BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig317
         (466 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|Q9M0Y6|DPNM_ARATH|DPNM_ARATH Putative PAP-specific phosphatase, mitochon...   107   8e-23   Arabidopsis thaliana [mouse-ear cress]
gb:AP005195_1849234 Oryza sativa (japonica cultivar-group) genom...    91   9e-18   
gb:T32N4_1724016 Arabidopsis thaliana BAC T32N4.                       63   2e-09   
gb:AC069158_1540663 Genomic Sequence for Oryza sativa, Nipponbar...    58   5e-08   
sp|Q42546|DPN1_ARATH|DPN1_ARATH SAL1 phosphatase (3'(2'),5'-bisphosphate nu...    55   4e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AP004240_1839150 Oryza sativa (japonica cultivar-group) genom...    54   1e-06   
gb:AF016644_1761509 Arabidopsis thaliana PAP-specific phosphatas...    52   4e-06   
sp|Q38945|DPNH_ARATH|DPNH_ARATH PAP-specific phosphatase HAL2-like (3'(2'),...    52   4e-06   Arabidopsis thaliana [mouse-ear cress]
sp|O49623|DPN2_ARATH|DPN2_ARATH SAL2 phosphatase (3'(2'),5'-bisphosphate nu...    51   8e-06   Arabidopsis thaliana [mouse-ear cress]
gb:ATT5E8_1556124 Arabidopsis thaliana DNA chromosome 5, BAC clo...    50   1e-05   
sp|Q84VY5|DPN4_ARATH|DPN4_ARATH Probable SAL4 phosphatase (3'(2'),5'-bispho...    50   1e-05   Arabidopsis thaliana [mouse-ear cress]
sp|Q40639|DPNP_ORYSA|DPNP_ORYSA 3'(2'),5'-bisphosphate nucleotidase (EC 3.1...    48   5e-05   Oryza sativa [red rice]
gb:AY088896_1573904 Arabidopsis thaliana clone 98980 mRNA, compl...    47   9e-05   
gb:AB019227_1514085 Arabidopsis thaliana genomic DNA, chromosome...    47   9e-05   
sp|Q8GY63|DPN3_ARATH|DPN3_ARATH Probable SAL3 phosphatase (3'(2'),5'-bispho...    47   9e-05   Arabidopsis thaliana [mouse-ear cress]
gb:CR382132_1666093 Yarrowia lipolytica chromosome F of strain C...    45   4e-04   
gb:AP008231_580272 Synechococcus elongatus PCC 6301 DNA, complet...    44   0.001   
gb:AP005195_1849235 Oryza sativa (japonica cultivar-group) genom...    41   0.009   
gb:AE017341_1754157 Cryptococcus neoformans var. neoformans JEC2...    41   0.009   
gb:AE016818_1748061 Ashbya gossypii (= Eremothecium gossypii) AT...    41   0.009   
gb:AF288075_1783322 Zea mays diphosphonucleotide phosphatase 1 m...    40   0.019   
sp|O94505|DPNP_SCHPO|DPNP_SCHPO 3'(2'),5'-bisphosphate nucleotidase (EC 3.1...    39   0.033   Schizosaccharomyces pombe
gb:NCB15B24_1689370 Neurospora crassa DNA linkage group II BAC c...    38   0.056   
gb:CR382137_1670492 Debaryomyces hansenii chromosome E of strain...    38   0.073   
gb:CR382126_1659445 Kluyveromyces lactis strain NRRL Y-1140 chro...    37   0.095   
gb:AY035375_1559969 Candida albicans HAL2 gene, complete cds.          37   0.095   
gb:AY340817_1600681 Debaryomyces hansenii 3'(2')5' bisphosphate ...    36   0.21    
sp|P32179|HAL2_YEAST|HAL2_YEAST 3'(2'),5'-bisphosphate nucleotidase (EC 3.1...    33   2.3     Saccharomyces cerevisiae [brewer's yeast]
gb:BA000035_717497 Corynebacterium efficiens YS-314 DNA, complet...    32   3.1     
gb:CR380949_1649634 Candida glabrata strain CBS138 chromosome C ...    32   5.2     
gb:BA000042_1632484 Nicotiana tabacum mitochondrial DNA, complet...    32   5.2     
gb:AX646437_1471844 Sequence 629 from Patent EP1270724.>gb:AB065...    32   5.2     
gb:BA000040_729247 Bradyrhizobium japonicum USDA 110 DNA, comple...    32   5.2     
gb:BC049258_2100001 Mus musculus LIM domain only 6, mRNA (cDNA c...    31   6.8     
gb:BC023671_2094200 Mus musculus LIM domain only 6, mRNA (cDNA c...    31   6.8     
gb:AK083704_1174049 Mus musculus 9 days embryo whole body cDNA, ...    31   6.8     
gb:AE001438_34964 Clostridium acetobutylicum ATCC 824 megaplasmi...    31   6.8     
gb:AY500154_1609646 Saccharomyces cerevisiae strain Montrache Ha...    31   8.9     
gb:AK037217_1164803 Mus musculus 6 days neonate skin cDNA, RIKEN...    31   8.9     


