BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig302
         (582 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB098630_1526120 Daucus carota DcCysP7 mRNA for cysteine prot...   188   6e-47   
gb:AF242372_1780149 Ipomoea batatas cysteine protease (SPCP1) mR...   184   1e-45   
gb:AY055589_1563381 Ipomoea batatas cysteine proteinase precurso...   183   2e-45   
gb:AF493233_1805005 Lycopersicon pennellii cysteine protease (Rc...   178   6e-44   
gb:AB098625_1526116 Daucus carota DcCysP2 mRNA for cysteine prot...   178   6e-44   
gb:OSJN00031_1693569 Oryza sativa genomic DNA, chromosome 4, BAC...   176   2e-43   
gb:AF493232_1805004 Lycopersicon pimpinellifolium cysteine prote...   176   2e-43   
gb:OSJN00114_1695146 Oryza sativa genomic DNA, chromosome 4, BAC...   175   5e-43   
gb:AGU13940_1811059 Alnus glutinosa cysteine proteinase mRNA, co...   174   9e-43   
gb:AY192364_1588669 Trifolium repens cysteine protease 8 gene, c...   173   2e-42   
gb:AF493234_1805006 Lycopersicon esculentum cysteine protease (R...   173   2e-42   
gb:AY504966_1609832 Iris hollandica putative cysteine protease 1...   173   2e-42   
gb:AY192366_1588671 Trifolium repens cysteine protease 12 gene, ...   172   5e-42   
gb:AY192363_1588668 Trifolium repens cysteine protease 5 gene, c...   171   6e-42   
gb:AY336982_1600287 Medicago truncatula putative cysteine protei...   170   2e-41   
gb:AB040454_1519513 Astragalus sinicus cysteine proteinase mRNA ...   166   3e-40   
pir|T06207|T06207 cysteine proteinase (EC 3.4.22.-) - barley>gb:...   164   1e-39   Hordeum vulgare [barley]
gb:AP003759_1833026 Oryza sativa (japonica cultivar-group) genom...   161   8e-39   
gb:AC092556_1735445 Oryza sativa chromosome 3 BAC OSJNBa0047E24 ...   160   1e-38   
pir|T45839|T45839 probable cysteine proteinase (EC 3.4.22.-) [si...   160   1e-38   Arabidopsis thaliana [mouse-ear cress]
pir|B84752|B84752 probable cysteine proteinase [imported] - Arab...   157   9e-38   Arabidopsis thaliana [mouse-ear cress]
gb:SEN11_1714956 Hemerocallis hybrid cultivar cysteine proteinas...   155   3e-37   
pir|JC4848|JC4848 cysteine proteinase (EC 3.4.22.-) - Douglas fi...   155   6e-37   Pseudotsuga menziesii
pir|T03941|T03941 cysteine proteinase (EC 3.4.22.-) precursor - ...   154   8e-37   Nicotiana tabacum [American tobacco]
sp|P00784|PAPA_CARPA|PAPA_CARPA Papain precursor (EC 3.4.22.2) (Papaya prot...   154   8e-37   Carica papaya [mamon]
pir|T07840|T07840 ananain (EC 3.4.22.31) AN8 precursor - pineapp...   154   1e-36   Ananas comosus
gb:OSJN00114_1695150 Oryza sativa genomic DNA, chromosome 4, BAC...   153   2e-36   
gb:AY604196_1617470 Gossypium hirsutum putative cysteine proteas...   153   2e-36   
gb:AY017413_1558850 Nicotiana tabacum CPR1-like cysteine protein...   153   2e-36   
pir|T10503|T10503 fruit bromelain (EC 3.4.22.33) FB18 precursor ...   153   2e-36   Ananas comosus
pir|T10514|T10514 probable stem bromelain (EC 3.4.22.32) precurs...   152   3e-36   Ananas comosus
gb:OSJN00046_1693820 Oryza sativa genomic DNA, chromosome 4, BAC...   152   4e-36   
gb:AY563270_1615020 Bromelia fastuosa fastuosain precursor mRNA,...   152   4e-36   
pir|T10501|T10501 fruit bromelain (EC 3.4.22.33) FB13 precursor ...   152   4e-36   Ananas comosus
gb:AF089848_1767322 Brassica napus senescence-specific cysteine ...   152   5e-36   
gb:AF454956_1801124 Brassica oleracea senescence-associated cyst...   151   6e-36   
gb:BT004146_1637245 Arabidopsis thaliana clone RAFL16-01-H24 (R5...   151   8e-36   
gb:AF259983_1781462 Ipomoea batatas putative cysteine protease m...   150   1e-35   
gb:D38533_1674560 Ananas comosus mRNA for FB22 precursor, partia...   150   2e-35   
pir|T10516|T10516 fruit bromelain (EC 3.4.22.33) FB22 precursor ...   150   2e-35   Ananas comosus
gb:AB109190_1526795 Helianthus annuus scp5 mRNA for cysteine pro...   149   2e-35   
gb:AB016870_1512880 Arabidopsis thaliana genomic DNA, chromosome...   149   3e-35   
sp|P80884|ANAN_ANACO|ANAN_ANACO Ananain precursor (EC 3.4.22.31).>pir|T0783...   149   3e-35   Ananas comosus
pir|T06416|T06416 cysteine proteinase (EC 3.4.22.-) precursor - ...   148   5e-35   Solanum lycopersicum
gb:STU245924_1723006 Solanum tuberosum mRNA for cysteine proteas...   148   7e-35   
gb:AY867764_1631390 Pinus taeda isolate FBRC3 cysteine protease ...   148   7e-35   
gb:AY867761_1631387 Pinus taeda isolate FBRC16 cysteine protease...   148   7e-35   
gb:AY867769_1631395 Pinus taeda isolate FBRC5 cysteine protease ...   147   9e-35   
gb:AY867762_1631388 Pinus taeda isolate FBRC1 cysteine protease ...   147   1e-34   
gb:ATU37336_1556938 Arabidopsis thaliana senescence-specific pro...   147   1e-34   
pir|F84672|F84672 probable cysteine proteinase [imported] - Arab...   147   1e-34   Arabidopsis thaliana [mouse-ear cress]
pir|C86413|C86413 cysteine proteinase (EC 3.4.22.-) [similarity]...   147   2e-34   Arabidopsis thaliana [mouse-ear cress]
sp|P05994|PAP4_CARPA|PAP4_CARPA Papaya proteinase IV precursor (EC 3.4.22.2...   147   2e-34   Carica papaya [mamon]
gb:AY867766_1631392 Pinus taeda isolate FBRC21 cysteine protease...   146   2e-34   
gb:AY867759_1631385 Pinus taeda isolate FBRC14 cysteine protease...   146   2e-34   
pir|JN0634|JN0634 caricain (EC 3.4.22.30) II precursor - papaya>...   146   2e-34   Carica papaya [mamon]
gb:AF089849_1767323 Brassica napus senescence-specific cysteine ...   146   3e-34   
gb:AP002866_1823377 Oryza sativa (japonica cultivar-group) genom...   145   4e-34   
pir|D86413|D86413 cysteine proteinase (EC 3.4.22.-) [similarity]...   145   4e-34   Arabidopsis thaliana [mouse-ear cress]
pir|T07851|T07851 ananain (EC 3.4.22.31) precursor AN11 - pineap...   145   4e-34   Ananas comosus
