNA (...    34   3.0     
gb:BC047107_1983802 Homo sapiens kelch repeat and BTB (POZ) doma...    34   3.0     
gb:BC037887_1982244 Homo sapiens kelch repeat and BTB (POZ) doma...    34   3.0     
gb:AF151831_1886317 Homo sapiens CGI-73 protein mRNA, complete cds.    34   3.0     
gb:AB041015_1866909 Homo sapiens ZNF295 mRNA for zinc finger pro...    34   3.0     
gb:AB033053_1866233 Homo sapiens mRNA for KIAA1227 protein, part...    34   3.0     
gb:CR933655_1185682 Homo sapiens mRNA; cDNA DKFZp781N1974 (from ...    34   3.0     
gb:CR857759_1181972 Pongo pygmaeus mRNA; cDNA DKFZp469K1929 (fro...    34   3.0     
gb:AK012935_1157238 Mus musculus 10, 11 days embryo whole body c...    34   3.0     
sp|Q9ULJ3|Z295_HUMAN|Z295_HUMAN Zinc finger protein 295.>gb:AB041014_186690...    34   3.0     Homo sapiens [man]
sp|Q8IY47|KBT2_HUMAN|KBT2_HUMAN Kelch repeat and BTB domain containing prot...    34   3.0     Homo sapiens [man]
gb:BC074064_2557593 Danio rerio cDNA clone IMAGE:7044077, partia...    34   3.9     
gb:BC042246_2548068 Xenopus laevis BTB/POZ and zinc-finger domai...    34   3.9     
gb:AY764034_1961874 Homo sapiens ENC2 (ENC2) mRNA, complete cds....    34   3.9     
gb:AY664415_1620628 Zea mays cultivar B73 locus 9009, complete s...    34   3.9     
gb:AF016684_1232785 Caenorhabditis elegans cosmid F45C12, comple...    34   3.9     
sp|P34324|YKV2_CAEEL|YKV2_CAEEL Hypothetical protein C08C3.2 in chromosome ...    34   3.9     Caenorhabditis elegans [roundworm]
gb:BC076781_2559525 Xenopus laevis ectoderm neural cortex relate...    33   5.0     
gb:BC045363_2549205 Danio rerio zgc:55511, mRNA (cDNA clone MGC:...    33   5.0     
gb:MVI012283_2443383 Myxoma virus mt6 gene.                            33   5.0     
gb:AF170726_2207817 Myxoma virus strain Lausanne, complete genom...    33   5.0     
gb:BC059177_2103684 Mus musculus cDNA sequence BC059177, mRNA (c...    33   5.0     
gb:BC029154_2096497 Mus musculus kelch-like 7 (Drosophila), mRNA...    33   5.0     
gb:BC027373_2095935 Mus musculus cDNA sequence BC027373, mRNA (c...    33   5.0     
gb:BC050061_1984254 Homo sapiens zinc finger and BTB domain cont...    33   5.0     
gb:AC006039_1875092 Homo sapiens BAC clone RP11-319F3 from 7, co...    33   5.0     
gb:AB028943_1865799 Homo sapiens mRNA for KIAA1020 protein, part...    33   5.0     
gb:HSM801571_1186265 Homo sapiens mRNA; cDNA DKFZp564C1616 (from...    33   5.0     
gb:AK083358_1173934 Mus musculus 2 days neonate thymus thymic ce...    33   5.0     
gb:AK041089_1165860 Mus musculus adult male aorta and vein cDNA,...    33   5.0     
gb:AK036584_1164536 Mus musculus adult male bone cDNA, RIKEN ful...    33   5.0     
gb:AK012326_1156891 Mus musculus 11 days embryo whole body cDNA,...    33   5.0     
gb:AE014298_1126607 Drosophila melanogaster chromosome X, comple...    33   5.0     
sp|Q96JB3|HIC2_HUMAN|HIC2_HUMAN Hypermethylated in cancer 2 protein (Hic-2)...    33   5.0     Homo sapiens [man]
gb:GGGFBPB_2573131 G.gallus gammaFBP-B mRNA.                           33   6.6     
gb:GGGFBPA_2573130 G.gallus gammaFBP-A mRNA.                           33   6.6     
gb:BC063944_2553646 Danio rerio zgc:66182, mRNA (cDNA clone MGC:...    33   6.6     
gb:BC055532_2551399 Danio rerio zgc:66182, mRNA (cDNA clone MGC:...    33   6.6     
gb:BC044506_2548809 Danio rerio, Similar to zinc finger protein ...    33   6.6     
gb:BC083903_2108959 Rattus norvegicus kelch-like 7 (Drosophila) ...    33   6.6     
gb:BC027135_2095775 Mus musculus zinc finger protein 295, mRNA (...    33   6.6     
gb:AK129353_2069584 Mus musculus mRNA for mKIAA1417 protein.           33   6.6     
gb:AK129313_2069544 Mus musculus mRNA for mKIAA1227 protein.           33   6.6     
gb:BC009555_1972094 Homo sapiens kelch-like 7 (Drosophila), mRNA...    33   6.6     
gb:AK056390_1911726 Homo sapiens cDNA FLJ31828 fis, clone NT2RP6...    33   6.6     
gb:AB002350_1863657 Homo sapiens mRNA for KIAA0352 gene, partial...    33   6.6     
gb:AP005476_1852574 Oryza sativa (japonica cultivar-group) genom...    33   6.6     
gb:AF077532_1239205 Caenorhabditis elegans cosmid F40B1, complet...    33   6.6     
gb:AK034057_1163609 Mus musculus adult male diencephalon cDNA, R...    33   6.6     
gb:AK031118_1162304 Mus musculus 13 days embryo forelimb cDNA, R...    33   6.6     
gb:AE014134_1129000 Drosophila melanogaster chromosome 2L, compl...    33   6.6     
gb:CP000009_862077 Gluconobacter oxydans 621H, complete genome.        33   6.6     
pir|T33336|T33336 hypothetical protein F40B1.2 - Caenorhabditis ...    33   6.6     Caenorhabditis elegans [roundworm]
pir|I50643|I50643 gammaFBP-C - chicken (fragment)                      33   6.6     Gallus gallus [bantam]
sp|O15060|Y352_HUMAN|Y352_HUMAN Hypothetical zinc finger protein KIAA0352.        33   6.6     Homo sapiens [man]
sp|Q90850|HIC1_CHICK|HIC1_CHICK Hypermethylated in cancer 1 protein (Hic-1)...    33   6.6     Gallus gallus [bantam]
gb:BC073690_2557510 Xenopus laevis MGC83590 protein, mRNA (cDNA ...    33   8.6     
gb:AF410153_2251877 Swinepox virus isolate 17077-99, complete ge...    33   8.6     
gb:AL355574_1924005 Human DNA sequence from clone RP11-432J22 on...    33   8.6     
gb:AP004262_1839358 Oryza sativa (japonica cultivar-group) genom...    33   8.6     
gb:AP003727_1832531 Oryza sativa (japonica cultivar-group) genom...    33   8.6     
gb:AP002969_1823996 Oryza sativa (japonica cultivar-group) genom...    33   8.6     
gb:AC084748_1733658 Oryza sativa chromosome 3 BAC OSJNBa0010I09 ...    33   8.6     
gb:AX877684_1477114 Sequence 12589 from Patent EP1074617.>gb:AK0...    33   8.6     
sp|Q8Y339|ARGC_RALSO|ARGC_RALSO N-acetyl-gamma-glutamyl-phosphate reductase...    33   8.6     Ralstonia solanacearum


>gb:AF181683_1774861 Arabidopsis thaliana RPT2 (RPT2) mRNA, complete
           cds.
          Length = 593

 Score =  315 bits (807), Expect = 7e-85
 Identities = 151/217 (69%), Positives = 178/217 (82%)
 Frame = +1

Query: 178 LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN 357
           +S ++ RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRIN
Sbjct: 14  MSSSLARTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRIN 73

Query: 358 LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXX 537
           LS IPGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DF  
Sbjct: 74  LSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS 133

Query: 538 XXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEEL 717
                           CE LLP++ DL IV+RCV++  AKAC EA FP R+PPNWWTEEL
Sbjct: 134 QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGAKACNEAMFPCRTPPNWWTEEL 193

Query: 718 TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL 828
            ILDV FF+ ++++M+ R  KP +LASAIITY E+SL
Sbjct: 194 CILDVDFFSDVVSSMKQRGVKPSSLASAIITYTEKSL 230



>gb:AY035063_1559836 Arabidopsis thaliana unknown protein
           (At2g30520) mRNA, complete cds.>gb:AY056359_1563667
           Arabidopsis thaliana unknown protein (At2g30520) mRNA,
           complete cds.>gb:BT000675_1634952 Arabidopsis thaliana
           clone RAFL09-15-A18 (R09304) unknown protein (At2g30520)
           mRNA, complete cds.
          Length = 593

 Score =  315 bits (807), Expect = 7e-85
 Identities = 151/217 (69%), Positives = 178/217 (82%)
 Frame = +1

Query: 178 LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN 357
           +S ++ RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRIN
Sbjct: 14  MSSSLARTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRIN 73

Query: 358 LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXX 537
           LS IPGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DF  
Sbjct: 74  LSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS 133

Query: 538 XXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPNWWTEEL 717
                           CE LLP++ DL IV+RCV++  AKAC EA FP R+PPNWWTEEL
Sbjct: 134 QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGAKACNEAMFPCRTPPNWWTEEL 193

Query: 718 TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL 828
            ILDV FF+ ++++M+ R  KP +LASAIITY E+SL
Sbjct: 194 CILDVDFFSDVVSSMKQRGVKPSSLASAIITYTEKSL 230



>gb:AK175297_1817285 Arabidopsis thaliana mRNA, complete cds, clone:
           RAFL21-73-G18.
          Length = 545

 Score =  257 bits (657), Expect = 2e-67
 Identities = 124/182 (68%), Positives = 145/182 (79%)
 Frame = +1

Query: 283 MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRC 462
           MLVAKSNYIRKLIM+SK++D+TRINLS IPGGPEIFE+AAKFCYGVNFEITV NVAAL C
Sbjct: 1   MLVAKSNYIRKLIMESKDSDVTRINLSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHC 60

Query: 463 AAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVE 642
           AAE+LQMTDKYCDNNLAGRT+DF                  CE LLP++ DL IV+RCV+
Sbjct: 61  AAEFLQMTDKYCDNNLAGRTQDFLSQVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVD 120

Query: 643 LASAKACVEANFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAER 822
           +  AKAC EA FP R+PPNWWTEEL ILDV FF+ ++++M+ R  KP +LASAIITY E+
Sbjct: 121 VVGAKACNEAMFPCRTPPNWWTEELCILDVDFFSDVVSSMKQRGVKPSSLASAIITYTEK 180

Query: 823 SL 828
           SL
Sbjct: 181 SL 182



>pir|D84709|D84709 hypothetical protein At2g30520 [imported] -
           Arabidopsis thaliana>gb:U93215_1726553 Arabidopsis
           thaliana chromosome 2 BAC T6B20 genomic sequence,
           complete sequence.
          Length = 185

 Score =  237 bits (605), Expect = 2e-61
 Identities = 114/160 (71%), Positives = 132/160 (82%)
 Frame = +1

Query: 178 LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN 357
           +S ++ RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRIN
Sbjct: 14  MSSSLARTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRIN 73

Query: 358 LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXX 537
           LS IPGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DF  
Sbjct: 74  LSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS 133

Query: 538 XXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAK 657
                           CE LLP++ DL IV+RCV++  AK
Sbjct: 134 QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGAK 173



>gb:BT015362_1642190 Arabidopsis thaliana At5g67385 gene, complete
           cds.>gb:BT015895_1642513 Arabidopsis thaliana At5g67385
           gene, complete cds.
          Length = 604

 Score =  189 bits (479), Expect = 7e-47
 Identities = 98/236 (41%), Positives = 141/236 (59%), Gaps = 19/236 (8%)
 Frame = +1

Query: 178 LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI 354
           LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ +S K++D T I
Sbjct: 9   LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLMSKCGFIKKLVSESSKDSDSTVI 68

Query: 355 NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFX 534
            +  IPGG E FE AAKFCYG+NF+++  N+A LRCAAEYL+MT+++   NL  R E + 
Sbjct: 69  KIPDIPGGSEAFELAAKFCYGINFDMSTENIAMLRCAAEYLEMTEEHSVENLVVRAEAYL 128

Query: 535 XXXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPN----- 699
                             E+LLP+AE +K+V RC++  +   C E++F S S  N     
Sbjct: 129 NEVALKSLSSSITVLHKSEKLLPIAERVKLVSRCIDAIAYMTCQESHFCSPSSSNSGNNE 188

Query: 700 -------------WWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL 828
                        WW E+LT+L +  F R++  M +R  K   L   ++ YA++SL
Sbjct: 189 VVVQQQSKQPVVDWWAEDLTVLRIDSFQRVLIAMMARGFKQYGLGPVLMLYAQKSL 244



>gb:AK117251_1815295 Arabidopsis thaliana At5g48800 mRNA for
           non-phototropic hypocotyl-like protein, complete cds,
           clone: RAFL16-80-M11.
          Length = 321

 Score =  173 bits (438), Expect = 4e-42
 Identities = 86/242 (35%), Positives = 147/242 (60%), Gaps = 24/242 (9%)
 Frame = +1

Query: 175 RLSLAM---ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL 345
           +LSLA    +   +W+F +++P+D+ +EV   +F+LHKF LV++S  IR+++ + +++D+
Sbjct: 22  KLSLAKSSRQSCSEWIF-RDVPSDITIEVNGGNFALHKFPLVSRSGRIRRIVAEHRDSDI 80

Query: 346 TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE 525
           +++ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT++Y  +NLA RTE
Sbjct: 81  SKVELLNLPGGAETFELAAKFCYGINFEITSSNVAQLFCVSDYLEMTEEYSKDNLASRTE 140

Query: 526 DFXXXXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACVE---ANF------ 678
           ++                   E LLPLA++L I+ RC++  ++KAC E   ++F      
Sbjct: 141 EYLESIVCKNLEMCVQVLKQSEILLPLADELNIIGRCIDAIASKACAEQIASSFSRLEYS 200

Query: 679 ------------PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAER 822
                        S    +WW E+L++L +  + R++  M+ R  +P ++ +++++YAER
Sbjct: 201 SSGRLHMSRQVKSSGDGGDWWIEDLSVLRIDLYQRVMNAMKCRGVRPESIGASLVSYAER 260

Query: 823 SL 828
            L
Sbjct: 261 EL 262



>gb:AB012242_1511718 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K24G6.
          Length = 614

 Score =  173 bits (438), Expect = 4e-42
 Identities = 86/242 (35%), Positives = 147/242 (60%), Gaps = 24/242 (9%)
 Frame = +1

Query: 175 RLSLAM---ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL 345
           +LSLA    +   +W+F +++P+D+ +EV   +F+LHKF LV++S  IR+++ + +++D+
Sbjct: 22  KLSLAKSSRQSCSEWIF-RDVPSDITIEVNGGNFALHKFPLVSRSGRIRRIVAEHRDSDI 80

Query: 346 TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE 525
           +++ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT++Y  +NLA RTE
Sbjct: 81  SKVELLNLPGGAETFELAAKFCYGINFEITSSNVAQLFCVSDYLEMTEEYSKDNLASRTE 140

Query: 526 DFXXXXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACVE---ANF------ 678
           ++                   E LLPLA++L I+ RC++  ++KAC E   ++F      
Sbjct: 141 EYLESIVCKNLEMCVQVLKQSEILLPLADELNIIGRCIDAIASKACAEQIASSFSRLEYS 200

Query: 679 ------------PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAER 822
                        S    +WW E+L++L +  + R++  M+ R  +P ++ +++++YAER
Sbjct: 201 SSGRLHMSRQVKSSGDGGDWWIEDLSVLRIDLYQRVMNAMKCRGVRPESIGASLVSYAER 260

Query: 823 SL 828
            L
Sbjct: 261 EL 262



>pir|D84920|D84920 hypothetical protein At2g47860 [imported] -
           Arabidopsis thaliana>gb:AC005309_1532462 Arabidopsis
           thaliana chromosome 2 clone F17A22 map CIC06C03,
           complete sequence.>gb:AC006072_1533395 Arabidopsis
           thaliana chromosome 2 clone T9J23 map CIC06C03, complete
           sequence.
          Length = 635

 Score =  164 bits (414), Expect = 2e-39
 Identities = 91/244 (37%), Positives = 133/244 (54%), Gaps = 15/244 (6%)
 Frame = +1

Query: 142 NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI 321
           N  S     A R S ++  T QW  S ++ +D+ +EVG A+FSLHKF LV++S  IRKL+
Sbjct: 10  NKQSVAAKRAFRPSSSIRHTPQWPVS-DVTSDLTIEVGSATFSLHKFPLVSRSGRIRKLV 68

Query: 322 MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD 501
           ++SK+   T +NL+ +PGG E FE AAKFCYGV  +    N+AALRC A YL+MT+   +
Sbjct: 69  LESKD---TNLNLAAVPGGSESFELAAKFCYGVGVQYNSSNIAALRCVAHYLEMTEDLSE 125

Query: 502 NNLAGRTEDFXXXXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACVE---- 669
            NL  RTE +                  CE LLP+AE++ +V R V   +  AC E    
Sbjct: 126 KNLEARTEAYLKDSIFNDISNSITVLHSCERLLPVAEEINLVGRLVNAIAVNACKEQLAS 185

Query: 670 ----------ANFPSRSPP-NWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYA 816
                        P  + P +WW   L IL + FF R+++ M+S+      ++  +++YA
Sbjct: 186 GLLKLDQSFSCGVPETAKPCDWWGRSLPILKLDFFQRVLSAMKSKGLNHDIISDILMSYA 245

Query: 817 ERSL 828
            +SL
Sbjct: 246 RKSL 249



>pir|G86160|G86160 protein F10O3.17 [imported] - Arabidopsis
           thaliana>gb:AE005172_889320 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F10O3_1677295 Arabidopsis thaliana
           chromosome 1 BAC F10O3 sequence, complete sequence.
          Length = 634

 Score =  160 bits (406), Expect = 2e-38
 Identities = 84/233 (36%), Positives = 131/233 (56%), Gaps = 15/233 (6%)
 Frame = +1

Query: 175 RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI 354
           RL+  +    +W  S ++ +D+ V+VG +SF LHKF LV++S  IRKL+ D K   ++ +
Sbjct: 20  RLNSTIRHASEWPIS-DVSSDLTVQVGSSSFCLHKFPLVSRSGKIRKLLADPK---ISNV 75

Query: 355 NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFX 534
            LS  PGG E FE AAKFCYG+N EI + N+A LRCA+ YL+MT+ + + NLA +TE F 
Sbjct: 76  CLSNAPGGSEAFELAAKFCYGINIEINLLNIAKLRCASHYLEMTEDFSEENLASKTEHFL 135

Query: 535 XXXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACVE--------------- 669
                            CE L+P++EDL +V R +   +  AC E               
Sbjct: 136 KETIFPSILNSIIVLHHCETLIPVSEDLNLVNRLIIAVANNACKEQLTSGLLKLDYSFSG 195

Query: 670 ANFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL 828
            N   ++P +WW + L +L++ FF R+I+ ++S+      ++  +I+Y  +SL
Sbjct: 196 TNIEPQTPLDWWGKSLAVLNLDFFQRVISAVKSKGLIQDVISKILISYTNKSL 248



>gb:AC105928_1738265 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0014O06, complete sequence.
          Length = 626

 Score =  160 bits (404), Expect = 4e-38
 Identities = 86/247 (34%), Positives = 136/247 (55%), Gaps = 23/247 (9%)
 Frame = +1

Query: 157 LKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKE 336
           +++ A  +S AM+RT  W+ SQE+P+D+ ++V +A+F+LHK  L ++  YI+K +     
Sbjct: 1   MQAEARFVSPAMKRTSDWILSQELPSDITIKVDDAAFNLHKLPLASRCGYIKKQVSGVGG 60

Query: 337 ADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAG 516
              T + ++G+PGG + FE   KFCYGVNFEITV NVA LRCA E+L+MT++    NL G
Sbjct: 61  NKATHLEIAGMPGGSKSFELVVKFCYGVNFEITVDNVAMLRCAGEHLEMTEECRPGNLVG 120

Query: 517 RTEDFXXXXXXXXXXXXXXXXXXCEELLPLAED-LKIVQRCVELASAKAC-------VEA 672
           RTE +                   EELLP +E+  ++V RC++  ++  C       +  
Sbjct: 121 RTEAYLEEVALASLEGAVAVLRKAEELLPASEEKARLVARCIDAVASIVCGGDGQFSMSL 180

Query: 673 NFP---------------SRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAII 807
             P               SR   +W  +ELT L +  F R++  M++R  K + + + I+
Sbjct: 181 GTPGGGGGGGYNGVGAAASREVDDWCADELTALRIDTFQRVMIAMKARGFKGIAMGTLIM 240

Query: 808 TYAERSL 828
            YA++SL
Sbjct: 241 LYAQKSL 247



>gb:AC147427_1744693 Oryza sativa chromosome 3 B1394A07 genomic
           sequence, complete sequence.
          Length = 650

 Score =  152 bits (383), Expect = 1e-35
 Identities = 82/229 (35%), Positives = 125/229 (54%), Gaps = 28/229 (12%)
 Frame = +1

Query: 226 IPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAK 405
           +P+DV VEVG+ SF LHKF L++KS ++ +LI ++ + D   I L+ IPGG + FE  A+
Sbjct: 53  LPSDVTVEVGDMSFHLHKFPLLSKSAFLERLIEETSDQDECVIILNDIPGGAKSFELVAR 112

Query: 406 FCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXXXXXXXXX 585
           FCYGV  E++  NV  LRCA+E+LQMT++  ++NL  ++E F                  
Sbjct: 113 FCYGVKIELSSENVVYLRCASEHLQMTEEIAEDNLISQSEIFLNQVIIRNWKDSLKALET 172

Query: 586 CEELLPLAEDLKIVQRCVELASAKACVEANF----------------------------P 681
           CE+LLP AE+L+IV+RC+E  ++KA  + N                             P
Sbjct: 173 CEDLLPHAENLQIVKRCIESLASKATTDPNLFGWPIREHGIMQSPGGSVLWNGISTGARP 232

Query: 682 SRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL 828
                NWW E+ + L    + R+I+TM SR  +P  +A ++  YA++ L
Sbjct: 233 RNFSSNWWYEDASALSFHMYKRLISTMESRGIRPEIIAGSLTYYAKKYL 281



>gb:AY144442_1583524 Sorghum bicolor BAC 95A23/98N8.1 Rph region,
           partial sequence.
          Length = 614

 Score =  152 bits (383), Expect = 1e-35
 Identities = 86/220 (39%), Positives = 123/220 (55%), Gaps = 14/220 (6%)
 Frame = +1

Query: 211 VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF 390
           +FS ++  DV V V   SF LHKF LV++   +RK+++DSK+ DL ++ L  +PGG   F
Sbjct: 36  IFS-DVAEDVTVSVDGQSFLLHKFPLVSRCGRVRKMVVDSKDPDLLKLELVNVPGGAFAF 94

Query: 391 ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXXXX 570
           E AAKFCYG NFEIT  NVA LRC AEYL+MT+ Y + NL  RTE +             
Sbjct: 95  ELAAKFCYGSNFEITTGNVAHLRCVAEYLEMTEDYQEENLIFRTETYLNEIVLKNLDKSL 154

Query: 571 XXXXXCEELLPLAEDLKIVQRCV----------ELASAKACVEANFPSRS----PPNWWT 708
                C+ L P+ E++ +V RCV          +L S  A +E +  S        +WW 
Sbjct: 155 EVLCKCDGLDPVVEEVGLVDRCVDAIAVNASKEQLVSGLAHLECDVGSAKLRMHCQDWWV 214

Query: 709 EELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL 828
           E+L+ L +  + R+IA MR    +P ++ ++I  YA+ SL
Sbjct: 215 EDLSALRIDHYRRVIAAMRRNGVRPESIGTSITHYAQTSL 254



>gb:AF180390_1774821 Arabidopsis thaliana non-phototropic hypocotyl
           3 (NPH3) mRNA, complete cds.
          Length = 745

 Score =  149 bits (376), Expect = 6e-35
 Identities = 85/252 (33%), Positives = 133/252 (52%), Gaps = 41/252 (16%)
 Frame = +1

Query: 196 RTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPG 375
           R   W  + +IP+D++V++G+ +F LHK+ L+++S  + +LI +S++ D T + L  +PG
Sbjct: 41  RGQSWFVATDIPSDLLVKIGDMNFHLHKYPLLSRSGKMNRLIYESRDPDPTILILDDLPG 100

Query: 376 GPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXX 555
           GPE FE A+KFCYGV  ++T  N++ LRCAAEYL+MT+   + NL  +TE F        
Sbjct: 101 GPEAFELASKFCYGVPVDLTATNISGLRCAAEYLEMTEDLEEGNLIFKTEAFLSYVVLSS 160

Query: 556 XXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACVE-----------------ANF-- 678
                     CE+L P AE+L+IV+RC E  + KAC                    NF  
Sbjct: 161 WRDSILVLKSCEKLSPWAENLQIVRRCSESIAWKACSNPKGIRWAYTGKAPSPSTTNFAG 220

Query: 679 ----------------PSRS------PPNWWTEELTILDVAFFARIIATMRSRTAKPLTL 792
                           PSR+      PP+WW E+++IL +  F R+I  ++ +  +   L
Sbjct: 221 SSPRWNESKDSSFYCSPSRNTNSQPVPPDWWFEDVSILRIDHFVRVITAIKVKGMRFELL 280

Query: 793 ASAIITYAERSL 828
            + I+ YA + L
Sbjct: 281 GAVIMHYAGKWL 292



>gb:AB008268_1510462 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MSJ1.
          Length = 745

 Score =  149 bits (376), Expect = 6e-35
 Identities = 85/252 (33%), Positives = 133/252 (52%), Gaps = 41/252 (16%)
 Frame = +1

Query: 196 RTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPG 375
           R   W  + +IP+D++V++G+ +F LHK+ L+++S  + +LI +S++ D T + L  +PG
Sbjct: 41  RGQSWFVATDIPSDLLVKIGDMNFHLHKYPLLSRSGKMNRLIYESRDPDPTILILDDLPG 100

Query: 376 GPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXX 555
           GPE FE A+KFCYGV  ++T  N++ LRCAAEYL+MT+   + NL  +TE F        
Sbjct: 101 GPEAFELASKFCYGVPVDLTATNISGLRCAAEYLEMTEDLEEGNLIFKTEAFLSYVVLSS 160

Query: 556 XXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACVE-----------------ANF-- 678
                     CE+L P AE+L+IV+RC E  + KAC                    NF  
Sbjct: 161 WRDSILVLKSCEKLSPWAENLQIVRRCSESIAWKACSNPKGIRWAYTGKAPSPSTTNFAG 220

Query: 679 ----------------PSRS------PPNWWTEELTILDVAFFARIIATMRSRTAKPLTL 792
                           PSR+      PP+WW E+++IL +  F R+I  ++ +  +   L
Sbjct: 221 SSPRWNESKDSSFYCSPSRNTNSQPVPPDWWFEDVSILRIDHFVRVITAIKVKGMRFELL 280

Query: 793 ASAIITYAERSL 828
            + I+ YA + L
Sbjct: 281 GAVIMHYAGKWL 292



>gb:AF466200_1802233 Sorghum bicolor putative protein kinase gene,
           partial cds; putative Cf-2, fertilization-independent
           endosperm proteins, hypothetical protein, putative
           non-LTR retroelement reverse transcriptase, OCL5
           protein, tryptophan synthase beta-subunit, hypothetical
           proteins, putative AP endonuclease, putative RNA
           polymerase II complex component SRB7, putative
           beta-1,3-glucanase, hypothetical protein, TNP2-like
           protein, hypothetical protein, putative
           phosphate/phosphoenolpyruvate translocator, putative
           protein, hypothetical proteins, putative
           galactosyltransferase family, hypothetical protein,
           putative cytochrome P450 family, putative lipid transfer
           protein, putative photoreceptor-interacting protein, and
           hypothetical protein genes, complete cds; and
           hypothetical protein gene, partial cds.
          Length = 658

 Score =  146 bits (368), Expect = 5e-34
 Identities = 81/250 (32%), Positives = 128/250 (51%), Gaps = 31/250 (12%)
 Frame = +1

Query: 172 TRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS--KEADL 345
           +R  +  ++  +W  +  +P+D+ V VGE SF LHKF L++KS  + K I +   K  D 
Sbjct: 8   SRADVFRKQGQEWYCTSGLPSDITVVVGEQSFHLHKFPLLSKSGLLEKRIREKIDKGDDS 67

Query: 346 TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE 525
             I+LS IPGG + FE AAKFCYGV FE+T  NV  LRCAA+YL+MT++  + NL  +TE
Sbjct: 68  CTIDLSDIPGGAKAFELAAKFCYGVKFEMTASNVVHLRCAADYLEMTEEISEENLIAQTE 127

Query: 526 DFXXXXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACVEANF--------- 678
            F                  C+ +L +AE L+IV+RCV+  + ++C + +          
Sbjct: 128 YFLTQTVLRSWKDSVKALQTCDNVLEVAERLQIVKRCVDSIATRSCSDPDLFGWPVAQYG 187

Query: 679 --------------------PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLAS 798
                               P  S P+WW ++++ L +  + ++I+ M  R      +  
Sbjct: 188 GPMQSPGGSLLWNGISTGARPRNSSPDWWYDDVSCLSLPLYKKLISAMEYRGISQEIIVG 247

Query: 799 AIITYAERSL 828
           ++  YA+R L
Sbjct: 248 SLNHYAKRRL 257



>gb:AP004591_1842017 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0582D05.>gb:AP005250_1849561 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBb0009H02.
          Length = 641

 Score =  145 bits (367), Expect = 7e-34
 Identities = 78/250 (31%), Positives = 128/250 (51%), Gaps = 31/250 (12%)
 Frame = +1

Query: 172 TRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEA--DL 345
           +R  +  ++   W  +  +P+D+ V VGE SF LHKF L++KS  + + I +  E   + 
Sbjct: 8   SRADVFRKQGQDWYCTTGLPSDITVTVGEQSFHLHKFPLLSKSGLLERCIREKIENGDNS 67

Query: 346 TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE 525
             I+LS IPGG + FE  AKFCYGV FE+T  NV  LRCAAEYL+MT++  + NL  +TE
Sbjct: 68  CVIDLSDIPGGAKAFELTAKFCYGVKFEMTASNVVHLRCAAEYLEMTEEIAEGNLIAQTE 127

Query: 526 DFXXXXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACVEANF--------- 678
           +F                  C++++ LAE L+IV+RC++  + ++C + +          
Sbjct: 128 NFLTQTVLRSWKDSIKALHTCDDIIDLAEKLQIVKRCIDSVATRSCTDPDLFGWPVVQYG 187

Query: 679 --------------------PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLAS 798
                               P  S P+WW ++++ L +  + ++I+ M  R      +  
Sbjct: 188 GPMQSPGGSVLWNGISTGARPRHSSPDWWYDDVSCLSLPLYKKVISAMEYRGINQDIIVG 247

Query: 799 AIITYAERSL 828
           ++  YA+R L
Sbjct: 248 SLNHYAKRRL 257



>pir|G86428|G86428 F26G16.2 protein - Arabidopsis
           thaliana>gb:AE005172_891887 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F26G16_1678079 Arabidopsis thaliana
           chromosome 1 BAC F26G16 sequence, complete sequence.
          Length = 662

 Score =  143 bits (361), Expect = 3e-33
 Identities = 81/246 (32%), Positives = 125/246 (50%), Gaps = 32/246 (13%)
 Frame = +1

Query: 187 AMERTGQ-WVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMD-SKEAD-LTRIN 357
           A +R GQ W  +  +P+D++VEVGE SF LHKF L+++S  + + I + SKE D    I 
Sbjct: 9   AFQRQGQAWFCTTGLPSDIVVEVGEMSFHLHKFPLLSRSGVMERRIAEASKEGDDKCLIE 68

Query: 358 LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXX 537
           +S +PGG + FE  AKFCYGV  E+T  NV  LRCAAE+L+MT+++ + NL  +TE F  
Sbjct: 69  ISDLPGGDKTFELVAKFCYGVKLELTASNVVYLRCAAEHLEMTEEHGEGNLISQTETFFN 128

Query: 538 XXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACVEANF------------- 678
                           C+E+L  A++L I ++C+E  + +A  + N              
Sbjct: 129 QVVLKSWKDSIKALHSCDEVLEYADELNITKKCIESLAMRASTDPNLFGWPVVEHGGPMQ 188

Query: 679 ----------------PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIIT 810
                           P  +  +WW E+ ++L    F R+I  M SR  +   +A ++  
Sbjct: 189 SPGGSVLWNGISTGARPKHTSSDWWYEDASMLSFPLFKRLITVMESRGIREDIIAGSLTY 248