>sp|Q9M0Y6|DPNM_ARATH Putative PAP-specific phosphatase,
           mitochondrial precursor (3'(2'),5'- bisphosphate
           nucleotidase) (EC 3.1.3.7)
           (3'(2'),5-bisphosphonucleoside 3'(2')-phosphohydrolase)
           (DPNPase).>pir|A85064|A85064 hypothetical protein
           AT4g05090 [imported] - Arabidopsis
           thaliana>gb:ATCHRIV14_1544353 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           14.>gb:AY085591_1570659 Arabidopsis thaliana clone
           158702 mRNA, complete sequence.>gb:AK175301_1817289
           Arabidopsis thaliana mRNA for 3'(2'),5'-bisphosphate
           nucleotidase-like protein, complete cds, clone:
           RAFL21-73-J08.
          Length = 397

 Score =  107 bits (267), Expect = 8e-23
 Identities = 62/101 (61%), Positives = 74/101 (73%), Gaps = 3/101 (2%)
 Frame = +3

Query: 171 RYSAVRFPKAHPCRPFDQPP---RRRCFTVRLSSRLPLSEQKAKYYKELEAAVDVVERAC 341
           R+SAVRF        F+ PP   RRR F VR  + LP  + +AKY+KELE A+D V+RAC
Sbjct: 9   RFSAVRFSPV-----FNPPPTSLRRRYFIVR--ANLPFPKHQAKYHKELEVAIDAVDRAC 61

Query: 342 RLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGVQALVSL 464
           RLCVDVK+SL SS    +I+EKNDQTPVT+ADFGVQALVSL
Sbjct: 62  RLCVDVKRSLFSS--KEKIVEKNDQTPVTIADFGVQALVSL 100



>gb:AP005195_1849234 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0567H04.
          Length = 431

 Score = 90.5 bits (223), Expect = 9e-18
 Identities = 46/66 (69%), Positives = 55/66 (83%)
 Frame = +3

Query: 267 LPLSEQKAKYYKELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGV 446
           LP   ++A +++EL AA   VERACRLCVDVK++LLS  GD +ILEKNDQTPVTVADFGV
Sbjct: 52  LPFPPERAAHHRELAAAAAAVERACRLCVDVKRTLLS--GDKKILEKNDQTPVTVADFGV 109

Query: 447 QALVSL 464
           QAL+SL
Sbjct: 110 QALISL 115



>gb:T32N4_1724016 Arabidopsis thaliana BAC T32N4.
          Length = 165

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 36/66 (54%), Positives = 44/66 (66%), Gaps = 3/66 (4%)
 Frame = +3

Query: 171 RYSAVRFPKAHPCRPFDQPP---RRRCFTVRLSSRLPLSEQKAKYYKELEAAVDVVERAC 341
           R+SAVRF        F+ PP   RRR F VR  + LP  + +AKY+KELE A+D V+RAC
Sbjct: 106 RFSAVRFSPV-----FNPPPTSLRRRYFIVR--ANLPFPKHQAKYHKELEVAIDAVDRAC 158

Query: 342 RLCVDV 359
           RLCVDV
Sbjct: 159 RLCVDV 164



>gb:AC069158_1540663 Genomic Sequence for Oryza sativa, Nipponbare
           strain, clone OSJNBa0049O12, from chromosome 2, complete
           sequence.
          Length = 463

 Score = 58.2 bits (139), Expect = 5e-08
 Identities = 31/59 (52%), Positives = 41/59 (69%), Gaps = 3/59 (5%)
 Frame = +3

Query: 294 YYKELEAAVDVVERACRLCVDVKKSLL---SSDGDGQILEKNDQTPVTVADFGVQALVS 461
           Y +E+E AV VV+ AC LC  V+ SLL   S+   G +  K D++PVTVAD+GVQA+VS
Sbjct: 85  YAREMEVAVRVVQAACTLCQRVQSSLLLPASASASGSVHSKIDRSPVTVADWGVQAIVS 143