sp|Q9LT77|CPR1_ARATH|CPR1_ARATH Putative cysteine proteinase At3g19400 prec...   144   8e-34   Arabidopsis thaliana [mouse-ear cress]
gb:AP003724_1832447 Oryza sativa (japonica cultivar-group) genom...   144   1e-33   
gb:AK118509_1816482 Arabidopsis thaliana At3g19400 mRNA for puta...   144   1e-33   
gb:AB109186_1526791 Helianthus annuus scp1 mRNA for cysteine pro...   144   1e-33   
gb:D38534_1674561 Ananas comosus mRNA for FB1035 precursor, part...   143   2e-33   
pir|T10518|T10518 fruit bromelain (EC 3.4.22.33) FB1035 precurso...   143   2e-33   Ananas comosus
sp|P10056|PAP3_CARPA|PAP3_CARPA Caricain precursor (EC 3.4.22.30) (Papaya p...   143   2e-33   Carica papaya [mamon]
gb:AB025624_1516468 Arabidopsis thaliana genomic DNA, chromosome...   142   3e-33   
gb:AB098628_1526118 Daucus carota DcCysP5 mRNA for cysteine prot...   142   4e-33   
gb:AF133839_1770952 Sandersonia aurantiaca papain-like cysteine ...   142   5e-33   
gb:AY087918_1572943 Arabidopsis thaliana clone 39621 mRNA, compl...   142   5e-33   
sp|Q9LXW3|CPR2_ARATH|CPR2_ARATH Putative cysteine proteinase At3g43960 prec...   142   5e-33   Arabidopsis thaliana [mouse-ear cress]
gb:AY700587_1623605 Zingiber officinale cysteine protease gp3a m...   141   9e-33   
gb:AF448505_1800669 Brassica napus cysteine proteinase (CysP1) m...   140   1e-32   
gb:PSU34747_1702498 Phalaenopsis sp. 'hybrid SM9108' cysteine pr...   140   1e-32   
pir|T06122|T06122 cysteine proteinase (EC 3.4.22.-) F23E12.90 - ...   140   1e-32   Arabidopsis thaliana [mouse-ear cress]
gb:AY251055_1592749 Anthurium andraeanum senescence-associated c...   140   2e-32   
gb:AP004047_1836874 Oryza sativa (japonica cultivar-group) genom...   139   3e-32   
gb:AB098631_1526121 Daucus carota DcCysP8 mRNA for cysteine prot...   139   3e-32   
gb:AB098627_1526117 Daucus carota DcCysP4 mRNA for cysteine prot...   139   4e-32   
gb:AB098624_1526115 Daucus carota DcCysP1 mRNA for cysteine prot...   139   4e-32   
pir|T12039|T12039 cysteine proteinase (EC 3.4.22.-) 1 precursor ...   138   7e-32   Phaseolus vulgaris [French bean]
gb:AB098629_1526119 Daucus carota DcCysP6 mRNA for cysteine prot...   137   1e-31   
pir|S12618|TAGB actinidain (EC 3.4.22.14) precursor - kiwi fruit...   137   1e-31   
sp|P00785|ACTN_ACTCH|ACTN_ACTCH Actinidain precursor (EC 3.4.22.14) (Actini...   137   1e-31   Actinidia chinensis
pir|T12382|T12382 cysteine proteinase (EC 3.4.22.-) - common ice...   137   1e-31   Mesembryanthemum crystallinum
gb:AY881010_1631908 Nicotiana tabacum cysteine protease (CP2) mR...   137   2e-31   
gb:AB177386_1528888 Dianthus caryophyllus DC-CP2 mRNA for cystei...   137   2e-31   
pir|T12041|T12041 cysteine proteinase (EC 3.4.22.-) 3 precursor ...   137   2e-31   Phaseolus vulgaris [French bean]
gb:AJ606073_1811951 Gossypium hirsutum mRNA for cysteine protein...   136   2e-31   
gb:AF343446_1789638 Actinidia chinensis actinidin protease mRNA,...   136   2e-31   
pir|T46630|T46630 cysteine proteinase (EC 3.4.22.-) 1 precursor ...   136   2e-31   Phaseolus vulgaris [French bean]
sp|P12412|CYSP_VIGMU|CYSP_VIGMU Vignain precursor (EC 3.4.22.-) (Bean endop...   136   3e-31   Vigna mungo [urad dal]
sp|P43156|CYSP_HEMSP|CYSP_HEMSP Thiol protease SEN102 precursor (EC 3.4.22....   135   4e-31   
gb:VRU49445_1727379 Vigna radiata cysteinyl endopeptidase mRNA, ...   135   5e-31   
pir|S24602|S24602 cysteine proteinase tpp (EC 3.4.22.-) - garden...   135   6e-31   Pisum sativum [garden pea]
pir|T01207|T01207 cysteine proteinase mir3 (EC 3.4.22.-) - maize...   134   8e-31   Zea mays [maize]
gb:AF454958_1801126 Brassica oleracea senescence-associated cyst...   134   1e-30   
gb:AC079022_1541706 Oryza sativa chromosome 5 clone P0574H01, co...   134   1e-30   
gb:AB109189_1526794 Helianthus annuus scp4 mRNA for cysteine pro...   134   1e-30   
gb:AB020961_1514764 Zea mays mRNA for cysteine protease componen...   134   1e-30   
gb:AB004819_1509189 Oryza sativa Rep1 gene for cysteine endopept...   134   1e-30   
gb:AP003277_1827059 Oryza sativa (japonica cultivar-group) genom...   134   1e-30   
gb:AY039606_1560319 Arabidopsis thaliana F2G19.31/F2G19.31 mRNA,...   134   1e-30   
gb:AC069251_1540748 Genomic sequence for Arabidopsis thaliana BA...   134   1e-30   
gb:AB092557_1525080 Glycine max CysP2 mRNA for cysteine proteina...   134   1e-30   
gb:AB091070_1524989 Zinnia elegans ZCP4 mRNA for cysteine protei...   134   1e-30   
gb:AB024031_1515760 Arabidopsis thaliana genomic DNA, chromosome...   134   1e-30   
gb:AB008267_1510432 Arabidopsis thaliana genomic DNA, chromosome...   134   1e-30   
pir|A86341|A86341 cysteine proteinase (EC 3.4.22.-) [similarity]...   134   1e-30   Arabidopsis thaliana [mouse-ear cress]
sp|P43297|RD21_ARATH|RD21_ARATH Cysteine proteinase RD21a precursor (EC 3.4...   134   1e-30   Arabidopsis thaliana [mouse-ear cress]
sp|P25250|CYS2_HORVU|CYS2_HORVU Cysteine proteinase EP-B 2 precursor (EC 3....   134   1e-30   Hordeum vulgare [barley]
sp|P25249|CYS1_HORVU|CYS1_HORVU Cysteine proteinase EP-B 1 precursor (EC 3....   134   1e-30   Hordeum vulgare [barley]
gb:AY504967_1609833 Iris hollandica putative cysteine protease 2...   133   2e-30   
gb:AY192361_1588666 Trifolium repens cysteine protease 14 mRNA, ...   133   2e-30   
gb:AY192360_1588665 Trifolium repens cysteine protease 14 gene, ...   133   2e-30   
gb:AF388175_1794932 Arabidopsis thaliana papain-like cysteine pe...   133   2e-30   
gb:OSJN00065_1694210 Oryza sativa genomic DNA, chromosome 4, BAC...   133   2e-30   
gb:H0212B02_1681314 Oryza sativa genomic DNA, chromosome 4, BAC ...   133   2e-30   
gb:CPA131996_1648455 Carica papaya mRNA for chymopapain isoform ...   133   2e-30   
gb:CPA131995_1648454 Carica papaya mRNA for chymopapain isoform II.   133   2e-30   