Query: 811 YAERSL 828
           Y  + L
Sbjct: 249 YTRKHL 254



>gb:AC012562_1537714 Arabidopsis thaliana chromosome 3 BAC F17O14
           genomic sequence, complete sequence.
          Length = 612

 Score =  141 bits (356), Expect = 1e-32
 Identities = 79/225 (35%), Positives = 118/225 (52%), Gaps = 19/225 (8%)
 Frame = +1

Query: 211 VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEA--DLTRINLSGIPGGPE 384
           +FS ++  D+ + V   SF LHKF LVA+   IRK++ + KE+  +L+   L   PGG +
Sbjct: 25  IFS-DVAGDITIVVDGESFLLHKFPLVARCGKIRKMVAEMKESSSNLSHTELRDFPGGSK 83

Query: 385 IFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXX 564
            FE A KFCYG+NFEIT+ NV A+RCAA YL+MT+ + + NL  RTE +           
Sbjct: 84  TFELAMKFCYGINFEITISNVVAIRCAAGYLEMTEDFKEENLIARTETYLEQVAFRSLEK 143

Query: 565 XXXXXXXCEELLP--LAEDLKIVQRCVELASAKACVE---------------ANFPSRSP 693
                  CE L P  +AE   I  RCVE  +  AC E                       
Sbjct: 144 SVEVLCSCETLYPQDIAETAHIPDRCVEAIAVNACREQLVLGLSRLNRGTESGELKRGDS 203

Query: 694 PNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL 828
           P WW E+L+ L + ++AR+++ M     +  ++ ++++ YA+ SL
Sbjct: 204 PEWWIEDLSALRIDYYARVVSAMARTGLRSESIITSLMHYAQESL 248



>pir|T48346|T48346 photoreceptor-interacting protein-like -
           Arabidopsis thaliana>gb:AB005240_1509473 Arabidopsis
           thaliana genomic DNA, chromosome 5, P1
           clone:MOK16.>gb:ATF15A17_1548661 Arabidopsis thaliana
           DNA chromosome 5, BAC clone F15A17 (ESSA project).
          Length = 592

 Score =  140 bits (354), Expect = 2e-32
 Identities = 84/250 (33%), Positives = 124/250 (49%), Gaps = 36/250 (14%)
 Frame = +1

Query: 181 SLAMERTGQ-WVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTR-- 351
           S A  R GQ W+ +  + +DV +EVG+  F LHKF L+++S  + +LI +S   D +   
Sbjct: 10  SEAFHREGQTWLCTTGLVSDVTIEVGDMKFHLHKFPLLSRSGLLERLIEESSTDDGSGCV 69

Query: 352 INLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDF 531
           ++L  IPGG + FE   KFCYGV  E+T  NV +LRCAAEYL+MTD Y + NL G TE F
Sbjct: 70  LSLDEIPGGGKTFELVTKFCYGVKIELTAFNVVSLRCAAEYLEMTDNYGEGNLVGMTETF 129

Query: 532 XXXXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACVEA---NFP------- 681
                             CEE++  AEDL I+ RCV+  + KAC +    N+P       
Sbjct: 130 -LNEVFGNWTDSIKALQTCEEVIDYAEDLHIISRCVDSLAVKACADPSLFNWPVGGGKNA 188

Query: 682 -----------------------SRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTL 792
                                    +  +WW ++ + L +  F R+I  + +R  K   +
Sbjct: 189 TSGQNTEDESHLWNGISASGKMLQHTGEDWWFDDASFLSLPLFKRLITAIEARGMKLENI 248

Query: 793 ASAIITYAER 822
           A A++ Y  +
Sbjct: 249 AMAVMYYTRK 258



>gb:AP003224_1825592 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0010B10.
          Length = 659

 Score =  137 bits (344), Expect = 3e-31
 Identities = 84/261 (32%), Positives = 122/261 (46%), Gaps = 54/261 (20%)
 Frame = +1

Query: 208 WVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEAD--------LTRINLS 363
           W    E+ +DV+VEVGE SF LHKF L+++S  ++++I + +           +  + L 
Sbjct: 20  WRCMTELESDVVVEVGEMSFYLHKFPLLSRSGVLQRMISEYQAPQEDGGGGGGMCTLQLD 79

Query: 364 GIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXX 543
            IPGG + FE AA+FCY V  E+  HNV  LRCAAEYL+MTD Y + NL  + E F    
Sbjct: 80  DIPGGAKAFELAARFCYDVKIELNAHNVVCLRCAAEYLRMTDDYAEGNLITQAESF-LAD 138

Query: 544 XXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACV------------------- 666
                         CE +LP AEDL IV RC+   ++KAC                    
Sbjct: 139 VLANWKDSIKALETCEGVLPTAEDLHIVSRCITALASKACASDAAACSTGHAAASASAVA 198

Query: 667 ----EANFPSR-----------------------SPPNWWTEELTILDVAFFARIIATMR 765
                A++ +                        S  +WW E+++ L +  F R+I  M 
Sbjct: 199 VAAKNASYDALWNGIGSGGTPRGGGGAAGAAAGCSGMDWWYEDVSFLSLPMFKRLIQAME 258

Query: 766 SRTAKPLTLASAIITYAERSL 828
            +  +P ++A AI+ YA R L
Sbjct: 259 GKGMRPESIAGAIMFYAGRFL 279



>gb:AY144442_1583522 Sorghum bicolor BAC 95A23/98N8.1 Rph region,
           partial sequence.
          Length = 665

 Score =  137 bits (344), Expect = 3e-31
 Identities = 81/223 (36%), Positives = 115/223 (51%), Gaps = 24/223 (10%)
 Frame = +1

Query: 223 EIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM------DSKEAD-------LTRINLS 363
           EIP D+I+ +G++ F LHK ++V K +YIR+ I        SK AD       +  ++LS
Sbjct: 23  EIPADLIIRIGDSIFPLHKAVMVPKCSYIRRAITALAAAASSKAADDGDATATVVELDLS 82

Query: 364 GIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXX 543
            +PGG + FE+AA++CYG NFEIT  N AALRCAA +L M     D  LA R ++F    
Sbjct: 83  ALPGGADAFEKAARYCYGANFEITPANAAALRCAAAFLDMRHPSAD--LARRVDEFLARS 140

Query: 544 XXXXXXXXXXXXXXCEE-----LLPLAEDLKIVQRCVELASAKACVEANFPSRSP----- 693
                         CE      L   A++L + +R  +  +   C EA FP+ +      
Sbjct: 141 ALRTLPGAVAVLRSCEAPDDDLLRAAADELGVARRAADAVALAVCREALFPTTTTSGSSR 200

Query: 694 -PNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAE 819
            P WW  EL  L    FAR++  +R R A P  +A+A  +YAE
Sbjct: 201 LPGWWKVELAALSPRSFARVVTALRCRRADPAVVAAAAGSYAE 243



>gb:AC012562_1537723 Arabidopsis thaliana chromosome 3 BAC F17O14
           genomic sequence, complete sequence.
          Length = 582

 Score =  136 bits (342), Expect = 6e-31
 Identities = 76/213 (35%), Positives = 116/213 (54%), Gaps = 7/213 (3%)
 Frame = +1

Query: 211 VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF 390
           +FS ++  D+IV V   SF LHKF LVA+S  +RK++ D K++  + I L   PGGP  F
Sbjct: 30  IFS-DVAGDIIVVVDGESFLLHKFPLVARSGKMRKMVRDLKDSS-SMIELRDFPGGPSTF 87

Query: 391 ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXXXX 570
           E   KFCYG+NF+IT  NV +LRCAA YL+MT+ Y + NL  R E++             
Sbjct: 88  ELTMKFCYGINFDITAFNVVSLRCAAGYLEMTEDYKEQNLIFRAENYLDQIVFRSFHESV 147

Query: 571 XXXXXCEELLPLAEDLKIVQRCVELASAKAC-------VEANFPSRSPPNWWTEELTILD 729
                C E   +AE  +I  RCVE  +  AC       +      R     WTEEL+ L 
Sbjct: 148 LVLCSC-ETQEIAETYEIPDRCVEAIAMNACRKQLVSGLSEELKGRDCLEMWTEELSALG 206

Query: 730 VAFFARIIATMRSRTAKPLTLASAIITYAERSL 828
           + ++ ++++ M   + +  ++ ++++ YA+ SL
Sbjct: 207 IDYYVQVVSAMARLSVRSESIVASLVHYAKTSL 239



>gb:AB006704_1509977 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MSH12.
          Length = 591

 Score =  135 bits (339), Expect = 1e-30
 Identities = 86/235 (36%), Positives = 121/235 (51%), Gaps = 28/235 (11%)
 Frame = +1

Query: 208 WVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI-NLSGIPGGPE 384
           W+    +  DV+++V + SF LHKF L+++S Y+  L   SK ++ T +  L  IPGGPE
Sbjct: 20  WLCKTGLKPDVMIQVVDESFHLHKFPLLSRSGYLETLF--SKASETTCVAQLHDIPGGPE 77

Query: 385 IFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXX-XX 561
            F   AKFCYGV  E+T  N  +LRCAAEYLQM++ Y D NL   TE F           
Sbjct: 78  TFLLVAKFCYGVRIEVTPENAVSLRCAAEYLQMSENYGDANLIYLTESFLNDHVFVNWED 137

Query: 562 XXXXXXXXCE-ELLPLAEDLKIVQRCVELASAKACVE-----ANFPSRSP---------- 693
                   CE ++LPLAE+L IV RC+   + KAC E      N+P   P          
Sbjct: 138 SIKALEKSCEPKVLPLAEELHIVSRCIGSLAMKACAEDNTSFFNWPISLPEGTTTTTIYW 197

Query: 694 ---------PNWWTEEL-TILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL 828
                     NWW  ++ + LD+  + R I T+ SR      +A+++  YA+R+L
Sbjct: 198 NGIQTKATSENWWFNDVSSFLDLPMYKRFIKTVESRGVNAGIIAASVTHYAKRNL 252



>pir|T50813|T50813 non-phototropic hypocotyl 3-like protein -
           Arabidopsis thaliana>gb:ATF18D22_1549102 Arabidopsis
           thaliana DNA chromosome 5, BAC clone F18D22 (ESSA
           project).
          Length = 607

 Score =  135 bits (339), Expect = 1e-30
 Identities = 73/211 (34%), Positives = 108/211 (51%), Gaps = 4/211 (1%)
 Frame = +1

Query: 208 WVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKL-IMDSKEADLTRINLSGIPGGPE 384
           W    +IPTD+ ++V + +F  HKF L++K  YI  + +  S   +   + L   PGG +
Sbjct: 44  WYVKSQIPTDLSIQVNDITFKAHKFPLISKCGYISSIELKPSTSENGYHLKLENFPGGAD 103

Query: 385 IFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXX 564
            FE   KFCY +  ++   NVA LRCA+EYL MT+++   NL  +TE F           
Sbjct: 104 TFETILKFCYNLPLDLNPLNVAPLRCASEYLYMTEEFEAGNLISKTEAFITFVVLASWRD 163

Query: 565 XXXXXXXCEELLPLAEDLKIVQRCVELASAKACVEANFPS---RSPPNWWTEELTILDVA 735
                  C  L P AE+L+IV+RC +L + KAC + N P             ++  LD+ 
Sbjct: 164 TLTVLRSCTNLSPWAENLQIVRRCCDLLAWKACNDNNIPEDVVDRNERCLYNDIATLDID 223

Query: 736 FFARIIATMRSRTAKPLTLASAIITYAERSL 828
            F R+I TM++R AKP      I+ YA+  L
Sbjct: 224 HFMRVITTMKARRAKPQITGKIIMKYADNFL 254



>gb:AC099043_1737016 Oryza sativa chromosome 3 BAC OSJNBa0079B15
           genomic sequence, complete sequence.>gb:AC107207_1738374
           Oryza sativa chromosome 3 BAC OSJNBb0106M04 genomic
           sequence, complete sequence.
          Length = 725

 Score =  134 bits (337), Expect = 2e-30
 Identities = 85/257 (33%), Positives = 120/257 (46%), Gaps = 56/257 (21%)
 Frame = +1

Query: 226 IPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMD-------------------------- 327
           +P+DV++EVG+ +F LHKF L+++S  +  LI +                          
Sbjct: 87  LPSDVVIEVGDMTFHLHKFPLMSRSKKLHDLITNRESRAAGGGEQDEEEEEDAGEIREEE 146

Query: 328 -----SKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDK 492
                 +++D+ RI L   PGG E FE+AAKFCYGV  ++T    A LRCAAE L M+D 
Sbjct: 147 VVLEVDEDSDVHRIRLPDFPGGAEAFEQAAKFCYGVKLDLTPATAAPLRCAAERLGMSDD 206

Query: 493 YCDNNLAGRTEDFXXXXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACVE- 669
           + D+NL  R + F                  CE LLPLA+DL +V RCV+  +AKA    
Sbjct: 207 HSDDNLISRADRFMSHTVLRNPRDAIRALRSCEGLLPLADDLGLVSRCVDAIAAKAAAST 266

Query: 670 -------------------ANFPSRSPPN-----WWTEELTILDVAFFARIIATMRSRTA 777
                              A    R   N      W ++L  L +A F R+IA M+ R  
Sbjct: 267 PTALFGWPINDAAAAAAAAAGDRPRRKNNAGAGATWFDDLAGLSLATFTRVIAAMKERNV 326

Query: 778 KPLTLASAIITYAERSL 828
            P  +  A+I YA+RS+
Sbjct: 327 GPEIIEGALIAYAKRSI 343



>gb:OSJN00101_1694921 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0034I13, complete sequence.
          Length = 644

 Score =  131 bits (329), Expect = 2e-29
 Identities = 78/240 (32%), Positives = 119/240 (49%), Gaps = 33/240 (13%)
 Frame = +1

Query: 208 WVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK----EADLTRINLSGIPG 375
           W    E+ +DV+VEVG+ SF LHKF L+++S  ++KLI ++     + +   + L  +PG
Sbjct: 23  WTCMTELVSDVVVEVGDFSFHLHKFPLMSRSGTLQKLISEAAAGADDGEPCSVKLHDVPG 82

Query: 376 GPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYC-DNNLAGRTEDFXXXXXXX 552
           G   FE AA+FCY V  E+   NV ALRCAAE+L MT+ +  + NL  + E F       
Sbjct: 83  GAAAFELAARFCYDVRAELDAGNVVALRCAAEHLGMTEDHGGEGNLVEQAEAFLRDVLGS 142

Query: 553 XXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACVE--------------------- 669
                         LLPLAE+L +V RC++  ++KAC +                     
Sbjct: 143 WDDALRALRSCDGALLPLAEELLVVPRCIDALASKACADPTLFGWPMVEYYTARGLEETV 202

Query: 670 -------ANFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL 828
                  A  P    P+WW ++ + L +  + R+I  MRS+   P  +A ++  YA+R L
Sbjct: 203 MWNGIATAGKPRSPGPDWWYKQASSLKLPVYKRLITAMRSKGMSPENIAGSLTHYAKRHL 262



>gb:AP005426_1851664 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0668D04.>gb:AP005579_1854402 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OJ1740_D06.
          Length = 618

 Score =  129 bits (325), Expect = 5e-29
 Identities = 74/226 (32%), Positives = 116/226 (51%), Gaps = 24/226 (10%)
 Frame = +1

Query: 223 EIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAA 402
           ++ TDVIV V E  F LHKF L++KS+ +++L++ + E     +++ G PGG   FE  A
Sbjct: 26  DLATDVIVHVSEVKFYLHKFPLLSKSSKLQRLVIKATEEGTDEVHIDGFPGGVTAFEICA 85

Query: 403 KFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXXXXXXXX 582
           KFCYG+   ++ HNV A RCAAEYL+MT+     NL  + + F                 
Sbjct: 86  KFCYGMVVTLSPHNVVAARCAAEYLEMTEDVDKGNLIFKIDVFINSSILRSWKDSIIVLQ 145

Query: 583 XCEELLPLAEDLKIVQRCVELASAKACVE-ANF----------------------PSRSP 693
             + LLP +E+LK++ RC++  ++K  V+ AN                        S +P
Sbjct: 146 STKALLPWSEELKVIGRCIDAIASKTSVDPANVTWSYSHSRKGMSCTEIVESTGRTSIAP 205

Query: 694 PNWWTEELTILDVAFFARIIATMRSR-TAKPLTLASAIITYAERSL 828
            +WW E+L  LDV  + R++  ++S+    P  +  A+  YA R L
Sbjct: 206 KDWWVEDLCELDVDLYKRVMVAVKSKGRMSPELIGEALKAYAVRWL 251



>pir|T45850|T45850 hypothetical protein F3A4.50 - Arabidopsis
           thaliana>gb:ATF3A4_1550551 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F3A4.
          Length = 526

 Score =  125 bits (314), Expect = 1e-27
 Identities = 66/189 (34%), Positives = 102/189 (53%)
 Frame = +1

Query: 262 SFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVH 441
           SF LHKF LV+K  +I+KL  +S   D   I +   PGG E FE   KFCY ++FEI   
Sbjct: 6   SFLLHKFPLVSKCGFIKKLASESSN-DSNIIRIPDFPGGAEGFELVIKFCYDISFEINTE 64

Query: 442 NVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXXXXXXXXXCEELLPLAEDLK 621
           N+A L CAAEYL+MT+++   NL    E +                   ++LLP+AE ++
Sbjct: 65  NIAMLLCAAEYLEMTEEHSVENLVETIEVYLNEVILKSLSKSVKVLQKSQDLLPIAERVR 124

Query: 622 IVQRCVELASAKACVEANFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASA 801
           +V RC++  +   C E+   +    +WW ++L +L +  F R++  M +R  K  +L   
Sbjct: 125 LVDRCIDSIAYAICQESQ-SNEDIVDWWADDLAVLKIDMFRRVLVAMIARGFKRYSLGPV 183

Query: 802 IITYAERSL 828
           +  YAE++L
Sbjct: 184 LKLYAEKAL 192



>gb:AC135500_1742438 Oryza sativa chromosome 3 BAC OSJNBa0034J04
           genomic sequence, complete sequence.>gb:AC136972_1743280
           Oryza sativa chromosome 3 BAC OSJNBb0007E22 genomic
           sequence, complete sequence.
          Length = 634

 Score =  124 bits (312), Expect = 2e-27
 Identities = 67/230 (29%), Positives = 115/230 (50%), Gaps = 28/230 (12%)
 Frame = +1

Query: 223 EIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAA 402
           E+ TD+++ +G+  F LHKF L++KS+ +++L   S       +++S IPGGP  FE  A
Sbjct: 26  ELATDIVISIGDVKFCLHKFPLLSKSSCLQRLAASSNVEGNEELDISDIPGGPSAFEICA 85

Query: 403 KFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXXXXXXXX 582
           KFCYG+   +  +NV A RCAAEYL+M +     NL  + + F                 
Sbjct: 86  KFCYGMIVTLNAYNVLAARCAAEYLEMFETIEKGNLIYKIDVFLTSSIFRAWKDSIIVLQ 145

Query: 583 XCEELLPLAEDLKIVQRCVELASAKACVEAN------------FPSRS------------ 690
             + LLP +E+LK++  C++  ++KA ++ +             PS +            
Sbjct: 146 STKSLLPWSENLKVINHCIDSIASKALIDPSEVEWSYTYNRKKLPSENGHDSHWNGVRKQ 205

Query: 691 ---PPNWWTEELTILDVAFFARIIATMRSR-TAKPLTLASAIITYAERSL 828
              P +WW E+L  L++  + R+I  ++++    P+ +  A+  YA R L
Sbjct: 206 LIVPKDWWVEDLCDLEMDLYKRVIMMIKAKGRTSPIVIGEALRAYAYRRL 255



>gb:AY150514_1585079 Arabidopsis thaliana unknown protein
           (At4g31820) mRNA, complete cds.
          Length = 571

 Score =  124 bits (311), Expect = 2e-27
 Identities = 67/208 (32%), Positives = 105/208 (50%), Gaps = 26/208 (12%)
 Frame = +1

Query: 223 EIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAA 402
           ++ +DV + VGE +F LHKF L++KSN +++L+ ++ E     I +  +PGG + FE  A
Sbjct: 26  DLDSDVTIHVGEVTFHLHKFPLLSKSNRMQRLVFEASEEKTDEITILDMPGGYKAFEICA 85

Query: 403 KFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXXXXXXXX 582
           KFCYG+   +  +N+ A+RCAAEYL+MT+     NL  + E F                 
Sbjct: 86  KFCYGMTVTLNAYNITAVRCAAEYLEMTEDADRGNLIYKIEVFLNSGIFRSWKDSIIVLQ 145

Query: 583 XCEELLPLAEDLKIVQRCVELASAKACVEANFPSRS------------------------ 690
               LLP +EDLK+V RC++  SAK  V     + S                        
Sbjct: 146 TTRSLLPWSEDLKLVGRCIDSVSAKILVNPETITWSYTFNRKLSGPDKIVEYHREKREEN 205

Query: 691 --PPNWWTEELTILDVAFFARIIATMRS 768
             P +WW E++  L++  F R+I+ ++S
Sbjct: 206 VIPKDWWVEDVCELEIDMFKRVISVVKS 233



>pir|T02594|T02594 hypothetical protein At2g14820 [imported] -
           Arabidopsis thaliana>gb:AC004705_1532116 Arabidopsis
           thaliana chromosome 2 clone F26C24 map mi398, complete
           sequence.
          Length = 634

 Score =  124 bits (311), Expect = 2e-27
 Identities = 65/206 (31%), Positives = 107/206 (51%), Gaps = 23/206 (11%)
 Frame = +1

Query: 223 EIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAA 402
           E+ +D+ V+V  + F LHKF L++K   ++KL+  + + ++  I++SGIPGGP  FE  A
Sbjct: 26  ELASDISVDVEGSRFCLHKFPLLSKCACLQKLLSSTDKNNIDDIDISGIPGGPTAFETCA 85

Query: 403 KFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXXXXXXXX 582
           KFCYG+   ++ +NV A RCAAEYL M +     NL  + + F                 
Sbjct: 86  KFCYGMTVTLSAYNVVATRCAAEYLGMHETVEKGNLIYKIDVFLSSSLFRSWKDSIIVLQ 145

Query: 583 XCEELLPLAEDLKIVQRCVELASAKACVEANFPSRS-----------------------P 693
             +  LPL+EDLK+V  C++  + KACV+ +    S                       P
Sbjct: 146 TTKPFLPLSEDLKLVSLCIDAIATKACVDVSHVEWSYTYNKKKLAEENNGADSIKARDVP 205

Query: 694 PNWWTEELTILDVAFFARIIATMRSR 771
            +WW E+L  L++ ++ R+I  ++++
Sbjct: 206 HDWWVEDLCELEIDYYKRVIMNIKTK 231



>gb:AP005919_1860143 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0554A06.
          Length = 644

 Score =  124 bits (310), Expect = 3e-27
 Identities = 74/226 (32%), Positives = 115/226 (50%), Gaps = 24/226 (10%)
 Frame = +1

Query: 223 EIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAA 402
           E+P+D+++ V EA F LHKF L++KS+ +++LI+++ +     + +  IPGG +IFE  A
Sbjct: 27  ELPSDIVIHVEEARFYLHKFPLLSKSSLLQRLIIEASQNGTDEVYIHDIPGGVKIFEICA 86

Query: 403 KFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXXXXXXXX 582
           KFCYG+   +  +NV A RCAAE L MT+    +NL  + E F                 
Sbjct: 87  KFCYGMVVTLNAYNVVAARCAAELLGMTEDVDKSNLVFKIEVFLNSGIFRSWKDSIIALQ 146

Query: 583 XCEELLPLAEDLKIVQRCVELASAKA----------------------CVEANFPSRS-P 693
             + LLP +E LK+  RC++  ++KA                       VEA   S+  P
Sbjct: 147 TTDALLPWSEQLKLAARCIDSIASKATSNPCNVVWSYTYNRKSASSDEIVEARKNSQPVP 206

Query: 694 PNWWTEELTILDVAFFARIIATMRSR-TAKPLTLASAIITYAERSL 828
            +WW E+L  LDV  + R++  ++SR       +  A+  YA R L
Sbjct: 207 KDWWVEDLCELDVDLYKRVMVAVKSRGRITSDVVGEALKAYASRWL 252



>pir|T08405|T08405 hypothetical protein F18B3.120 - Arabidopsis
           thaliana>gb:ATF18B3_1549088 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F18B3.
          Length = 567

 Score =  123 bits (309), Expect = 4e-27
 Identities = 70/227 (30%), Positives = 113/227 (49%), Gaps = 21/227 (9%)
 Frame = +1

Query: 211 VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL-TRINLSGIPGGPEI 387
           +F   +P+D+ +EV + +F LHKF L++KS  + +LI + +++ + + I L   PGG EI
Sbjct: 9   IFFNSLPSDIEIEVDDITFHLHKFPLMSKSKKLHQLITEQEQSKVYSHIKLENFPGGSEI 68

Query: 388 FERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXXX 567
           FE   K  YG   +I+V     LRCAAEYL+MT++Y   NL  +TE F            
Sbjct: 69  FEMVIKISYGFKVDISVSTAVPLRCAAEYLEMTEEYSPENLISKTEKFLSEFVFTNVQES 128

Query: 568 XXXXXXCEELLPLAEDLKIVQRCVE--LASAKACVEANF------------------PSR 687
                 CE +  LAE L I ++C++  +  A +   ++F                     
Sbjct: 129 IKALKACESVSSLAESLCITEQCIDSIVFQASSTDPSSFYGWPINNGGIFTVDRKKQSKD 188

Query: 688 SPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL 828
           S    W E+LT L    F R+I +M+S    P  +  +++TYA++ +
Sbjct: 189 SKTELWFEDLTELSFPIFRRVILSMKSSVLSPEIVERSLLTYAKKHI 235



>gb:AY094473_1575768 Arabidopsis thaliana AT3g50840/F18B3_120 mRNA,
           complete cds.>gb:BT004531_1637565 Arabidopsis thaliana
           At3g50840/F18B3_120 gene, complete cds.
          Length = 569

 Score =  122 bits (306), Expect = 8e-27
 Identities = 72/237 (30%), Positives = 117/237 (49%), Gaps = 22/237 (9%)
 Frame = +1

Query: 184 LAMERTGQWVF-SQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL-TRIN 357
           +A  +   W F +  +P+D+ +EV + +F LHKF L++KS  + +LI + +++ + + I 
Sbjct: 1   MANSKKQAWFFYTTGLPSDIEIEVDDITFHLHKFPLMSKSKKLHQLITEQEQSKVYSHIK 60

Query: 358 LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXX 537
           L   PGG EIFE   K  YG   +I+V     LRCAAEYL+MT++Y   NL  +TE F  
Sbjct: 61  LENFPGGSEIFEMVIKISYGFKVDISVSTAVPLRCAAEYLEMTEEYSPENLISKTEKFLS 120

Query: 538 XXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVE--LASAKACVEANF----------- 678
                           CE +  LAE L I ++C++  +  A +   ++F           
Sbjct: 121 EFVFTNVQESIKALKACESVSSLAESLCITEQCIDSIVFQASSTDPSSFYGWPINNGGIF 180

Query: 679 -------PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL 828
                     S    W E+LT L    F R+I +M+S    P  +  +++TYA++ +
Sbjct: 181 TVDRKKQSKDSKTELWFEDLTELSFPIFRRVILSMKSSVLSPEIVERSLLTYAKKHI 237



>gb:AY091021_1574252 Arabidopsis thaliana unknown protein
           (At4g31820) mRNA, complete cds.
          Length = 571

 Score =  121 bits (304), Expect = 1e-26
 Identities = 66/208 (31%), Positives = 104/208 (50%), Gaps = 26/208 (12%)
 Frame = +1

Query: 223 EIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAA 402
           ++ +DV + VGE +F LHKF L++KSN +++L+ ++ E     I +  +PGG + FE  A
Sbjct: 26  DLDSDVTIHVGEVTFHLHKFPLLSKSNRMQRLVFEASEEKTDEITILDMPGGYKAFEICA 85

Query: 403 KFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXXXXXXXX 582
           KFCYG+   +  +N+ A+RCAAEYL+MT+     NL  + E F                 
Sbjct: 86  KFCYGMTVTLNAYNITAVRCAAEYLEMTEDADRGNLIYKIEVFLNSGIFRSWKDSIIVLQ 145

Query: 583 XCEELLPLAEDLKIVQRCVELASAKACV--------------------------EANFPS 684
               LLP +EDLK+V RC++  SAK  V                          E    +
Sbjct: 146 TTRSLLPWSEDLKLVGRCIDSVSAKILVNPETITWSYTFNRKLSGPDKIVEYHREKREEN 205

Query: 685 RSPPNWWTEELTILDVAFFARIIATMRS 768
             P +WW E++  L++  F  +I+ ++S
Sbjct: 206 VIPKDWWVEDVCELEIDMFKGVISVVKS 233



>gb:AY054694_1563348 Arabidopsis thaliana photoreceptor-interacting
           protein-like (At5g67440; K8K14.18) mRNA, complete
           cds.>gb:AY128721_1580801 Arabidopsis thaliana
           photoreceptor-interacting protein-like (At5g67440) mRNA,
           complete cds.
          Length = 579

 Score =  121 bits (304), Expect = 1e-26
 Identities = 73/227 (32%), Positives = 113/227 (49%), Gaps = 25/227 (11%)
 Frame = +1

Query: 223 EIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS---KEADLTRINLSGIPGGPEIFE 393
           E+ TDV+V VG+  F LHKF L++KS  ++KLI  +   +++D   I +  IPGGP  FE
Sbjct: 26  ELATDVVVIVGDVKFHLHKFPLLSKSARLQKLIATTTTDEQSDDDEIRIPDIPGGPPAFE 85

Query: 394 RAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXXXXX 573
             AKFCYG+   +  +NV A+RCAAEYL+M +   + NL  + E F              
Sbjct: 86  ICAKFCYGMAVTLNAYNVVAVRCAAEYLEMYESIENGNLVYKMEVFLNSSVLRSWKDSII 145

Query: 574 XXXXCEELLPLAEDLKIVQRCVELASAKACVEANFPSR---------------------S 690
                    P +ED+K+  RC+E  + KA ++   P+R                      
Sbjct: 146 VLQTTRSFYPWSEDVKLDVRCLESIALKAAMD---PARVDWSYTYNRRKLLPPEMNNNSV 202

Query: 691 PPNWWTEELTILDVAFFARIIATMRSR-TAKPLTLASAIITYAERSL 828
           P +WW E+L  L +  F R+++T+R +    P  +  A+  YA + +
Sbjct: 203 PRDWWVEDLAELSIDLFKRVVSTIRRKGGVLPEVIGEALEVYAAKRI 249



>gb:AB186127_1529351 Oryza sativa (japonica cultivar-group) mRNA for
           NPH3, complete cds.
          Length = 762

 Score =  121 bits (304), Expect = 1e-26
 Identities = 73/275 (26%), Positives = 127/275 (46%), Gaps = 62/275 (22%)
 Frame = +1

Query: 190 MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEAD--------- 342
           + R   W  + +IP+D++V+VG+ +F LHK+ ++++S  + + + +S  AD         
Sbjct: 37  VRRDRSWYVNSDIPSDLLVKVGDVNFYLHKYPMISRSGRMSRAVYESSAADEAEADAAAA 96

Query: 343 LTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRT 522
           +  + +  +PGG   FE AA+F YG+  ++T  N++ LRCAAEYL+MT++  + NL  +T
Sbjct: 97  VAVVEMGDLPGGAGSFELAARFSYGMAVDLTAANISGLRCAAEYLEMTEEMEEGNLIFKT 156

Query: 523 EDFXXXXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACV------------ 666
           E F                  CE L P AE+L+IV+RC E  + KAC             
Sbjct: 157 EAFLSYVVLSSWRDSIAVLKSCEALSPWAENLQIVRRCSESIAWKACANPRGVRWAYTGA 216

Query: 667 --------------------------------------EANFPSRS---PPNWWTEELTI 723
                                                 + + PSR    P +WW E++++
Sbjct: 217 GAGSGGARGGPAAIRGGGGSGGTASPRWNVGGGGGGESKESSPSRQAVPPADWWFEDVSV 276

Query: 724 LDVAFFARIIATMRSRTAKPLTLASAIITYAERSL 828
           L +  F R++  ++ +  +   + +AI  YA + L
Sbjct: 277 LRIDHFVRVVTAIKVKGMRFDLIGAAITHYASKWL 311



>gb:AB007645_1510162 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K8K14.
          Length = 579

 Score =  121 bits (304), Expect = 1e-26
 Identities = 73/227 (32%), Positives = 113/227 (49%), Gaps = 25/227 (11%)
 Frame = +1

Query: 223 EIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS---KEADLTRINLSGIPGGPEIFE 393
           E+ TDV+V VG+  F LHKF L++KS  ++KLI  +   +++D   I +  IPGGP  FE
Sbjct: 26  ELATDVVVIVGDVKFHLHKFPLLSKSARLQKLIATTTTDEQSDDDEIRIPDIPGGPPAFE 85