>sp|Q42546|DPN1_ARATH SAL1 phosphatase (3'(2'),5'-bisphosphate
           nucleotidase 1) (EC 3.1.3.7)
           (3'(2'),5'-bisphosphonucleoside 3'(2')-phosphohydrolase
           1) (DPNPase 1) (Inositol-1,4-bisphosphate 1-phosphatase
           1) (EC 3.1.3.57) (Inositol polyphosphate 1-phosphatase
           1) (IPPase 1) (FIERY1 protein).>gb:AB019227_1514084
           Arabidopsis thaliana genomic DNA, chromosome 5, P1
           clone:MBM17.>gb:ATU40433_1556977 Arabidopsis thaliana
           3'(2'),5'-bisphosphate nucleotidase (SAL1) mRNA,
           complete cds.>gb:AY034894_1559679 Arabidopsis thaliana
           inositol polyphosphate 1-phosphatase FIERY1 (FRY1) mRNA,
           complete cds.>gb:BT005993_1638915 Arabidopsis thaliana
           At5g63980 gene, complete cds.
          Length = 353

 Score = 55.1 bits (131), Expect = 4e-07
 Identities = 30/57 (52%), Positives = 39/57 (68%)
 Frame = +3

Query: 294 YYKELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGVQALVSL 464
           Y KEL+AA      A RLC  V+K+LL SD    +  K+D++PVTVAD+G QA+VSL
Sbjct: 3   YEKELDAAKKAASLAARLCQKVQKALLQSD----VQSKSDKSPVTVADYGSQAVVSL 55



>gb:AP004240_1839150 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1548_F12.
          Length = 375

 Score = 53.5 bits (127), Expect = 1e-06
 Identities = 29/55 (52%), Positives = 38/55 (69%), Gaps = 3/55 (5%)
 Frame = +3

Query: 306 LEAAVDVVERACRLCVDVKKSLL---SSDGDGQILEKNDQTPVTVADFGVQALVS 461
           +E AV VV+ AC LC  V+ SLL   S+   G +  K D++PVTVAD+GVQA+VS
Sbjct: 1   MEVAVRVVQAACTLCQRVQSSLLLPASASASGSVHSKIDRSPVTVADWGVQAIVS 55



>gb:AF016644_1761509 Arabidopsis thaliana PAP-specific phosphatase
           (Ahl) gene, complete cds.
          Length = 373

 Score = 52.0 bits (123), Expect = 4e-06
 Identities = 28/53 (52%), Positives = 37/53 (69%)
 Frame = +3

Query: 303 ELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGVQALVS 461
           E++ AV VV  A  LCV V++ L   +G G +  K+D +PVTVADFGVQA+VS
Sbjct: 9   EIDTAVRVVHLASSLCVKVQEKLHLPNG-GHVKSKDDDSPVTVADFGVQAIVS 60



>sp|Q38945|DPNH_ARATH PAP-specific phosphatase HAL2-like
           (3'(2'),5'-bisphosphate nucleotidase) (EC 3.1.3.7)
           (3'(2'),5-bisphosphonucleoside 3'(2')- phosphohydrolase)
           (DPNPase) (Halotolerance protein).>gb:AB026634_1517033
           Arabidopsis thaliana genomic DNA, chromosome 5, BAC
           clone:F24B18.>gb:ATU55205_1557091 Arabidopsis thaliana
           HAL2-like protein (Ahl) mRNA, complete
           cds.>gb:AY045848_1561360 Arabidopsis thaliana unknown
           protein (At5g54390) mRNA, complete
           cds.>gb:AY086488_1571536 Arabidopsis thaliana clone
           253770 mRNA, complete sequence.>gb:AY091377_1574580
           Arabidopsis thaliana unknown protein (At5g54390) mRNA,
           complete cds.
          Length = 373

 Score = 52.0 bits (123), Expect = 4e-06
 Identities = 28/53 (52%), Positives = 37/53 (69%)
 Frame = +3

Query: 303 ELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGVQALVS 461
           E++ AV VV  A  LCV V++ L   +G G +  K+D +PVTVADFGVQA+VS
Sbjct: 9   EIDTAVRVVHLASSLCVKVQEKLHLPNG-GHVKSKDDDSPVTVADFGVQAIVS 60