pir|D86198|D86198 cysteine proteinase (EC 3.4.22.-) [similarity]...   133   2e-30   Arabidopsis thaliana [mouse-ear cress]
sp|P14080|PAP2_CARPA|PAP2_CARPA Chymopapain precursor (EC 3.4.22.6) (Papaya...   133   2e-30   Carica papaya [mamon]
gb:OSJN00032_1693605 Oryza sativa genomic DNA, chromosome 4, BAC...   132   3e-30   
pir|S22502|S22502 cysteine proteinase (EC 3.4.22.-) - kidney bean     132   3e-30   Phaseolus vulgaris [French bean]
sp|P25777|ORYB_ORYSA|ORYB_ORYSA Oryzain beta chain precursor (EC 3.4.22.-)....   132   3e-30   Oryza sativa [red rice]
gb:AP001633_1821394 Oryza sativa (japonica cultivar-group) genom...   132   4e-30   
gb:PVEPC1_1702940 Phaseolus vulgaris mRNA for endopeptidase (EP-...   132   4e-30   
gb:D14057_1674466 Ananas comosus mRNA for bromelain, partial cds.     132   4e-30   
sp|P25803|CYSP_PHAVU|CYSP_PHAVU Vignain precursor (EC 3.4.22.-) (Bean endop...   132   4e-30   Phaseolus vulgaris [French bean]
gb:AY700588_1623606 Zingiber officinale cysteine protease gp3b m...   132   5e-30   
gb:AY192362_1588667 Trifolium repens cysteine protease 1 gene, p...   132   5e-30   
pir|G86232|G86232 cysteine proteinase (EC 3.4.22.-) [similarity]...   132   5e-30   Arabidopsis thaliana [mouse-ear cress]
sp|P25776|ORYA_ORYSA|ORYA_ORYSA Oryzain alpha chain precursor (EC 3.4.22.-)...   131   7e-30   Oryza sativa [red rice]
gb:AP003928_1835387 Oryza sativa (japonica cultivar-group) genom...   131   9e-30   
gb:DCU17135_1675750 Dianthus caryophyllus cysteine proteinase (D...   130   1e-29   
pir|S57776|S57776 cysteine proteinase (EC 3.4.22.-) - clove pink...   130   1e-29   Dianthus caryophyllus [carnation]
gb:AY093066_1575020 Arabidopsis thaliana drought-inducible cyste...   130   2e-29   
pir|T06708|T06708 cysteine proteinase (EC 3.4.22.-) T29H11.140 -...   130   2e-29   Arabidopsis thaliana [mouse-ear cress]
sp|Q9SUT0|CPR3_ARATH|CPR3_ARATH Putative cysteine proteinase At4g11310 prec...   130   2e-29   Arabidopsis thaliana [mouse-ear cress]
pir|T06529|T06529 cysteine proteinase (EC 3.4.22.-) - garden pea...   129   3e-29   Pisum sativum [garden pea]
gb:AP003852_1834273 Oryza sativa (japonica cultivar-group) genom...   129   4e-29   
gb:PSA004958_1701891 Pisum sativum mRNA for TPE4A thiol-protease.     129   4e-29   
gb:AY043294_1560995 Arabidopsis thaliana cysteine proteinase (GC...   129   4e-29   
gb:AB092555_1525078 Glycine max CysP1 mRNA for cysteine proteina...   129   4e-29   
sp|Q94B08|GCP1_ARATH|GCP1_ARATH Germination-specific cysteine protease 1 pr...   129   4e-29   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00105_1694997 Oryza sativa genomic DNA, chromosome 4, BAC...   128   6e-29   
gb:AP003852_1834274 Oryza sativa (japonica cultivar-group) genom...   127   1e-28   
gb:AY700586_1623604 Zingiber officinale cysteine protease gp2b m...   127   1e-28   
pir|T06707|T06707 cysteine proteinase (EC 3.4.22.-) T29H11.130 -...   127   1e-28   Arabidopsis thaliana [mouse-ear cress]
pir|T05390|T05390 probable cysteine proteinase (EC 3.4.22.-) F16...   127   1e-28   Arabidopsis thaliana [mouse-ear cress]
gb:VSCYSPROA_1727386 V.sativa L. (PROT A) mRNA for cysteine prot...   127   1e-28   
pir|S49166|S49166 cysteine proteinase (EC 3.4.22.-) precursor - ...   127   1e-28   Vicia sativa [spring vetch]
sp|O65039|CYSP_RICCO|CYSP_RICCO Vignain precursor (EC 3.4.22.-) (Cysteine e...   127   1e-28   Ricinus communis
gb:AY700585_1623603 Zingiber officinale cysteine protease gp2a m...   126   2e-28   
gb:AY662993_1620480 Petunia x hybrida cysteine proteinase (CP7) ...   126   2e-28   
gb:AF454957_1801125 Brassica oleracea senescence-associated cyst...   126   3e-28   
pir|S47434|S47434 cysteine proteinase (EC 3.4.22.-) - rice>gb:AB...   126   3e-28   Oryza sativa [red rice]
pir|S71773|S71773 cysteine proteinase (EC 3.4.22.-) precursor - ...   126   3e-28   Zinnia elegans [garden zinnia]
sp|Q9SUS9|CPR4_ARATH|CPR4_ARATH Putative cysteine proteinase At4g11320 prec...   126   3e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AP006170_1861285 Oryza sativa (japonica cultivar-group) genom...   125   4e-28   
gb:AB057372_1521685 Daucus carota CSCP gene for cysteine protein...   125   5e-28   
pir|JC7787|JC7787 carrot seed cysteine proteinase (EC 3.4.-.-), ...   125   5e-28   Daucus carota [carrots]
gb:AB109187_1526792 Helianthus annuus scp2 mRNA for cysteine pro...   125   6e-28   
gb:AC130601_1740746 Oryza sativa (japonica cultivar-group) chrom...   124   1e-27   
gb:ZMSEE1_1732027 Z.mays mRNA for cysteine proteinase, See1.          123   2e-27   
gb:AY251054_1592748 Anthurium andraeanum cysteine protease mRNA,...   123   2e-27   
pir|S51817|S47312 cysteine proteinase (EC 3.4.22.-) precursor - ...   123   2e-27   
pir|S49451|S49451 cysteine proteinase (EC 3.4.22.-) - chickpea>g...   123   2e-27   Cicer arietinum [garbanzo]
pir|T06276|T06276 benzothiadiazole-induced protein (clone WCI-4)...   123   2e-27   Triticum aestivum [Canadian hard winter wheat]
pir|T06206|T06206 probable cysteine proteinase (EC 3.4.22.-) pre...   122   3e-27   Hordeum vulgare [barley]
gb:AP006170_1861279 Oryza sativa (japonica cultivar-group) genom...   122   4e-27   
gb:AY171099_1586735 Gossypium hirsutum cysteine protease mRNA, c...   122   4e-27   
pir|T06208|T06208 cysteine proteinase (EC 3.4.22.-) - barley>gb:...   122   5e-27   Hordeum vulgare [barley]
gb:OSJN00032_1693610 Oryza sativa genomic DNA, chromosome 4, BAC...   121   7e-27   
sp|Q10717|CYS2_MAIZE|CYS2_MAIZE Cysteine proteinase 2 precursor (EC 3.4.22....   121   7e-27   Zea mays [maize]
gb:AP002866_1823379 Oryza sativa (japonica cultivar-group) genom...   121   9e-27   
gb:AY345219_1321634 Acanthoscelides obtectus cathepsin L-like cy...   121   9e-27   