Query: 394 RAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXXXXX 573
             AKFCYG+   +  +NV A+RCAAEYL+M +   + NL  + E F              
Sbjct: 86  ICAKFCYGMAVTLNAYNVVAVRCAAEYLEMYESIENGNLVYKMEVFLNSSVLRSWKDSII 145

Query: 574 XXXXCEELLPLAEDLKIVQRCVELASAKACVEANFPSR---------------------S 690
                    P +ED+K+  RC+E  + KA ++   P+R                      
Sbjct: 146 VLQTTRSFYPWSEDVKLDVRCLESIALKAAMD---PARVDWSYTYNRRKLLPPEMNNNSV 202

Query: 691 PPNWWTEELTILDVAFFARIIATMRSR-TAKPLTLASAIITYAERSL 828
           P +WW E+L  L +  F R+++T+R +    P  +  A+  YA + +
Sbjct: 203 PRDWWVEDLAELSIDLFKRVVSTIRRKGGVLPEVIGEALEVYAAKRI 249



>gb:AB013389_1512060 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K1F13.
          Length = 597

 Score =  118 bits (295), Expect = 2e-25
 Identities = 73/242 (30%), Positives = 110/242 (45%), Gaps = 35/242 (14%)
 Frame = +1

Query: 208 WVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEAD-LTRINLSGIPGGPE 384
           W  +  +P+D+ +EV + +F LHKF L++KS  + +LI + +  +    I L   PG  E
Sbjct: 13  WFCTTGLPSDIEIEVDDMTFHLHKFPLMSKSRKLHRLITEQETKNGYPHIKLEDFPGSSE 72

Query: 385 IFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXX 564
            FE  AKFCYGV  +++   V  LRCAAE+L+MT++Y  +NL  +TE F           
Sbjct: 73  SFEMVAKFCYGVKMDLSASTVVPLRCAAEHLEMTEEYSPDNLISKTERFLSHSVYKSLRE 132

Query: 565 XXXXXXXCEELLPLAEDLKIVQRCV---------------------------------EL 645
                  CE + PLA  L I ++C+                                 +L
Sbjct: 133 SIKALKACESVSPLAGSLGITEQCIDSIVSRASSADPSLFGWPVNDGGGRGNISATDLQL 192

Query: 646 ASAKACVEANFPSR-SPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAER 822
               A      PSR S    W E+LT L +  F  +I +MRS       + S +I YA++
Sbjct: 193 IPGGAAKSRKKPSRDSNMELWFEDLTQLSLPIFKTVILSMRSGDLSSDIIESCLICYAKK 252

Query: 823 SL 828
            +
Sbjct: 253 HI 254



>gb:AP006068_1860884 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0020D05.>gb:AP006069_1860892 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0025F02.
          Length = 771

 Score =  116 bits (290), Expect = 6e-25
 Identities = 73/278 (26%), Positives = 127/278 (45%), Gaps = 65/278 (23%)
 Frame = +1

Query: 190 MERTGQWVFSQEIPTDVIVEVGEASFSLHK---FMLVAKSNYIRKLIMDSKEAD------ 342
           + R   W  + +IP+D++V+VG+ +F LHK   + ++++S  + + + +S  AD      
Sbjct: 37  VRRDRSWYVNSDIPSDLLVKVGDVNFYLHKMDQYPMISRSGRMSRAVYESSAADEAEADA 96

Query: 343 ---LTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLA 513
              +  + +  +PGG   FE AA+F YG+  ++T  N++ LRCAAEYL+MT++  + NL 
Sbjct: 97  AAAVAVVEMGDLPGGAGSFELAARFSYGMAVDLTAANISGLRCAAEYLEMTEEMEEGNLI 156

Query: 514 GRTEDFXXXXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACV--------- 666
            +TE F                  CE L P AE+L+IV+RC E  + KAC          
Sbjct: 157 FKTEAFLSYVVLSSWRDSIAVLKSCEALSPWAENLQIVRRCSESIAWKACANPRGVRWAY 216

Query: 667 -----------------------------------------EANFPSRS---PPNWWTEE 714
                                                    + + PSR    P +WW E+
Sbjct: 217 TGAGAGSGGARGGPAAIRGGGGSGGTASPRWNVGGGGGGESKESSPSRQAVPPADWWFED 276

Query: 715 LTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL 828
           +++L +  F R++  ++ +  +   + +AI  YA + L
Sbjct: 277 VSVLRIDHFVRVVTAIKVKGMRFDLIGAAITHYASKWL 314



>gb:AC117988_1739426 Oryza sativa chromosome 3 BAC OSJNBa0057G07
           genomic sequence, complete sequence.
          Length = 632

 Score =  116 bits (290), Expect = 6e-25
 Identities = 66/169 (39%), Positives = 94/169 (55%), Gaps = 1/169 (0%)
 Frame = +1

Query: 325 DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN 504
           + +E     I     PGGP  FE AAKFCYGV  E+T  NVA LRCAAEYL+MT+++ ++
Sbjct: 66  EEEEGQAFCIAFPDFPGGPGTFETAAKFCYGVRVELTAWNVAPLRCAAEYLEMTEEHAED 125

Query: 505 NLAGRTEDFXXXXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACVEANFPS 684
           NLA R E F                  CEELLP AE+L IV RCVE  +A+    ++  S
Sbjct: 126 NLAARAEAFLEQAVLRHPGEATKALKSCEELLPHAEELGIVGRCVEAIAAR----SSAAS 181

Query: 685 RSPPNWWTEELTILDVAFFARIIATMRSRT-AKPLTLASAIITYAERSL 828
           RS    W ++L +L +  + R++A M +R   +     S +++YA  ++
Sbjct: 182 RS----WFDDLAVLGLHMYKRVMAAMAARADVRTEARESCLVSYARGTI 226



>pir|T04716|T04716 hypothetical protein F19F18.80 - Arabidopsis
           thaliana>gb:ATCHRIV87_1547713 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           87.>gb:ATF19F18_1549299 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F19F18 (ESSA project).
          Length = 586

 Score =  113 bits (282), Expect = 5e-24
 Identities = 67/215 (31%), Positives = 102/215 (47%), Gaps = 30/215 (13%)
 Frame = +1

Query: 217 SQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTR-----------INLS 363
           S E+ TDVIV +G+  F LHKF L++KS  ++KLI  S  +               I ++
Sbjct: 30  SSELATDVIVIIGDVKFYLHKFPLLSKSARLQKLITTSTSSSNEENQIHHHHHEDEIEIA 89

Query: 364 GIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXX 543
            IPGGP  FE  AKFCYG+   +  +NV A RCAAE+L+M +     NL  + E F    
Sbjct: 90  EIPGGPASFEICAKFCYGMTVTLNAYNVVAARCAAEFLEMYETVEKGNLVYKIEVFLNSS 149

Query: 544 XXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACVEAN---------------- 675
                            L P +E+LK+  RC++  +++A ++ +                
Sbjct: 150 ILQSWKDSIIVLQTTRALSPYSEELKLTGRCLDSIASRASIDTSKVEWSYTYSKKKNLDN 209

Query: 676 ---FPSRSPPNWWTEELTILDVAFFARIIATMRSR 771
               P   P +WW E+L  L +  + R +AT+ +R
Sbjct: 210 GLRKPQAVPRDWWVEDLCDLHIDLYKRALATIEAR 244



>gb:AY054668_1563322 Arabidopsis thaliana putative protein
           (At4g37590; F19F18.80) mRNA, complete
           cds.>gb:AY081497_1568757 Arabidopsis thaliana putative
           protein (At4g37590) mRNA, complete cds.
          Length = 580

 Score =  112 bits (279), Expect = 1e-23
 Identities = 66/215 (30%), Positives = 102/215 (47%), Gaps = 30/215 (13%)
 Frame = +1

Query: 217 SQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTR-----------INLS 363
           S ++ TDVIV +G+  F LHKF L++KS  ++KLI  S  +               I ++
Sbjct: 24  SSDLATDVIVIIGDVKFYLHKFPLLSKSARLQKLITTSTSSSNEENQIHHHHHEDEIEIA 83

Query: 364 GIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXX 543
            IPGGP  FE  AKFCYG+   +  +NV A RCAAE+L+M +     NL  + E F    
Sbjct: 84  EIPGGPASFEICAKFCYGMTVTLNAYNVVAARCAAEFLEMYETVEKGNLVYKIEVFLNSS 143

Query: 544 XXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACVEAN---------------- 675
                            L P +E+LK+  RC++  +++A ++ +                
Sbjct: 144 ILQSWKDSIIVLQTTRALSPYSEELKLTGRCLDSIASRASIDTSKVEWSYTYSKKKNLDN 203

Query: 676 ---FPSRSPPNWWTEELTILDVAFFARIIATMRSR 771
               P   P +WW E+L  L +  + R +AT+ +R
Sbjct: 204 GLRKPQAVPRDWWVEDLCDLHIDLYKRALATIEAR 238



>gb:AY448010S4_1606587 Ipomoea trifida haplotype S1
           self-incompatibility (S-) locus, contig SR4.
          Length = 652

 Score =  107 bits (268), Expect = 2e-22
 Identities = 67/260 (25%), Positives = 111/260 (42%), Gaps = 53/260 (20%)
 Frame = +1

Query: 208 WVFSQEIPTDVIVEVGEASFSLHKFM-----------------------LVAKSNYIRKL 318
           W  +  +P+D+ + V   +F LHKF                        L++K   I K 
Sbjct: 17  WFCNASLPSDISLIVDGVNFHLHKFYSGVIYDTLNSNLTTKKMLTVQFPLISKCGRIFKA 76

Query: 319 IMDSK--EADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDK 492
           + +++      +   L   PGG +IF    K+CYG   E T  N+  + CAA+YL+MTD+
Sbjct: 77  LEEAEGTNGQTSTTRLEDFPGGADIFLVTVKYCYGCRVEFTPRNIVMVYCAADYLEMTDE 136

Query: 493 YCDNNLAGRTEDFXXXXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACVEA 672
           Y +NNL  +++D+                  C  ++P A  L+I+ +C+   S   C + 
Sbjct: 137 YGENNLLSKSDDYFHKNVLTNWKDCILALQSCNSMIPRAIKLQIIGKCLNALSVMVCTDP 196

Query: 673 N--------FPSRSPP--------------------NWWTEELTILDVAFFARIIATMRS 768
           +        + S   P                    +WW E+++ L V  F R+I TM +
Sbjct: 197 SLFGWPMLMYGSLQSPGGSILWNGINTGARIQSTASDWWFEDISYLSVPLFERLIQTMET 256

Query: 769 RTAKPLTLASAIITYAERSL 828
           +  KP +LA AI+ Y  + L
Sbjct: 257 KGIKPESLAGAIMHYCRKYL 276



>gb:AB023039_1515419 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MIF21.
          Length = 625

 Score =  106 bits (265), Expect = 5e-22
 Identities = 71/233 (30%), Positives = 107/233 (45%), Gaps = 26/233 (11%)
 Frame = +1

Query: 208 WVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINL-SGIPGGPE 384
           W     +P  V V V   SF+LHK +L AKS Y ++     +E  L+ I +    PGG E
Sbjct: 33  WSKETGLPASVHVRVCNKSFNLHKSLLCAKSGYFKE-----REDQLSEIEIPQEFPGGAE 87

Query: 385 IFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXX 564
            FE+   F YG    I   N+A LRCAA++L+MT+++   NL  R + +           
Sbjct: 88  TFEKIMLFIYGCPTLIHPFNIAGLRCAAQFLEMTEQHSTGNLCERFDLYLNQVVLQNWDD 147

Query: 565 XXXXXXXCEELLPLAEDLKIVQRCVELASAKACVEANFPSRSPPN------------W-- 702
                  C++L+P +EDL IV RC+E  +  AC+E   P R                W  
Sbjct: 148 TLVVLKKCQDLVPWSEDLLIVSRCIESLAFTACMEILDPERRREKPVIMLEGMVNQPWEY 207

Query: 703 -----------WTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL 828
                      W ++LT L   FF +II ++R +  K   ++  +  YA +S+
Sbjct: 208 TNIERIINQDTWIKDLTDLPFEFFKKIIGSLRRQGMKERYVSPLVALYASKSV 260



>gb:AB016886_1513138 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MCA23.>gb:BT005761_1638685 Arabidopsis thaliana
           clone RAFL15-17-A20 (R20741) putative
           photoreceptor-interacting protein (At5g47800) mRNA,
           complete cds.>gb:BT006083_1638977 Arabidopsis thaliana
           clone U20741 putative photoreceptor-interacting protein
           (At5g47800) mRNA, complete cds.
          Length = 559

 Score =  106 bits (265), Expect = 5e-22
 Identities = 62/219 (28%), Positives = 101/219 (46%), Gaps = 17/219 (7%)
 Frame = +1

Query: 223 EIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAA 402
           + P D+++ +   ++ LH+  LV K   +R+L  D +E+D   I L+ IPGG + FE  A
Sbjct: 25  DTPNDLVIRINNTTYHLHRSCLVPKCGLLRRLCTDLEESDTVTIELNDIPGGADAFELCA 84

Query: 403 KFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXXXXXXXX 582
           KFCY +   ++ HN+    CA+++L+M+D     NL  + E F                 
Sbjct: 85  KFCYDITINLSAHNLVNALCASKFLRMSDSVDKGNLLPKLEAFFHSCILQGWKDSIVTLQ 144

Query: 583 XCEELLPLAEDLKIVQRCVELASAKACVEANFPSRS----------------PPNWWTEE 714
              +L    E+L IV++C++    K     +  S S                P +WWTE+
Sbjct: 145 STTKLPEWCENLGIVRKCIDSIVEKILTPTSEVSWSHTYTRPGYAKRQHHSVPRDWWTED 204

Query: 715 LTILDVAFFARIIATMRSR-TAKPLTLASAIITYAERSL 828
           ++ LD+  F  +I   RS  T  P  +  A+  Y  R L
Sbjct: 205 ISDLDLDLFRCVITAARSTFTLPPQLIGEALHVYTCRWL 243



>pir|T51779|T51779 non-phototropic hypocotyl 3-like protein -
           Arabidopsis thaliana>gb:ATF28D10_1550295 Arabidopsis
           thaliana DNA chromosome 3, BAC clone F28D10.
          Length = 661

 Score =  106 bits (264), Expect = 6e-22
 Identities = 68/249 (27%), Positives = 112/249 (44%), Gaps = 34/249 (13%)
 Frame = +1

Query: 184 LAMERTGQWVF---SQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEAD---L 345
           + ++ TG  +F      + +D+ V V +  F LHKF LV+K   + ++  DSK  D   L
Sbjct: 49  ILLKETGIGIFRFCKTGLSSDITVVVDDVKFHLHKFPLVSKCGKLARMYEDSKSTDKQSL 108

Query: 346 TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE 525
               L   PGG + F   A+FCYG   +IT  N+ ++ CAAEYL+MT++Y ++NL  + E
Sbjct: 109 WTTVLEEFPGGADNFLIVARFCYGARVDITSKNLVSIHCAAEYLEMTNEYGEDNLISQVE 168

Query: 526 DFXXXXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACVEANF--------- 678
            F                     +L  AE L+++ + +   S   C + +          
Sbjct: 169 TFLHKHVLRNWKDCILALQSSSPVLKSAEKLQMIPKLMNAVSTMVCTDPSLFGWPMMMYG 228

Query: 679 -------------------PSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASA 801
                                 S  +WW E+++ L V  F R+I TM ++  +  +LA A
Sbjct: 229 TLQSPGGSILWNGINTGARMRSSGSDWWYEDISYLSVDLFKRLIKTMETKGIRAESLAGA 288

Query: 802 IITYAERSL 828
           ++ YA + L
Sbjct: 289 MMYYARKYL 297



>gb:AP003747_1832804 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1127_E01.
          Length = 547

 Score =  103 bits (256), Expect = 5e-21
 Identities = 76/259 (29%), Positives = 111/259 (42%), Gaps = 35/259 (13%)
 Frame = +1

Query: 151 SPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS 330
           SP  S +T L L   R   W      P  V V VG+ SF+LHK  LV++  Y+R+ I+  
Sbjct: 12  SPYSSPSTAL-LLQRRVVSWAKETGSPATVSVHVGDRSFNLHKDPLVSRCGYLRQAILRC 70

Query: 331 KEADLTRINL-SGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNN 507
            + D   + L +  PGG E FE    +CYG    +   NVAA+RCAAE+L +      + 
Sbjct: 71  GDGDGEVVELPASFPGGSEAFEVIGLYCYGDAVALDPFNVAAVRCAAEFLDV------SG 124

Query: 508 LAGRTEDFXXXXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACVEANFP-- 681
           L  R + +                  C+ LLP+AE+L +V RCVE  +  AC+E   P  
Sbjct: 125 LGARCDLYINQVVLQSWDDALIVLQRCQPLLPVAEELLVVSRCVESLAFMACMEILDPDG 184

Query: 682 -----SRSPP--------------NW-------------WTEELTILDVAFFARIIATMR 765
                 R  P               W             W ++L  L   FF RI+  +R
Sbjct: 185 DEQRRERDQPGLLAAAAARGLAGRRWDAELVKELAARDLWIKDLVALPFEFFRRIVLALR 244

Query: 766 SRTAKPLTLASAIITYAER 822
            +  K   ++  ++ YA +
Sbjct: 245 RQGMKEKYVSPVVLFYANK 263



>gb:AY049300_1561942 Arabidopsis thaliana AT5g66560/K1F13_23 mRNA,
           complete cds.>gb:BT001071_1635326 Arabidopsis thaliana
           At5g66560/K1F13_23 mRNA, complete cds.
          Length = 668

 Score =  103 bits (256), Expect = 5e-21
 Identities = 76/285 (26%), Positives = 111/285 (38%), Gaps = 78/285 (27%)
 Frame = +1

Query: 208 WVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM--------------------- 324
           W  +  +P+D+ +EV + +F LHKF L++KS  + +LI                      
Sbjct: 13  WFCTTGLPSDIEIEVDDMTFHLHKFPLMSKSRKLHRLITEQETRSSSSMALITVIDPKVE 72

Query: 325 ------------DSKEAD-----------LTRINLSGIPGGPEIFERAAKFCYGVNFEIT 435
                       D KE +              I L   PG  E FE  AKFCYGV  +++
Sbjct: 73  ETDKKGKGHEIEDDKEEEEVEEQEIEENGYPHIKLEDFPGSSESFEMVAKFCYGVKMDLS 132

Query: 436 VHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXXXXXXXXXCEELLPLAED 615
              V  LRCAAE+L+MT++Y  +NL  +TE F                  CE + PLA  
Sbjct: 133 ASTVVPLRCAAEHLEMTEEYSPDNLISKTERFLSHSVYKSLRESIKALKACESVSPLAGS 192

Query: 616 LKIVQRCV---------------------------------ELASAKACVEANFPSR-SP 693
           L I ++C+                                 +L    A      PSR S 
Sbjct: 193 LGITEQCIDSIVSRASSADPSLFGWPVNDGGGRGNISATDLQLIPGGAAKSRKKPSRDSN 252

Query: 694 PNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL 828
              W E+LT L +  F  +I +MRS       + S +I YA++ +
Sbjct: 253 MELWFEDLTQLSLPIFKTVILSMRSGDLSSDIIESCLICYAKKHI 297



>gb:OSJN00035_1693653 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0044K18, complete sequence.
          Length = 627

 Score =  102 bits (253), Expect = 1e-20
 Identities = 67/211 (31%), Positives = 98/211 (46%), Gaps = 7/211 (3%)
 Frame = +1

Query: 217 SQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFER 396
           S ++ TD+ + V    F LHKF L++K  +++ L ++S +     + L   PGG E FE 
Sbjct: 23  STDLATDMQILVDGCLFRLHKFPLLSKCMWLQALCVESGDGG-GAVELPAFPGGAEAFEA 81

Query: 397 AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXXXXXX 576
            AKFCYGV   I  HNV A+RCAA  L M++     NLA + + F               
Sbjct: 82  CAKFCYGVAVTIGPHNVVAVRCAAARLGMSEAADRGNLAAKLDAFLSSCLLRRWKDALAV 141

Query: 577 XXXCEELLPLAEDLKIVQRCVELASAKA------CVEANFPSRSPPNWWTEELTILDVAF 738
                    L E+L +  RCV+  +A A       V A   S SPP WW  +++ L V  
Sbjct: 142 LHSTRRYAALCEELGVTSRCVDAVAALAVGDASGAVPAGSSSSSPP-WWARDISELGVDL 200

Query: 739 FARI-IATMRSRTAKPLTLASAIITYAERSL 828
           + R+ +A   + T     +   +  YA R L
Sbjct: 201 YWRVMVAVKATGTVHAKAIGDTLKAYARRWL 231



>pir|G96701|G96701 unknown protein, 76653-74502 [imported] -
           Arabidopsis thaliana>gb:AE005173_894412 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC012563_1537764 Arabidopsis thaliana
           chromosome 1 BAC T23K23 genomic sequence, complete
           sequence.>gb:AY120729_1579611 Arabidopsis thaliana
           unknown protein (At1g67900) mRNA, complete
           cds.>gb:BT008787_1639983 Arabidopsis thaliana At1g67900
           gene, complete cds.
          Length = 631

 Score =  102 bits (253), Expect = 1e-20
 Identities = 65/225 (28%), Positives = 104/225 (46%), Gaps = 21/225 (9%)
 Frame = +1

Query: 217 SQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFER 396
           S E+ +D  +EV  + + LHKF L++K   ++++  +S E+    I L   PGG E FE 
Sbjct: 23  SSEVSSDFTIEVSGSRYLLHKFPLLSKCLRLQRMCSESPESI---IQLPEFPGGVEAFEL 79

Query: 397 AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXXXXXX 576
            AKFCYG+   I+ +N+ A RCAAEYLQM+++    NL  + E F               
Sbjct: 80  CAKFCYGITITISAYNIVAARCAAEYLQMSEEVEKGNLVYKLEVFFNSCILNGWRDSIVT 139

Query: 577 XXXCEELLPLAEDLKIVQRCVELASAKAC--------------------VEANFPSRSPP 696
               +     +EDL I  RC+E  ++K                      + +N  + S  
Sbjct: 140 LQTTKAFPLWSEDLAITSRCIEAIASKVLSHPSKVSLSHSHSRRVRDDDMSSNRAAASSR 199

Query: 697 NWWTEELTILDVAFFARIIATMRSRTAKPLTL-ASAIITYAERSL 828
            WW E++  L +  + R +  ++S    P +L   A+  YA + L
Sbjct: 200 GWWAEDIAELGIDLYWRTMIAIKSGGKVPASLIGDALRVYASKWL 244



>pir|H84619|H84619 hypothetical protein At2g23050 [imported] -
           Arabidopsis thaliana>gb:AC004401_1531653 Arabidopsis
           thaliana chromosome 2 clone F21P24 map CIC06C07,
           complete sequence.>gb:AY102541_1577770 Arabidopsis
           thaliana hypothetical protein (At2g23050/F21P24.11)
           mRNA, complete cds.>gb:BT005613_1638553 Arabidopsis
           thaliana clone U50388 unknown protein (At2g23050) mRNA,
           complete cds.>gb:AK117486_1815518 Arabidopsis thaliana
           At2g23050 mRNA for unknown protein, complete cds, clone:
           RAFL17-11-E06.
          Length = 481

 Score =  102 bits (253), Expect = 1e-20
 Identities = 62/229 (27%), Positives = 111/229 (48%), Gaps = 25/229 (10%)
 Frame = +1

Query: 217 SQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEAD-----LTRINLSGIPGGP 381
           + E+ T++I+ +G   F LHKF L++KS +++K I  SK  +     +  I++S IPGG 
Sbjct: 24  TNELETEIIIIIGNVKFYLHKFPLLSKSGFLQKHIATSKNEEEKKNQIDEIDISEIPGGS 83

Query: 382 EIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXX 561
             FE   KFCYG+   +  +NV A+RCAAE+L+M + +  +NL  + + F          
Sbjct: 84  VAFEICVKFCYGITVTLNAYNVVAVRCAAEFLEMNETFEKSNLVYKIDVFLNSTIFRSWK 143

Query: 562 XXXXXXXXCEELLPLAEDLKIVQRCVELASAKACVEANFPSRS----------------- 690
                    ++LL   +  ++V+RC+   ++ A ++ +    S                 
Sbjct: 144 DSIIVLQTTKDLLS-DDSEELVKRCLGSIASTASIDTSKVKWSYTYNRKKKLEKVRKPED 202

Query: 691 --PPNWWTEELTILDVAFFARIIATMRSRTAKPL-TLASAIITYAERSL 828
             P +WW E+L  L +  + + I  +++R   P   +  A+  YA R +
Sbjct: 203 GVPKDWWVEDLCELHIDLYKQAIKAIKNRGKVPSNVIGEALHAYAIRRI 251



>pir|T06304|T06304 hypothetical protein F11C18.20 - Arabidopsis
           thaliana>gb:ATCHRIV75_1547103 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           75.>gb:ATF11C18_1548261 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F11C18 (ESSA project).
          Length = 498

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 50/160 (31%), Positives = 74/160 (46%), Gaps = 26/160 (16%)
 Frame = +1

Query: 367 IPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXX 546
           +PGG + FE  AKFCYG+   +  +N+ A+RCAAEYL+MT+     NL  + E F     
Sbjct: 1   MPGGYKAFEICAKFCYGMTVTLNAYNITAVRCAAEYLEMTEDADRGNLIYKIEVFLNSGI 60

Query: 547 XXXXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACVEANFPSRS------------ 690
                           LLP +EDLK+V RC++  SAK  V     + S            
Sbjct: 61  FRSWKDSIIVLQTTRSLLPWSEDLKLVGRCIDSVSAKILVNPETITWSYTFNRKLSGPDK 120

Query: 691 --------------PPNWWTEELTILDVAFFARIIATMRS 768
                         P +WW E++  L++  F R+I+ ++S
Sbjct: 121 IVEYHREKREENVIPKDWWVEDVCELEIDMFKRVISVVKS 160



>gb:AP001298_1820987 Arabidopsis thaliana genomic DNA, chromosome 3,
           BAC clone:F20C19.
          Length = 588

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 64/242 (26%), Positives = 100/242 (41%), Gaps = 38/242 (15%)
 Frame = +1

Query: 217 SQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTR----INLSGIPGGPE 384
           S ++  D++++V    + LHKF +++K   ++ L+  S+E + ++    I L   PG  E
Sbjct: 23  SSDLLNDLVIQVKSTKYLLHKFPMLSKCLRLKNLV-SSQETETSQEQQVIQLVDFPGETE 81

Query: 385 IFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKY---CDNNLAGRTEDFXXXXXXXX 555
            FE  AKFCYG+   +  HNV A+RCAAEYL MT++       NL  R E F        
Sbjct: 82  AFELCAKFCYGITITLCAHNVVAVRCAAEYLGMTEEVELGETENLVQRLELFLTTCVFKS 141

Query: 556 XXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKA------------------------- 660
                      + L   +EDL I  RC+E  +                            
Sbjct: 142 WRDSYVTLQTTKVLPLWSEDLGITNRCIEAIANGVTVSPGEDFSTQLETGLLRNRSRIRR 201

Query: 661 ----CVEANFPSRSPPNWWTEELTILDVAFFARIIATMRS--RTAKPLTLASAIITYAER 822
               C            WW E+L  L +  + R +  ++S  R   P  + +A+  YA +
Sbjct: 202 DEILCNGGGGSKAESLRWWGEDLAELGLDLYRRTMVAIKSSHRKISPRLIGNALRIYASK 261

Query: 823 SL 828
            L
Sbjct: 262 WL 263



>gb:AP005903_1859850 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC
           clone:B1012G11.>gb:AP005969_1860420 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OJ1119_C03.
          Length = 594

 Score = 79.3 bits (194), Expect = 8e-14
 Identities = 61/246 (24%), Positives = 99/246 (40%), Gaps = 44/246 (17%)
 Frame = +1

Query: 223 EIPTDVIVEVGEASFSLHK----------------------FMLVAKSNYIRKLI----- 321
           ++P D+I+ V    + LHK                      F L+ K   +++L      
Sbjct: 25  DVPADLIIHVNNTKYQLHKLKFCSHSENADTEGTGCHPYYQFPLLLKCGLLQRLCSDDDG 84

Query: 322 MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD 501
           +D  +A    + L  IPGG E FE  AKFCYG++  I   N  A   AA +L+MT+    
Sbjct: 85  VDGVDAAPVPVALHDIPGGEEAFELCAKFCYGISINIGAGNFVAAALAARFLRMTEAVAK 144

Query: 502 NNLAGRTEDFXXXXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVELASAKACVEANFP 681
            NL  + + F                     +   +E  +IVQ CV+    K     +  
Sbjct: 145 GNLVAKLDSFFDSCILQGWKDPIAALTAAWRISGWSES-RIVQPCVDAIVEKILTPPSKV 203

Query: 682 SRS----------------PPNWWTEELTILDVAFFARIIATM-RSRTAKPLTLASAIIT 810
           + S                P +WWTE+++ LD+  F  +++T+  +R   P  +  A+  
Sbjct: 204 TWSYTYTRPGYAKKAHQSVPKDWWTEDVSELDIDVFRSLLSTVCAARLLPPPLIGEALHV 263

Query: 811 YAERSL 828
           YA + L
Sbjct: 264 YACKHL 269



>pir|C84709|C84709 hypothetical protein At2g30510 [imported] -
           Arabidopsis thaliana>gb:U93215_1726554 Arabidopsis
           thaliana chromosome 2 BAC T6B20 genomic sequence,
           complete sequence.
          Length = 415

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 33/51 (64%), Positives = 42/51 (82%)
 Frame = +1

Query: 676 FPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAERSL 828
           FP R+PPNWWTEEL ILDV FF+ ++++M+ R  KP +LASAIITY E+SL
Sbjct: 2   FPCRTPPNWWTEELCILDVDFFSDVVSSMKQRGVKPSSLASAIITYTEKSL 52



>gb:AP005292_1850005 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1340_C08.
          Length = 440

 Score = 73.6 bits (179), Expect = 4e-12
 Identities = 48/154 (31%), Positives = 72/154 (46%), Gaps = 17/154 (11%)
 Frame = +1

Query: 418 VNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXXXXXXXXXCEEL 597
           V  E+T  NVA LRCAAEYL+MT+++ ++NL  R E +                   EEL
Sbjct: 63  VRVELTAWNVAPLRCAAEYLEMTEEHAEDNLTARVEAYLEQAVLRHSCEATKALKSREEL 122

Query: 598 LPLAEDLKIVQRCVELAS-----AKACVEANFPSRSPP-----------NWWTEELTILD 729
           LP AE+L IV RCVE  S          E N    + P             W ++L +L 
Sbjct: 123 LPHAEELGIVSRCVEAISIFTSGVNLNEEQNMDHLTSPFATTARSSAASRSWFDDLAVLG 182

Query: 730 VAFFARIIATMRSRT-AKPLTLASAIITYAERSL 828
           +  + R++A M +R   +     S +++YA  ++
Sbjct: 183 LDMYRRVMAAMAARADVRTEARESCLVSYARGTI 216



>gb:AB025631_1516560 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MPN9.>gb:AK175315_1817303 Arabidopsis thaliana
           mRNA for hypothetical protein, complete cds, clone:
           RAFL21-75-H23.>gb:AK176753_1818741 Arabidopsis thaliana
           mRNA for hypothetical protein, complete cds, clone:
           RAFL25-29-E14.>gb:AK176817_1818805 Arabidopsis thaliana
           mRNA for hypothetical protein, complete cds, clone:
           RAFL25-37-F21.
          Length = 554

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 49/213 (23%), Positives = 86/213 (40%), Gaps = 46/213 (21%)
 Frame = +1

Query: 262 SFSLHKFMLVAKSNYIRKLIMDSKEADLTR------INLSGIPGGPEIFERAAKFCYGVN 423
           +F +++ ++   S ++RK+I  S +           I +   PGG + F+   +FCYG  
Sbjct: 16  TFFVNQDLISEYSGFLRKMIKQSNKKKKNHKNSRIIIEVEDFPGGSDGFDLVLRFCYGGG 75

Query: 424 FEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXXXXXXXXXCEELLP 603
             I V NV+ L C++ +L+MT+K C +NL  RTE F                  CE++  
Sbjct: 76  ISIDVSNVSILHCSSVFLEMTEKLCSSNLLLRTEKFLEGMFYWSWNDIVLCLKSCEQVFL 135

Query: 604 LAEDLKIVQRCV-----------------------ELASAKACVEA-------------- 672
            A+   +V + V                         ASA A  ++              
Sbjct: 136 HADSYGLVDKLVFGVLAKIPQNSDVSHVFSSSSPSSSASASASSQSPETAMIRSYSDKRS 195