>sp|O49623|DPN2_ARATH SAL2 phosphatase (3'(2'),5'-bisphosphate
           nucleotidase 2) (EC 3.1.3.7)
           (3'(2'),5'-bisphosphonucleoside 3'(2')-phosphohydrolase
           2) (DPNPase 2) (Inositol-1,4-bisphosphate 1-phosphatase
           2) (EC 3.1.3.57) (Inositol polyphosphate 1-phosphatase
           2) (IPPase 2).>gb:AB019227_1514086 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1
           clone:MBM17.>gb:ATSAL2MRN_1554143 A.thaliana mRNA for
           3'(2'),5'-bisphosphate nucleotidase.>gb:AY070383_1566783
           Arabidopsis thaliana putative 3(2),5-bisphosphate
           nucleotidase (At5g64000) mRNA, complete
           cds.>gb:AY096575_1576115 Arabidopsis thaliana putative
           3(2),5-bisphosphate nucleotidase (At5g64000) mRNA,
           complete cds.
          Length = 347

 Score = 50.8 bits (120), Expect = 8e-06
 Identities = 29/57 (50%), Positives = 39/57 (68%)
 Frame = +3

Query: 294 YYKELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGVQALVSL 464
           Y KEL AA   V  A RL  +V+K+LL S    Q+ +K+D++PVT AD+G QA+VSL
Sbjct: 3   YEKELAAAKKAVTLAARLSQEVQKTLLQS----QVWKKSDRSPVTAADYGSQAVVSL 55



>gb:ATT5E8_1556124 Arabidopsis thaliana DNA chromosome 5, BAC clone
           T5E8 (ESSA project).
          Length = 342

 Score = 50.4 bits (119), Expect = 1e-05
 Identities = 28/56 (50%), Positives = 37/56 (66%)
 Frame = +3

Query: 294 YYKELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGVQALVS 461
           Y KEL AA   V  A RL  +V+KSLL SD    +  K+D++PVT AD+G QA++S
Sbjct: 3   YEKELAAAKKAVSLAARLSQEVQKSLLQSD----VRSKSDKSPVTAADYGSQAVIS 54



>sp|Q84VY5|DPN4_ARATH Probable SAL4 phosphatase
           (3'(2'),5'-bisphosphate nucleotidase 4) (EC 3.1.3.7)
           (3'(2'),5'-bisphosphonucleoside 3'(2')-phosphohydrolase
           4) (DPNPase 4) (Inositol-1,4-bisphosphate 1-phosphatase
           4) (EC 3.1.3.57) (Inositol polyphosphate 1-phosphatase
           4) (IPPase 4).>gb:BT004622_1637656 Arabidopsis thaliana
           At5g09290 gene, complete cds.
          Length = 345

 Score = 50.4 bits (119), Expect = 1e-05
 Identities = 28/56 (50%), Positives = 37/56 (66%)
 Frame = +3

Query: 294 YYKELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGVQALVS 461
           Y KEL AA   V  A RL  +V+KSLL SD    +  K+D++PVT AD+G QA++S
Sbjct: 3   YEKELAAAKKAVSLAARLSQEVQKSLLQSD----VRSKSDKSPVTAADYGSQAVIS 54



>sp|Q40639|DPNP_ORYSA 3'(2'),5'-bisphosphate nucleotidase (EC
           3.1.3.7) (3'(2'),5- bisphosphonucleoside
           3'(2')-phosphohydrolase) (DPNPase).>pir|T03305|T03305
           probable 3'(2'),5'-bisphosphate nucleotidase (EC
           3.1.3.7) - rice>gb:OSU33283_1698436 Oryza sativa Ca2+
           sensitive 3'(2'),5-diphosphonucleoside 3'(2')
           phosphohydrolase mRNA, complete cds.
          Length = 358

 Score = 48.1 bits (113), Expect = 5e-05
 Identities = 29/57 (50%), Positives = 34/57 (59%)
 Frame = +3

Query: 294 YYKELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGVQALVSL 464
           Y  EL AA   V  A RLC  V+K +L S     +  K DQ+PVTVAD+G Q LVSL
Sbjct: 9   YAAELAAAKKAVTLAARLCQAVQKDILQSG----VQSKADQSPVTVADYGSQILVSL 61



>gb:AY088896_1573904 Arabidopsis thaliana clone 98980 mRNA, complete
           sequence.
          Length = 357

 Score = 47.4 bits (111), Expect = 9e-05
 Identities = 28/57 (49%), Positives = 37/57 (64%)
 Frame = +3