sp|P25251|CYS4_BRANA|CYS4_BRANA Cysteine proteinase COT44 precursor (EC 3.4...   121   9e-27   Brassica napus [oilseed rape]
gb:AP002869_1823473 Oryza sativa (japonica cultivar-group) genom...   120   1e-26   
gb:AF182079_1774901 Matricaria chamomilla thiol protease (ctp) m...   120   2e-26   
gb:HVU94591_1682853 Hordeum vulgare cysteine proteinase precurso...   120   2e-26   
gb:AY515271_1332446 Taenia cellulosae cathepsin L-like cysteine ...   120   2e-26   
gb:AF157961_1246018 Hypera postica cysteine proteinase mRNA, com...   120   2e-26   
pir|T03694|T03694 cysteine proteinase (EC 3.4.22.-) - rice>gb:D7...   120   2e-26   Oryza sativa [red rice]
gb:AB128161_2466293 Cyprinus carpio CTSL mRNA for cathepsin L pr...   119   3e-26   
gb:AF099203_1767963 Oryza sativa cysteine endopeptidase precurso...   119   3e-26   
gb:AY192365_1588670 Trifolium repens cysteine protease 10 gene, ...   119   3e-26   
gb:AJ583511_1282280 Diabrotica virgifera virgifera mRNA for cath...   119   3e-26   
gb:TRBACYSPRO_1400578 Trypanosoma congolense cysteine protease m...   119   5e-26   
gb:AP006170_1861276 Oryza sativa (japonica cultivar-group) genom...   118   6e-26   
gb:AB109188_1526793 Helianthus annuus scp3 mRNA for cysteine pro...   118   8e-26   
gb:AY156691_1937293 Saimiri boliviensis cathepsin S preproprotei...   117   1e-25   
gb:AF190653_1249496 Diabrotica virgifera virgifera cathepsin L-l...   117   1e-25   
gb:TCCYSPROT_1399672 T.congolense mRNA for (prepro) cysteine pro...   117   1e-25   
pir|S37048|S37048 cysteine proteinase - Trypanosoma congolense        117   1e-25   Trypanosoma congolense
gb:AJ784223_1284201 Suberites domuncula mRNA for cathepsin H (ca...   117   2e-25   
gb:HUMCATS_2029864 Homo sapiens cathepsin S (CTSS) mRNA, complet...   116   2e-25   
gb:AL356292_1924398 Human DNA sequence from clone RP11-363I22 on...   116   2e-25   
sp|P25774|CATS_HUMAN|CATS_HUMAN Cathepsin S precursor (EC 3.4.22.27).            116   2e-25   Homo sapiens [man]
gb:AF358668_2489199 Oncorhynchus mykiss procathepsin L mRNA, com...   116   3e-25   
gb:AP006170_1861281 Oryza sativa (japonica cultivar-group) genom...   115   4e-25   
gb:AF019145_1761576 Zea mays cysteine protease Mir1 (mir1) mRNA,...   115   4e-25   
gb:AJ583510_1282279 Diabrotica virgifera virgifera partial mRNA ...   115   4e-25   
gb:BC002642_1968284 Homo sapiens cathepsin S, mRNA (cDNA clone M...   115   5e-25   
gb:AF038546_2051874 Mus musculus cathepsin S precursor, mRNA, co...   115   7e-25   
gb:AY528229_1333138 Leptinotarsa decemlineata clone IntB11 diges...   115   7e-25   
gb:AF115280_1242488 Sarcocystis muris thiolproteinase SmTP1 (smt...   115   7e-25   
pir|A25492|KHBH aleurain (EC 3.4.22.-) precursor - barley             115   7e-25   
sp|O70370|CATS_MOUSE|CATS_MOUSE Cathepsin S precursor (EC 3.4.22.27).>gb:MM...   115   7e-25   Mus musculus [mouse]
sp|P05167|ALEU_HORVU|ALEU_HORVU Thiol protease aleurain precursor (EC 3.4.2...   115   7e-25   Hordeum vulgare [barley]
gb:DRCATHEPL_2571000 D.rerio mRNA for cathepsin L.                    114   9e-25   
gb:AP006170_1861277 Oryza sativa (japonica cultivar-group) genom...   114   9e-25   
gb:LMU249847_1685158 Lolium multiflorum mRNA for cysteine protea...   114   9e-25   
gb:AY336947_1320742 Anthonomus grandis cysteine proteinase (cys1...   114   9e-25   
pir|T01206|T01206 cysteine proteinase mir2 (EC 3.4.22.-) - maize...   114   9e-25   Zea mays [maize]
gb:MMCATHEPS_2114426 Mus musculus mRNA for cathepsin S.               114   1e-24   
gb:AH005369S6_1906625 Human cathepsin S gene, exon 6, partial cds.    114   1e-24   
gb:AE014297_1137928 Drosophila melanogaster chromosome 3R, compl...   114   1e-24   
pir|A42482|A42482 cathepsin S (EC 3.4.22.27) precursor - human>g...   114   1e-24   Homo sapiens [man]
sp|Q9VN93|CPR1_DROME|CPR1_DROME Putative cysteine proteinase CG12163 precur...   114   1e-24   Drosophila melanogaster
gb:BC075887_2558777 Danio rerio zgc:92089, mRNA (cDNA clone MGC:...   114   1e-24   
gb:TBR297265_1399271 Trypanosoma brucei rhodesiense partial mRNA...   114   1e-24   
gb:AY528230_1333139 Leptinotarsa decemlineata clone IntB12 diges...   114   1e-24   
gb:AY231965_1177258 Drosophila yakuba clone yak-em_CG12163 mRNA ...   114   1e-24   
pir|T14625|T14625 hypothetical protein - Trypanosoma cruzi>gb:AC...   114   1e-24   Trypanosoma cruzi
pir|S12099|S12099 cysteine proteinase (EC 3.4.22.-) precursor - ...   114   1e-24   Trypanosoma brucei brucei
gb:BC002125_2088888 Mus musculus cathepsin S, mRNA (cDNA clone M...   113   2e-24   
gb:AY156692_1425816 Canis familiaris cathepsin S preproprotein (...   113   2e-24   
gb:AF544844_1280690 Callosobruchus maculatus putative gut cathep...   113   2e-24   
gb:AK028366_1160949 Mus musculus 18 days pregnant adult female p...   113   2e-24   
sp|Q28944|CATL_PIG|CATL_PIG Cathepsin L precursor (EC 3.4.22.15).>pir|A58...   113   2e-24   Sus scrofa [pigs]
gb:BC066490_2554378 Danio rerio cathepsin L, a, mRNA (cDNA clone...   113   3e-24   
gb:AY333300_2528357 Paralabidochromis chilotes isolate Pach-cath...   113   3e-24   
gb:TRBCYSPRNS_1400635 Trypanosoma cruzi cysteine proteinase gene...   113   3e-24   
gb:AY795054_1352260 Artemia franciscana cathepsin L precursor, g...   113   3e-24   
gb:AJ583512_1282281 Diabrotica virgifera virgifera mRNA for cath...   113   3e-24   
sp|Q26636|CATL_SARPE|CATL_SARPE Cathepsin L precursor (EC 3.4.22.15).>pir|A...   113   3e-24   Sarcophaga peregrina
gb:BC080004_2561441 Xenopus laevis MGC81823 protein, mRNA (cDNA ...   112   3e-24   
gb:BC060335_2552818 Xenopus laevis cDNA clone MGC:68554 IMAGE:40...   112   3e-24   
gb:AP005419_1851485 Oryza sativa (japonica cultivar-group) genom...   112   3e-24   