Query: 673 ---NFPSRSPPNWWTEELTILDVAFFARIIATM 762
              +F  R+   WW ++++IL      ++I T+
Sbjct: 196 TSRSFSCRTSNEWWFDDMSILGPKIIEKLINTL 228



>gb:AY080713_1568435 Arabidopsis thaliana unknown protein
           (At1g50280) mRNA, complete cds.>gb:BT003005_1636587
           Arabidopsis thaliana clone U18076 unknown protein
           (At1g50280) mRNA, complete cds.
          Length = 525

 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 53/233 (22%), Positives = 96/233 (41%), Gaps = 41/233 (17%)
 Frame = +1

Query: 253 GEASFSLHKFMLVAKSNYIRKLIMDSKEAD-----LTRINLSGIPGGPEIFERAAKFCY- 414
           G+ +F L++ ++   S  +RK+I  SK+       +  I ++  PGGP+ FE  ++FCY 
Sbjct: 13  GQYTFFLNQNVISKYSGSLRKMIKQSKKKRNKKKRIITIEINDFPGGPDGFELVSRFCYH 72

Query: 415 GVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXXXXXXXXXCEE 594
                I V NV+ L C + +L M++K+C +NL  +TE F                  CE+
Sbjct: 73  NGEILIDVSNVSTLYCCSVFLGMSEKFCFSNLFLQTEKFLEEVFYGSWSDIVSCLKNCEQ 132

Query: 595 LLPLAEDLKIVQRCV----------------------------ELASAKACVEANFPSRS 690
           +   A+   +V + +                            E+A   +  +  + SRS
Sbjct: 133 VFFQADSYGLVDKLIFAALNKISQNSDDFSSSSLSSFASSLSPEMAKNTSESDGRYISRS 192

Query: 691 -----PPNWWTEELTILDVAFFARIIATMRS--RTAKPLTLASAIITYAERSL 828
                   WW E++T L      +++  + +     K L L   ++ Y +  L
Sbjct: 193 VACGRSNEWWFEDMTNLSPKIILKLVMIIGAYKTNIKSLVLTRFLLHYLKTKL 245



>gb:BT012660_1641730 Arabidopsis thaliana At3g19850 gene, complete
           cds.
          Length = 521

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 43/177 (24%), Positives = 70/177 (39%), Gaps = 40/177 (22%)
 Frame = +1

Query: 352 INLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDF 531
           I +   PGG + F+   +FCYG    I V NV+ L C++ +L+MT+K C +NL  RTE F
Sbjct: 19  IEVEDFPGGSDGFDLVLRFCYGGGISIDVSNVSILHCSSVFLEMTEKLCSSNLLLRTEKF 78

Query: 532 XXXXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCV-----------------------E 642
                             CE++   A+   +V + V                        
Sbjct: 79  LEGMFYWSWNDIVLCLKSCEQVFLHADSYGLVDKLVFGVLAKIPQNSDVSHVFSSSSPSS 138

Query: 643 LASAKACVEA-----------------NFPSRSPPNWWTEELTILDVAFFARIIATM 762
            ASA A  ++                 +F  R+   WW ++++IL      ++I T+
Sbjct: 139 SASASASSQSPETAMIRSYSDKRSTSRSFSCRTSNEWWFDDMSILGPKIIEKLINTL 195



>pir|T51462|T51462 hypothetical protein K10A8_60 - Arabidopsis
           thaliana>gb:ATK10A8_1553509 Arabidopsis thaliana DNA
           chromosome 5, BAC clone K10A8 (ESSA project).
          Length = 548

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 33/100 (33%), Positives = 52/100 (52%)
 Frame = +1

Query: 232 TDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFC 411
           +D+ + V    F L K ML  +S+ +  L+ +  E D  R+ L  +   PE FE  A+FC
Sbjct: 7   SDLHINVKGVPFHLCKEMLAKRSSKVSSLL-ERNEIDELRLILRDLEVDPETFELVARFC 65

Query: 412 YGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDF 531
            G  F+ T   + ++ C A YL M ++   NNL G+  +F
Sbjct: 66  NGSEFKFTSDTIVSVLCIAYYLGMNEEQSSNNLLGKASEF 105



>pir|T46056|T46056 hypothetical protein T16K5.250 - Arabidopsis
           thaliana>gb:ATT16K5_1554603 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T16K5.
          Length = 517

 Score = 59.3 bits (142), Expect = 9e-08
 Identities = 47/155 (30%), Positives = 69/155 (44%), Gaps = 6/155 (3%)
 Frame = +1

Query: 196 RTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTR-INLSGIP 372
           R  +W  +     DV V VG   F LHK  L +KS Y+++ +    E  L+  +N++   
Sbjct: 55  RVHKWSLANNSKPDVFVNVGGTRFHLHKDPL-SKSGYLKRHLTGVNELTLSPPLNITA-- 111

Query: 373 GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDK----YCDNNLAGRTEDFXXX 540
              E F   A FCYG + E+T  NV +LR A E L +T+        ++L   TE +   
Sbjct: 112 ---ETFSLVAGFCYGAHIELTPSNVVSLRIAVEVLLITEADDGGRVRDSLRNLTESYLRR 168

Query: 541 XXXXXXXXXXXXXXXCEELLPLAEDLK-IVQRCVE 642
                          C  LLP +E    ++ RCVE
Sbjct: 169 VVFVNVDYIQIVLRSCLLLLPESETTAFLIGRCVE 203



>gb:OSJN00002_1693082 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0018M05, complete sequence.
          Length = 566

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 38/150 (25%), Positives = 63/150 (42%), Gaps = 7/150 (4%)
 Frame = +1

Query: 253 GEASFSLHKFMLVAKSNYIRKLIMDSKE------ADLTRINLSGIPGGPEIFERAAKFCY 414
           G  +  LH+ ++ A S  +R ++   K+      A+   + L+  PGG E FE  A+FCY
Sbjct: 13  GHHTLLLHQSVMCAFSGRLRTMVTQEKKKRKTSRAESLSVKLADFPGGGEGFELVARFCY 72

Query: 415 GVN-FEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXXXXXXXXXCE 591
                 +   N+  L CAA +L+MT++ C  NL  + E F                  CE
Sbjct: 73  NNGRVPLCPSNLPLLHCAAVFLEMTEEVCTCNLLTQAEAFVDGLYYWTWADVLAAVKSCE 132

Query: 592 ELLPLAEDLKIVQRCVELASAKACVEANFP 681
                A+   +++R +    +K       P
Sbjct: 133 PFAAAADASGLLERLISALFSKITANPETP 162



>gb:AC130732_1740965 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0708D12, complete sequence.
          Length = 162

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 27/69 (39%), Positives = 45/69 (65%), Gaps = 2/69 (2%)
 Frame = +1

Query: 283 MLVAKSNYIRKLIMDSKEADLTRI--NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAAL 456
           ++V K  YIRK +  ++    T +  +L  +PGG + F++AA++CY  NF+++V N AAL
Sbjct: 24  VMVPKFGYIRKAVAAARGGITTTVEFDLFTLPGGVDAFDKAARYCYRANFQLSVRNAAAL 83

Query: 457 RCAAEYLQM 483
            CA+ +L M
Sbjct: 84  LCASAFLDM 92



>pir|B96539|B96539 hypothetical protein F14I3.11 [imported] -
           Arabidopsis thaliana>gb:AE005173_892950 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC007980_1536384 Arabidopsis thaliana
           chromosome I BAC F14I3 genomic sequence, complete
           sequence.
          Length = 409

 Score = 56.2 bits (134), Expect = 7e-07
 Identities = 45/203 (22%), Positives = 81/203 (39%), Gaps = 36/203 (17%)
 Frame = +1

Query: 328 SKEADLTRINLSGIPGGPEIFERAAKFCY-GVNFEITVHNVAALRCAAEYLQMTDKYCDN 504
           +K+  +  I ++  PGGP+ FE  ++FCY      I V NV+ L C + +L M++K+C +
Sbjct: 10  NKKKRIITIEINDFPGGPDGFELVSRFCYHNGEILIDVSNVSTLYCCSVFLGMSEKFCFS 69

Query: 505 NLAGRTEDFXXXXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCV--------------- 639
           NL  +TE F                  CE++   A+   +V + +               
Sbjct: 70  NLFLQTEKFLEEVFYGSWSDIVSCLKNCEQVFFQADSYGLVDKLIFAALNKISQNSDDFS 129

Query: 640 -------------ELASAKACVEANFPSRS-----PPNWWTEELTILDVAFFARIIATMR 765
                        E+A   +  +  + SRS        WW E++T L      +++  + 
Sbjct: 130 SSSLSSFASSLSPEMAKNTSESDGRYISRSVACGRSNEWWFEDMTNLSPKIILKLVMIIG 189

Query: 766 S--RTAKPLTLASAIITYAERSL 828
           +     K L L   ++ Y +  L
Sbjct: 190 AYKTNIKSLVLTRFLLHYLKTKL 212



>gb:ATAC009895_1543071 Arabidopsis thaliana chromosome III BAC T21P5
           genomic sequence, complete sequence.
          Length = 484

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 33/180 (18%), Positives = 70/180 (38%)
 Frame = +1

Query: 283 MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRC 462
           ++V+K +     +++S +    R  +  +   P IF    +FCYG   E++  N+ ++ C
Sbjct: 2   LIVSKRSAKVTTLLESNKLHELRWIIRDMDINPSIFHLVTRFCYGYKIELSADNIVSVLC 61

Query: 463 AAEYLQMTDKYCDNNLAGRTEDFXXXXXXXXXXXXXXXXXXCEELLPLAEDLKIVQRCVE 642
            A YL+M+D +  NNL  +   F                  C +        KI+ +   
Sbjct: 62  IAYYLEMSDDHSSNNLLNKAVTFLEQRVLMSWSETVKALCICSD--------KILDKLAN 113

Query: 643 LASAKACVEANFPSRSPPNWWTEELTILDVAFFARIIATMRSRTAKPLTLASAIITYAER 822
           +   +  +++            ++L  L +  +  +I  +         L +++  YA R
Sbjct: 114 VGLIEVFLDSLIEKALNDTRLLQDLITLPLRLYEPLILEVSKHNVSLENLVASVCNYANR 173



>gb:AY040058_1560556 Arabidopsis thaliana unknown protein
           (At3g22104) mRNA, complete cds.>gb:AF360210_1791164
           Arabidopsis thaliana unknown protein (At3g22104) mRNA,
           complete cds.
          Length = 506

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 28/88 (31%), Positives = 50/88 (56%), Gaps = 3/88 (3%)
 Frame = +1

Query: 232 TDVIVEV-GEASFSLHKFMLVAKSNYIRKLIMDSKEADLT-RINLSGIPGGPEIFERAAK 405
           +D+ V++ GE +  L+K ++ A S  +RKL+  S  +    ++  +  PGG E FE  ++
Sbjct: 6   SDLEVDINGEQTIFLNKQIICAYSGTLRKLLGKSTSSSGNLKVIFNDFPGGAESFEFVSR 65

Query: 406 FCYG-VNFEITVHNVAALRCAAEYLQMT 486
           FCY      +   NV  L CAA+++++T
Sbjct: 66  FCYNDGRVAVMPSNVVFLHCAAKFMEVT 93



>gb:BC077331_2560044 Xenopus laevis kelch-like 15 (Drosophila), mRNA
           (cDNA clone MGC:80309 IMAGE:5073806), complete cds.
          Length = 240

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 28/99 (28%), Positives = 51/99 (51%), Gaps = 3/99 (3%)
 Frame = +1

Query: 211 VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI-MDSKEADLTRINLSGIPGGPEI 387
           ++ + +  DV + + E  F  HK +L  +S+Y R +   D +E D  +I L G+      
Sbjct: 24  LYEEGLLVDVTLVIEEHQFQAHKALLATQSDYFRIMFTADMRERDQDKIYLKGLTATG-- 81

Query: 388 FERAAKFCYGVNFEITVHNVAALRCAAEYLQMTD--KYC 498
           F    +F Y  N ++++  V  +  AA Y+Q+T+  K+C
Sbjct: 82  FSHVLQFMYYGNIDLSMATVHEILQAAMYVQLTEVVKFC 120



>gb:BX664740_1991918 Human DNA sequence from clone WI2-85598E4 on
           chromosome 1 Contains the 5' end of the IPP gene for
           intracisternal A particle-promoted polypeptide and a CpG
           island, complete sequence.
          Length = 436

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 31/86 (36%), Positives = 44/86 (51%), Gaps = 1/86 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRINLSGIPGGPEIFERAAKFC 411
           DV ++VG+ SF  H+ +L A S Y   L     KE+    + + GI  G  IF+    F 
Sbjct: 38  DVQLQVGQESFKAHRLVLAASSPYFAALFTGGMKESSKDVVPILGIEAG--IFQILLDFI 95

Query: 412 YGVNFEITVHNVAALRCAAEYLQMTD 489
           Y     I V+NV  L  AA+ LQ+T+
Sbjct: 96  YTGIVNIGVNNVQELIIAADMLQLTE 121



>gb:BC032544_1980525 Homo sapiens intracisternal A particle-promoted
           polypeptide, mRNA (cDNA clone MGC:45221 IMAGE:5535760),
           complete cds.
          Length = 582

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 31/86 (36%), Positives = 44/86 (51%), Gaps = 1/86 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRINLSGIPGGPEIFERAAKFC 411
           DV ++VG+ SF  H+ +L A S Y   L     KE+    + + GI  G  IF+    F 
Sbjct: 38  DVQLQVGQESFKAHRLVLAASSPYFAALFTGGMKESSKDVVPILGIEAG--IFQILLDFI 95

Query: 412 YGVNFEITVHNVAALRCAAEYLQMTD 489
           Y     I V+NV  L  AA+ LQ+T+
Sbjct: 96  YTGIVNIGVNNVQELIIAADMLQLTE 121



>sp|Q9Y573|IPP_HUMAN Actin-binding protein IPP (MIPP
           protein).>gb:AX883340_1479296 Sequence 18245 from Patent
           EP1074617.>gb:AF156857_1886706 Homo sapiens
           actin-binding protein (IPP) mRNA, complete cds.
          Length = 584

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 31/86 (36%), Positives = 44/86 (51%), Gaps = 1/86 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRINLSGIPGGPEIFERAAKFC 411
           DV ++VG+ SF  H+ +L A S Y   L     KE+    + + GI  G  IF+    F 
Sbjct: 38  DVQLQVGQESFKAHRLVLAASSPYFAALFTGGMKESSKDVVPILGIEAG--IFQILLDFI 95

Query: 412 YGVNFEITVHNVAALRCAAEYLQMTD 489
           Y     I V+NV  L  AA+ LQ+T+
Sbjct: 96  YTGIVNIGVNNVQELIIAADMLQLTE 121



>gb:BC077093_2559814 Danio rerio zgc:101051, mRNA (cDNA clone
           MGC:101051 IMAGE:7152174), complete cds.
          Length = 604

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 25/94 (26%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = +1

Query: 211 VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI-MDSKEADLTRINLSGIPGGPEI 387
           ++ + +  DV + + E  F  HK +L  +S+Y R +   D +E D  +I++ G+      
Sbjct: 24  LYEERLLLDVTLLIEEHHFQAHKALLATQSDYFRVMFTADMRERDQDKIHMKGLTAAG-- 81

Query: 388 FERAAKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
           F    +F Y  + E+++  V  +  AA Y+Q+T+
Sbjct: 82  FGHVLRFMYYGSLELSMLTVQEILQAAMYVQLTE 115



>gb:BC044333_2548644 Xenopus laevis hypothetical protein MGC53639,
           mRNA (cDNA clone MGC:53639 IMAGE:4724997), complete cds.
          Length = 490

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 25/83 (30%), Positives = 43/83 (51%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           D++V +    F  HK +L A S Y R     S  + ++ +++S I   P +FE+   FCY
Sbjct: 33  DIVVHIQGQPFRAHKAVLAASSPYFRD---HSALSTMSGLSISVIKS-PNVFEQLLSFCY 88

Query: 415 GVNFEITVHNVAALRCAAEYLQM 483
             +  + + +V +   AA +LQM
Sbjct: 89  TGSMSVQLKDVVSFLTAASFLQM 111



>gb:AJ719545_2501732 Gallus gallus mRNA for hypothetical protein,
           clone 3d20.
          Length = 708

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 29/89 (32%), Positives = 42/89 (47%)
 Frame = +1

Query: 217 SQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFER 396
           S++I TDV++ V    F  HK +L+A S     +  D  + +L  INL      PE F  
Sbjct: 27  SRDILTDVVIIVNREQFRAHKTVLMACSGLFYSIFTDQLKCNLNVINLDP-EINPEGFCI 85

Query: 397 AAKFCYGVNFEITVHNVAALRCAAEYLQM 483
              F Y     +  +N+ A+   A YLQM
Sbjct: 86  LLDFMYTSRLNLRENNIMAVMATALYLQM 114



>gb:CR858790_1182940 Pongo pygmaeus mRNA; cDNA DKFZp468I1913 (from
           clone DKFZp468I1913).
          Length = 706

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 29/89 (32%), Positives = 42/89 (47%)
 Frame = +1

Query: 217 SQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFER 396
           S++I TDV++ V    F  HK +L+A S     +  D  + +L+ INL      PE F  
Sbjct: 27  SRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKCNLSVINLDP-EINPEGFCI 85

Query: 397 AAKFCYGVNFEITVHNVAALRCAAEYLQM 483
              F Y     +   N+ A+   A YLQM
Sbjct: 86  LLDFMYTSRLNLREGNIMAVMATAMYLQM 114



>pir|A48752|A48752 B-cell CLL/lymphoma 6 (BCL6) protein -
           human>gb:U00115_2042498 Human zinc-finger protein
           (bcl-6) mRNA, complete cds.
          Length = 706

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 29/89 (32%), Positives = 42/89 (47%)
 Frame = +1

Query: 217 SQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFER 396
           S++I TDV++ V    F  HK +L+A S     +  D  + +L+ INL      PE F  
Sbjct: 27  SRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKCNLSVINLDP-EINPEGFCI 85

Query: 397 AAKFCYGVNFEITVHNVAALRCAAEYLQM 483
              F Y     +   N+ A+   A YLQM
Sbjct: 86  LLDFMYTSRLNLREGNIMAVMATAMYLQM 114



>sp|P41182|BCL6_HUMAN B-cell lymphoma 6 protein (BCL-6) (Zinc finger
           protein 51) (LAZ-3 protein) (BCL-5).>pir|I52586|I52586
           B-cell CLL/lymphoma 5 (BCL5) protein -
           human>gb:HSZNFNPRA_2028636 H.sapiens mRNA for zinc
           finger protein.
          Length = 706

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 29/89 (32%), Positives = 42/89 (47%)
 Frame = +1

Query: 217 SQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFER 396
           S++I TDV++ V    F  HK +L+A S     +  D  + +L+ INL      PE F  
Sbjct: 27  SRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKCNLSVINLDP-EINPEGFCI 85

Query: 397 AAKFCYGVNFEITVHNVAALRCAAEYLQM 483
              F Y     +   N+ A+   A YLQM
Sbjct: 86  LLDFMYTSRLNLREGNIMAVMATAMYLQM 114



>gb:MMU41465_2121330 Mus musculus BCL-6 mRNA, complete cds.
          Length = 707

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 29/89 (32%), Positives = 42/89 (47%)
 Frame = +1

Query: 217 SQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFER 396
           S++I TDV++ V    F  HK +L+A S     +  D  + +L+ INL      PE F  
Sbjct: 27  SRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKCNLSVINLDP-EISPEGFCI 85

Query: 397 AAKFCYGVNFEITVHNVAALRCAAEYLQM 483
              F Y     +   N+ A+   A YLQM
Sbjct: 86  LLDFMYTSRLNLREGNIMAVMTTAMYLQM 114



>gb:AK173321_2070255 Mus musculus mRNA for mKIAA1993 protein.
          Length = 527

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 26/83 (31%), Positives = 42/83 (50%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           D+IV +    F  HK +L A S Y R     S  + ++ +++S I   P +FE+   FCY
Sbjct: 60  DIIVHIQGQPFRAHKAVLAASSPYFRD---HSALSTMSGLSISVIKN-PSVFEQLLSFCY 115

Query: 415 GVNFEITVHNVAALRCAAEYLQM 483
                + + +V +   AA +LQM
Sbjct: 116 TGRMSLQLKDVVSFLTAASFLQM 138



>gb:AL354944_1923595 Human DNA sequence from clone RP11-106H5 on
           chromosome 9 Contains the 3'end of the ZNF297B gene for
           zinc finger protein 297B (ZNF-X, FLJ22470, KIAA0414),
           the gene for a novel protein (KIAA1993) and a CpG
           island, complete sequence.
          Length = 504

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 26/83 (31%), Positives = 42/83 (50%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           D+IV +    F  HK +L A S Y R     S  + ++ +++S I   P +FE+   FCY
Sbjct: 37  DIIVHIQGQPFRAHKAVLAASSPYFRD---HSALSTMSGLSISVIKN-PNVFEQLLSFCY 92

Query: 415 GVNFEITVHNVAALRCAAEYLQM 483
                + + +V +   AA +LQM
Sbjct: 93  TGRMSLQLKDVVSFLTAASFLQM 115



>gb:AB082524_1871803 Homo sapiens mRNA for KIAA1993 protein.
          Length = 532

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 26/83 (31%), Positives = 42/83 (50%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           D+IV +    F  HK +L A S Y R     S  + ++ +++S I   P +FE+   FCY
Sbjct: 65  DIIVHIQGQPFRAHKAVLAASSPYFRD---HSALSTMSGLSISVIKN-PNVFEQLLSFCY 120

Query: 415 GVNFEITVHNVAALRCAAEYLQM 483
                + + +V +   AA +LQM
Sbjct: 121 TGRMSLQLKDVVSFLTAASFLQM 143



>gb:AK036975_1164699 Mus musculus adult female vagina cDNA, RIKEN
           full-length enriched library, clone:9930032A10
           product:B-cell leukemia/lymphoma 6, full insert
           sequence.
          Length = 707

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 29/89 (32%), Positives = 42/89 (47%)
 Frame = +1

Query: 217 SQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFER 396
           S++I TDV++ V    F  HK +L+A S     +  D  + +L+ INL      PE F  
Sbjct: 27  SRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKCNLSVINLDP-EISPEGFCI 85

Query: 397 AAKFCYGVNFEITVHNVAALRCAAEYLQM 483
              F Y     +   N+ A+   A YLQM
Sbjct: 86  LLDFMYTSRLNLREGNIMAVMTTAMYLQM 114



>sp|Q90W33|HIC2_BRARE Hypermethylated in cancer 2
           protein.>gb:DRE307688_2571072 Danio rerio mRNA for HRG22
           protein.
          Length = 560

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/89 (34%), Positives = 40/89 (44%), Gaps = 4/89 (4%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           DVI+ V  A F  HK +L A S Y + LI+         INL      P +F +   F Y
Sbjct: 25  DVIIVVENALFRAHKNILAASSIYFKSLILHD-----NLINLDTDMVNPSVFRQVLDFIY 79

Query: 415 GVNF----EITVHNVAALRCAAEYLQMTD 489
                   + + HN  AL  AA YLQ+ D
Sbjct: 80  TGKLLSSDQFSDHNFNALLTAASYLQLHD 108



>sp|P41183|BCL6_MOUSE B-cell lymphoma 6 protein
           homolog.>gb:AK039228_1165331 Mus musculus adult male
           spinal cord cDNA, RIKEN full-length enriched library,
           clone:A330001J07 product:B-cell leukemia/lymphoma 6,
           full insert sequence.>gb:BC052315_2101019 Mus musculus
           B-cell leukemia/lymphoma 6, mRNA (cDNA clone MGC:54682
           IMAGE:6309948), complete cds.>gb:MUSMBCL6_2128861 Mouse
           mRNA for murine BCL6.
          Length = 707

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 29/89 (32%), Positives = 42/89 (47%)
 Frame = +1

Query: 217 SQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFER 396
           S++I TDV++ V    F  HK +L+A S     +  D  + +L+ INL      PE F  
Sbjct: 27  SRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKCNLSVINLDP-EISPEGFCI 85

Query: 397 AAKFCYGVNFEITVHNVAALRCAAEYLQM 483
              F Y     +   N+ A+   A YLQM
Sbjct: 86  LLDFMYTSRLNLREGNIMAVMTTAMYLQM 114



>gb:AJ720342_2502529 Gallus gallus mRNA for hypothetical protein,
           clone 15l4.
          Length = 488

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 26/99 (26%), Positives = 51/99 (51%), Gaps = 3/99 (3%)
 Frame = +1

Query: 211 VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI-MDSKEADLTRINLSGIPGGPEI 387
           ++ + +  DV + + +  F  HK +L  +S+Y R +   D +E D  +I+L G+      
Sbjct: 24  LYEEGLLLDVTLVIEDHQFQAHKALLATQSDYFRIMFTADMRERDQDKIHLKGLTATG-- 81

Query: 388 FERAAKFCYGVNFEITVHNVAALRCAAEYLQMTD--KYC 498
           F    +F Y    E++++ V  +  AA Y+Q+ +  K+C
Sbjct: 82  FSHVLQFMYYGTIELSMNTVHEILQAAMYVQLIEVVKFC 120



>gb:AK057298_1911966 Homo sapiens cDNA FLJ32736 fis, clone
           TESTI2001237, weakly similar to RING CANAL PROTEIN.
          Length = 604

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 26/99 (26%), Positives = 51/99 (51%), Gaps = 3/99 (3%)
 Frame = +1

Query: 211 VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI-MDSKEADLTRINLSGIPGGPEI 387
           ++ + +  DV + + +  F  HK +L  +S+Y R +   D +E D  +I+L G+      
Sbjct: 24  LYEEGLLLDVTLVIEDHQFQAHKALLATQSDYFRIMFTADMRERDQDKIHLKGLTATG-- 81

Query: 388 FERAAKFCYGVNFEITVHNVAALRCAAEYLQMTD--KYC 498
           F    +F Y    E++++ V  +  AA Y+Q+ +  K+C
Sbjct: 82  FSHVLQFMYYGTIELSMNTVHEILQAAMYVQLIEVVKFC 120



>gb:CET27E9_1368280 Caenorhabditis elegans cosmid T27E9, complete
           sequence.
          Length = 591

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 29/98 (29%), Positives = 43/98 (43%), Gaps = 3/98 (3%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLI-MDSKEADLTRINLSGIPGGPEIFERAAKFC 411
           DV + V     S HK +L A   Y R +  +D  EA++  IN+       E  +    F 
Sbjct: 52  DVALLVENRKLSAHKVILAATIPYFRGMFTLDLMEANMKEINIEDSDMNYETVDALLSFA 111

Query: 412 YGVNFEITVHNVAALRCAAEYLQMTD--KYCDNNLAGR 519
           Y     IT  NV ++   A + QM +  ++C N L  R
Sbjct: 112 YTGELRITTSNVQSIMLGANFFQMLEVVQHCGNFLLTR 149



>gb:AK081546_1173304 Mus musculus 16 days embryo head cDNA, RIKEN
           full-length enriched library, clone:C130036K12
           product:weakly similar to CDNA FLJ32736 FIS, CLONE
           TESTI2001237, WEAKLY SIMILAR TO RING CANAL PROTEIN [Homo
           sapiens], full insert sequence.>gb:BC036978_2097915 Mus
           musculus kelch-like 15 (Drosophila), mRNA (cDNA clone
           MGC:47138 IMAGE:4947611), complete cds.
          Length = 237

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 26/99 (26%), Positives = 51/99 (51%), Gaps = 3/99 (3%)
 Frame = +1

Query: 211 VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI-MDSKEADLTRINLSGIPGGPEI 387
           ++ + +  DV + + +  F  HK +L  +S+Y R +   D +E D  +I+L G+      
Sbjct: 24  LYEEGLLLDVTLVIEDHQFQAHKALLATQSDYFRIMFTADMRERDQDKIHLKGLTATG-- 81

Query: 388 FERAAKFCYGVNFEITVHNVAALRCAAEYLQMTD--KYC 498
           F    +F Y    E++++ V  +  AA Y+Q+ +  K+C
Sbjct: 82  FSHVLQFMYYGTIELSMNTVHEILQAAMYVQLIEVVKFC 120



>gb:BC052269_1984780 Homo sapiens BTB (POZ) domain containing 4,
           mRNA (cDNA clone MGC:59877 IMAGE:6574149), complete
           cds.>gb:BC073800_1989107 Homo sapiens BTB (POZ) domain
           containing 4, mRNA (cDNA clone MGC:88821 IMAGE:6576441),
           complete cds.
          Length = 589

 Score = 42.0 bits (97), Expect = 0.014
 Identities = 28/89 (31%), Positives = 42/89 (47%), Gaps = 4/89 (4%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMD----SKEADLTRINLSGIPGGPEIFERAA 402
           DV V V    F  HK +L+  S Y + L       S++A +T +++    G    F+   
Sbjct: 32  DVCVVVEGKVFKAHKNVLLGSSRYFKTLYCQVQKTSEQATVTHLDIVTAQG----FKAII 87

Query: 403 KFCYGVNFEITVHNVAALRCAAEYLQMTD 489
            F Y  +  +T  NV  +  AA +LQMTD
Sbjct: 88  DFMYSAHLALTSRNVIEVMSAASFLQMTD 116



>gb:AK131482_1918016 Homo sapiens cDNA FLJ16656 fis, clone
           TESTI4038779, weakly similar to Rattus norvegicus zinc
           finger protein RIN ZF (RINZF).
          Length = 589

 Score = 42.0 bits (97), Expect = 0.014
 Identities = 28/89 (31%), Positives = 42/89 (47%), Gaps = 4/89 (4%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMD----SKEADLTRINLSGIPGGPEIFERAA 402
           DV V V    F  HK +L+  S Y + L       S++A +T +++    G    F+   
Sbjct: 32  DVCVVVEGKVFKAHKNVLLGSSRYFKTLYCQVQKTSEQATVTHLDIVTAQG----FKAII 87

Query: 403 KFCYGVNFEITVHNVAALRCAAEYLQMTD 489
            F Y  +  +T  NV  +  AA +LQMTD
Sbjct: 88  DFMYSAHLALTSRNVIEVMSAASFLQMTD 116



>sp|Q86UZ6|BTB4_HUMAN BTB/POZ domain containing protein 4 (Zinc
           finger protein 340).>gb:HSJ583P15_2016299 Human DNA
           sequence from clone RP4-583P15 on chromosome 20 Contains
           the 3' end of the TNFRSF6B gene for member 6 (decoy) of
           tumor necrosis factor receptor, the ARFRP1 gene for
           ADP-ribosylation factor related protein 1, the gene for
           a novel protein (KIAA1847, FLJ14972), the gene for a
           novel protein (FLJ20406), the SLC2A4RG gene for SLC2A4
           regulator (GEF), the 3' end of the BTBD4 gene for BTB
           (POZ) domain containing 4, a novel gene and ten CpG
           islands, complete sequence.
          Length = 589

 Score = 42.0 bits (97), Expect = 0.014
 Identities = 28/89 (31%), Positives = 42/89 (47%), Gaps = 4/89 (4%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMD----SKEADLTRINLSGIPGGPEIFERAA 402
           DV V V    F  HK +L+  S Y + L       S++A +T +++    G    F+   
Sbjct: 32  DVCVVVEGKVFKAHKNVLLGSSRYFKTLYCQVQKTSEQATVTHLDIVTAQG----FKAII 87

Query: 403 KFCYGVNFEITVHNVAALRCAAEYLQMTD 489
            F Y  +  +T  NV  +  AA +LQMTD
Sbjct: 88  DFMYSAHLALTSRNVIEVMSAASFLQMTD 116



>gb:BC078108_2560744 Xenopus laevis BTB (POZ) domain containing 4,
           mRNA (cDNA clone MGC:83598 IMAGE:5083764), complete cds.
          Length = 576

 Score = 41.2 bits (95), Expect = 0.024
 Identities = 27/89 (30%), Positives = 42/89 (47%), Gaps = 4/89 (4%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMD----SKEADLTRINLSGIPGGPEIFERAA 402
           DV + V    F  HK +L+  S Y + L       S++  +T++++    G    F+   
Sbjct: 32  DVCIIVEGKIFKAHKNVLLGSSRYFKTLYCQVQKASEQTTVTQLDIVTAQG----FKAII 87

Query: 403 KFCYGVNFEITVHNVAALRCAAEYLQMTD 489
            F Y  +  +T  NV  +  AA YLQMTD
Sbjct: 88  DFMYSAHLALTSKNVIEVMSAASYLQMTD 116



>gb:AY350736_2083969 Mus musculus kelch-like protein KLHL6 mRNA,
           complete cds.
          Length = 610

 Score = 41.2 bits (95), Expect = 0.024
 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 4/110 (3%)
 Frame = +1

Query: 172 TRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLT 348
           TRLSL ++   + +  +   TDVI+ V    FS H+ +L A SNY R +   D KE    
Sbjct: 41  TRLSLILQNGLETLREENALTDVILCVDVQEFSCHRVVLAAASNYFRAMFCNDLKEKYEK 100