Query: 294 YYKELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGVQALVSL 464
           Y + L AA   V  A RL  +V+KSLL +D    +  K+D +PVTVAD+G QA+VSL
Sbjct: 3   YDEMLSAAKKAVSLAARLSNEVRKSLLVTD----VWNKSDDSPVTVADYGSQAVVSL 55



>gb:AB019227_1514085 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MBM17.
          Length = 353

 Score = 47.4 bits (111), Expect = 9e-05
 Identities = 28/57 (49%), Positives = 37/57 (64%)
 Frame = +3

Query: 294 YYKELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGVQALVSL 464
           Y + L AA   V  A RL  +V+KSLL +D    +  K+D +PVTVAD+G QA+VSL
Sbjct: 3   YDEMLSAAKKAVSLAARLSNEVRKSLLVTD----VWNKSDDSPVTVADYGSQAVVSL 55



>sp|Q8GY63|DPN3_ARATH Probable SAL3 phosphatase
           (3'(2'),5'-bisphosphate nucleotidase 3) (EC 3.1.3.7)
           (3'(2'),5'-bisphosphonucleoside 3'(2')-phosphohydrolase
           3) (DPNPase 3) (Inositol-1,4-bisphosphate 1-phosphatase
           3) (EC 3.1.3.57) (Inositol polyphosphate 1-phosphatase
           3) (IPPase 3).>gb:BT006247_1639139 Arabidopsis thaliana
           At5g63990 mRNA, complete cds.>gb:AK117842_1815852
           Arabidopsis thaliana At5g63990 mRNA for putative
           3'(2'),5'-bisphosphate nucleotidase, complete cds,
           clone: RAFL18-04-D21.
          Length = 357

 Score = 47.4 bits (111), Expect = 9e-05
 Identities = 28/57 (49%), Positives = 37/57 (64%)
 Frame = +3

Query: 294 YYKELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGVQALVSL 464
           Y + L AA   V  A RL  +V+KSLL +D    +  K+D +PVTVAD+G QA+VSL
Sbjct: 3   YDEMLSAAKKAVSLAARLSNEVRKSLLVTD----VWNKSDDSPVTVADYGSQAVVSL 55



>gb:CR382132_1666093 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 339

 Score = 45.4 bits (106), Expect = 4e-04
 Identities = 24/57 (42%), Positives = 37/57 (64%)
 Frame = +3

Query: 288 AKYYKELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGVQALV 458
           ++Y  EL+ A D V RA  L   +  S +++D  GQ+  K+D +PVTVAD+G QA++
Sbjct: 2   SQYSAELKVAKDAVRRASALAASIA-STIATDTSGQVT-KSDTSPVTVADYGAQAII 56



>gb:AP008231_580272 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 320

 Score = 43.9 bits (102), Expect = 0.001
 Identities = 24/53 (45%), Positives = 31/53 (58%)
 Frame = +3

Query: 303 ELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGVQALVS 461
           EL AA+  V+ A  LC  V+      D     L K DQ+PVTVAD+G QAL++
Sbjct: 9   ELHAALTAVQAAAHLCQTVRH-----DRQATALRKPDQSPVTVADYGAQALIA 56



>gb:AP005195_1849235 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0567H04.
          Length = 445

 Score = 40.8 bits (94), Expect = 0.009
 Identities = 18/32 (56%), Positives = 23/32 (71%)
 Frame = +3

Query: 267 LPLSEQKAKYYKELEAAVDVVERACRLCVDVK 362
           LP   ++A +++EL AA   VERACRLCVD K
Sbjct: 57  LPFPSERAAHHRELAAAAAAVERACRLCVDRK 88



>gb:AE017341_1754157 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 357

 Score = 40.8 bits (94), Expect = 0.009
 Identities = 25/70 (35%), Positives = 43/70 (61%)
 Frame = +3

Query: 255 LSSRLPLSEQKAKYYKELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVA 434
           ++S+LP +    +  +E +  +  V RAC L  +V+ +L++ D     L K+D++PVTVA
Sbjct: 1   MASQLPFT----RLVQETQIGILSVLRACYLTKNVQDTLVTKD----TLLKSDKSPVTVA 52

Query: 435 DFGVQALVSL 464
           D   Q+L+SL
Sbjct: 53  DLSAQSLISL 62



>gb:AE016818_1748061 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 355

 Score = 40.8 bits (94), Expect = 0.009
 Identities = 21/55 (38%), Positives = 31/55 (56%)
 Frame = +3