gb:AP005312_1850386 Oryza sativa (japonica cultivar-group) genom...   112   3e-24   
gb:AF039554_1235484 Acanthamoeba culbertsoni cysteine proteinase...   112   3e-24   
gb:FHECATHES_1385098 Fasciola hepatica cathepsin L-like protease...   112   6e-24   
gb:AY795056_1352262 Artemia parthenogenetica cathepsin L1 gene, ...   112   6e-24   
gb:AY528231_1333140 Leptinotarsa decemlineata clone IntC14 diges...   112   6e-24   
gb:AY333293_1320329 Branchiostoma lanceolatum isolate Brla-beta2...   112   6e-24   
gb:AF544839_1280685 Callosobruchus maculatus putative gut cathep...   112   6e-24   
gb:AF271385_1257585 Fasciola hepatica cathepsin L mRNA, complete...   112   6e-24   
gb:AY212286_2519529 Fundulus heteroclitus cathepsin L precursor,...   111   7e-24   
gb:AJ719318_2501505 Gallus gallus mRNA for hypothetical protein,...   111   7e-24   
gb:AF194426_2479445 Myxine glutinosa clone hicl20 cysteine prote...   111   7e-24   
gb:PVY13924_1396253 Penaeus vannamei cathepsin L gene.                111   7e-24   
gb:PVCATHEPL_1396092 P.vannamei mRNA for cathepsin L.                 111   7e-24   
gb:AY333297_1320333 Branchiostoma lanceolatum isolate Brla-beta2...   111   7e-24   
gb:AY333294_1320330 Branchiostoma lanceolatum isolate Brla-beta2...   111   7e-24   
gb:AY333292_1320328 Branchiostoma lanceolatum isolate Brla-beta1...   111   7e-24   
gb:AF544843_1280689 Callosobruchus maculatus putative gut cathep...   111   7e-24   
gb:AF544842_1280688 Callosobruchus maculatus putative gut cathep...   111   7e-24   
gb:AF544840_1280686 Callosobruchus maculatus putative gut cathep...   111   7e-24   
gb:AF227957_1252867 Boophilus microplus cathepsin L-like protein...   111   7e-24   
gb:BC077285_2559999 Xenopus laevis cathepsin S, mRNA (cDNA clone...   111   1e-23   
gb:AB099890_2464886 Oryzias latipes ctsL mRNA for cathepsin L, c...   111   1e-23   
gb:PVCLCPRNA_1396098 P.vannamei cathepsin-L like cysteine protea...   111   1e-23   
gb:AY366355_1322893 Litopenaeus vannamei cathepsin L gene, exons...   111   1e-23   
gb:AY159374_1305255 Leptinotarsa decemlineata clone IntB4 digest...   111   1e-23   
gb:AF419329_1269467 Fasciola gigantica cathepsin L mRNA, complet...   111   1e-23   
gb:AF320565_1262382 Rhodnius prolixus cathepsine L-like cysteine...   111   1e-23   
pir|S47433|S47433 cathepsin L (EC 3.4.22.15) - Norway lobster>gb...   111   1e-23   Nephrops norvegicus
pir|S53027|S53027 cathepsin L (EC 3.4.22.15) precursor - penaeid...   111   1e-23   Penaeus vannamei [white Pacific shrimp]
sp|P04989|CYS2_DICDI|CYS2_DICDI Cysteine proteinase 2 precursor (EC 3.4.22....   111   1e-23   Dictyostelium discoideum
gb:BC075261_2558367 Xenopus tropicalis cathepsin S, mRNA (cDNA c...   110   1e-23   
gb:AY336797_1320738 Rhipicephalus haemaphysaloides haemaphysaloi...   110   1e-23   
gb:AB091669_1198742 Pandalus borealis PbCys mRNA for crustapain,...   110   1e-23   
gb:BC059142_2103659 Rattus norvegicus cathepsin S, mRNA (cDNA cl...   110   2e-23   
gb:AB013289_1512004 Glycine max gene for Bd 30K, complete cds.        110   2e-23   
gb:PWU70537_1396266 Paragonimus westermani pre-procathepsin L mR...   110   2e-23   
gb:LMCPB18G_1387670 L.mexicana cpb18 gene.                            110   2e-23   
gb:AF544838_1280684 Callosobruchus maculatus putative gut cathep...   110   2e-23   
gb:AF544837_1280683 Callosobruchus maculatus putative gut cathep...   110   2e-23   
gb:AF544836_1280682 Callosobruchus maculatus putative gut cathep...   110   2e-23   
gb:AF544834_1280680 Callosobruchus maculatus putative gut cathep...   110   2e-23   
gb:AF147207_1244945 Artemia franciscana cathepsin L-like proteas...   110   2e-23   
gb:AF139913_1244281 Trypanosoma congolense cysteine protease gen...   110   2e-23   
gb:AF016448_1232447 Caenorhabditis elegans cosmid F41E6, complet...   110   2e-23   
pir|T31871|T31871 hypothetical protein F41E6.6 - Caenorhabditis ...   110   2e-23   
sp|P14658|CYSP_TRYBB|CYSP_TRYBB Cysteine proteinase precursor (EC 3.4.22.-)...   110   2e-23   
sp|P13277|CYS1_HOMAM|CYS1_HOMAM Digestive cysteine proteinase 1 precursor (...   110   2e-23   
gb:BC075275_2558381 Xenopus tropicalis cathepsin K (pycnodysosto...   110   2e-23   
gb:AF544841_1280687 Callosobruchus maculatus putative gut cathep...   110   2e-23   
gb:AF544835_1280681 Callosobruchus maculatus putative gut cathep...   110   2e-23   
pir|F86413|F86413 probable cysteine proteinase [imported] - Arab...   110   2e-23   
sp|P25778|ORYC_ORYSA|ORYC_ORYSA Oryzain gamma chain precursor (EC 3.4.22.-)...   110   2e-23   
sp|P36400|LCPB_LEIME|LCPB_LEIME Cysteine proteinase B precursor (EC 3.4.22....   110   2e-23   
sp|Q05094|CYS2_LEIPI|CYS2_LEIPI Cysteine proteinase 2 precursor (EC 3.4.22....   110   2e-23   
sp|P25782|CYS2_HOMAM|CYS2_HOMAM Digestive cysteine proteinase 2 precursor (...   110   2e-23   
gb:BT000674_1634951 Arabidopsis thaliana clone RAFL05-19-H13 (R1...   109   3e-23   
gb:AB011483_1511491 Arabidopsis thaliana genomic DNA, chromosome...   109   3e-23   
pir|S47432|S47432 cathepsin L (EC 3.4.22.15) - Norway lobster>gb...   109   3e-23   
gb:AF194427_2479446 Myxine glutinosa clone hicl22 cysteine prote...   109   4e-23   
gb:BC051665_2100812 Mus musculus cDNA sequence BC051665, mRNA (c...   109   4e-23   
gb:AF411121_1797175 Sandersonia aurantiaca cysteine proteinase p...   109   4e-23   
gb:CFA279008_1438278 Canis familiaris mRNA for cathepsin L (ccL ...   109   4e-23   
gb:AY584068_1339114 Plasmodium vivax vivapain-4 mRNA, complete cds.   109   4e-23   
gb:AY333295_1320331 Branchiostoma lanceolatum isolate Brla-beta3...   109   4e-23   
gb:AC117076_1207833 Dictyostelium discoideum chromosome 2 map 33...   109   4e-23   
pir|JC5443|JC5443 cathepsin L-like cysteine proteinase (EC 3.4.2...   109   4e-23   