Query: 349 RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAA---EYLQMTD 489
           RI + G+    E       + Y     IT   V  +  AA   ++LQ+ D
Sbjct: 101 RIIIKGVDA--ETMHTLLVYTYTSKALITKQKVQRVLEAANLFQFLQLVD 148



>gb:AE014297_1139985 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE014297_1139986 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003716_1221978
           Drosophila melanogaster chromosome 3R, section 54 of 118
           of the complete sequence.>gb:AE003716_1221979 Drosophila
           melanogaster chromosome 3R, section 54 of 118 of the
           complete sequence.
          Length = 744

 Score = 41.2 bits (95), Expect = 0.024
 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 1/85 (1%)
 Frame = +1

Query: 232 TDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRINLSGIPGGPEIFERAAKF 408
           TDV++EV +  F  HK +L A S Y + +     KE++++R+ L G+   P    R   F
Sbjct: 58  TDVVLEVKKELFPAHKVVLSAASPYFKAMFTGGLKESEMSRVQLQGV--CPTAMSRILYF 115

Query: 409 CYGVNFEITVHNVAALRCAAEYLQM 483
            Y     +T   V  L  AA   Q+
Sbjct: 116 MYTGQIRVTEVTVCQLLPAATMFQV 140



>gb:AE014297_1139984 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003716_1221977 Drosophila melanogaster
           chromosome 3R, section 54 of 118 of the complete
           sequence.
          Length = 776

 Score = 41.2 bits (95), Expect = 0.024
 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 1/85 (1%)
 Frame = +1

Query: 232 TDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRINLSGIPGGPEIFERAAKF 408
           TDV++EV +  F  HK +L A S Y + +     KE++++R+ L G+   P    R   F
Sbjct: 90  TDVVLEVKKELFPAHKVVLSAASPYFKAMFTGGLKESEMSRVQLQGV--CPTAMSRILYF 147

Query: 409 CYGVNFEITVHNVAALRCAAEYLQM 483
            Y     +T   V  L  AA   Q+
Sbjct: 148 MYTGQIRVTEVTVCQLLPAATMFQV 172



>gb:BC071523_2556259 Danio rerio kelch-like 18 (Drosophila), mRNA
           (cDNA clone MGC:86901 IMAGE:6905132), complete cds.
          Length = 574

 Score = 40.8 bits (94), Expect = 0.032
 Identities = 27/84 (32%), Positives = 37/84 (44%), Gaps = 1/84 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRINLSGIPGGPEIFERAAKFC 411
           DV ++VGE  FS H+ +L A   Y   +   D  E     I + G+   P   E    F 
Sbjct: 39  DVTLKVGEHKFSAHRIVLAASIPYFHAMFTNDMVECKQDEIVMQGMD--PSALEALINFA 96

Query: 412 YGVNFEITVHNVAALRCAAEYLQM 483
           Y  +  I   NV AL   A +LQ+
Sbjct: 97  YNGHIAIDQQNVQALLIGASFLQL 120



>gb:BC045319_2549162 Danio rerio kelch-like 18 (Drosophila), mRNA
           (cDNA clone MGC:55359 IMAGE:2601518), complete cds.
          Length = 576

 Score = 40.8 bits (94), Expect = 0.032
 Identities = 27/84 (32%), Positives = 37/84 (44%), Gaps = 1/84 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRINLSGIPGGPEIFERAAKFC 411
           DV ++VGE  FS H+ +L A   Y   +   D  E     I + G+   P   E    F 
Sbjct: 41  DVTLKVGEHKFSAHRIVLAASIPYFHAMFTNDMVECKQDEIVMQGMD--PSALEALINFA 98

Query: 412 YGVNFEITVHNVAALRCAAEYLQM 483
           Y  +  I   NV AL   A +LQ+
Sbjct: 99  YNGHIAIDQQNVQALLIGASFLQL 122



>gb:AST577207_1285695 Anopheles stephensi mRNA for putative
           kelch-like proteins (kel gene).
          Length = 636

 Score = 40.8 bits (94), Expect = 0.032
 Identities = 26/90 (28%), Positives = 40/90 (44%)
 Frame = +1

Query: 220 QEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERA 399
           Q +  DV++         HK +L + S Y   +    +E+   RI L G+   P   +  
Sbjct: 96  QNLLCDVVLVAEGIEIPAHKMVLASCSPYFYAMFTGFEESRQDRITLQGVD--PRALQLL 153

Query: 400 AKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
            ++ Y    E+T  NV  L  AA  LQ+TD
Sbjct: 154 IEYVYRAVVEVTEDNVQILLTAANLLQLTD 183



>gb:AST577207_1285694 Anopheles stephensi mRNA for putative
           kelch-like proteins (kel gene).
          Length = 1499

 Score = 40.8 bits (94), Expect = 0.032
 Identities = 26/90 (28%), Positives = 40/90 (44%)
 Frame = +1

Query: 220 QEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERA 399
           Q +  DV++         HK +L + S Y   +    +E+   RI L G+   P   +  
Sbjct: 96  QNLLCDVVLVAEGIEIPAHKMVLASCSPYFYAMFTGFEESRQDRITLQGVD--PRALQLL 153

Query: 400 AKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
            ++ Y    E+T  NV  L  AA  LQ+TD
Sbjct: 154 IEYVYRAVVEVTEDNVQILLTAANLLQLTD 183



>gb:AK173029_2069963 Mus musculus mRNA for mKIAA0795 protein.
          Length = 588

 Score = 40.4 bits (93), Expect = 0.041
 Identities = 25/84 (29%), Positives = 37/84 (44%), Gaps = 1/84 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRINLSGIPGGPEIFERAAKFC 411
           DV +++G+  FS H+ +L A   Y   +   D  E     I + G+   P   E    F 
Sbjct: 53  DVTLKIGDHKFSAHRIVLAASIPYFHAMFTNDMMECKQDEIVMQGMD--PSALEALINFA 110

Query: 412 YGVNFEITVHNVAALRCAAEYLQM 483
           Y  N  I   NV +L   A +LQ+
Sbjct: 111 YNGNLAIDQQNVQSLLMGASFLQL 134



>gb:HSM806080_2018165 Homo sapiens mRNA; cDNA DKFZp686M0586 (from
           clone DKFZp686M0586); complete cds.
          Length = 579

 Score = 40.4 bits (93), Expect = 0.041
 Identities = 25/84 (29%), Positives = 37/84 (44%), Gaps = 1/84 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRINLSGIPGGPEIFERAAKFC 411
           DV +++G+  FS H+ +L A   Y   +   D  E     I + G+   P   E    F 
Sbjct: 44  DVTLKIGDHKFSAHRIVLAASIPYFHAMFTNDMMECKQDEIVMQGMD--PSALEALINFA 101

Query: 412 YGVNFEITVHNVAALRCAAEYLQM 483
           Y  N  I   NV +L   A +LQ+
Sbjct: 102 YNGNLAIDQQNVQSLLMGASFLQL 125



>gb:AL136170_1919003 Human DNA sequence from clone RP5-1198E17 on
           chromosome 1 Contains the 3' end of a novel gene
           (KIAA2025), two novel genes (MGC2629), the GAS5 gene for
           growth arrest-specific 5, the SERPINC1 gene for serine
           (or cysteine) proteinase inhibitor clade C
           (antithrombin) member 1 and a CpG island, complete
           sequence.>gb:BC003116_1968701 Homo sapiens zinc finger
           and BTB domain containing 37, mRNA (cDNA clone MGC:2629
           IMAGE:3503643), complete cds.>gb:BC006315_1970189 Homo
           sapiens zinc finger and BTB domain containing 37, mRNA
           (cDNA clone MGC:13132 IMAGE:4124255), complete cds.
          Length = 361

 Score = 40.4 bits (93), Expect = 0.041
 Identities = 24/83 (28%), Positives = 44/83 (53%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           D++V V   +F  HK +L A S Y R  +  +   +++ +++S I   P +FE+   FCY
Sbjct: 33  DIVVNVQGQAFRAHKVVLAASSPYFRDHMSLN---EMSTVSISVIKN-PTVFEQLLSFCY 88

Query: 415 GVNFEITVHNVAALRCAAEYLQM 483
                + + ++ +   AA +LQM
Sbjct: 89  TGRICLQLADIISYLTAASFLQM 111



>gb:AL136170_1919002 Human DNA sequence from clone RP5-1198E17 on
           chromosome 1 Contains the 3' end of a novel gene
           (KIAA2025), two novel genes (MGC2629), the GAS5 gene for
           growth arrest-specific 5, the SERPINC1 gene for serine
           (or cysteine) proteinase inhibitor clade C
           (antithrombin) member 1 and a CpG island, complete
           sequence.
          Length = 308

 Score = 40.4 bits (93), Expect = 0.041
 Identities = 24/83 (28%), Positives = 44/83 (53%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           D++V V   +F  HK +L A S Y R  +  +   +++ +++S I   P +FE+   FCY
Sbjct: 33  DIVVNVQGQAFRAHKVVLAASSPYFRDHMSLN---EMSTVSISVIKN-PTVFEQLLSFCY 88

Query: 415 GVNFEITVHNVAALRCAAEYLQM 483
                + + ++ +   AA +LQM
Sbjct: 89  TGRICLQLADIISYLTAASFLQM 111



>gb:AL136170_1919001 Human DNA sequence from clone RP5-1198E17 on
           chromosome 1 Contains the 3' end of a novel gene
           (KIAA2025), two novel genes (MGC2629), the GAS5 gene for
           growth arrest-specific 5, the SERPINC1 gene for serine
           (or cysteine) proteinase inhibitor clade C
           (antithrombin) member 1 and a CpG island, complete
           sequence.
          Length = 503

 Score = 40.4 bits (93), Expect = 0.041
 Identities = 24/83 (28%), Positives = 44/83 (53%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           D++V V   +F  HK +L A S Y R  +  +   +++ +++S I   P +FE+   FCY
Sbjct: 33  DIVVNVQGQAFRAHKVVLAASSPYFRDHMSLN---EMSTVSISVIKN-PTVFEQLLSFCY 88

Query: 415 GVNFEITVHNVAALRCAAEYLQM 483
                + + ++ +   AA +LQM
Sbjct: 89  TGRICLQLADIISYLTAASFLQM 111



>gb:AK057310_1911973 Homo sapiens cDNA FLJ32748 fis, clone
           TESTI2001556, weakly similar to ZINC FINGER PROTEIN 151.
          Length = 308

 Score = 40.4 bits (93), Expect = 0.041
 Identities = 24/83 (28%), Positives = 44/83 (53%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           D++V V   +F  HK +L A S Y R  +  +   +++ +++S I   P +FE+   FCY
Sbjct: 33  DIVVNVQGQAFRAHKVVLAASSPYFRDHMSLN---EMSTVSISVIKN-PTVFEQLLSFCY 88

Query: 415 GVNFEITVHNVAALRCAAEYLQM 483
                + + ++ +   AA +LQM
Sbjct: 89  TGRICLQLADIISYLTAASFLQM 111



>gb:AK084871_1174350 Mus musculus 13 days embryo lung cDNA, RIKEN
           full-length enriched library, clone:D430004I08
           product:hypothetical BTB/POZ domain containing protein,
           full insert sequence.
          Length = 504

 Score = 40.4 bits (93), Expect = 0.041
 Identities = 24/83 (28%), Positives = 44/83 (53%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           D++V V   +F  HK +L A S Y R  +  +   +++ +++S I   P +FE+   FCY
Sbjct: 35  DIVVNVQGQAFRAHKVVLAASSPYFRDHMSLN---EMSTVSISVIKN-PTVFEQLLSFCY 90

Query: 415 GVNFEITVHNVAALRCAAEYLQM 483
                + + ++ +   AA +LQM
Sbjct: 91  TGRICLQLADIISYLTAASFLQM 113



>gb:AK078748_1172427 Mus musculus 15 days embryo male testis cDNA,
           RIKEN full-length enriched library, clone:8030412L05
           product:hypothetical BTB/POZ domain containing protein,
           full insert sequence.
          Length = 476

 Score = 40.4 bits (93), Expect = 0.041
 Identities = 24/83 (28%), Positives = 44/83 (53%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           D++V V   +F  HK +L A S Y R  +  +   +++ +++S I   P +FE+   FCY
Sbjct: 7   DIVVNVQGQAFRAHKVVLAASSPYFRDHMSLN---EMSTVSISVIKN-PTVFEQLLSFCY 62

Query: 415 GVNFEITVHNVAALRCAAEYLQM 483
                + + ++ +   AA +LQM
Sbjct: 63  TGRICLQLADIISYLTAASFLQM 85



>gb:YDI293568_2459758 Yaba-like disease virus (YLDV), complete
           genome.
          Length = 570

 Score = 40.0 bits (92), Expect = 0.054
 Identities = 27/85 (31%), Positives = 38/85 (44%), Gaps = 1/85 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRINLSGIPGGPEIFERAAKFC 411
           DV +         HK +L + S+Y +K+  D+  E +   IN+SGI            F 
Sbjct: 25  DVALIADGKKIQAHKIILASVSDYFKKMFTDNFSEKNSNEINMSGIDFNS--LSLLINFI 82

Query: 412 YGVNFEITVHNVAALRCAAEYLQMT 486
           Y  N  I   NV  L   A+YLQ+T
Sbjct: 83  YSGNLNINQSNVEILLYKADYLQIT 107



>gb:BC077434_2560143 Xenopus laevis MGC82233 protein, mRNA (cDNA
           clone MGC:82233 IMAGE:4030930), complete cds.
          Length = 573

 Score = 39.7 bits (91), Expect = 0.070
 Identities = 26/84 (30%), Positives = 36/84 (42%), Gaps = 1/84 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRINLSGIPGGPEIFERAAKFC 411
           DV + VGE  FS H+ +L A   Y   +   D  E     I + G+   P   E    F 
Sbjct: 38  DVTLRVGEHKFSAHRIVLAASIPYFHAMFTNDMMECKQDEIVMQGMD--PSALEALINFA 95

Query: 412 YGVNFEITVHNVAALRCAAEYLQM 483
           Y  +  I   NV +L   A +LQ+
Sbjct: 96  YNGHLAIDQQNVQSLLMGASFLQL 119



>gb:AK011461_1156415 Mus musculus 10 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2610019F01
           product:similar to DJ583P15.7.2 (NOVEL ZINC FINGER
           PROTEIN SIMILAR TO RAT RIN ZF) (FRAGMENT) [Homo
           sapiens], full insert sequence.>gb:BC058179_2103086 Mus
           musculus BTB (POZ) domain containing 4, mRNA (cDNA clone
           MGC:67874 IMAGE:5326477), complete cds.
          Length = 434

 Score = 39.7 bits (91), Expect = 0.070
 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 4/89 (4%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMD----SKEADLTRINLSGIPGGPEIFERAA 402
           D  V V    F  HK +L+  S Y + L       S +A +T +++    G    F+   
Sbjct: 32  DACVVVEGKVFKAHKNVLLGSSRYFKTLYCQVQKTSDQATVTHLDIVTAQG----FKAII 87

Query: 403 KFCYGVNFEITVHNVAALRCAAEYLQMTD 489
            F Y  +  +T  NV  +  AA +LQMTD
Sbjct: 88  DFMYSAHLALTSRNVIEVMSAASFLQMTD 116



>sp|Q8BID6|BTB4_MOUSE BTB/POZ domain containing protein 4.
          Length = 600

 Score = 39.7 bits (91), Expect = 0.070
 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 4/89 (4%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMD----SKEADLTRINLSGIPGGPEIFERAA 402
           D  V V    F  HK +L+  S Y + L       S +A +T +++    G    F+   
Sbjct: 32  DACVVVEGKVFKAHKNVLLGSSRYFKTLYCQVQKTSDQATVTHLDIVTAQG----FKAII 87

Query: 403 KFCYGVNFEITVHNVAALRCAAEYLQMTD 489
            F Y  +  +T  NV  +  AA +LQMTD
Sbjct: 88  DFMYSAHLALTSRNVIEVMSAASFLQMTD 116



>gb:BC059515_2552492 Danio rerio B-cell CLL/lymphoma 6 (zinc finger
           protein 51), mRNA (cDNA clone MGC:73162 IMAGE:4145622),
           complete cds.
          Length = 704

 Score = 39.3 bits (90), Expect = 0.092
 Identities = 28/89 (31%), Positives = 41/89 (46%)
 Frame = +1

Query: 217 SQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFER 396
           S++I TDV + V    F  HK +L+A S     +  DS + +L  I+L      PE F  
Sbjct: 27  SRDILTDVTILVNRQQFRAHKTVLMACSGLFYSIFTDSHKCNLNAISLDP-KVDPEGFAI 85

Query: 397 AAKFCYGVNFEITVHNVAALRCAAEYLQM 483
             +F Y     +    + A+   A YLQM
Sbjct: 86  LLEFMYTSRLALKESLIMAIMNTAIYLQM 114



>gb:BC083577_2108662 Rattus norvegicus zinc finger protein 100
           (predicted), mRNA (cDNA clone MGC:93950 IMAGE:7113925),
           complete cds.
          Length = 801

 Score = 39.3 bits (90), Expect = 0.092
 Identities = 25/85 (29%), Positives = 38/85 (44%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           D    V    F  HK +L A S Y + L +D K  D+  +++S   G  ++ E    F Y
Sbjct: 25  DCTFVVDGVDFKAHKAVLAACSEYFKMLFVDQK--DVVHLDISNAAGLGQVLE----FMY 78

Query: 415 GVNFEITVHNVAALRCAAEYLQMTD 489
                ++  NV  +   A +LQM D
Sbjct: 79  TAKLHLSPENVDDVLAVASFLQMQD 103



>gb:BC060055_2103856 Mus musculus zinc finger and BTB domain
           containing 17, mRNA (cDNA clone IMAGE:5695851), complete
           cds.
          Length = 309

 Score = 39.3 bits (90), Expect = 0.092
 Identities = 25/85 (29%), Positives = 38/85 (44%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           D    V    F  HK +L A S Y + L +D K  D+  +++S   G  ++ E    F Y
Sbjct: 25  DCTFVVDGVDFKAHKAVLAACSEYFKMLFVDQK--DVVHLDISNAAGLGQVLE----FMY 78

Query: 415 GVNFEITVHNVAALRCAAEYLQMTD 489
                ++  NV  +   A +LQM D
Sbjct: 79  TAKLSLSPENVDDVLAVASFLQMQD 103



>pir|S59069|S59069 Z13 protein - mouse>gb:MMU14556_2118508 Mus
           musculus zinc-finger protein mRNA, complete cds.
          Length = 794

 Score = 39.3 bits (90), Expect = 0.092
 Identities = 25/85 (29%), Positives = 38/85 (44%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           D    V    F  HK +L A S Y + L +D K  D+  +++S   G  ++ E    F Y
Sbjct: 25  DCTFVVDGVDFKAHKAVLAACSEYFKMLFVDQK--DVVHLDISNAAGLGQVLE----FMY 78

Query: 415 GVNFEITVHNVAALRCAAEYLQMTD 489
                ++  NV  +   A +LQM D
Sbjct: 79  TAKLSLSPENVDDVLAVASFLQMQD 103



>sp|Q60821|Z151_MOUSE Zinc finger protein 151 (Zinc finger protein
           100) (Zfp-100) (Polyomavirus late initiator promoter
           binding protein) (LP-1) (Zinc finger protein
           Z13).>gb:MMU22396_2119054 Mus musculus polyomavirus late
           initiator promoter binding protein (LP-1) mRNA, complete
           cds.
          Length = 794

 Score = 39.3 bits (90), Expect = 0.092
 Identities = 25/85 (29%), Positives = 38/85 (44%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           D    V    F  HK +L A S Y + L +D K  D+  +++S   G  ++ E    F Y
Sbjct: 25  DCTFVVDGVDFKAHKAVLAACSEYFKMLFVDQK--DVVHLDISNAAGLGQVLE----FMY 78

Query: 415 GVNFEITVHNVAALRCAAEYLQMTD 489
                ++  NV  +   A +LQM D
Sbjct: 79  TAKLSLSPENVDDVLAVASFLQMQD 103



>gb:BC084912_2564148 Xenopus laevis hypothetical LOC495412, mRNA
           (cDNA clone MGC:78907 IMAGE:4175407), complete cds.
          Length = 701

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 29/93 (31%), Positives = 42/93 (45%), Gaps = 4/93 (4%)
 Frame = +1

Query: 217 SQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEI--- 387
           S++I TDVI+ V    F  HK +L+A S     +  D  + +L  INL      P+I   
Sbjct: 29  SRDILTDVIIVVNREHFRAHKTVLMACSGLFYAIFTDPMKCNLNIINLD-----PDISAE 83

Query: 388 -FERAAKFCYGVNFEITVHNVAALRCAAEYLQM 483
            F     F Y     +   ++ A+   A YLQM
Sbjct: 84  GFRVLLDFMYTSRLNLRDSSIMAVMSTALYLQM 116



>gb:AJ720960_2503147 Gallus gallus mRNA for hypothetical protein,
           clone 31c15.
          Length = 584

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 25/84 (29%), Positives = 37/84 (44%), Gaps = 1/84 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRINLSGIPGGPEIFERAAKFC 411
           DV ++VG+  FS H+ +L A   Y   +   D  E     I + G+   P   E    F 
Sbjct: 44  DVTLKVGDHKFSAHRIVLAASIPYFHAMFTNDMMECKQDEIVMQGMD--PSALEALINFA 101

Query: 412 YGVNFEITVHNVAALRCAAEYLQM 483
           Y  +  I   NV +L   A +LQ+
Sbjct: 102 YNGHLAIDQQNVQSLLMGASFLQL 125



>gb:AB197694_2467329 Takifugu rubripes bcl6 mRNA for B-cell lymphoma
           6 protein, complete cds.
          Length = 703

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 28/89 (31%), Positives = 41/89 (46%)
 Frame = +1

Query: 217 SQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFER 396
           S++I TDV + V    F  HK +L+A S     +  DS + +L  I+L      PE F  
Sbjct: 27  SRDILTDVTILVNRQQFRAHKTVLMACSGLFYTIFTDSHKCNLNAISLDP-KVDPEGFAI 85

Query: 397 AAKFCYGVNFEITVHNVAALRCAAEYLQM 483
             +F Y     +    + A+   A YLQM
Sbjct: 86  LLEFMYTSRLTLKESLIMAIMNTAIYLQM 114



>gb:HSM806800_2018446 Homo sapiens mRNA; cDNA DKFZp686G17262 (from
           clone DKFZp686G17262); complete cds.
          Length = 620

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 28/84 (33%), Positives = 38/84 (45%), Gaps = 1/84 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRINLSGIPGGPEIFERAAKFC 411
           DV ++VG    S HK +L     Y R + + +  EA  T I +    G  +  E   KF 
Sbjct: 68  DVTLKVGSKLISCHKLVLACVIPYFRAMFLSEMAEAKQTLIEIRDFDG--DAIEDLVKFV 125

Query: 412 YGVNFEITVHNVAALRCAAEYLQM 483
           Y     +TV NV  L  AA  LQ+
Sbjct: 126 YSSRLTLTVDNVQPLLYAACILQV 149



>gb:HSM806379_2018308 Homo sapiens mRNA; cDNA DKFZp686P15123 (from
           clone DKFZp686P15123); complete cds.
          Length = 620

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 28/84 (33%), Positives = 38/84 (45%), Gaps = 1/84 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRINLSGIPGGPEIFERAAKFC 411
           DV ++VG    S HK +L     Y R + + +  EA  T I +    G  +  E   KF 
Sbjct: 68  DVTLKVGSKLISCHKLVLACVIPYFRAMFLSEMAEAKQTLIEIRDFDG--DAIEDLVKFV 125

Query: 412 YGVNFEITVHNVAALRCAAEYLQM 483
           Y     +TV NV  L  AA  LQ+
Sbjct: 126 YSSRLTLTVDNVQPLLYAACILQV 149



>gb:AY157873_1937320 Homo sapiens BTB/POZ and zinc-finger domain
           containing factor variant L (BOZF1) mRNA, complete cds;
           alternatively spliced.>gb:HS27O5_1997852 Human DNA
           sequence from clone RP1-27O5 on chromosome 1p34.1-35.3
           Contains the 3' end of the ZBTB8 gene for zinc finger
           and BTB domain containing 8, the 3' end of the gene for
           archease (ARCH) and two CpG islands, complete sequence.
          Length = 340

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 24/90 (26%), Positives = 38/90 (42%)
 Frame = +1

Query: 220 QEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERA 399
           Q++  D  + V    F  H+ +L A S Y + L+  + +        +     P+ F   
Sbjct: 20  QDVFCDCSILVEGKVFKAHRNVLFASSGYFKMLLSQNSKETSQPTTATFQAFSPDTFTVI 79

Query: 400 AKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
             F Y     +T  NV  +  AA +LQMTD
Sbjct: 80  LDFVYSGKLSLTGQNVIEVMSAASFLQMTD 109



>gb:AK097125_1914769 Homo sapiens cDNA FLJ39806 fis, clone
           SPLEN2008460.
          Length = 621

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 4/108 (3%)
 Frame = +1

Query: 178 LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRI 354
           LSL ++   + +  +   TDVI+ V    FS H+ +L A SNY R +   D KE    RI
Sbjct: 54  LSLILQNGLETLRMENALTDVILCVDIQEFSCHRVVLAAASNYFRAMFCNDLKEKYEKRI 113

Query: 355 NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAA---EYLQMTD 489
            + G+    E       + Y     IT  NV  +  AA   ++L+M D
Sbjct: 114 IIKGVDA--ETMHTLLDYTYTSKALITKQNVQRVLEAANLFQFLRMVD 159



>gb:AF548353_1906558 Homo sapiens BTB/POZ and zinc-finger domains
           factor on chromosome 1 (BOZF1) mRNA, complete
           cds.>gb:HS27O5_1997851 Human DNA sequence from clone
           RP1-27O5 on chromosome 1p34.1-35.3 Contains the 3' end
           of the ZBTB8 gene for zinc finger and BTB domain
           containing 8, the 3' end of the gene for archease (ARCH)
           and two CpG islands, complete sequence.
          Length = 441

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 24/90 (26%), Positives = 38/90 (42%)
 Frame = +1

Query: 220 QEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERA 399
           Q++  D  + V    F  H+ +L A S Y + L+  + +        +     P+ F   
Sbjct: 20  QDVFCDCSILVEGKVFKAHRNVLFASSGYFKMLLSQNSKETSQPTTATFQAFSPDTFTVI 79

Query: 400 AKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
             F Y     +T  NV  +  AA +LQMTD
Sbjct: 80  LDFVYSGKLSLTGQNVIEVMSAASFLQMTD 109



>gb:AF441792_1902260 Homo sapiens kelch-like protein KLHL6 (KLHL6)
           mRNA, complete cds.
          Length = 610

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 4/108 (3%)
 Frame = +1

Query: 178 LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRI 354
           LSL ++   + +  +   TDVI+ V    FS H+ +L A SNY R +   D KE    RI
Sbjct: 43  LSLILQNGLETLRMENALTDVILCVDIQEFSCHRVVLAAASNYFRAMFCNDLKEKYEKRI 102

Query: 355 NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAA---EYLQMTD 489
            + G+    E       + Y     IT  NV  +  AA   ++L+M D
Sbjct: 103 IIKGVDA--ETMHTLLDYTYTSKALITKQNVQRVLEAANLFQFLRMVD 148



>gb:AB037799_1866590 Homo sapiens mRNA for KIAA1378 protein, partial
           cds.
          Length = 628

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 28/84 (33%), Positives = 38/84 (45%), Gaps = 1/84 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRINLSGIPGGPEIFERAAKFC 411
           DV ++VG    S HK +L     Y R + + +  EA  T I +    G  +  E   KF 
Sbjct: 76  DVTLKVGSKLISCHKLVLACVIPYFRAMFLSEMAEAKQTLIEIRDFDG--DAIEDLVKFV 133

Query: 412 YGVNFEITVHNVAALRCAAEYLQM 483
           Y     +TV NV  L  AA  LQ+
Sbjct: 134 YSSRLTLTVDNVQPLLYAACILQV 157



>gb:CQ783479_1452482 Sequence 3619 from Patent
           EP1396543.>gb:AK074546_1912536 Homo sapiens cDNA
           FLJ90065 fis, clone HEMBA1003497, weakly similar to ZINC
           FINGER PROTEIN 151.>gb:BC015239_1975028 Homo sapiens
           zinc finger and BTB domain containing 8, mRNA (cDNA
           clone MGC:17919 IMAGE:3914043), complete cds.
          Length = 441

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 24/90 (26%), Positives = 38/90 (42%)
 Frame = +1

Query: 220 QEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERA 399
           Q++  D  + V    F  H+ +L A S Y + L+  + +        +     P+ F   
Sbjct: 20  QDVFCDCSILVEGKVFKAHRNVLFASSGYFKMLLSQNSKETSQPTTATFQAFSPDTFTVI 79

Query: 400 AKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
             F Y     +T  NV  +  AA +LQMTD
Sbjct: 80  LDFVYSGKLSLTGQNVIEVMSAASFLQMTD 109



>sp|Q9P2G9|KHL8_HUMAN Kelch-like protein 8.>gb:BC041384_1983034 Homo
           sapiens kelch-like 8 (Drosophila), mRNA (cDNA clone
           MGC:43939 IMAGE:5275946), complete cds.
          Length = 620

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 28/84 (33%), Positives = 38/84 (45%), Gaps = 1/84 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRINLSGIPGGPEIFERAAKFC 411
           DV ++VG    S HK +L     Y R + + +  EA  T I +    G  +  E   KF 
Sbjct: 68  DVTLKVGSKLISCHKLVLACVIPYFRAMFLSEMAEAKQTLIEIRDFDG--DAIEDLVKFV 125

Query: 412 YGVNFEITVHNVAALRCAAEYLQM 483
           Y     +TV NV  L  AA  LQ+
Sbjct: 126 YSSRLTLTVDNVQPLLYAACILQV 149



>sp|Q8WZ60|KHL6_HUMAN Kelch-like protein 6.>gb:BC032348_1980416 Homo
           sapiens kelch-like 6 (Drosophila), mRNA (cDNA clone
           MGC:40562 IMAGE:5213743), complete cds.
          Length = 610

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 4/108 (3%)
 Frame = +1

Query: 178 LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRI 354
           LSL ++   + +  +   TDVI+ V    FS H+ +L A SNY R +   D KE    RI
Sbjct: 43  LSLILQNGLETLRMENALTDVILCVDIQEFSCHRVVLAAASNYFRAMFCNDLKEKYEKRI 102

Query: 355 NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAA---EYLQMTD 489
            + G+    E       + Y     IT  NV  +  AA   ++L+M D
Sbjct: 103 IIKGVDA--ETMHTLLDYTYTSKALITKQNVQRVLEAANLFQFLRMVD 148



>gb:BC017614_2092511 Mus musculus RIKEN cDNA 2410081M15 gene, mRNA
           (cDNA clone MGC:27680 IMAGE:4912757), complete cds.
          Length = 434

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 24/90 (26%), Positives = 37/90 (41%)
 Frame = +1

Query: 220 QEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERA 399
           Q++  D  + V    F  H+ +L A S Y + L+  +          +     P+ F   
Sbjct: 20  QDVFCDCSILVEGKVFKAHRNVLFASSGYFKMLLSQNSRETSQPTTATFQTFSPDTFTVI 79

Query: 400 AKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
             F Y     +T  NV  +  AA +LQMTD
Sbjct: 80  LDFVYSGKLSLTGQNVIEVMSAASFLQMTD 109



>gb:HS134O19_1997087 Human DNA sequence from clone RP1-134O19 on
           chromosome 1p36.11-36.33 Contains the 3' end of the gene
           for SMART/HDAC1 associated repressor protein (SHARP),
           the 3' end of the ZNF151 gene for zinc finger protein
           151 (pHZ-67) and a CpG island, complete sequence.
          Length = 803

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 25/85 (29%), Positives = 38/85 (44%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           D    V    F  HK +L A S Y + L +D K  D+  +++S   G  ++ E    F Y
Sbjct: 25  DCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQK--DVVHLDISNAAGLGQVLE----FMY 78

Query: 415 GVNFEITVHNVAALRCAAEYLQMTD 489
                ++  NV  +   A +LQM D
Sbjct: 79  TAKLSLSPENVDDVLAVATFLQMQD 103



>gb:AK010736_1155965 Mus musculus ES cells cDNA, RIKEN full-length
           enriched library, clone:2410081M15 product:weakly
           similar to ZINC FINGER PROTEIN 12 (ZINC FINGER PROTEIN
           KOX3) (FRAGMENT) [Homo sapiens], full insert sequence.
          Length = 434

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 24/90 (26%), Positives = 37/90 (41%)
 Frame = +1

Query: 220 QEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERA 399
           Q++  D  + V    F  H+ +L A S Y + L+  +          +     P+ F   
Sbjct: 20  QDVFCDCSILVEGKVFKAHRNVLFASSGYFKMLLSQNSRETSQPTTATFQTFSPDTFTVI 79