Query: 294 YYKELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGVQALV 458
           Y KEL  AV  V +A  L   ++  + S+ G      K+D +PVT+ DFG QA++
Sbjct: 3   YEKELRVAVQAVRKASLLTKRIQSQITSNKGLSSFT-KDDNSPVTIGDFGAQAVI 56



>gb:AF288075_1783322 Zea mays diphosphonucleotide phosphatase 1
           mRNA, complete cds.
          Length = 355

 Score = 39.7 bits (91), Expect = 0.019
 Identities = 23/55 (41%), Positives = 32/55 (58%)
 Frame = +3

Query: 294 YYKELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGVQALV 458
           Y  EL AA   V  A +LC  V++ ++ S     +  K D++PVTVAD+G Q LV
Sbjct: 7   YAAELAAAKKAVTLAAKLCQTVQQDIMHSG----VQAKADKSPVTVADYGSQILV 57



>sp|O94505|DPNP_SCHPO 3'(2'),5'-bisphosphate nucleotidase (EC
           3.1.3.7) (3'(2'),5- bisphosphonucleoside
           3'(2')-phosphohydrolase) (DPNPase) (Halotolerance
           protein tol1) (Target of lithium protein
           1).>pir|T41127|T41127 halotolerance protein - fission
           yeast (Schizosaccharomyces pombe)>gb:D86083_1674951
           Schizosaccharomyces pombe tol1+ gene for
           3'(2'),5'-bisphosphate nucleotidase, complete
           cds.>gb:SPCC1753_1721058 S.pombe chromosome III PCR
           product from region of cosmid c1753.
          Length = 353

 Score = 38.9 bits (89), Expect = 0.033
 Identities = 20/52 (38%), Positives = 28/52 (53%)
 Frame = +3

Query: 303 ELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGVQALV 458
           E + A+  V RA  L   V   L+        L K+D++PVT+ DFG QA+V
Sbjct: 6   EKQLAIAAVRRASYLTEKVFNQLIKEKSAAGALTKDDKSPVTIGDFGAQAIV 57



>gb:NCB15B24_1689370 Neurospora crassa DNA linkage group II BAC
           clone B15B24.
          Length = 392

 Score = 38.1 bits (87), Expect = 0.056
 Identities = 20/56 (35%), Positives = 32/56 (57%)
 Frame = +3

Query: 294 YYKELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGVQALVS 461
           Y  E+  A+  ++ A R    + K +L+S   G I +  D +PVTVADF +QA ++
Sbjct: 5   YATEISIAIPTIQLAAR----ISKHVLASANKGTIEKAEDLSPVTVADFAIQAYLT 56



>gb:CR382137_1670492 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 366

 Score = 37.7 bits (86), Expect = 0.073
 Identities = 20/56 (35%), Positives = 33/56 (58%)
 Frame = +3

Query: 294 YYKELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGVQALVS 461
           YYKELE A   V R   L  ++  S+ ++   G    K+D++PVT+ D+  QA+++
Sbjct: 10  YYKELEIASIAVMRTSILTKELSDSIATTQKSGTHT-KDDKSPVTIGDYASQAIIN 64



>gb:CR382126_1659445 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 363

 Score = 37.4 bits (85), Expect = 0.095
 Identities = 18/56 (32%), Positives = 32/56 (57%)
 Frame = +3

Query: 291 KYYKELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGVQALV 458
           ++ KEL  A   V +A  L   ++  ++SS      + K+DQ+PVT+ D+  QA++
Sbjct: 4   QFAKELAVATQAVRKASLLTKRIQADVISSSNS--TITKSDQSPVTIGDYSCQAII 57



>gb:AY035375_1559969 Candida albicans HAL2 gene, complete cds.
          Length = 337

 Score = 37.4 bits (85), Expect = 0.095
 Identities = 21/63 (33%), Positives = 35/63 (55%)
 Frame = +3

Query: 273 LSEQKAKYYKELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGVQA 452
           +S     Y KEL+ A   V+ A  L   +  S++ +   G  L K+D++PVT+ DF  QA
Sbjct: 1   MSHSTHPYQKELKVATLAVKCASLLTKQLSDSIVQTAKSGT-LTKDDKSPVTIGDFASQA 59

Query: 453 LVS 461
           +++
Sbjct: 60  IIN 62



>gb:AY340817_1600681 Debaryomyces hansenii 3'(2')5' bisphosphate
           nucleosidase gene, complete cds.
          Length = 420