gb:LME319727_1387710 Leishmania mexicana cpb2 gene.                   108   5e-23   
gb:AY333298_1320334 Branchiostoma lanceolatum isolate Brla-beta1...   108   5e-23   
sp|P54640|CYS5_DICDI|CYS5_DICDI Cysteine proteinase 5 precursor (EC 3.4.22....   108   5e-23   
gb:BC012612_1973709 Homo sapiens cathepsin L, transcript variant...   108   6e-23   
gb:LMCPB1_1387668 L.mexicana cpb1 gene.                               108   6e-23   
pir|S29245|S29245 cysteine proteinase (EC 3.4.22.-) precursor - ...   108   6e-23   
gb:BC056059_2551642 Xenopus laevis cathepsin S, mRNA (cDNA clone...   108   8e-23   
gb:AY333296_1320332 Branchiostoma lanceolatum isolate Brla-beta9...   108   8e-23   
gb:AF265226_1257249 Trypanosoma cruzi strain TUL cruzipain gene,...   108   8e-23   
sp|P25975|CATL_BOVIN|CATL_BOVIN Cathepsin L precursor (EC 3.4.22.15).>gb:BT...   108   8e-23   
gb:BC074718_2558211 Xenopus tropicalis MGC69486 protein, mRNA (c...   107   1e-22   
gb:AF479267_2066775 Mesocricetus auratus cathepsin L mRNA, compl...   107   1e-22   
gb:AB032168_1518656 Nicotiana tabacum NTCP-23 mRNA for cysteine ...   107   1e-22   
gb:CQ974042_1455430 Sequence 1 from Patent WO2004113520.              107   1e-22   
gb:BT021022_1436380 Bos taurus cathepsin L2 (CTSL2), mRNA, compl...   107   1e-22   
gb:AB017645S4_1407910 Bos taurus gene for preprocathepsin L, exo...   107   1e-22   
gb:AY728269_1348763 Paragonimus westermani westerpain-1 gene, co...   107   1e-22   
gb:AY277910_1315306 Branchiostoma belcheri tsingtaunese cathepsi...   107   1e-22   
gb:AF426414_1269965 Delia radicum cathepsin L-like cysteine prot...   107   1e-22   
gb:AY622858_2540719 Oncorhynchus mykiss cathepsin S-like mRNA, p...   107   1e-22   
gb:AF121837_2055371 Mus musculus cell-line L929 cathepsin L mRNA...   107   1e-22   
gb:AL160279_1921866 Human DNA sequence from clone RP11-65B23 on ...   107   1e-22   
gb:ACACT1_1745315 Actinidia chinensis partial mRNA for actinidin...   107   1e-22   
gb:AF314930_1261697 Trypanosoma cruzi strain Ynull cruzipain gen...   107   1e-22   
gb:AF314929_1261696 Trypanosoma cruzi strain Y cruzipain gene, c...   107   1e-22   
gb:AK011589_1156491 Mus musculus 10 days embryo whole body cDNA,...   107   1e-22   
pir|S02728|S02728 actinidain (EC 3.4.22.14) precursor (clone pAC...   107   1e-22   
sp|P25779|CYSP_TRYCR|CYSP_TRYCR Cruzipain precursor (EC 3.4.22.51) (Major c...   107   1e-22   
sp|P06797|CATL_MOUSE|CATL_MOUSE Cathepsin L precursor (EC 3.4.22.15) (Major...   107   1e-22   
sp|P07711|CATL_HUMAN|CATL_HUMAN Cathepsin L precursor (EC 3.4.22.15) (Major...   107   1e-22   
sp|O35186|CATK_RAT|CATK_RAT Cathepsin K precursor (EC 3.4.22.38).>gb:AF01...   107   1e-22   
gb:AF454960_1801128 Brassica oleracea senescence-associated cyst...   107   2e-22   
gb:AY337012_1600306 Brassica rapa subsp. pekinensis clone MJ32 p...   107   2e-22   
gb:TCU41454_1399894 Trypanosoma cruzi cysteine protease cruzipai...   107   2e-22   
gb:PWU69121_1396265 Paragonimus westermani cysteine proteinase P...   107   2e-22   
gb:AY728270_1348764 Paragonimus westermani westerpain-10 gene, c...   107   2e-22   
gb:AY428949_1326022 Fasciola gigantica cathepsin L (cat-L1H) mRN...   107   2e-22   
gb:AC104496_1192353 Trypanosoma cruzi strain CL Brener chromosom...   107   2e-22   
gb:BC067615_2554787 Danio rerio zgc:85774, mRNA (cDNA clone MGC:...   106   2e-22   
gb:AY220615_1310449 Hydra vulgaris cathepsin L precursor, mRNA, ...   106   2e-22   
gb:AY208821_1309913 Rhipicephalus appendiculatus midgut cysteine...   106   2e-22   
gb:AE013599_1131763 Drosophila melanogaster chromosome 2R, compl...   106   2e-22   
sp|Q95029|CATL_DROME|CATL_DROME Cathepsin L precursor (EC 3.4.22.15) (Cyste...   106   2e-22   
gb:AP004299_1839782 Oryza sativa (japonica cultivar-group) genom...   106   3e-22   
gb:DDU72745_1377414 Dictyostelium discoideum cysteine proteinase...   106   3e-22   
gb:AY126713_1301858 Metapenaeus ensis cathepsin L precursor (Cat...   106   3e-22   
gb:AY126712_1301857 Metapenaeus ensis cathepsin L precursor (Cat...   106   3e-22   
gb:AF265227_1257250 Trypanosoma cruzi strain TCC cruzipain gene,...   106   3e-22   
gb:PHU31094_1700203 Petunia hybrida thiol protease homolog P21 (...   105   4e-22   
gb:TRBTUL2TAN_1400840 Trypanosoma cruzi tandem cysteine proteina...   105   4e-22   
gb:TCU41444_1399893 Trypanosoma cruzi cysteine protease cruzipai...   105   4e-22   
pir|A45629|A45629 cysteine proteinase cruzipain (EC 3.4.22.-) - ...   105   4e-22   
gb:AJ784224_1284202 Suberites domuncula mRNA for cathepsin L (ca...   105   5e-22   
gb:CYICYPR_2570479 Cyprinus carpio cysteine proteinase gene, com...   105   7e-22   
gb:RNCATHL_2134588 Rat mRNA for cathepsin L (EC 3.4.22.15).           105   7e-22   
gb:SOYP34A_1716071 Glycine max 34 kDa maturing seed vacuolar thi...   105   7e-22   
gb:AY017412_1558849 Nicotiana tabacum NTCP23-like cysteine prote...   105   7e-22   
gb:CQ783130_1452314 Sequence 3270 from Patent EP1396543.              105   7e-22   
pir|S55923|S55923 cysteine proteinase (EC 3.4.22.-) precursor - ...   105   7e-22   
pir|A47306|A47306 cysteine proteinase - Tetrahymena thermophila>...   105   7e-22   
sp|P22895|P34_SOYBN|P34_SOYBN P34 probable thiol protease precursor (EC 3....   105   7e-22   
sp|P07154|CATL_RAT|CATL_RAT Cathepsin L precursor (EC 3.4.22.15) (Major e...   105   7e-22   
gb:AY333299_2528356 Petromyzon marinus isolate Pema-cathepsin ca...   104   9e-22   
gb:AY225486_2520440 Fundulus heteroclitus cathepsin S precursor,...   104   9e-22   
gb:AB099891_2464887 Oryzias latipes ctsS mRNA for cathepsin S, c...   104   9e-22   
gb:AF201700_1889800 Cercopithecus aethiops cysteine protease mRN...   104   9e-22   