Query: 400 AKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
             F Y     +T  NV  +  AA +LQMTD
Sbjct: 80  LDFVYSGKLSLTGQNVIEVMSAASFLQMTD 109



>pir|T41321|T41321 BTB domain and Ankaryin repeat containing protein
           - fission yeast (Schizosaccharomyces
           pombe)>gb:SPCC330_1721280 S.pombe chromosome III cosmid
           c330.
          Length = 1347

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 15/41 (36%), Positives = 29/41 (70%)
 Frame = +1

Query: 232 TDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI 354
           +DV +  G + F  HKF+L A+S+++RKL++  K++ ++ I
Sbjct: 619 SDVTIYCGTSMFHSHKFILCARSSFLRKLLLQKKKSSVSNI 659



>sp|Q9WTY8|ZB10_RAT Zinc finger and BTB domain containing protein 10
           (Zinc finger protein RIN ZF).>gb:AF091457_2054117 Rattus
           norvegicus zinc finger protein RIN ZF mRNA, complete
           cds.
          Length = 836

 Score = 38.1 bits (87), Expect = 0.20
 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 5/95 (5%)
 Frame = +1

Query: 220 QEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI-MDSKEA----DLTRINLSGIPGGPE 384
           ++I  DV + V    F  HK +LVA S + + L  + +KE+    + T ++++ + G   
Sbjct: 326 KDILCDVSIVVSGKIFKAHKNILVAGSRFFKTLYCVSNKESPNQNNTTHLDIAAVQGFSV 385

Query: 385 IFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
           I +    F Y  N  +T  N   +   A YLQM++
Sbjct: 386 ILD----FLYSGNLVLTSQNAIEVMTVASYLQMSE 416



>gb:BC084492_2563863 Xenopus tropicalis hypothetical LOC496558, mRNA
           (cDNA clone MGC:89470 IMAGE:6991718), complete cds.
          Length = 799

 Score = 37.7 bits (86), Expect = 0.27
 Identities = 25/85 (29%), Positives = 38/85 (44%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           D    V    F  HK +L A S Y R L ++ K  D+  +++S   G  ++ E    F Y
Sbjct: 25  DCTFVVDGIDFKAHKAVLAACSQYFRMLFVEQK--DVVHLDISNAAGLGQVLE----FMY 78

Query: 415 GVNFEITVHNVAALRCAAEYLQMTD 489
                +T  NV  +   A +LQM +
Sbjct: 79  TARLSLTRENVEDVLAVAGFLQMQE 103



>gb:BC077915_2560561 Xenopus laevis B-cell CLL/lymphoma 6 (zinc
           finger protein 51), mRNA (cDNA clone MGC:80825
           IMAGE:5513995), complete cds.
          Length = 701

 Score = 37.7 bits (86), Expect = 0.27
 Identities = 29/93 (31%), Positives = 42/93 (45%), Gaps = 4/93 (4%)
 Frame = +1

Query: 217 SQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEI--- 387
           S++I TDVI+ V    F  HK +L+A S     +  D  + +L  INL      P+I   
Sbjct: 29  SRDILTDVIIIVNGEHFRAHKTVLMACSGLFYAIFTDPMKCNLNIINLD-----PDISAD 83

Query: 388 -FERAAKFCYGVNFEITVHNVAALRCAAEYLQM 483
            F     F Y     +   ++ A+   A YLQM
Sbjct: 84  GFRVLLDFMYTSRLNLRDSSIMAVMSTALYLQM 116



>gb:AF111712_2474475 Danio rerio hypermethylated in cancer zinc
           finger/POZ-domain 1 protein (hzp1) mRNA, partial cds.
          Length = 448

 Score = 37.7 bits (86), Expect = 0.27
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 3/88 (3%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           DVI+ V    F  HK +L A S+Y++ L++         I+L      P +F++   F Y
Sbjct: 19  DVIIMVENTLFRAHKSVLAATSHYLKSLVLHD-----NLIHLDPDMVDPAVFQQILDFIY 73

Query: 415 GVNFE---ITVHNVAALRCAAEYLQMTD 489
                     V N+++L   A YLQ+ D
Sbjct: 74  TGKLSDETFEVLNLSSLLKTANYLQLND 101



>gb:AK085310_1174470 Mus musculus 0 day neonate kidney cDNA, RIKEN
           full-length enriched library, clone:D630009O07
           product:similar to DJ583P15.7.2 (NOVEL ZINC FINGER
           PROTEIN SIMILAR TO RAT RIN ZF) (FRAGMENT) [Homo
           sapiens], full insert sequence.
          Length = 205

 Score = 37.7 bits (86), Expect = 0.27
 Identities = 26/89 (29%), Positives = 40/89 (44%), Gaps = 4/89 (4%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMD----SKEADLTRINLSGIPGGPEIFERAA 402
           D  V V    F  HK +L+  S Y + L       S +A +T +++    G    F+   
Sbjct: 32  DASVVVEGKVFKAHKNVLLGSSRYFKTLYCQVQKTSDQATVTHLDIVTAQG----FKAII 87

Query: 403 KFCYGVNFEITVHNVAALRCAAEYLQMTD 489
            F Y  +  +T  NV  +  AA +LQ+TD
Sbjct: 88  DFMYSAHLALTSRNVIEVMSAASFLQITD 116



>sp|Q13105|Z151_HUMAN Zinc finger protein 151 (Myc-interacting zinc
           finger protein) (Miz-1 protein).>gb:HSMIZ1_2018819
           H.sapiens mRNA for Miz-1 protein.
          Length = 803

 Score = 37.7 bits (86), Expect = 0.27
 Identities = 25/85 (29%), Positives = 38/85 (44%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           D    V    F  HK +L A S Y + L +D K  D+  +++S   G  ++ E    F Y
Sbjct: 25  DCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQK--DVVHLDISNAAGLGQMLE----FMY 78

Query: 415 GVNFEITVHNVAALRCAAEYLQMTD 489
                ++  NV  +   A +LQM D
Sbjct: 79  TAKLSLSPENVDDVLAVATFLQMQD 103



>gb:OSJN00056_1694017 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0015K02, complete
           sequence.>gb:OSJN00153_1695788 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0011F23, complete
           sequence.>gb:AF480497_1803764 Oryza sativa clone BAC
           24K23, complete sequence.
          Length = 353

 Score = 37.4 bits (85), Expect = 0.35
 Identities = 30/107 (28%), Positives = 47/107 (43%), Gaps = 5/107 (4%)
 Frame = +1

Query: 205 QWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMD--SKEADLTRINLSGIPGG 378
           +++ S + P D+ + VG+A+F  H+  L  +S Y RKL+      EA    I L  +   
Sbjct: 200 EFLLSGDAPFDLEIHVGDATFGAHRLALAGQSLYFRKLLYGQVGNEASSPAIRLREM--S 257

Query: 379 PEIFERAAKFCYGVNFEITVH---NVAALRCAAEYLQMTDKYCDNNL 510
           PE F     + Y  +     +   N AA+  A E  +  D Y    L
Sbjct: 258 PEAFGAVLHYVYHDSLPPEANKGRNAAAM--AREVFEAADMYAMERL 302



>gb:BX255917_2567174 Zebrafish DNA sequence from clone DKEY-1H6 in
           linkage group 20 Contains a novel gene, two transposase
           genes, a gene for a novel zinc finger protein and a gene
           for a novel protein similar to vertebrate MTHFD1,
           complete sequence.
          Length = 677

 Score = 37.0 bits (84), Expect = 0.46
 Identities = 29/113 (25%), Positives = 48/113 (42%)
 Frame = +1

Query: 145 MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM 324
           MA P  S      L  +R  +W F      D  + +G+  F  HK +L A S+Y R + +
Sbjct: 1   MARPSHSEHVLQQLNNQR--EWGFL----CDCCIAIGDIYFRAHKAVLAACSSYFRMMFI 54

Query: 325 DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQM 483
             ++    R +LS +    E F+   +  Y     +  +    L+ +  YLQM
Sbjct: 55  RDQQGS-ARFDLSNMQISAECFDLILQLMYLGRIAVDHYEFEELKASMAYLQM 106



>gb:BC080910_2561824 Xenopus tropicalis MGC79538 protein, mRNA (cDNA
           clone MGC:79538 IMAGE:6978089), complete cds.
          Length = 588

 Score = 37.0 bits (84), Expect = 0.46
 Identities = 24/87 (27%), Positives = 37/87 (42%), Gaps = 1/87 (1%)
 Frame = +1

Query: 232 TDVIVEVGEASFSLHKFMLVAKSNYIRKLI-MDSKEADLTRINLSGIPGGPEIFERAAKF 408
           TDV++  G  SF  HK +L + S Y   +  +  KE+    +N       PE+ E    +
Sbjct: 46  TDVVLLAGNRSFPCHKAVLASSSRYFEAMFSVGLKESQDREVNFQDAL-HPEVLELLLDY 104

Query: 409 CYGVNFEITVHNVAALRCAAEYLQMTD 489
            Y     +   N  +L  A + LQ  D
Sbjct: 105 AYSARIILNEENAESLLEAGDMLQFHD 131



>gb:BC046953_2549820 Xenopus laevis similar to ectodermal-neural
           cortex (with BTB-like domain), mRNA (cDNA clone
           MGC:53471 IMAGE:5572165), complete cds.
          Length = 588

 Score = 37.0 bits (84), Expect = 0.46
 Identities = 24/87 (27%), Positives = 37/87 (42%), Gaps = 1/87 (1%)
 Frame = +1

Query: 232 TDVIVEVGEASFSLHKFMLVAKSNYIRKLI-MDSKEADLTRINLSGIPGGPEIFERAAKF 408
           TDV++  G  SF  HK +L + S Y   +  +  KE+    +N       PE+ E    +
Sbjct: 46  TDVVLLAGNRSFPCHKAVLASSSRYFEAMFSVGLKESQDREVNFQDAL-HPEVLELLLDY 104

Query: 409 CYGVNFEITVHNVAALRCAAEYLQMTD 489
            Y     +   N  +L  A + LQ  D
Sbjct: 105 AYSARIILNEENAESLLEAGDMLQFHD 131



>gb:AY577006_2538250 Danio rerio clone RZ151A3D10 zinc finger and
           BTB domain containing 1 mRNA, complete cds.
          Length = 677

 Score = 37.0 bits (84), Expect = 0.46
 Identities = 29/113 (25%), Positives = 48/113 (42%)
 Frame = +1

Query: 145 MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM 324
           MA P  S      L  +R  +W F      D  + +G+  F  HK +L A S+Y R + +
Sbjct: 1   MARPSHSEHVLQQLNNQR--EWGFL----CDCCIAIGDIYFRAHKAVLAACSSYFRMMFI 54

Query: 325 DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQM 483
             ++    R +LS +    E F+   +  Y     +  +    L+ +  YLQM
Sbjct: 55  RDQQGS-ARFDLSNMQISAECFDLILQLMYLGRIAVDHYEFEELKASMAYLQM 106



>gb:AY216791_2519635 Xenopus laevis ectoderm neural cortex related-1
           (Encr-1) mRNA, complete cds.
          Length = 588

 Score = 37.0 bits (84), Expect = 0.46
 Identities = 24/87 (27%), Positives = 37/87 (42%), Gaps = 1/87 (1%)
 Frame = +1

Query: 232 TDVIVEVGEASFSLHKFMLVAKSNYIRKLI-MDSKEADLTRINLSGIPGGPEIFERAAKF 408
           TDV++  G  SF  HK +L + S Y   +  +  KE+    +N       PE+ E    +
Sbjct: 46  TDVVLLAGNRSFPCHKAVLASSSRYFEAMFSVGLKESQDREVNFQDAL-HPEVLELLLDY 104

Query: 409 CYGVNFEITVHNVAALRCAAEYLQMTD 489
            Y     +   N  +L  A + LQ  D
Sbjct: 105 AYSARIILNEENAESLLEAGDMLQFHD 131



>gb:AY101769_2076223 Mus musculus kelch-like protein mRNA, partial
           cds.
          Length = 629

 Score = 37.0 bits (84), Expect = 0.46
 Identities = 27/84 (32%), Positives = 37/84 (44%), Gaps = 1/84 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRINLSGIPGGPEIFERAAKFC 411
           DV ++VG    S HK +L     Y R + + +  EA    I +    G  +  E   KF 
Sbjct: 77  DVTLKVGSKLISCHKLVLACVIPYFRAMFLSEMSEAKQALIEIRDFDG--DAVEDLVKFV 134

Query: 412 YGVNFEITVHNVAALRCAAEYLQM 483
           Y     +TV NV  L  AA  LQ+
Sbjct: 135 YSSRLTLTVDNVQPLLYAACILQV 158



>gb:AF395817_1900720 Homo sapiens NAC1 protein mRNA, complete
           cds.>gb:BC055396_1985243 Homo sapiens BTB (POZ) domain
           containing 14B, mRNA (cDNA clone MGC:61553
           IMAGE:6142288), complete cds.
          Length = 527

 Score = 37.0 bits (84), Expect = 0.46
 Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 2/92 (2%)
 Frame = +1

Query: 220 QEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGG--PEIFE 393
           Q +  DV V V   +F  H+ +L A S+Y R L  +S+ A +       +P    P+ F+
Sbjct: 26  QGLYCDVSVVVKGHAFKAHRAVLAASSSYFRDLFNNSRSAVVE------LPAAVQPQSFQ 79

Query: 394 RAAKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
           +   FCY     + V +   L   A +LQ+ +
Sbjct: 80  QILSFCYTGRLSMNVGDQFLLMYTAGFLQIQE 111



>gb:AK034618_1163817 Mus musculus 12 days embryo embryonic body
           between diaphragm region and neck cDNA, RIKEN
           full-length enriched library, clone:9430015D11
           product:hypothetical BTB/POZ domain containing protein,
           full insert sequence.
          Length = 429

 Score = 37.0 bits (84), Expect = 0.46
 Identities = 27/84 (32%), Positives = 37/84 (44%), Gaps = 1/84 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRINLSGIPGGPEIFERAAKFC 411
           DV ++VG    S HK +L     Y R + + +  EA    I +    G  +  E   KF 
Sbjct: 77  DVTLKVGSKLISCHKLVLACVIPYFRAMFLSEMSEAKQALIEIRDFDG--DAVEDLVKFV 134

Query: 412 YGVNFEITVHNVAALRCAAEYLQM 483
           Y     +TV NV  L  AA  LQ+
Sbjct: 135 YSSRLTLTVDNVQPLLYAACILQV 158



>gb:AK031028_1162263 Mus musculus adult male thymus cDNA, RIKEN
           full-length enriched library, clone:5832405J12
           product:hypothetical BTB/POZ domain containing protein,
           full insert sequence.>gb:BC086802_2109810 Mus musculus
           kelch-like 8 (Drosophila), mRNA (cDNA clone MGC:102224
           IMAGE:30612176), complete cds.
          Length = 629

 Score = 37.0 bits (84), Expect = 0.46
 Identities = 27/84 (32%), Positives = 37/84 (44%), Gaps = 1/84 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRINLSGIPGGPEIFERAAKFC 411
           DV ++VG    S HK +L     Y R + + +  EA    I +    G  +  E   KF 
Sbjct: 77  DVTLKVGSKLISCHKLVLACVIPYFRAMFLSEMSEAKQALIEIRDFDG--DAVEDLVKFV 134

Query: 412 YGVNFEITVHNVAALRCAAEYLQM 483
           Y     +TV NV  L  AA  LQ+
Sbjct: 135 YSSRLTLTVDNVQPLLYAACILQV 158



>sp|P59280|KHL8_MOUSE Kelch-like protein 8.>gb:AK049960_1169056 Mus
           musculus adult male hippocampus cDNA, RIKEN full-length
           enriched library, clone:C630033J19 product:hypothetical
           BTB/POZ domain containing protein, full insert sequence.
          Length = 629

 Score = 37.0 bits (84), Expect = 0.46
 Identities = 27/84 (32%), Positives = 37/84 (44%), Gaps = 1/84 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRINLSGIPGGPEIFERAAKFC 411
           DV ++VG    S HK +L     Y R + + +  EA    I +    G  +  E   KF 
Sbjct: 77  DVTLKVGSKLISCHKLVLACVIPYFRAMFLSEMSEAKQALIEIRDFDG--DAVEDLVKFV 134

Query: 412 YGVNFEITVHNVAALRCAAEYLQM 483
           Y     +TV NV  L  AA  LQ+
Sbjct: 135 YSSRLTLTVDNVQPLLYAACILQV 158



>gb:BC077406_2560116 Xenopus laevis MGC81737 protein, mRNA (cDNA
           clone MGC:81737 IMAGE:6865559), complete cds.
          Length = 609

 Score = 36.6 bits (83), Expect = 0.60
 Identities = 21/85 (24%), Positives = 39/85 (45%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           D  + +G+  F  H+ +L + S+Y R    DS ++ +    +   P G   F+    F Y
Sbjct: 25  DCTILIGDFHFKAHRNVLASFSDYFRAYFKDSLDSIVLLDQIKVTPSG---FQTLLDFIY 81

Query: 415 GVNFEITVHNVAALRCAAEYLQMTD 489
             N      N+  +  AA++L++ D
Sbjct: 82  SGNLNYDSCNLEEINLAAQHLRLED 106



>gb:BC073388_2557230 Xenopus laevis MGC80829 protein, mRNA (cDNA
           clone MGC:80829 IMAGE:5514082), complete cds.
          Length = 588

 Score = 36.6 bits (83), Expect = 0.60
 Identities = 23/87 (26%), Positives = 37/87 (42%), Gaps = 1/87 (1%)
 Frame = +1

Query: 232 TDVIVEVGEASFSLHKFMLVAKSNYIRKLI-MDSKEADLTRINLSGIPGGPEIFERAAKF 408
           TD+++  G  SF  HK +L + S Y   +  +  KE+    +N       PE+ E    +
Sbjct: 46  TDIVLLAGNRSFPCHKAVLASSSRYFEAMFSVGLKESQDREVNFQDAL-HPEVLELLLDY 104

Query: 409 CYGVNFEITVHNVAALRCAAEYLQMTD 489
            Y     +   N  +L  A + LQ  D
Sbjct: 105 AYSARIILNEENAESLLEAGDMLQFHD 131



>gb:AY693992_2087822 Rattus norvegicus zinc finger and BTB domain
           containing 1 mRNA, complete cds.
          Length = 713

 Score = 36.6 bits (83), Expect = 0.60
 Identities = 29/113 (25%), Positives = 48/113 (42%)
 Frame = +1

Query: 145 MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM 324
           MA P  S+     L  +R  +W F      D  + + +  F  HK +L A S+Y R   M
Sbjct: 1   MAKPSHSSYVLQQLNNQR--EWGFL----CDCCIAIDDTYFQAHKAVLAACSSYFRMFFM 54

Query: 325 DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQM 483
           + + +   ++NLS +    E F+   +F Y         +    + A  YLQ+
Sbjct: 55  NHQHS-TAQLNLSNMKISAECFDLILQFMYLGKILTAPSSFEQFKVAMNYLQL 106



>gb:HSA507398_2007994 Homo sapiens RINZFC gene for putative RIN zinc
           finger protein, exons 1-6.
          Length = 847

 Score = 36.6 bits (83), Expect = 0.60
 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 5/90 (5%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLI-MDSKEA----DLTRINLSGIPGGPEIFERA 399
           DV + V    F  HK +LVA S + + L    +KE+    + T ++++ + G   I +  
Sbjct: 365 DVSIVVSGKIFKAHKNILVAGSRFFKTLYCFSNKESPNQNNTTHLDIAAVQGFSVILD-- 422

Query: 400 AKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
             F Y  N  +T  N   +   A YLQM++
Sbjct: 423 --FLYSGNLVLTSQNAIEVMTVASYLQMSE 450



>gb:BC050719_1984502 Homo sapiens zinc finger and BTB domain
           containing 1, mRNA (cDNA clone MGC:60335 IMAGE:6141266),
           complete cds.
          Length = 713

 Score = 36.6 bits (83), Expect = 0.60
 Identities = 29/113 (25%), Positives = 48/113 (42%)
 Frame = +1

Query: 145 MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM 324
           MA P  S+     L  +R  +W F      D  + + +  F  HK +L A S+Y R   M
Sbjct: 1   MAKPSHSSYVLQQLNNQR--EWGFL----CDCCIAIDDIYFQAHKAVLAACSSYFRMFFM 54

Query: 325 DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQM 483
           + + +   ++NLS +    E F+   +F Y         +    + A  YLQ+
Sbjct: 55  NHQHS-TAQLNLSNMKISAECFDLILQFMYLGKIMTAPSSFEQFKVAMNYLQL 106



>gb:AY598321_1957276 Homo sapiens L2 mRNA, complete cds.
          Length = 644

 Score = 36.6 bits (83), Expect = 0.60
 Identities = 29/113 (25%), Positives = 48/113 (42%)
 Frame = +1

Query: 145 MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM 324
           MA P  S+     L  +R  +W F      D  + + +  F  HK +L A S+Y R   M
Sbjct: 1   MAKPSHSSYVLQQLNNQR--EWGFL----CDCCIAIDDIYFQAHKAVLAACSSYFRMFFM 54

Query: 325 DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQM 483
           + + +   ++NLS +    E F+   +F Y         +    + A  YLQ+
Sbjct: 55  NHQHS-TAQLNLSNMKISAECFDLILQFMYLGKIMTAPSSFEQFKVAMNYLQL 106



>gb:AK056913_1911860 Homo sapiens cDNA FLJ32351 fis, clone
           PROST2007317, highly similar to Rattus norvegicus zinc
           finger protein RIN ZF mRNA.
          Length = 579

 Score = 36.6 bits (83), Expect = 0.60
 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 5/90 (5%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLI-MDSKEA----DLTRINLSGIPGGPEIFERA 399
           DV + V    F  HK +LVA S + + L    +KE+    + T ++++ + G   I +  
Sbjct: 73  DVSIVVSGKIFKAHKNILVAGSRFFKTLYCFSNKESPNQNNTTHLDIAAVQGFSVILD-- 130

Query: 400 AKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
             F Y  N  +T  N   +   A YLQM++
Sbjct: 131 --FLYSGNLVLTSQNAIEVMTVASYLQMSE 158



>gb:AB023214_1865536 Homo sapiens mRNA for KIAA0997 protein, partial
           cds.
          Length = 646

 Score = 36.6 bits (83), Expect = 0.60
 Identities = 29/113 (25%), Positives = 48/113 (42%)
 Frame = +1

Query: 145 MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM 324
           MA P  S+     L  +R  +W F      D  + + +  F  HK +L A S+Y R   M
Sbjct: 3   MAKPSHSSYVLQQLNNQR--EWGFL----CDCCIAIDDIYFQAHKAVLAACSSYFRMFFM 56

Query: 325 DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQM 483
           + + +   ++NLS +    E F+   +F Y         +    + A  YLQ+
Sbjct: 57  NHQHS-TAQLNLSNMKISAECFDLILQFMYLGKIMTAPSSFEQFKVAMNYLQL 108



>gb:CNSLT1IBG_1180715 human full-length cDNA 5-PRIME end of clone
           CS0DK006YE12 of HeLa cells of Homo sapiens (human).
          Length = 417

 Score = 36.6 bits (83), Expect = 0.60
 Identities = 29/113 (25%), Positives = 48/113 (42%)
 Frame = +1

Query: 145 MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM 324
           MA P  S+     L  +R  +W F      D  + + +  F  HK +L A S+Y R   M
Sbjct: 1   MAKPSHSSYVLQQLNNQR--EWGFL----CDCCIAIDDIYFQAHKAVLAACSSYFRMFFM 54

Query: 325 DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQM 483
           + + +   ++NLS +    E F+   +F Y         +    + A  YLQ+
Sbjct: 55  NHQHS-TAQLNLSNMKISAECFDLILQFMYLGKIMTAPSSFEQFKVAMNYLQL 106



>gb:AK029762_1161646 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4930534F19
           product:hypothetical BTB/POZ domain containing protein,
           full insert sequence.
          Length = 713

 Score = 36.6 bits (83), Expect = 0.60
 Identities = 29/113 (25%), Positives = 48/113 (42%)
 Frame = +1

Query: 145 MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM 324
           MA P  S+     L  +R  +W F      D  + + +  F  HK +L A S+Y R   M
Sbjct: 1   MAKPSHSSYVLQQLNNQR--EWGFL----CDCCIAIDDIYFQAHKAVLAACSSYFRMFFM 54

Query: 325 DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQM 483
           + + +   ++NLS +    E F+   +F Y         +    + A  YLQ+
Sbjct: 55  NHQHS-TAQLNLSNMKISAECFDLILQFMYLGKIMTAPSSFEQFKVAMNYLQL 106



>sp|Q91VL9|ZBT1_MOUSE Zinc finger and BTB domain containing protein
           1.>gb:AK035036_1163966 Mus musculus 12 days embryo
           embryonic body between diaphragm region and neck cDNA,
           RIKEN full-length enriched library, clone:9430077A12
           product:hypothetical BTB/POZ domain containing protein,
           full insert sequence.>gb:AK049397_1168781 Mus musculus 7
           days embryo whole body cDNA, RIKEN full-length enriched
           library, clone:C430003J21 product:hypothetical BTB/POZ
           domain containing protein, full insert
           sequence.>gb:AY611626_2086860 Mus musculus brain
           specific protein 2 (Bsg2) mRNA, complete
           cds.>gb:BC012239_2091495 Mus musculus zinc finger and
           BTB domain containing 1, mRNA (cDNA clone MGC:19295
           IMAGE:4037044), complete cds.
          Length = 713

 Score = 36.6 bits (83), Expect = 0.60
 Identities = 29/113 (25%), Positives = 48/113 (42%)
 Frame = +1

Query: 145 MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM 324
           MA P  S+     L  +R  +W F      D  + + +  F  HK +L A S+Y R   M
Sbjct: 1   MAKPSHSSYVLQQLNNQR--EWGFL----CDCCIAIDDIYFQAHKAVLAACSSYFRMFFM 54

Query: 325 DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQM 483
           + + +   ++NLS +    E F+   +F Y         +    + A  YLQ+
Sbjct: 55  NHQHS-TAQLNLSNMKISAECFDLILQFMYLGKIMTAPSSFEQFKVAMNYLQL 106



>sp|Q9Y2K1|ZBT1_HUMAN Zinc finger and BTB domain containing protein
           1.
          Length = 713

 Score = 36.6 bits (83), Expect = 0.60
 Identities = 29/113 (25%), Positives = 48/113 (42%)
 Frame = +1

Query: 145 MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM 324
           MA P  S+     L  +R  +W F      D  + + +  F  HK +L A S+Y R   M
Sbjct: 1   MAKPSHSSYVLQQLNNQR--EWGFL----CDCCIAIDDIYFQAHKAVLAACSSYFRMFFM 54

Query: 325 DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQM 483
           + + +   ++NLS +    E F+   +F Y         +    + A  YLQ+
Sbjct: 55  NHQHS-TAQLNLSNMKISAECFDLILQFMYLGKIMTAPSSFEQFKVAMNYLQL 106



>sp|Q96DT7|ZB10_HUMAN Zinc finger and BTB domain containing protein
           10 (Zinc finger protein RIN ZF).>gb:HSA319673_2004051
           Homo sapiens mRNA for zinc finger protein RINZF (RINZF
           gene).
          Length = 847

 Score = 36.6 bits (83), Expect = 0.60
 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 5/90 (5%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLI-MDSKEA----DLTRINLSGIPGGPEIFERA 399
           DV + V    F  HK +LVA S + + L    +KE+    + T ++++ + G   I +  
Sbjct: 365 DVSIVVSGKIFKAHKNILVAGSRFFKTLYCFSNKESPNQNNTTHLDIAAVQGFSVILD-- 422

Query: 400 AKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
             F Y  N  +T  N   +   A YLQM++
Sbjct: 423 --FLYSGNLVLTSQNAIEVMTVASYLQMSE 450



>gb:AJ719971_2502158 Gallus gallus mRNA for hypothetical protein,
           clone 8o12.
          Length = 337

 Score = 36.2 bits (82), Expect = 0.78
 Identities = 22/83 (26%), Positives = 36/83 (43%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           D  + + +  F  HK +L A S+Y R   M+ +     ++NLS +    E F+   +F Y
Sbjct: 25  DCCIAIDDIYFQAHKAVLAACSSYFRMFFMNHQHT-TAQLNLSNMKISAECFDLILQFMY 83

Query: 415 GVNFEITVHNVAALRCAAEYLQM 483
                    N    + A  YLQ+
Sbjct: 84  LGKIMTAPANFEQFKVAMNYLQL 106



>gb:BC067753_1987461 Homo sapiens kelch-like 10 (Drosophila), mRNA
           (cDNA clone MGC:87028 IMAGE:5275619), complete cds.
          Length = 608

 Score = 36.2 bits (82), Expect = 0.78
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPG-GPEIFERAAKFC 411
           DV+++V    FS HK +L + S+Y R L   +   + T   +  IPG  P++ +   ++ 
Sbjct: 40  DVVIKVNGFEFSAHKNILCSCSSYFRALF--TSGWNNTEKKVYNIPGISPDMMKLIIEYA 97

Query: 412 YGVNFEITVHNVAALRCAAE 471
           Y     IT  NV  L  AA+
Sbjct: 98  YTRTVPITPDNVEKLLAAAD 117



>gb:BC059404_1985639 Homo sapiens B-cell CLL/lymphoma 6, member B
           (zinc finger protein), mRNA (cDNA clone MGC:71775
           IMAGE:30342006), complete cds.
          Length = 480

 Score = 36.2 bits (82), Expect = 0.78
 Identities = 26/88 (29%), Positives = 38/88 (43%), Gaps = 2/88 (2%)
 Frame = +1

Query: 226 IPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEI--FERA 399
           I TDV + VG      HK +L+A S +   +           +++  +PGGPE   F   
Sbjct: 36  ILTDVTLLVGGQPLRAHKAVLIACSGFFYSIFRGRAGVG---VDVLSLPGGPEARGFAPL 92

Query: 400 AKFCYGVNFEITVHNVAALRCAAEYLQM 483
             F Y     ++     A+  AA YLQM
Sbjct: 93  LDFMYTSRLRLSPATAPAVLAAATYLQM 120



>gb:AY495339_1954816 Homo sapiens KLHL10 (KLHL10) mRNA, complete
           cds.
          Length = 608

 Score = 36.2 bits (82), Expect = 0.78
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPG-GPEIFERAAKFC 411
           DV+++V    FS HK +L + S+Y R L   +   + T   +  IPG  P++ +   ++ 
Sbjct: 40  DVVIKVNGFEFSAHKNILCSCSSYFRALF--TSGWNNTEKKVYNIPGISPDMMKLIIEYA 97

Query: 412 YGVNFEITVHNVAALRCAAE 471
           Y     IT  NV  L  AA+
Sbjct: 98  YTRTVPITPDNVEKLLAAAD 117



>gb:AK057224_1911938 Homo sapiens cDNA FLJ32662 fis, clone
           TESTI1000064, weakly similar to Fugu rubripes sex comb
           on midleg-like 2 protein (SCML2) gene.
          Length = 614

 Score = 36.2 bits (82), Expect = 0.78
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPG-GPEIFERAAKFC 411
           DV+++V    FS HK +L + S+Y R L   +   + T   +  IPG  P++ +   ++ 
Sbjct: 40  DVVIKVNGFEFSAHKNILCSCSSYFRALF--TSGWNNTEKKVYNIPGISPDMMKLIIEYA 97

Query: 412 YGVNFEITVHNVAALRCAAE 471
           Y     IT  NV  L  AA+
Sbjct: 98  YTRTVPITPDNVEKLLAAAD 117



>gb:AX970133_1485442 Sequence 936 from Patent EP1104808.
          Length = 132

 Score = 36.2 bits (82), Expect = 0.78
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPG-GPEIFERAAKFC 411
           DV+++V    FS HK +L + S+Y R L   +   + T   +  IPG  P++ +   ++ 
Sbjct: 40  DVVIKVNGFEFSAHKNILCSCSSYFRALF--TSGWNNTEKKVYNIPGISPDMMKLIIEYA 97

Query: 412 YGVNFEITVHNVAALRCAAE 471
           Y     IT  NV  L  AA+
Sbjct: 98  YTRTVPITPDNVEKLLAAAD 117



>pir|JC7812|JC7812 BCL6 homologous zinc finger protein BAZF -
           human>gb:AB076580_1871508 Homo sapiens mRNA for BAZF,
           complete cds.>gb:AB076581_1871509 Homo sapiens gene for
           BAZF, complete cds.
          Length = 480

 Score = 36.2 bits (82), Expect = 0.78
 Identities = 26/88 (29%), Positives = 38/88 (43%), Gaps = 2/88 (2%)
 Frame = +1