 Score = 36.2 bits (82), Expect = 0.21
 Identities = 20/56 (35%), Positives = 32/56 (57%)
 Frame = +3

Query: 294 YYKELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGVQALVS 461
           YYKELE A   V R   L   +  S+ ++   G    K+D++PVT+ D+  QA+++
Sbjct: 64  YYKELEIASIAVIRTSILTKKLSDSIATTQKSGTHT-KDDKSPVTIGDYASQAIIN 118



>sp|P32179|HAL2_YEAST 3'(2'),5'-bisphosphate nucleotidase (EC
           3.1.3.7) (3'(2'),5- bisphosphonucleoside
           3'(2')-phosphohydrolase) (DPNPase) (Halotolerance
           protein HAL2).>pir|S35318|S35318 MET22 protein - yeast
           (Saccharomyces cerevisiae)>gb:SCHAL2_1708428
           S.cerevisiae HAL2 gene, identical to MET22
           gene.>gb:SCYOL064C_1714111 S.cerevisiae chromosome XV
           reading frame ORF YOL064c.
          Length = 357

 Score = 32.7 bits (73), Expect = 2.3
 Identities = 16/53 (30%), Positives = 27/53 (50%)
 Frame = +3

Query: 300 KELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGVQALV 458
           +EL  A   V +A  L   ++  ++S   D   + KND +PVT  D+  Q ++
Sbjct: 5   RELLVATQAVRKASLLTKRIQSEVISHK-DSTTITKNDNSPVTTGDYAAQTII 56



>gb:BA000035_717497 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 461

 Score = 32.3 bits (72), Expect = 3.1
 Identities = 13/30 (43%), Positives = 20/30 (66%)
 Frame = +1

Query: 157 QWIFSATPPFDSPKLIHAVRSISLPAGAAS 246
           QW+ +ATP  D P+++  VR I+L  G+ S
Sbjct: 53  QWLITATPDIDFPEVVQNVRYITLEGGSDS 82



>gb:CR380949_1649634 Candida glabrata strain CBS138 chromosome C
           complete sequence.
          Length = 357

 Score = 31.6 bits (70), Expect = 5.2
 Identities = 16/55 (29%), Positives = 29/55 (52%)
 Frame = +3

Query: 294 YYKELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGVQALV 458
           + +EL  A   V +A  L   ++  +++   D   + K+D +PVTV DF  Q ++
Sbjct: 3   FERELLVATQAVRKASLLTRRIQADVIAHR-DSTTITKSDSSPVTVGDFAAQTII 56



>gb:BA000042_1632484 Nicotiana tabacum mitochondrial DNA, complete
           genome.
          Length = 151

 Score = 31.6 bits (70), Expect = 5.2
 Identities = 17/40 (42%), Positives = 21/40 (52%)
 Frame = +2

Query: 2   DSTVTGLLNLSPQAAIILFAVRSRRFSSYNEH*TLNIAYS 121
           DSTV G  N S +  + LFA  S  F + N+H T    YS
Sbjct: 109 DSTVQGADNSSSKIILSLFAASSEHFMALNKHPTYTKGYS 148



>gb:AX646437_1471844 Sequence 629 from Patent
           EP1270724.>gb:AB065467_1869689 Homo sapiens gene for
           seven transmembrane helix receptor, complete cds,
           isolate:CBRC7TM_30.
          Length = 1520

 Score = 31.6 bits (70), Expect = 5.2
 Identities = 12/43 (27%), Positives = 22/43 (51%)
 Frame = +3

Query: 195 KAHPCRPFDQPPRRRCFTVRLSSRLPLSEQKAKYYKELEAAVD 323
           + HPCRPF QP +      R S ++P   +  ++ K +   ++
Sbjct: 254 RLHPCRPFSQPTQSFAAVARWSIKIPREPKPGEFSKVIRRLME 296



>gb:BA000040_729247 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 658

 Score = 31.6 bits (70), Expect = 5.2
 Identities = 15/31 (48%), Positives = 20/31 (64%)
 Frame = -2

Query: 351 RRDDKLSLQHPRLPRALCSISLSAPKAEASN 259
           R  D+L LQH   P A+   +L+APKA A+N
Sbjct: 554 RDGDRLYLQHRGFPLAVTDFTLAAPKAAATN 584



>gb:BC049258_2100001 Mus musculus LIM domain only 6, mRNA (cDNA
           clone MGC:55089 IMAGE:5250488), complete cds.
          Length = 624