gb:AF462189_1273287 Sarcoptes scabiei type hominis cathepsin L-l...   104   9e-22   
gb:AF239265_1253907 Fasciola gigantica cathepsin L (cat-L1C) mRN...   104   9e-22   
pir|S74227|S74227 cathepsin K (EC 3.4.22.-) precursor - mouse>gb...   104   9e-22   
sp|P55097|CATK_MOUSE|CATK_MOUSE Cathepsin K precursor (EC 3.4.22.38).>gb:AK...   104   9e-22   
gb:AF454959_1801127 Brassica oleracea senescence-associated cyst...   104   1e-21   
gb:PCO17903_1391799 Phaedon cochleariae mRNA for thiol protease.      104   1e-21   
gb:AY533168_1333682 Brugia malayi cathepsin F-like cysteine prot...   104   1e-21   
gb:AY363263_1322717 Triatoma infestans cathepsin L-like proteina...   104   1e-21   
gb:AK005526_1153086 Mus musculus adult female placenta cDNA, RIK...   104   1e-21   
pir|JC5441|JC5441 cathepsin L-like cysteine proteinase (EC 3.4.2...   104   1e-21   
pir|S07098|KHRTL cathepsin L (EC 3.4.22.15) precursor - rat           104   1e-21   
gb:HALCP3_1385637 H.americanus mRNA for cysteine proteinase prep...   103   2e-21   
sp|P25784|CYS3_HOMAM|CYS3_HOMAM Digestive cysteine proteinase 3 precursor (...   103   2e-21   
sp|Q9R014|CATJ_MOUSE|CATJ_MOUSE Cathepsin J precursor (EC 3.4.22.-) (Cathep...   103   2e-21   
gb:AP006170_1861280 Oryza sativa (japonica cultivar-group) genom...   103   2e-21   
sp|Q94504|CYS7_DICDI|CYS7_DICDI Cysteine proteinase 7 precursor (EC 3.4.22....   103   2e-21   
gb:AB081844_2463656 Engraulis japonicus aCat2 mRNA for cathepsin...   103   3e-21   
gb:AY070063_1566705 Arabidopsis thaliana putative cysteine prote...   103   3e-21   
gb:AB091670_1198743 Pandalus borealis PbCtL mRNA for cathepsin L...   103   3e-21   
pir|JC5442|JC5442 cathepsin L-like cysteine proteinase (EC 3.4.2...   103   3e-21   
pir|T06726|T06726 cysteine proteinase (EC 3.4.22.-) F28P10.80 - ...   103   3e-21   
gb:AY146988_2076805 Mus musculus strain BALB/c testin precursor,...   102   3e-21   
gb:LMU43706_1388899 Leishmania major cathepsin L-like protease m...   102   3e-21   
gb:AY332271_1320243 Tenebrio molitor cathepsin-L-like cysteine p...   102   3e-21   
gb:AY332270_1320242 Tenebrio molitor cathepsin-L-like cysteine p...   102   3e-21   
gb:MMU131851_2118392 Mus musculus mRNA for cathepsin F.               102   4e-21   
gb:AF197480_2058786 Mus musculus strain C57BL/6 cathepsin F (Cts...   102   4e-21   
gb:AL355860_1924096 Human DNA sequence from clone RP11-235D19 on...   102   4e-21   
gb:AX497240_1469602 Sequence 7 from Patent WO0229058.                 102   4e-21   
gb:A98645_1451469 Sequence 1 from Patent WO9910500.>gb:A98647_14...   102   4e-21   
gb:FHU62289_1385119 Fasciola hepatica secreted cathepsin L 2 (Fh...   102   4e-21   
gb:AY660746_1344372 Toxoplasma gondii strain RH toxopain-2 mRNA,...   102   4e-21   
gb:AF239264_1253906 Fasciola gigantica cathepsin L (cat-L1B) mRN...   102   4e-21   
gb:AY347838_1177996 Malus x domestica clone 19-6 cysteine protei...   102   4e-21   
gb:AY223168_1176632 Schistosoma japonicum clone ZZD1556 mRNA seq...   102   4e-21   
sp|P61276|CATK_MACFA|CATK_MACFA Cathepsin K precursor (EC 3.4.22.38).>sp|P6...   102   4e-21   
sp|Q9R013|CATF_MOUSE|CATF_MOUSE Cathepsin F precursor (EC 3.4.22.41).>gb:AK...   102   4e-21   
gb:AB081843_2463655 Engraulis japonicus aCat1 mRNA for cathepsin...   102   6e-21   
gb:CR541719_1993949 Homo sapiens full open reading frame cDNA cl...   102   6e-21   
gb:AY091771_1574731 Arabidopsis thaliana AT3g45310/F18N11_70 mRN...   102   6e-21   
gb:AF309627_1261141 Leishmania donovani clone Ld-F cysteine prot...   102   6e-21   
gb:AF217087_1251893 Leishmania chagasi cathepsin L-like cysteine...   102   6e-21   
gb:AF098670_1240857 Tethya aurantia silicatein beta mRNA, comple...   102   6e-21   
gb:AF004592_1231110 Leishmania donovani chagasi amastigote-speci...   102   6e-21   
pir|T47471|T47471 cysteine proteinase (EC 3.4.22.-) F18N11.70 [s...   102   6e-21   
sp|P43235|CATK_HUMAN|CATK_HUMAN Cathepsin K precursor (EC 3.4.22.38) (Cathe...   102   6e-21   
sp|O46427|CATH_PIG|CATH_PIG Cathepsin H precursor (EC 3.4.22.16).>gb:SSAF...   102   6e-21   
gb:NFU42758_1390810 Naegleria fowleri cysteine proteinase homolo...   101   8e-21   
gb:FHE279093_1385090 Fasciola hepatica partial mRNA for procathe...   101   8e-21   
gb:AF542132_1280468 Theromyzon tessulatum cathepsin L mRNA, comp...   101   8e-21   
gb:AF510740_1278431 Schistosoma japonicum cathepsin L1 mRNA, com...   101   8e-21   
gb:AF462309_1273297 Acanthamoeba healyi cysteine proteinase (CP1...   101   8e-21   
gb:AF309626_1261140 Leishmania donovani clone Ld-A cysteine prot...   101   8e-21   
gb:AF228731_1252916 Stylonychia lemnae cathepsin L gene, complet...   101   8e-21   
pir|S19651|S19651 cysteine proteinase (EC 3.4.22.-) precursor (c...   101   8e-21   
sp|P43236|CATK_RABIT|CATK_RABIT Cathepsin K precursor (EC 3.4.22.38) (OC-2 ...   101   8e-21   
sp|Q40143|CYS3_LYCES|CYS3_LYCES Cysteine proteinase 3 precursor (EC 3.4.22....   101   1e-20   
gb:BC068241_2106067 Mus musculus cathepsin 8, mRNA (cDNA clone M...   100   1e-20   
gb:LECYSPRO_1684282 L.esculentum mRNA encoding pre-pro-cysteine ...   100   1e-20   
gb:TRBRANGA_1400777 Trypanosoma rangeli (clone 2) rangelipain ge...   100   1e-20   
gb:GCRNAC_1385204 G.cydonium mRNA for cathepsin.                      100   1e-20   
gb:FHU62288_1385118 Fasciola hepatica secreted cathepsin L 1 (Fh...   100   1e-20   
gb:AY528227_1333136 Leptinotarsa decemlineata clone IntA26 diges...   100   1e-20   
gb:AY528226_1333135 Leptinotarsa decemlineata clone IntA24 diges...   100   1e-20   
gb:AY519971_1332767 Fasciola hepatica clone Porto 1 cathepsin L ...   100   1e-20   
gb:AY207373_1309880 Tenebrio molitor cathepsin L-like cysteine p...   100   1e-20   