Query: 226 IPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEI--FERA 399
           I TDV + VG      HK +L+A S +   +           +++  +PGGPE   F   
Sbjct: 36  ILTDVTLLVGGQPLRAHKAVLIACSGFFYSIFRGRAGVG---VDVLSLPGGPEARGFAPL 92

Query: 400 AKFCYGVNFEITVHNVAALRCAAEYLQM 483
             F Y     ++     A+  AA YLQM
Sbjct: 93  LDFMYTSRLRLSPATAPAVLAAATYLQM 120



>gb:BC071011_2555885 Xenopus laevis hypothetical protein MGC81277,
           mRNA (cDNA clone MGC:81277 IMAGE:6631797), complete cds.
          Length = 622

 Score = 35.8 bits (81), Expect = 1.0
 Identities = 24/93 (25%), Positives = 41/93 (44%), Gaps = 1/93 (1%)
 Frame = +1

Query: 214 FSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRINLSGIPGGPEIF 390
           + Q++ TD+++ V    F  HK +L   S+Y R + M    E+  T ++L  +       
Sbjct: 25  YEQQLLTDIVLIVEGTEFPCHKMVLATCSSYFRAMFMSGLSESKQTHVHLRNVDAAS--L 82

Query: 391 ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
           +    + Y  N  I    V  L   A +LQ+ D
Sbjct: 83  QIIITYAYTGNLAINEGTVEQLYETACFLQVDD 115



>gb:AK129374_2069605 Mus musculus mRNA for mKIAA1489 protein.
          Length = 627

 Score = 35.8 bits (81), Expect = 1.0
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 1/93 (1%)
 Frame = +1

Query: 214 FSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRINLSGIPGGPEIF 390
           + Q++ TD+++ V    F  HK +L   S+Y R + M    E+  T ++L  +       
Sbjct: 29  YEQQLFTDIVLIVEGTEFPCHKMVLATCSSYFRAMFMSGLSESKQTHVHLRNVDAA--AL 86

Query: 391 ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
           +    + Y  N  +    V  L   A +LQ+ D
Sbjct: 87  QMIIAYAYTGNLAVNDSTVEQLYETACFLQVED 119



>gb:AB011665_2043670 Mus musculus mRNA for BAZF, complete
           cds.>gb:AL669869_2072531 Mouse DNA sequence from clone
           RP23-198E14 on chromosome 11 Contains the 3' end of the
           Mgl2 gene for macrophage galactose
           N-acetyl-galactosamine specific lectin 2, the Mgl1 gene
           for macrophage galactose N-acetyl-galactosamine specific
           lectin 1, the gene for a novel RNA polymerase Rpb1
           C-terminal repeat domain containing protein, three novel
           genes, the Bcl6b gene for B-cell CLL/lymphoma 6 member
           B, the Alox12 gene for arachidonate 12-lipoxygenase and
           four CpG islands, complete sequence.
          Length = 474

 Score = 35.8 bits (81), Expect = 1.0
 Identities = 28/88 (31%), Positives = 40/88 (45%), Gaps = 2/88 (2%)
 Frame = +1

Query: 226 IPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEI--FERA 399
           I TDV + VG      HK +L+A S +   +      A L  +++  +PGGPE   F   
Sbjct: 36  ILTDVTLLVGGQPLRAHKAVLIACSGFFYSIFRG--RAGL-GVDVLSLPGGPEARGFAPL 92

Query: 400 AKFCYGVNFEITVHNVAALRCAAEYLQM 483
             F Y     ++     A+  AA YLQM
Sbjct: 93  LDFMYTSRLRLSPATAPAVLAAATYLQM 120



>gb:AK127065_1916578 Homo sapiens cDNA FLJ45122 fis, clone
           BRAWH3036247, weakly similar to Zinc finger protein 228.
          Length = 645

 Score = 35.8 bits (81), Expect = 1.0
 Identities = 23/86 (26%), Positives = 38/86 (44%), Gaps = 1/86 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI-PGGPEIFERAAKFC 411
           D+++    + F  HK +L A S +   L   +K+     ++L  + PGG    ++   F 
Sbjct: 18  DLVLVPQRSVFPAHKGVLAAYSQFFHSLFTQNKQLQRVELSLEALAPGG---LQQILNFI 74

Query: 412 YGVNFEITVHNVAALRCAAEYLQMTD 489
           Y     +   NV  +  AA  LQM D
Sbjct: 75  YTSKLLVNAANVHEVLSAASLLQMAD 100



>gb:AK028396_1160974 Mus musculus 18 days pregnant adult female
           placenta and extra embryonic tissue cDNA, RIKEN
           full-length enriched library, clone:3830432E14
           product:hypothetical BTB/POZ domain containing protein,
           full insert sequence.
          Length = 508

 Score = 35.8 bits (81), Expect = 1.0
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 1/93 (1%)
 Frame = +1

Query: 214 FSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRINLSGIPGGPEIF 390
           + Q++ TD+++ V    F  HK +L   S+Y R + M    E+  T ++L  +       
Sbjct: 25  YEQQLFTDIVLIVEGTEFPCHKMVLATCSSYFRAMFMSGLSESKQTHVHLRNVDAA--AL 82

Query: 391 ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
           +    + Y  N  +    V  L   A +LQ+ D
Sbjct: 83  QMIIAYAYTGNLAVNDSTVEQLYETACFLQVED 115



>gb:AL591589_2504004 Zebrafish DNA sequence from clone BUSM1-198M22
           in linkage group 2 Contains a novel gene similar to PAK2
           (p21 (CDKN1A)-activated kinase 2) and a novel gene
           similar to KLHL6 (kelch-like protein 6), complete
           sequence.
          Length = 521

 Score = 35.4 bits (80), Expect = 1.3
 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 1/80 (1%)
 Frame = +1

Query: 232 TDVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRINLSGIPGGPEIFERAAKF 408
           TDVI+ V   SF  H+ +L A S+Y R +   D +E     +N+ GI    +       +
Sbjct: 65  TDVILNVQSQSFKCHRVVLAAASHYFRAMFCNDLREKHEENVNIKGIDA--DTMRILLDY 122

Query: 409 CYGVNFEITVHNVAALRCAA 468
            Y     IT  NV  +  AA
Sbjct: 123 TYTSKVTITKDNVQRMLEAA 142



>gb:AJ720925_2503112 Gallus gallus mRNA for hypothetical protein,
           clone 30b5.
          Length = 344

 Score = 35.4 bits (80), Expect = 1.3
 Identities = 26/79 (32%), Positives = 33/79 (41%), Gaps = 4/79 (5%)
 Frame = +1

Query: 265 FSLHKFMLVAKSNYIRKL----IMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEI 432
           F  HK +L A S Y R L    I DS       +++       E F     F Y    ++
Sbjct: 35  FKAHKNILFANSGYFRALLIHYIQDSGRHSTASLDIVT----SEAFSIILDFLYSGKLDL 90

Query: 433 TVHNVAALRCAAEYLQMTD 489
              NV  +  AA YLQMTD
Sbjct: 91  CGENVIEVMSAASYLQMTD 109



>gb:BC064049_2105302 Mus musculus cDNA clone MGC:73573 IMAGE:639105,
           complete cds.
          Length = 270

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPG-GPEIFERAAKFC 411
           DV+++V    F+ HK +L + S+Y R L   +   + T   +  IPG  P++ +   ++ 
Sbjct: 40  DVVIKVNGFEFNAHKNILCSCSSYFRALF--TSGWNNTEKKVYNIPGISPDMMKLIIEYA 97

Query: 412 YGVNFEITVHNVAALRCAAE 471
           Y     IT  NV  L  AA+
Sbjct: 98  YTRTVPITPDNVEKLLAAAD 117



>gb:AY495338_2085606 Rattus norvegicus KLHL10 (Klhl10) mRNA,
           complete cds.>gb:BC085842_2109401 Rattus norvegicus
           kelch-like 10, mRNA (cDNA clone MGC:94527
           IMAGE:7135823), complete cds.
          Length = 608

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPG-GPEIFERAAKFC 411
           DV+++V    F+ HK +L + S+Y R L   +   + T   +  IPG  P++ +   ++ 
Sbjct: 40  DVVIKVNGFEFNAHKNILCSCSSYFRALF--TSGWNNTEKKVYNIPGISPDMMKLIIEYA 97

Query: 412 YGVNFEITVHNVAALRCAAE 471
           Y     IT  NV  L  AA+
Sbjct: 98  YTRTVPITPDNVEKLLAAAD 117



>gb:AK077202_1171730 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4933430B12
           product:hypothetical Galactose oxidase, central domain
           structure containing protein, full insert sequence.
          Length = 604

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPG-GPEIFERAAKFC 411
           DV+++V    F+ HK +L + S+Y R L   +   + T   +  IPG  P++ +   ++ 
Sbjct: 40  DVVIKVNGFEFNAHKNILCSCSSYFRALF--TSGWNNTEKKVYNIPGISPDMMKLIIEYA 97

Query: 412 YGVNFEITVHNVAALRCAAE 471
           Y     IT  NV  L  AA+
Sbjct: 98  YTRTVPITPDNVEKLLAAAD 117



>gb:AK014906_1158188 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4921517C11
           product:hypothetical Galactose oxidase, central domain
           structure containing protein, full insert
           sequence.>gb:AY495337_2085605 Mus musculus KLHL10
           (Klhl10) mRNA, complete cds.
          Length = 608

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPG-GPEIFERAAKFC 411
           DV+++V    F+ HK +L + S+Y R L   +   + T   +  IPG  P++ +   ++ 
Sbjct: 40  DVVIKVNGFEFNAHKNILCSCSSYFRALF--TSGWNNTEKKVYNIPGISPDMMKLIIEYA 97

Query: 412 YGVNFEITVHNVAALRCAAE 471
           Y     IT  NV  L  AA+
Sbjct: 98  YTRTVPITPDNVEKLLAAAD 117



>gb:AK006288_1153491 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:1700023O17
           product:hypothetical Galactose oxidase, central domain
           structure containing protein, full insert sequence.
          Length = 608

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPG-GPEIFERAAKFC 411
           DV+++V    F+ HK +L + S+Y R L   +   + T   +  IPG  P++ +   ++ 
Sbjct: 40  DVVIKVNGFEFNAHKNILCSCSSYFRALF--TSGWNNTEKKVYNIPGISPDMMKLIIEYA 97

Query: 412 YGVNFEITVHNVAALRCAAE 471
           Y     IT  NV  L  AA+
Sbjct: 98  YTRTVPITPDNVEKLLAAAD 117



>gb:CP000011_868247 Burkholderia mallei ATCC 23344 chromosome 2,
           complete sequence.
          Length = 751

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 5/54 (9%)
 Frame = -2

Query: 520 SDRRGCCRS-TCPSSEDTRRRNAEPPRYVQ*SR----S*LHSRTSPPFRRSQGR 374
           S RRG CR+ +CP++   RRR   PPR    SR        +RT P  RR + R
Sbjct: 676 SSRRGPCRALSCPTASRRRRRRRRPPRSAASSRRPPSGSAGTRTCPTCRRGRSR 729



>gb:DRE429491_2571128 Danio rerio mRNA for HIC1 protein.
          Length = 737

 Score = 34.7 bits (78), Expect = 2.3
 Identities = 27/91 (29%), Positives = 38/91 (41%), Gaps = 6/91 (6%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           DVI+ V  A F  HK +L A S Y++ L++         INL      P +F     + Y
Sbjct: 29  DVIIVVQNALFRAHKNILAASSLYLKSLVVHD-----NLINLDHEMVSPGVFRVILDYIY 83

Query: 415 GVNF------EITVHNVAALRCAAEYLQMTD 489
                          N+ A+  AA YLQ+ D
Sbjct: 84  TGRLSECDPTSPNEPNIGAVLAAASYLQLLD 114



>gb:MMU132691_2118437 Mus musculus (strain 129) partial HIC-1 gene,
           exon 1.
          Length = 160

 Score = 34.7 bits (78), Expect = 2.3
 Identities = 34/128 (26%), Positives = 51/128 (39%), Gaps = 13/128 (10%)
 Frame = +1

Query: 145 MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM 324
           M +P  S    L L  +RT  ++       DVI+ V  A F  HK +L A S Y++ L++
Sbjct: 5   MEAPGHSRQLLLQLNNQRTKGFL------CDVIIVVQNALFRAHKNVLAASSAYLKSLVV 58

Query: 325 DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVH-------------NVAALRCA 465
                    +NL      P +F     F Y      +V              ++ A+  A
Sbjct: 59  HD-----NLLNLDHDMVSPAVFRLVLDFIYTGRLTDSVEAAAAAAVAPGAEPSLGAVLAA 113

Query: 466 AEYLQMTD 489
           A YLQ+ D
Sbjct: 114 ASYLQIPD 121



>gb:AL603905_2071226 Mouse DNA sequence from clone RP23-143A14 on
           chromosome 11 Contains the 3' end of a novel gene, the
           Hic1 gene for hypermethylated in cancer 1, a novel gene,
           the gene for the ortholog of human candidate tumor
           suppressor in ovarian cancer 2 OVCA2, the Dph2l1 gene
           for DPH2-like 1 (S. cerevisiae), the Rtn4rl1 gene for
           reticulon 4 receptor-like 1 and two CpG islands,
           complete sequence.
          Length = 893

 Score = 34.7 bits (78), Expect = 2.3
 Identities = 34/128 (26%), Positives = 51/128 (39%), Gaps = 13/128 (10%)
 Frame = +1

Query: 145 MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM 324
           M +P  S    L L  +RT  ++       DVI+ V  A F  HK +L A S Y++ L++
Sbjct: 184 MEAPGHSRQLLLQLNNQRTKGFL------CDVIIVVQNALFRAHKNVLAASSAYLKSLVV 237

Query: 325 DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVH-------------NVAALRCA 465
                    +NL      P +F     F Y      +V              ++ A+  A
Sbjct: 238 HD-----NLLNLDHDMVSPAVFRLVLDFIYTGRLTDSVEAAAAAAVAPGAEPSLGAVLAA 292

Query: 466 AEYLQMTD 489
           A YLQ+ D
Sbjct: 293 ASYLQIPD 300



>gb:BC039585_1982579 Homo sapiens kelch-like 7 (Drosophila), mRNA
           (cDNA clone MGC:48764 IMAGE:5527346), complete cds.
          Length = 586

 Score = 34.7 bits (78), Expect = 2.3
 Identities = 23/88 (26%), Positives = 39/88 (44%)
 Frame = +1

Query: 220 QEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERA 399
           Q+   DVI+ V E     H+ +L A S++   L+  +   +     L      P+I E+ 
Sbjct: 40  QKTLCDVILMVQERKIPAHRVVLAAASHFFN-LMFTTNMLESKSFELELKDAEPDIIEQL 98

Query: 400 AKFCYGVNFEITVHNVAALRCAAEYLQM 483
            +F Y     +  +NV +L  AA   Q+
Sbjct: 99  VEFAYTARISVNSNNVQSLLDAANQYQI 126



>gb:AP005869_1859341 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:B1026C12.
          Length = 808

 Score = 34.7 bits (78), Expect = 2.3
 Identities = 36/161 (22%), Positives = 53/161 (32%), Gaps = 5/161 (3%)
 Frame = -2

Query: 826 ATVPXXXXXXXXXXXXXRCETSSXXXXXXXXXXRESLAP--PSTNSAATCSENSP--PRT 659
           +T P                 SS            S +P  P+T   A  S ++P  P T
Sbjct: 34  STPPPSTAASATPTTSSASSPSSSTASSSSPSSSTSTSPSAPTTTETAALSPSTPSSPAT 93

Query: 658 PLHSLIPRISARFSDLRPAGEXXXXXXXXXXXRKGWTGPPATENPPSDRRGCCRSTCPSS 479
           P  +  P    R S    +                   PP   + PS  R   R+  PS+
Sbjct: 94  PRSASSPTSRPRTSSTSTSASPPRSAAPPSSAS-----PPPPRSAPSGSRTSSRTAAPSA 148

Query: 478 EDTRRRNAEPPRYVQ*S-RS*LHSRTSPPFRRSQGRRESQT 359
             +    + PP +   +  S   S +SPP   S+ RR + T
Sbjct: 149 SPSSSSPSSPPPWSSATPASRPPSPSSPPSVASRTRRHTST 189



>sp|Q9R1Y5|HIC1_MOUSE Hypermethylated in cancer 1 protein
           (Hic-1).>gb:AF036582_2051811 Mus musculus
           hypermethylated in cancer 1 (Hic1) gene, complete cds.
          Length = 892

 Score = 34.7 bits (78), Expect = 2.3
 Identities = 34/128 (26%), Positives = 51/128 (39%), Gaps = 13/128 (10%)
 Frame = +1

Query: 145 MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM 324
           M +P  S    L L  +RT  ++       DVI+ V  A F  HK +L A S Y++ L++
Sbjct: 183 MEAPGHSRQLLLQLNNQRTKGFL------CDVIIVVQNALFRAHKNVLAASSAYLKSLVV 236

Query: 325 DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVH-------------NVAALRCA 465
                    +NL      P +F     F Y      +V              ++ A+  A
Sbjct: 237 HD-----NLLNLDHDMVSPAVFRLVLDFIYTGRLTDSVEAAAAAAVAPGAEPSLGAVLAA 291

Query: 466 AEYLQMTD 489
           A YLQ+ D
Sbjct: 292 ASYLQIPD 299



>gb:BC063745_2553596 Danio rerio zgc:63520, mRNA (cDNA clone
           MGC:63520 IMAGE:2644458), complete cds.
          Length = 538

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 27/89 (30%), Positives = 39/89 (43%), Gaps = 1/89 (1%)
 Frame = +1

Query: 220 QEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRINLSGIPGGPEIFER 396
           Q I  DVI+ V       H+ +L A S++   +   S  EA    + L G    PEI E 
Sbjct: 42  QGILCDVILVVEGKHILAHRVVLSAASHFFSLMFTSSMMEASNHEVELGGAE--PEIIEL 99

Query: 397 AAKFCYGVNFEITVHNVAALRCAAEYLQM 483
             +F Y     +  +NV +L  AA   Q+
Sbjct: 100 LVEFIYTARISVNSNNVQSLLNAANQYQI 128



>gb:BC049490_2550291 Danio rerio zgc:56572, mRNA (cDNA clone
           MGC:56572 IMAGE:5914847), complete cds.
          Length = 215

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 23/81 (28%), Positives = 37/81 (45%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           D  V +G+  F  HK +L A SNY R L +  +++D  R+  + I   P+IF       Y
Sbjct: 25  DCTVAIGDVFFKAHKAVLAAFSNYFRMLFI-HRDSDCVRLKPADIQ--PDIFSYLLNLMY 81

Query: 415 GVNFEITVHNVAALRCAAEYL 477
                  + + A L    ++L
Sbjct: 82  TGKLATQLIDPARLEQGVKFL 102



>gb:BC052706_2101226 Mus musculus BTB (POZ) domain containing 14B,
           mRNA (cDNA clone MGC:64707 IMAGE:5702150), complete
           cds.>gb:BC054800_2101837 Mus musculus BTB (POZ) domain
           containing 14B, mRNA (cDNA clone MGC:65691
           IMAGE:6850337), complete cds.
          Length = 514

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 2/92 (2%)
 Frame = +1

Query: 220 QEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGG--PEIFE 393
           Q +  DV V V   +F  H+ +L A S+Y R L   S+ A +       +P    P+ F+
Sbjct: 26  QGLYCDVSVVVKGHAFKAHRAVLAASSSYFRDLFNSSRSAVVE------LPAAVQPQSFQ 79

Query: 394 RAAKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
           +   FCY     + + +   L   A +LQ+ +
Sbjct: 80  QILTFCYTGRLSMNMGDQFLLIYTAGFLQIQE 111



>gb:BC048157_2099555 Mus musculus BTB (POZ) domain containing 14B,
           mRNA (cDNA clone MGC:61327 IMAGE:5697941), complete cds.
          Length = 514

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 2/92 (2%)
 Frame = +1

Query: 220 QEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGG--PEIFE 393
           Q +  DV V V   +F  H+ +L A S+Y R L   S+ A +       +P    P+ F+
Sbjct: 26  QGLYCDVSVVVKGHAFKAHRAVLAASSSYFRDLFNSSRSAVVE------LPAAVQPQSFQ 79

Query: 394 RAAKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
           +   FCY     + + +   L   A +LQ+ +
Sbjct: 80  QILTFCYTGRLSMNMGDQFLLIYTAGFLQIQE 111



>gb:AF036334_2051803 Mus musculus hypermethylated in cancer 1 (Hic1)
           mRNA, partial cds.
          Length = 736

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 34/128 (26%), Positives = 51/128 (39%), Gaps = 13/128 (10%)
 Frame = +1

Query: 145 MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM 324
           M +P  S    L L  +RT  ++       DVI+ V  A F  HK +L A S Y++ L++
Sbjct: 27  MEAPGHSRQLLLQLNNQRTKGFL------CDVIIVVQNALFRAHKNVLAASSAYLKSLVV 80

Query: 325 DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVH-------------NVAALRCA 465
                 L    +S     P +F     F Y      +V              ++ A+  A
Sbjct: 81  HDNLLSLDHDMVS-----PAVFRLVLDFIYTGRLTDSVEAAAAAAVAPGAEPSLGAVLAA 135

Query: 466 AEYLQMTD 489
           A YLQ+ D
Sbjct: 136 ASYLQIPD 143



>gb:AF015911_2050874 Rattus norvegicus NAC-1 protein (NAC-1) mRNA,
           complete cds.
          Length = 514

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 2/92 (2%)
 Frame = +1

Query: 220 QEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGG--PEIFE 393
           Q +  DV V V   +F  H+ +L A S+Y R L   S+ A +       +P    P+ F+
Sbjct: 26  QGLYCDVSVVVKGHAFKAHRAVLAASSSYFRDLFNSSRSAVVE------LPAAVQPQSFQ 79

Query: 394 RAAKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
           +   FCY     + + +   L   A +LQ+ +
Sbjct: 80  QILTFCYTGRLSMNMGDQFLLIYTAGFLQIQE 111



>gb:BC063290_1986131 Homo sapiens zinc finger protein 295, mRNA
           (cDNA clone MGC:71611 IMAGE:30348821), complete cds.
          Length = 1066

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 19/75 (25%), Positives = 35/75 (46%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           DV++ VG+  F  HK +L A S Y + L  + +    T   L      P+ F+    + Y
Sbjct: 31  DVLLIVGDQKFRAHKNVLAASSEYFQSLFTNKENESQTVFQLDFCE--PDAFDNVLNYIY 88

Query: 415 GVNFEITVHNVAALR 459
             +  +   ++AA++
Sbjct: 89  SSSLFVEKSSLAAVQ 103



>gb:BC047107_1983802 Homo sapiens kelch repeat and BTB (POZ) domain
           containing 2, mRNA (cDNA clone MGC:51304 IMAGE:5275217),
           complete cds.
          Length = 623

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 1/93 (1%)
 Frame = +1

Query: 214 FSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRINLSGIPGGPEIF 390
           + Q++ TD+++ V    F  HK +L   S+Y R + M    E+  T ++L  +       
Sbjct: 25  YEQQLFTDIVLIVEGTEFPCHKMVLATCSSYFRAMFMSGLSESKQTHVHLRNVDAA--TL 82

Query: 391 ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
           +    + Y  N  +    V  L   A +LQ+ D
Sbjct: 83  QIIITYAYTGNLAMNDSTVEQLYETACFLQVED 115



>gb:BC037887_1982244 Homo sapiens kelch repeat and BTB (POZ) domain
           containing 2, mRNA (cDNA clone MGC:43900 IMAGE:5274706),
           complete cds.
          Length = 623

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 1/93 (1%)
 Frame = +1

Query: 214 FSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRINLSGIPGGPEIF 390
           + Q++ TD+++ V    F  HK +L   S+Y R + M    E+  T ++L  +       
Sbjct: 25  YEQQLFTDIVLIVEGTEFPCHKMVLATCSSYFRAMFMSGLSESKQTHVHLRNVDAA--TL 82

Query: 391 ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
           +    + Y  N  +    V  L   A +LQ+ D
Sbjct: 83  QIIITYAYTGNLAMNDSTVEQLYETACFLQVED 115



>gb:AF151831_1886317 Homo sapiens CGI-73 protein mRNA, complete cds.
          Length = 335

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 1/93 (1%)
 Frame = +1

Query: 214 FSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRINLSGIPGGPEIF 390
           + Q++ TD+++ V    F  HK +L   S+Y R + M    E+  T ++L  +       
Sbjct: 25  YEQQLFTDIVLIVEGTEFPCHKMVLATCSSYFRAMFMSGLSESKQTHVHLRNVDAA--TL 82

Query: 391 ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
           +    + Y  N  +    V  L   A +LQ+ D
Sbjct: 83  QIIITYAYTGNLAMNDSTVEQLYETACFLQVED 115



>gb:AB041015_1866909 Homo sapiens ZNF295 mRNA for zinc finger
           protein short form, complete cds.
          Length = 865

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 19/75 (25%), Positives = 35/75 (46%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           DV++ VG+  F  HK +L A S Y + L  + +    T   L      P+ F+    + Y
Sbjct: 31  DVLLIVGDQKFRAHKNVLAASSEYFQSLFTNKENESQTVFQLDFCE--PDAFDNVLNYIY 88

Query: 415 GVNFEITVHNVAALR 459
             +  +   ++AA++
Sbjct: 89  SSSLFVEKSSLAAVQ 103



>gb:AB033053_1866233 Homo sapiens mRNA for KIAA1227 protein, partial
           cds.
          Length = 1069

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 19/75 (25%), Positives = 35/75 (46%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           DV++ VG+  F  HK +L A S Y + L  + +    T   L      P+ F+    + Y
Sbjct: 34  DVLLIVGDQKFRAHKNVLAASSEYFQSLFTNKENESQTVFQLDFCE--PDAFDNVLNYIY 91

Query: 415 GVNFEITVHNVAALR 459
             +  +   ++AA++
Sbjct: 92  SSSLFVEKSSLAAVQ 106



>gb:CR933655_1185682 Homo sapiens mRNA; cDNA DKFZp781N1974 (from
           clone DKFZp781N1974).
          Length = 763

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 19/75 (25%), Positives = 35/75 (46%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           DV++ VG+  F  HK +L A S Y + L  + +    T   L      P+ F+    + Y
Sbjct: 31  DVLLIVGDQKFRAHKNVLAASSEYFQSLFTNKENESQTVFQLDFCE--PDAFDNVLNYIY 88

Query: 415 GVNFEITVHNVAALR 459
             +  +   ++AA++
Sbjct: 89  SSSLFVEKSSLAAVQ 103



>gb:CR857759_1181972 Pongo pygmaeus mRNA; cDNA DKFZp469K1929 (from
           clone DKFZp469K1929).
          Length = 623

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 1/93 (1%)
 Frame = +1

Query: 214 FSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRINLSGIPGGPEIF 390
           + Q++ TD+++ V    F  HK +L   S+Y R + M    E+  T ++L  +       
Sbjct: 25  YEQQLFTDIVLIVEGTEFPCHKMVLATCSSYFRAMFMSGLSESKQTHVHLRNVDAA--TL 82

Query: 391 ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
           +    + Y  N  +    V  L   A +LQ+ D
Sbjct: 83  QIIITYAYTGNLAMNDSTVEQLYETACFLQVED 115



>gb:AK012935_1157238 Mus musculus 10, 11 days embryo whole body
           cDNA, RIKEN full-length enriched library,
           clone:2810049M13 product:NAC-1 PROTEIN homolog [Rattus
           norvegicus], full insert sequence.
          Length = 514

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 2/92 (2%)
 Frame = +1

Query: 220 QEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGG--PEIFE 393
           Q +  DV V V   +F  H+ +L A S+Y R L   S+ A +       +P    P+ F+
Sbjct: 26  QGLYCDVSVVVKGHAFKAHRAVLAASSSYFRDLFNSSRSAVVE------LPAAVQPQSFQ 79

Query: 394 RAAKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
           +   FCY     + + +   L   A +LQ+ +
Sbjct: 80  QILTFCYTGRLSMNMGDQFLLIYTAGFLQIQE 111



>sp|Q9ULJ3|Z295_HUMAN Zinc finger protein 295.>gb:AB041014_1866908
           Homo sapiens ZNF295 mRNA for zinc finger protein long
           form, complete cds.>gb:AP001745_1933542 Homo sapiens
           genomic DNA, chromosome 21q, section 89/105.
          Length = 1066

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 19/75 (25%), Positives = 35/75 (46%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           DV++ VG+  F  HK +L A S Y + L  + +    T   L      P+ F+    + Y
Sbjct: 31  DVLLIVGDQKFRAHKNVLAASSEYFQSLFTNKENESQTVFQLDFCE--PDAFDNVLNYIY 88

Query: 415 GVNFEITVHNVAALR 459
             +  +   ++AA++
Sbjct: 89  SSSLFVEKSSLAAVQ 103



>sp|Q8IY47|KBT2_HUMAN Kelch repeat and BTB domain containing protein
           2 (BTB and kelch domain containing protein 1).
          Length = 623

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 1/93 (1%)
 Frame = +1

Query: 214 FSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRINLSGIPGGPEIF 390
           + Q++ TD+++ V    F  HK +L   S+Y R + M    E+  T ++L  +       
Sbjct: 25  YEQQLFTDIVLIVEGTEFPCHKMVLATCSSYFRAMFMSGLSESKQTHVHLRNVDAA--TL 82

Query: 391 ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
           +    + Y  N  +    V  L   A +LQ+ D
Sbjct: 83  QIIITYAYTGNLAMNDSTVEQLYETACFLQVED 115



>gb:BC074064_2557593 Danio rerio cDNA clone IMAGE:7044077, partial
           cds.
          Length = 573

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 23/81 (28%), Positives = 37/81 (45%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           D  V +G+  F  HK +L A SNY R L +  +++D  R+  + I   P+IF       Y
Sbjct: 60  DCTVAIGDVFFKAHKAVLAAFSNYFRMLFI-HQDSDCVRLKPADIQ--PDIFSYLLNLMY 116

Query: 415 GVNFEITVHNVAALRCAAEYL 477
                  + + A L    ++L
Sbjct: 117 TGKLATQLIDPARLEQGVKFL 137



>gb:BC042246_2548068 Xenopus laevis BTB/POZ and zinc-finger domains
           factor on chromosome 1, mRNA (cDNA clone MGC:53369
           IMAGE:5571222), complete cds.
          Length = 459

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 24/79 (30%), Positives = 32/79 (40%), Gaps = 4/79 (5%)
 Frame = +1

Query: 265 FSLHKFMLVAKSNYIRKL----IMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEI 432
           F  H+ +L A S Y R +    I DS       +++       E F     F Y     +
Sbjct: 35  FKAHRNVLFANSGYFRAMLVHYIQDSGRHSTASLDIVT----SEAFSTILDFLYSGKLNV 90

Query: 433 TVHNVAALRCAAEYLQMTD 489
              NV  +  AA YLQMTD
Sbjct: 91  CGENVIEVMSAASYLQMTD 109



>gb:AY764034_1961874 Homo sapiens ENC2 (ENC2) mRNA, complete
           cds.>gb:BC028100_1979110 Homo sapiens BTB/POZ KELCH
           domain protein, mRNA (cDNA clone MGC:39894
           IMAGE:5242783), complete cds.>gb:HSM801764_2017356 Homo
           sapiens mRNA; cDNA DKFZp434K111 (from clone
           DKFZp434K111); complete cds.
          Length = 589

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 24/87 (27%), Positives = 36/87 (41%), Gaps = 1/87 (1%)
 Frame = +1

Query: 232 TDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRINLSGIPGGPEIFERAAKF 408
           TDV +  G+ +F  H+ +L A S Y   +     +E+    +N       PE+ E    F
Sbjct: 46  TDVTLWAGDRAFPCHRAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLH-PEVLELLLDF 104

Query: 409 CYGVNFEITVHNVAALRCAAEYLQMTD 489
            Y     I   N  +L  A + LQ  D
Sbjct: 105 AYSSRIAINEENAESLLEAGDMLQFHD 131



>gb:AY664415_1620628 Zea mays cultivar B73 locus 9009, complete
           sequence.
          Length = 347

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 26/79 (32%), Positives = 35/79 (44%), Gaps = 1/79 (1%)
 Frame = +3

Query: 474 SSDDGQVLRQQPRRSDGGFSVA-GGPVQPFRRACRA*ILRGASPAGRRSENRAEMRGISE 650
           SS      R  PRR+ G    A   P++  R  CR      A+P+  RS +R   R +S 
Sbjct: 90  SSGSADGTRCSPRRAGGADRQAEAAPLERGRSGCRPSSAAAAAPSSSRSRSRRATRSLSP 149

Query: 651 CKGVRGGEFSEQVAAELVD 707
               RGG   +  AA+ VD
Sbjct: 150 ---FRGGSGLDAAAADDVD 165



>gb:AF016684_1232785 Caenorhabditis elegans cosmid F45C12, complete
           sequence.
          Length = 157