 Score = 31.2 bits (69), Expect = 6.8
 Identities = 19/58 (32%), Positives = 23/58 (39%), Gaps = 1/58 (1%)
 Frame = -2

Query: 390 HHHHWRAMTS*HQRRDDKLSLQHP-RLPRALCSISLSAPKAEASNSTSR*SSAGGEAD 220
           HHHH R     H+RR       HP R     C +   +     S+S S  SS   E D
Sbjct: 512 HHHHHRRRRQRHRRRGSHHHHHHPGRHGHHRCDLGSGSDSGSCSSSPSSPSSESSEDD 569



>gb:BC023671_2094200 Mus musculus LIM domain only 6, mRNA (cDNA
           clone IMAGE:5039859), partial cds.
          Length = 649

 Score = 31.2 bits (69), Expect = 6.8
 Identities = 19/58 (32%), Positives = 23/58 (39%), Gaps = 1/58 (1%)
 Frame = -2

Query: 390 HHHHWRAMTS*HQRRDDKLSLQHP-RLPRALCSISLSAPKAEASNSTSR*SSAGGEAD 220
           HHHH R     H+RR       HP R     C +   +     S+S S  SS   E D
Sbjct: 537 HHHHHRRRRQRHRRRGSHHHHHHPGRHGHHRCDLGSGSDSGSCSSSPSSPSSESSEDD 594



>gb:AK083704_1174049 Mus musculus 9 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:D030068I23
           product:LIM only 6, full insert sequence.
          Length = 556

 Score = 31.2 bits (69), Expect = 6.8
 Identities = 19/58 (32%), Positives = 23/58 (39%), Gaps = 1/58 (1%)
 Frame = -2

Query: 390 HHHHWRAMTS*HQRRDDKLSLQHP-RLPRALCSISLSAPKAEASNSTSR*SSAGGEAD 220
           HHHH R     H+RR       HP R     C +   +     S+S S  SS   E D
Sbjct: 444 HHHHHRRRRQRHRRRGSHHHHHHPGRHGHHRCDLGSGSDSGSCSSSPSSPSSESSEDD 501



>gb:AE001438_34964 Clostridium acetobutylicum ATCC 824 megaplasmid
           pSOL1, complete sequence.
          Length = 225

 Score = 31.2 bits (69), Expect = 6.8
 Identities = 14/32 (43%), Positives = 22/32 (68%)
 Frame = +3

Query: 354 DVKKSLLSSDGDGQILEKNDQTPVTVADFGVQ 449
           DV+ +LL  DG   +L+K +++ VTV D G+Q
Sbjct: 132 DVEIALLEPDGKLSVLKKAEKSSVTVEDLGIQ 163



>gb:AY500154_1609646 Saccharomyces cerevisiae strain Montrache Hal2
           (HAL2) gene, complete cds.
          Length = 357

 Score = 30.8 bits (68), Expect = 8.9
 Identities = 15/53 (28%), Positives = 27/53 (50%)
 Frame = +3

Query: 300 KELEAAVDVVERACRLCVDVKKSLLSSDGDGQILEKNDQTPVTVADFGVQALV 458
           +EL  A   V +A  L   ++  ++S   D   + K+D +PVT  D+  Q ++
Sbjct: 5   RELLVATQAVRKASLLTKRIQSEVISHK-DSTTITKSDNSPVTTGDYAAQTII 56



>gb:AK037217_1164803 Mus musculus 6 days neonate skin cDNA, RIKEN
           full-length enriched library, clone:A030011A22
           product:LIM only 6, full insert sequence.
          Length = 624

 Score = 30.8 bits (68), Expect = 8.9
 Identities = 19/58 (32%), Positives = 23/58 (39%), Gaps = 1/58 (1%)
 Frame = -2

Query: 390 HHHHWRAMTS*HQRRDDKLSLQHP-RLPRALCSISLSAPKAEASNSTSR*SSAGGEAD 220
           HHHH R     H+RR       HP R     C +   +     S+S S  SS   E D
Sbjct: 512 HHHHHRRRRRRHRRRGSHHHHHHPGRHGHHRCDLGSGSDSGSCSSSPSSPSSESSEDD 569


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 447,042,922
Number of Sequences: 1806583
Number of extensions: 7840749
Number of successful extensions: 21526
Number of sequences better than 10.0: 39
Number of HSP's better than 10.0 without gapping: 20914
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21489
length of database: 581,917,975
effective HSP length: 114
effective length of database: 375,967,513
effective search space used: 15038700520
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)