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 1/70 (1%)
 Frame = +1

Query: 232 TDVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRINLSGIPGGPEIFERAAKF 408
           +DV++ V +  F + K  L A+SNY + L++ D +E     + L+ I   P  F+   + 
Sbjct: 76  SDVVLVVKDVKFYVLKTYLAAQSNYFKALLLGDFEEGKSLEVTLNSI--DPNDFQNFLEV 133

Query: 409 CYGVNFEITV 438
            YG +  ITV
Sbjct: 134 LYGHHQAITV 143



>sp|P34324|YKV2_CAEEL Hypothetical protein C08C3.2 in chromosome
           III.>pir|S44616|S44616 C08C3.2 protein - Caenorhabditis
           elegans>gb:L15201_1386919 Caenorhabditis elegans cosmid
           C08C3, complete sequence.
          Length = 274

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 1/63 (1%)
 Frame = +1

Query: 232 TDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRINLSGIPGGPEIFERAAKF 408
           +DVI+ VG+  F + K  L + S+Y   L +   KEAD + + L  I   P  F+   + 
Sbjct: 147 SDVILVVGDEKFYVLKLFLASHSSYFNALFLGKFKEADQSEVTLQNI--DPTDFQSLLEV 204

Query: 409 CYG 417
            YG
Sbjct: 205 LYG 207



>gb:BC076781_2559525 Xenopus laevis ectoderm neural cortex
           related-2, mRNA (cDNA clone MGC:83685 IMAGE:6638045),
           complete cds.
          Length = 589

 Score = 33.5 bits (75), Expect = 5.0
 Identities = 24/90 (26%), Positives = 34/90 (37%)
 Frame = +1

Query: 220 QEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERA 399
           Q + TD+ +  G  SF  H+ +L A S Y   +  +     L           PE+ E  
Sbjct: 42  QRLFTDMTLWAGNRSFPCHRAVLAACSPYFEAMFSNGLRESLDNTVNFHNSLHPEVLELL 101

Query: 400 AKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
             F Y     I   N  +L  A + LQ  D
Sbjct: 102 LDFAYSSKIIINEENAESLLEAGDMLQFHD 131



>gb:BC045363_2549205 Danio rerio zgc:55511, mRNA (cDNA clone
           MGC:55511 IMAGE:2641414), complete cds.
          Length = 443

 Score = 33.5 bits (75), Expect = 5.0
 Identities = 22/64 (34%), Positives = 30/64 (46%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           D  V +G+  F  HK +L A SNY R L +  +E+D  R+  S I    +IF       Y
Sbjct: 25  DCTVAIGDVLFKAHKAVLAAFSNYFRMLFI-HQESDCVRLKPSDIQA--DIFSYLLNLMY 81

Query: 415 GVNF 426
              F
Sbjct: 82  TGKF 85



>gb:MVI012283_2443383 Myxoma virus mt6 gene.
          Length = 509

 Score = 33.5 bits (75), Expect = 5.0
 Identities = 31/114 (27%), Positives = 49/114 (42%), Gaps = 2/114 (1%)
 Frame = +1

Query: 190 MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI 369
           MERT          +D+ +  GE SF+ H+ +L   S+Y  +L   S E   T I L   
Sbjct: 1   MERTLVSFLDSGTMSDITLVAGETSFTAHRLILSVHSDYFYRLFNGSFEVPDT-ITLDTD 59

Query: 370 PGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTD--KYCDNNLAGRTE 525
            G      R     Y    + TV ++ ++   A+YL +T   K C + +  R +
Sbjct: 60  DGVLRTVLRYMYTGYSNIRDRTVEDLQSIIVLADYLGITKLVKECADYMVSRVD 113



>gb:AF170726_2207817 Myxoma virus strain Lausanne, complete
           genome.>gb:AF170726_2207970 Myxoma virus strain
           Lausanne, complete genome.
          Length = 509

 Score = 33.5 bits (75), Expect = 5.0
 Identities = 31/114 (27%), Positives = 49/114 (42%), Gaps = 2/114 (1%)
 Frame = +1

Query: 190 MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI 369
           MERT          +D+ +  GE SF+ H+ +L   S+Y  +L   S E   T I L   
Sbjct: 1   MERTLVSFLDSGTMSDITLVAGETSFTAHRLILSVHSDYFYRLFNGSFEVPDT-ITLDTD 59

Query: 370 PGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTD--KYCDNNLAGRTE 525
            G      R     Y    + TV ++ ++   A+YL +T   K C + +  R +
Sbjct: 60  DGVLRTVLRYMYTGYSNIRDRTVEDLQSIIVLADYLGITKLVKECADYMVSRVD 113



>gb:BC059177_2103684 Mus musculus cDNA sequence BC059177, mRNA (cDNA
           clone MGC:62412 IMAGE:6410689), complete cds.
          Length = 1258

 Score = 33.5 bits (75), Expect = 5.0
 Identities = 25/85 (29%), Positives = 38/85 (44%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           D  + VG   F  HK +L A S  + K ++DS +A    I++      PE F    +  Y
Sbjct: 25  DCTISVGNIYFRAHKPVLAAAS-LLFKTLLDSTDA----ISIDASVVSPEEFALLLEMTY 79

Query: 415 GVNFEITVHNVAALRCAAEYLQMTD 489
                +  HN + +   A+ LQM D
Sbjct: 80  TGKLPVGKHNFSKIISLADSLQMFD 104



>gb:BC029154_2096497 Mus musculus kelch-like 7 (Drosophila), mRNA
           (cDNA clone MGC:37117 IMAGE:4952319), complete cds.
          Length = 400

 Score = 33.5 bits (75), Expect = 5.0
 Identities = 21/83 (25%), Positives = 37/83 (44%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           DVI+ V E     H+ +L A S++   L+  +   +     +      P+I E+  +F Y
Sbjct: 45  DVILTVQERKIPAHRVVLAAASHFFN-LMFTTNMLESKSFEVELKDAEPDIIEQLVEFAY 103

Query: 415 GVNFEITVHNVAALRCAAEYLQM 483
                +  +NV +L  AA   Q+
Sbjct: 104 TARISVNSNNVQSLLDAANQYQI 126



>gb:BC027373_2095935 Mus musculus cDNA sequence BC027373, mRNA (cDNA
           clone MGC:36331 IMAGE:4948451), complete cds.
          Length = 589

 Score = 33.5 bits (75), Expect = 5.0
 Identities = 24/87 (27%), Positives = 36/87 (41%), Gaps = 1/87 (1%)
 Frame = +1

Query: 232 TDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRINLSGIPGGPEIFERAAKF 408
           TDV +  G+ +F  H+ +L A S Y   +     +E+    +N       PE+ E    F
Sbjct: 46  TDVTLWAGDRAFPCHRAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLH-PEVLELLLDF 104

Query: 409 CYGVNFEITVHNVAALRCAAEYLQMTD 489
            Y     I   N  +L  A + LQ  D
Sbjct: 105 AYSSRIVINEENAESLLEAGDMLQFHD 131



>gb:BC050061_1984254 Homo sapiens zinc finger and BTB domain
           containing 10, mRNA (cDNA clone IMAGE:5269403), partial
           cds.
          Length = 504

 Score = 33.5 bits (75), Expect = 5.0
 Identities = 23/80 (28%), Positives = 39/80 (48%), Gaps = 5/80 (6%)
 Frame = +1

Query: 265 FSLHKFMLVAKSNYIRKLI-MDSKEA----DLTRINLSGIPGGPEIFERAAKFCYGVNFE 429
           F  HK +LVA S + + L    +KE+    + T ++++ + G   I +    F Y  N  
Sbjct: 8   FKAHKNILVAGSRFFKTLYCFSNKESPNQNNTTHLDIAAVQGFSVILD----FLYSGNLV 63

Query: 430 ITVHNVAALRCAAEYLQMTD 489
           +T  N   +   A YLQM++
Sbjct: 64  LTSQNAIEVMTVASYLQMSE 83



>gb:AC006039_1875092 Homo sapiens BAC clone RP11-319F3 from 7,
           complete sequence.>gb:AF111113_1884310 Homo sapiens
           SBBI26 mRNA, complete cds.
          Length = 166

 Score = 33.5 bits (75), Expect = 5.0
 Identities = 22/88 (25%), Positives = 39/88 (44%)
 Frame = +1

Query: 220 QEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERA 399
           Q+   DVI+ V E     H+ +L A S++   L+  +   +     +      P+I E+ 
Sbjct: 40  QKTLCDVILMVQERKIPAHRVVLAAASHFFN-LMFTTNMLESKSFEVELKDAEPDIIEQL 98

Query: 400 AKFCYGVNFEITVHNVAALRCAAEYLQM 483
            +F Y     +  +NV +L  AA   Q+
Sbjct: 99  VEFAYTARISVNSNNVQSLLDAANQYQI 126



>gb:AB028943_1865799 Homo sapiens mRNA for KIAA1020 protein, partial
           cds.
          Length = 638

 Score = 33.5 bits (75), Expect = 5.0
 Identities = 32/120 (26%), Positives = 49/120 (40%), Gaps = 4/120 (3%)
 Frame = +1

Query: 142 NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI 321
           +M  P  S    L L  +RT  ++       DVI+ V  + F  HK +L A S Y + L+
Sbjct: 45  DMELPSHSKQLLLQLNQQRTKGFL------CDVIIMVENSIFRAHKNVLAASSIYFKSLV 98

Query: 322 MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNF----EITVHNVAALRCAAEYLQMTD 489
           +         INL        +F++   F Y        +    N + L  AA YLQ+ +
Sbjct: 99  LHD-----NLINLDTDMVSSTVFQQILDFIYTGKLLPSDQPAEPNFSTLLTAASYLQLPE 153



>gb:HSM801571_1186265 Homo sapiens mRNA; cDNA DKFZp564C1616 (from
           clone DKFZp564C1616).
          Length = 586

 Score = 33.5 bits (75), Expect = 5.0
 Identities = 22/88 (25%), Positives = 39/88 (44%)
 Frame = +1

Query: 220 QEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERA 399
           Q+   DVI+ V E     H+ +L A S++   L+  +   +     +      P+I E+ 
Sbjct: 40  QKTLCDVILMVQERKIPAHRVVLAAASHFFN-LMFTTNMLESKSFEVELKDAEPDIIEQL 98

Query: 400 AKFCYGVNFEITVHNVAALRCAAEYLQM 483
            +F Y     +  +NV +L  AA   Q+
Sbjct: 99  VEFAYTARISVNSNNVQSLLDAANQYQI 126



>gb:AK083358_1173934 Mus musculus 2 days neonate thymus thymic cells
           cDNA, RIKEN full-length enriched library,
           clone:C920019I01 product:CDNA FLJ31828 FIS, CLONE
           NT2RP6000109, WEAKLY SIMILAR TO RING CANAL PROTEIN
           homolog [Homo sapiens], full insert sequence.
          Length = 586

 Score = 33.5 bits (75), Expect = 5.0
 Identities = 21/83 (25%), Positives = 37/83 (44%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           DVI+ V E     H+ +L A S++   L+  +   +     +      P+I E+  +F Y
Sbjct: 45  DVILTVQERKIPAHRVVLAAASHFFN-LMFTTNMLESKSFEVELKDAEPDIIEQLVEFAY 103

Query: 415 GVNFEITVHNVAALRCAAEYLQM 483
                +  +NV +L  AA   Q+
Sbjct: 104 TARISVNSNNVQSLLDAANQYQI 126



>gb:AK041089_1165860 Mus musculus adult male aorta and vein cDNA,
           RIKEN full-length enriched library, clone:A530081O19
           product:CDNA FLJ11078 FIS, CLONE PLACE1005102, WEAKLY
           SIMILAR TO RING CANAL PROTEIN homolog [Homo sapiens],
           full insert sequence.>gb:AK048601_1168433 Mus musculus
           16 days embryo head cDNA, RIKEN full-length enriched
           library, clone:C130084H03 product:CDNA FLJ11078 FIS,
           CLONE PLACE1005102, WEAKLY SIMILAR TO RING CANAL PROTEIN
           homolog [Homo sapiens], full insert
           sequence.>gb:AK049946_1169047 Mus musculus adult male
           hippocampus cDNA, RIKEN full-length enriched library,
           clone:C630013N10 product:CDNA FLJ11078 FIS, CLONE
           PLACE1005102, WEAKLY SIMILAR TO RING CANAL PROTEIN
           homolog [Homo sapiens], full insert sequence.
          Length = 606

 Score = 33.5 bits (75), Expect = 5.0
 Identities = 24/84 (28%), Positives = 37/84 (44%), Gaps = 1/84 (1%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRINLSGIPGGPEIFERAAKFC 411
           DV++ V   +F  HK +L A S+Y R +     +EA+   I L G+            F 
Sbjct: 55  DVVLTVNSEAFHAHKVVLAACSDYFRAMFTGGMREANQAVIQLQGV--SARGLRHIIDFA 112

Query: 412 YGVNFEITVHNVAALRCAAEYLQM 483
           Y     + +  V  +  AA +LQM
Sbjct: 113 YSAEVTLDLDCVQDVLGAAVFLQM 136



>gb:AK036584_1164536 Mus musculus adult male bone cDNA, RIKEN
           full-length enriched library, clone:9830138B13
           product:similar to DJ61A9.4 (NOVEL BTB/POZ DOMAIN
           CONTAINING ZINC FINGER PROTEIN (PRESUMED PART OF
           DJ61A9.2.2)) (FRAGMENT) [Homo sapiens], full insert
           sequence.
          Length = 266

 Score = 33.5 bits (75), Expect = 5.0
 Identities = 25/85 (29%), Positives = 38/85 (44%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           D  + VG   F  HK +L A S  + K ++DS +A    I++      PE F    +  Y
Sbjct: 25  DCTISVGNIYFRAHKPVLAAAS-LLFKTLLDSTDA----ISIDASVVSPEEFALLLEMTY 79

Query: 415 GVNFEITVHNVAALRCAAEYLQMTD 489
                +  HN + +   A+ LQM D
Sbjct: 80  TGKLPVGKHNFSKIISLADSLQMFD 104



>gb:AK012326_1156891 Mus musculus 11 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2700038B03
           product:CDNA FLJ31828 FIS, CLONE NT2RP6000109, WEAKLY
           SIMILAR TO RING CANAL PROTEIN homolog [Homo sapiens],
           full insert sequence.
          Length = 586

 Score = 33.5 bits (75), Expect = 5.0
 Identities = 21/83 (25%), Positives = 37/83 (44%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           DVI+ V E     H+ +L A S++   L+  +   +     +      P+I E+  +F Y
Sbjct: 45  DVILTVQERKIPAHRVVLAAASHFFN-LMFTTNMLESKSFEVELKDAEPDIIEQLVEFAY 103

Query: 415 GVNFEITVHNVAALRCAAEYLQM 483
                +  +NV +L  AA   Q+
Sbjct: 104 TARISVNSNNVQSLLDAANQYQI 126



>gb:AE014298_1126607 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003571_1216013 Drosophila melanogaster
           chromosome X, section 68 of 74 of the complete
           sequence.>gb:AY094818_1297992 Drosophila melanogaster
           LD33804 full insert cDNA.
          Length = 616

 Score = 33.5 bits (75), Expect = 5.0
 Identities = 25/93 (26%), Positives = 41/93 (44%), Gaps = 2/93 (2%)
 Frame = +1

Query: 217 SQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK--EADLTRINLSGIPGGPEIF 390
           ++E  TDV + V E  F  H+ +L A S+Y   +  D    E+    INL GI       
Sbjct: 43  NEEKLTDVTLIVEEHRFKAHRVVLAASSDYFCAMFADCAMIESRKDEINLYGIKA--RAM 100

Query: 391 ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTD 489
                + Y    E+   N+  +  AA ++Q+ +
Sbjct: 101 GSIIDYIYTSMLELNYDNIEEILAAATHVQVRE 133



>sp|Q96JB3|HIC2_HUMAN Hypermethylated in cancer 2 protein (Hic-2)
           (Hic-3) (HIC1-related gene on chromosome
           22).>gb:CR456377_1992668 Homo sapiens Em:AP000557.1 full
           length open reading frame (ORF) cDNA clone (cDNA clone
           C22ORF:pGEM.Em:AP000557.1.V3).
          Length = 615

 Score = 33.5 bits (75), Expect = 5.0
 Identities = 32/120 (26%), Positives = 49/120 (40%), Gaps = 4/120 (3%)
 Frame = +1

Query: 142 NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI 321
           +M  P  S    L L  +RT  ++       DVI+ V  + F  HK +L A S Y + L+
Sbjct: 22  DMELPSHSKQLLLQLNQQRTKGFL------CDVIIMVENSIFRAHKNVLAASSIYFKSLV 75

Query: 322 MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNF----EITVHNVAALRCAAEYLQMTD 489
           +         INL        +F++   F Y        +    N + L  AA YLQ+ +
Sbjct: 76  LHD-----NLINLDTDMVSSTVFQQILDFIYTGKLLPSDQPAEPNFSTLLTAASYLQLPE 130



>gb:GGGFBPB_2573131 G.gallus gammaFBP-B mRNA.
          Length = 641

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 34/117 (29%), Positives = 48/117 (41%), Gaps = 4/117 (3%)
 Frame = +1

Query: 145 MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM 324
           M  P  S    L L  +RT  ++       DVI+ V  A F  HK +L A S Y++ L++
Sbjct: 5   MEVPSHSRQLLLQLNTQRTKGFL------CDVIIVVQNALFRAHKNILAASSAYLKSLVV 58

Query: 325 DSKEADLTRINLSGIPGGPEIFERAAKFCY----GVNFEITVHNVAALRCAAEYLQM 483
                    +NL      P IF     F Y    G        ++ A+  AA YLQ+
Sbjct: 59  HD-----NLLNLDHEMVSPGIFRLILDFIYTGRLGECEPGGEQSLGAVLAAASYLQI 110



>gb:GGGFBPA_2573130 G.gallus gammaFBP-A mRNA.
          Length = 665

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 34/117 (29%), Positives = 48/117 (41%), Gaps = 4/117 (3%)
 Frame = +1

Query: 145 MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM 324
           M  P  S    L L  +RT  ++       DVI+ V  A F  HK +L A S Y++ L++
Sbjct: 29  MEVPSHSRQLLLQLNTQRTKGFL------CDVIIVVQNALFRAHKNILAASSAYLKSLVV 82

Query: 325 DSKEADLTRINLSGIPGGPEIFERAAKFCY----GVNFEITVHNVAALRCAAEYLQM 483
                    +NL      P IF     F Y    G        ++ A+  AA YLQ+
Sbjct: 83  HD-----NLLNLDHEMVSPGIFRLILDFIYTGRLGECEPGGEQSLGAVLAAASYLQI 134



>gb:BC063944_2553646 Danio rerio zgc:66182, mRNA (cDNA clone
           MGC:77600 IMAGE:6996394), complete cds.
          Length = 558

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 28/100 (28%), Positives = 42/100 (42%), Gaps = 3/100 (3%)
 Frame = +1

Query: 232 TDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFC 411
           TD+ + V    F  HK +L A S +  K   D  +  L  + + G+      F    +F 
Sbjct: 34  TDITLIVDGHQFRAHKAVLAACSQFFHKFFQDFTQEPL--VEIEGVSN--SAFRHLMEFT 89

Query: 412 YGVNFEIT-VHNVAALRCAAEYLQMTD--KYCDNNLAGRT 522
           Y     +     V+ +  AAEYLQM +  K  +N   G T
Sbjct: 90  YTATLAVNGEEEVSDVWRAAEYLQMQEAIKALNNRRNGTT 129



>gb:BC055532_2551399 Danio rerio zgc:66182, mRNA (cDNA clone
           MGC:66182 IMAGE:5604894), complete cds.
          Length = 344

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 28/100 (28%), Positives = 42/100 (42%), Gaps = 3/100 (3%)
 Frame = +1

Query: 232 TDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFC 411
           TD+ + V    F  HK +L A S +  K   D  +  L  + + G+      F    +F 
Sbjct: 34  TDITLIVDGHQFRAHKAVLAACSQFFHKFFQDFTQEPL--VEIEGVSN--SAFRHLMEFT 89

Query: 412 YGVNFEIT-VHNVAALRCAAEYLQMTD--KYCDNNLAGRT 522
           Y     +     V+ +  AAEYLQM +  K  +N   G T
Sbjct: 90  YTATLAVNGEEEVSDVWRAAEYLQMQEAIKALNNRRNGST 129



>gb:BC044506_2548809 Danio rerio, Similar to zinc finger protein
           131, clone IMAGE:3818128, mRNA, partial cds.
          Length = 471

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 28/100 (28%), Positives = 42/100 (42%), Gaps = 3/100 (3%)
 Frame = +1

Query: 232 TDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFC 411
           TD+ + V    F  HK +L A S +  K   D  +  L  + + G+      F    +F 
Sbjct: 34  TDITLIVDGHQFRAHKAVLAACSQFFHKFFQDFTQEPL--VEIEGVSN--SAFRHLMEFT 89

Query: 412 YGVNFEIT-VHNVAALRCAAEYLQMTD--KYCDNNLAGRT 522
           Y     +     V+ +  AAEYLQM +  K  +N   G T
Sbjct: 90  YTATLAVNGEEEVSDVWRAAEYLQMQEAIKALNNRRNGTT 129



>gb:BC083903_2108959 Rattus norvegicus kelch-like 7 (Drosophila)
           (predicted), mRNA (cDNA clone MGC:95261 IMAGE:7133606),
           complete cds.
          Length = 586

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 21/83 (25%), Positives = 37/83 (44%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           DVI+ V E     H+ +L A S++   L+  +   +     +      P+I E+  +F Y
Sbjct: 45  DVILMVQERKIPAHRVVLAAASHFFN-LMFTTNMLESKSFEVELKDAEPDIIEQLVEFAY 103

Query: 415 GVNFEITVHNVAALRCAAEYLQM 483
                +  +NV +L  AA   Q+
Sbjct: 104 TARISVNSNNVQSLLDAANQYQI 126



>gb:BC027135_2095775 Mus musculus zinc finger protein 295, mRNA
           (cDNA clone MGC:38832 IMAGE:5360683), complete cds.
          Length = 866

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 19/75 (25%), Positives = 35/75 (46%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           DV++ VG+  F  HK +L A S Y + L  + +    T   L      P+ F+    + Y
Sbjct: 31  DVLLIVGDQKFRAHKNVLAASSEYFQSLFTNKENEAQTVFQLDFCE--PDAFDNVLNYIY 88

Query: 415 GVNFEITVHNVAALR 459
             +  +   ++AA++
Sbjct: 89  SSSLFVEKGSLAAVQ 103



>gb:AK129353_2069584 Mus musculus mRNA for mKIAA1417 protein.
          Length = 1167

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 20/81 (24%), Positives = 35/81 (43%), Gaps = 12/81 (14%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRINLSGIPGG----------- 378
           DV  +VG   F  HK++L  +S++ +KL + D    +LT +                   
Sbjct: 381 DVTFQVGNRHFPAHKYILAVRSDFFQKLFLSDGSSLELTDVYQKDEDAAGCHLFVVEKVH 440

Query: 379 PEIFERAAKFCYGVNFEITVH 441
           P++FE   +F Y    ++  H
Sbjct: 441 PDLFEYLLQFMYTDTCDLLTH 461



>gb:AK129313_2069544 Mus musculus mRNA for mKIAA1227 protein.
          Length = 1074

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 19/75 (25%), Positives = 35/75 (46%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           DV++ VG+  F  HK +L A S Y + L  + +    T   L      P+ F+    + Y
Sbjct: 39  DVLLIVGDQKFRAHKNVLAASSEYFQSLFTNKENEAQTVFQLDFCE--PDAFDNVLNYIY 96

Query: 415 GVNFEITVHNVAALR 459
             +  +   ++AA++
Sbjct: 97  SSSLFVEKGSLAAVQ 111



>gb:BC009555_1972094 Homo sapiens kelch-like 7 (Drosophila), mRNA
           (cDNA clone IMAGE:3899090), complete cds.
          Length = 144

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 21/83 (25%), Positives = 37/83 (44%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           DVI+ V E     H+ +L A S++   L+  +   +     +      P+I E+  +F Y
Sbjct: 23  DVILMVQERKIPAHRVVLAAASHFFN-LMFTTNMLESKSFEVELKDAEPDIIEQLVEFAY 81

Query: 415 GVNFEITVHNVAALRCAAEYLQM 483
                +  +NV +L  AA   Q+
Sbjct: 82  TARISVNSNNVQSLLDAANQYQI 104



>gb:AK056390_1911726 Homo sapiens cDNA FLJ31828 fis, clone
           NT2RP6000109, weakly similar to RING CANAL PROTEIN.
          Length = 564

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 21/83 (25%), Positives = 37/83 (44%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           DVI+ V E     H+ +L A S++   L+  +   +     +      P+I E+  +F Y
Sbjct: 23  DVILMVQERKIPAHRVVLAAASHFFN-LMFTTNMLESKSFEVELKDAEPDIIEQLVEFAY 81

Query: 415 GVNFEITVHNVAALRCAAEYLQM 483
                +  +NV +L  AA   Q+
Sbjct: 82  TARISVNSNNVQSLLDAANQYQI 104



>gb:AB002350_1863657 Homo sapiens mRNA for KIAA0352 gene, partial
           cds.
          Length = 721

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 26/89 (29%), Positives = 37/89 (41%)
 Frame = +1

Query: 223 EIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAA 402
           E   DV + VG  SF  HK +L   + Y + L +++   D  R  +      P  FE+  
Sbjct: 36  ETMCDVTIVVGSRSFPAHKAVLACAAGYFQNLFLNTG-LDAARTYVVDFIT-PANFEKVL 93

Query: 403 KFCYGVNFEITVHNVAALRCAAEYLQMTD 489
            F Y       + NV  +   AE L M D
Sbjct: 94  SFVYTSELFTDLINVGVIYEVAERLGMED 122



>gb:AP005476_1852574 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBb0026D20.
          Length = 353

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 23/73 (31%), Positives = 32/73 (43%), Gaps = 1/73 (1%)
 Frame = +1

Query: 232 TDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTR-INLSGIPGGPEIFERAAKF 408
           TDV   VG+  FS HK +L A+S+  R     +  A   R I +  I  G  +F     F
Sbjct: 186 TDVTFNVGQDIFSAHKCILAARSSVFRAEFFGAMSAKARRTIKIEDIEAG--VFRALLHF 243

Query: 409 CYGVNFEITVHNV 447
            Y  +   T  N+
Sbjct: 244 IYTDSLPETAQNI 256



>gb:AF077532_1239205 Caenorhabditis elegans cosmid F40B1, complete
           sequence.
          Length = 181

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 1/68 (1%)
 Frame = +1

Query: 217 SQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRINLSGIPGGPEIFE 393
           S E  +DVI+ VG+  F + K  L + S+Y + L++ + +EAD   + L GI      F+
Sbjct: 103 SNEEFSDVILAVGDKKFFVLKKFLASHSSYFKTLLLGNFEEADKGEVTLHGIDSTD--FQ 160

Query: 394 RAAKFCYG 417
              +  YG
Sbjct: 161 NLLEVLYG 168



>gb:AK034057_1163609 Mus musculus adult male diencephalon cDNA,
           RIKEN full-length enriched library, clone:9330152G21
           product:zinc finger protein 295, full insert sequence.
          Length = 1036

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 19/75 (25%), Positives = 35/75 (46%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           DV++ VG+  F  HK +L A S Y + L  + +    T   L      P+ F+    + Y
Sbjct: 59  DVLLIVGDQKFRAHKNVLAASSEYFQSLFTNKENEAQTVFQLDFCE--PDAFDNVLNYIY 116

Query: 415 GVNFEITVHNVAALR 459
             +  +   ++AA++
Sbjct: 117 SSSLFVEKGSLAAVQ 131



>gb:AK031118_1162304 Mus musculus 13 days embryo forelimb cDNA,
           RIKEN full-length enriched library, clone:5930406H20
           product:zinc finger protein 295, full insert sequence.
          Length = 894

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 19/75 (25%), Positives = 35/75 (46%)
 Frame = +1

Query: 235 DVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCY 414
           DV++ VG+  F  HK +L A S Y + L  + +    T   L      P+ F+    + Y
Sbjct: 59  DVLLIVGDQKFRAHKNVLAASSEYFQSLFTNKENEAQTVFQLDFCE--PDAFDNVLNYIY 116

Query: 415 GVNFEITVHNVAALR 459
             +  +   ++AA++
Sbjct: 117 SSSLFVEKGSLAAVQ 131



>gb:AE014134_1129000 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003639_1219107 Drosophila melanogaster
           chromosome 2L, section 48 of 83 of the complete
           sequence.>gb:AY118728_1300450 Drosophila melanogaster
           GH03286 full insert cDNA.
          Length = 627

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 35/129 (27%), Positives = 51/129 (39%), Gaps = 13/129 (10%)
 Frame = +1

Query: 142 NMASPLKSAATRLSLAMERTGQWVFS----------QEIPTDVIVEVGEASFSLHKFMLV 291
           N+ S   +A+ R +L      Q+ F           Q    DV +  G A+ S H+ +L 
Sbjct: 43  NLGSGATAASHRTNLPSYCNAQYPFKVLSNLNQLREQSRFCDVEIIAGMATLSAHRAVLS 102

Query: 292 AKSNYIRKLI---MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRC 462
           A S Y   +    +   E     + L  I G  +I      F Y    EIT  NV  L  
Sbjct: 103 AASAYFEAMFRPELGLNEVKQKSVVLHTIDG--DILHILLDFIYTGRCEITQSNVQELLA 160

Query: 463 AAEYLQMTD 489
           AA+ LQ+ +
Sbjct: 161 AADMLQLNE 169



>gb:CP000009_862077 Gluconobacter oxydans 621H, complete genome.
          Length = 423

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 36/117 (30%), Positives = 43/117 (36%), Gaps = 4/117 (3%)
 Frame = -2

Query: 715 APPSTNSAATCSENSPPRTPLHSLIPRISARFSDLRPAGEXXXXXXXXXXXRKGWTGPPA 536
           AP    SAA     S P T   S+ P  S   S+  PAGE             G  G PA
Sbjct: 202 APAPDVSAAPSVAQSTPSTVAPSVAPLASDDDSEPLPAGEAAPSQQA------GAIGQPA 255

Query: 535 TENPPSDRRGC--CRSTCPSSEDTRRRNAE--PPRYVQ*SRS*LHSRTSPPFRRSQG 377
           T+ PP+   G    R+  P     R R+      R +Q   S        PFR S G
Sbjct: 256 TDLPPAVPEGAVVLRALAPVWTQVRDRDGHVLMSRVMQPGESWQGDPAGAPFRMSFG 312



>pir|T33336|T33336 hypothetical protein F40B1.2 - Caenorhabditis
           elegans
          Length = 202

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 1/68 (1%)
 Frame = +1

Query: 217 SQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRINLSGIPGGPEIFE 393
           S E  +DVI+ VG+  F + K  L + S+Y + L++ + +EAD   + L GI      F+
Sbjct: 124 SNEEFSDVILAVGDKKFFVLKKFLASHSSYFKTLLLGNFEEADKGEVTLHGIDSTD--FQ 181

Query: 394 RAAKFCYG 417
              +  YG
Sbjct: 182 NLLEVLYG 189



>pir|I50643|I50643 gammaFBP-C - chicken (fragment)
          Length = 676

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 34/117 (29%), Positives = 48/117 (41%), Gaps = 4/117 (3%)
 Frame = +1

Query: 145 MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM 324
           M  P  S    L L  +RT  ++       DVI+ V  A F  HK +L A S Y++ L++
Sbjct: 40  MEVPSHSRQLLLQLNTQRTKGFL------CDVIIVVQNALFRAHKNILAASSAYLKSLVV 93

Query: 325 DSKEADLTRINLSGIPGGPEIFERAAKFCY----GVNFEITVHNVAALRCAAEYLQM 483
                    +NL      P IF     F Y    G        ++ A+  AA YLQ+
Sbjct: 94  HD-----NLLNLDHEMVSPGIFRLILDFIYTGRLGECEPGGEQSLGAVLAAASYLQI 145



>sp|O15060|Y352_HUMAN Hypothetical zinc finger protein KIAA0352.
          Length = 712

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 26/89 (29%), Positives = 37/89 (41%)
 Frame = +1

Query: 223 EIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAA 402
           E   DV + VG  SF  HK +L   + Y + L +++   D  R  +      P  FE+  
Sbjct: 27  ETMCDVTIVVGSRSFPAHKAVLACAAGYFQNLFLNTG-LDAARTYVVDFIT-PANFEKVL 84

Query: 403 KFCYGVNFEITVHNVAALRCAAEYLQMTD 489
            F Y       + NV  +   AE L M D
Sbjct: 85  SFVYTSELFTDLINVGVIYEVAERLGMED 113


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 873,176,567
Number of Sequences: 1806583
Number of extensions: 19406916
Number of successful extensions: 56617
Number of sequences better than 10.0: 260
Number of HSP's better than 10.0 without gapping: 53796
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 56447
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 55035364698
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)