gb:AY159370_1305251 Leptinotarsa decemlineata clone IntA3 digest...   100   1e-20   
pir|T09528|T09528 probable cysteine proteinase (EC 3.4.22.-) pre...   100   1e-20   
pir|S30149|S30149 cysteine proteinase (EC 3.4.22.-) precursor (c...   100   1e-20   
pir|S24988|S24988 cysteine proteinase (EC 3.4.22.-) precursor - ...   100   1e-20   
gb:AF498292_2498168 Danio rerio cathepsin mRNA, partial cds.          100   2e-20   
gb:AF510856_1278438 Fasciola gigantica cathepsin L2 mRNA, comple...   100   2e-20   
gb:AF032117_1234629 Tethya aurantia silicatein alpha mRNA, compl...   100   2e-20   
gb:AF004594_1231112 Trypanosoma cruzi cysteine protease (cp) gen...   100   2e-20   
pir|S43991|S43991 cathepsin L-like proteinases (EC 3.4.22.-) - l...   100   2e-20   
sp|Q26534|CATL_SCHMA|CATL_SCHMA Cathepsin L precursor (EC 3.4.22.15) (SMCL1...   100   2e-20   
gb:NTU57825_1691844 Nicotiana tabacum endopeptidase-like protein...   100   2e-20   
gb:AB161375_1528556 Aster tripolium CysP mRNA for cysteine prote...   100   2e-20   
gb:AY713477_1348126 Cryptobia salmositica cysteine proteinase (C...   100   2e-20   
gb:AY090898_1297506 Cryptobia salmositica 49 kDa cysteine protei...   100   2e-20   
gb:AF112566_1242101 Fasciola gigantica cathepsin (cat-L1) mRNA, ...   100   2e-20   
pir|T02166|T02166 cysteine proteinase (EC 3.4.22.-) precursor - ...   100   2e-20   
pir|T09259|T09259 cathepsin L-like proteinase (EC 3.4.22.-) - li...   100   2e-20   
gb:BC004054_2089564 Mus musculus cathepsin F, mRNA (cDNA clone M...   100   3e-20   
gb:AF310623_2062410 Rattus norvegicus cathepsin P (CtsP) mRNA, c...   100   3e-20   
gb:PSA278699_1701953 Pisum sativum mRNA for protease (elsa gene).     100   3e-20   
gb:LMFL4766_1388080 Leishmania major Friedlin chromosome 19 cosm...   100   3e-20   
gb:AB009306_1193154 Fasciola hepatica mRNA for cathepsin L, comp...   100   3e-20   
sp|P15242|TEST_RAT|TEST_RAT Testin 2 precursor (CMB-23) [Contains: Testin...   100   3e-20   
sp|P04988|CYS1_DICDI|CYS1_DICDI Cysteine proteinase 1 precursor (EC 3.4.22....   100   3e-20   
gb:AY817140_2387987 Bombyx mori nucleopolyhedrovirus strain K1 c...    99   4e-20   
gb:HSU20280_2022711 Human cathepsin X mRNA, complete cds.              99   4e-20   
gb:AF082181_1766609 Solanum melongena cysteine proteinase precur...    99   4e-20   
gb:AY528228_1333137 Leptinotarsa decemlineata clone IntA27 diges...    99   4e-20   
gb:AF490984_1276287 Fasciola hepatica cathepsin L mRNA, partial ...    99   4e-20   
gb:AF309687_1261144 Leishmania donovani cysteine protease gene, ...    99   4e-20   
gb:AF093243_1240351 Clonorchis sinensis cysteine proteinase 1 pr...    99   4e-20   
gb:AF004593_1231111 Leishmania donovani chagasi promastigote-spe...    99   4e-20   
gb:AK049474_1168816 Mus musculus 7 days embryo whole body cDNA, ...    99   4e-20   
sp|P54639|CYS4_DICDI|CYS4_DICDI Cysteine proteinase 4 precursor (EC 3.4.22....    99   4e-20   
sp|O60911|CSL2_HUMAN|CSL2_HUMAN Cathepsin L2 precursor (EC 3.4.22.43) (Cath...    99   4e-20   
sp|P25783|CATV_NPVAC|CATV_NPVAC Viral cathepsin (EC 3.4.22.50) (V-cath) (Cy...    99   4e-20   
sp|Q02765|CATS_RAT|CATS_RAT Cathepsin S precursor (EC 3.4.22.27).>pir|A45...    99   4e-20   
sp|Q9GLE3|CATK_PIG|CATK_PIG Cathepsin K precursor (EC 3.4.22.38).>gb:AF29...    99   4e-20   
gb:BC087770_2565423 Xenopus tropicalis hypothetical LOC496647, m...    99   5e-20   
gb:AB106359_2465157 Engraulis japonicus catL gene for cathepsin ...    99   5e-20   
gb:BT019598_2151441 Synthetic construct Homo sapiens cathepsin F...    99   5e-20   
gb:HSY14734_2028363 Homo sapiens mRNA for cathepsin L2.                99   5e-20   
gb:HSM802335_2017462 Homo sapiens mRNA; cDNA DKFZp434F0610 (from...    99   5e-20   
gb:CR541680_1993910 Homo sapiens full open reading frame cDNA cl...    99   5e-20   
gb:AF071748_1880833 Homo sapiens cathepsin F (CATSF) mRNA, compl...    99   5e-20   
gb:CQ840846_1454162 Sequence 16 from Patent WO2004058816.              99   5e-20   
gb:FHE279091_1385088 Fasciola hepatica partial mRNA for procathe...    99   5e-20   
gb:AY426971_1325773 Bombyx mori fibroinase precursor, mRNA, comp...    99   5e-20   
gb:AY277628_1315242 Fasciola hepatica cathepsin L mRNA, partial ...    99   5e-20   
gb:AY158071_1305116 Petrosia ficiformis silicatein mRNA, complet...    99   5e-20   
pir|T46294|T46294 hypothetical protein DKFZp434F0610.1 - human (...    99   5e-20   
pir|S71923|S71923 cysteine proteinase (EC 3.4.22.-) - garden pea...    99   5e-20   
sp|Q9UBX1|CATF_HUMAN|CATF_HUMAN Cathepsin F precursor (EC 3.4.22.41) (CATSF...    99   5e-20   
gb:AB081845_2463657 Engraulis japonicus aCatL mRNA for cathepsin...    99   6e-20   
gb:NTA242994_1691277 Nicotiana tabacum mRNA for putative preproc...    99   6e-20   
gb:TRBRANGB_1400779 Trypanosoma rangeli (clone 3) rangelipain ge...    99   6e-20   
gb:AY333290_1320327 Branchiostoma lanceolatum isolate Brla-alpha...    99   6e-20   
pir|T12042|T12042 cysteine proteinase (EC 3.4.22.-) 4 precursor ...    99   6e-20   
gb:AJ606072_1811950 Gossypium hirsutum mRNA for putative papain-...    98   8e-20   
gb:AY333289_1320326 Branchiostoma lanceolatum isolate Brla-alpha...    98   8e-20   
gb:AY075147_1296002 Tetrahymena thermophila granule-biosynthesis...    98   8e-20   


>gb:AB098630_1526120 Daucus carota DcCysP7 mRNA for cysteine
           protease, complete cds.
          Length = 361

 Score =  188 bits (477), Expect = 6e-47
 Identities = 97/193 (50%), Positives = 134/193 (69%), Gaps = 4/193 (2%)
 Frame = +1

Query: 13  LSSMASNFDFQ-LILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKA 186
           L +  +N  F+  ++AA++LLGA+A QAT+    E SM ERHE+WM+ +GR YK++AEK+
Sbjct: 16  LCTSTTNMAFKHFMIAALILLGAWACQATSRTLPEASMFERHEQWMIQYGRVYKDEAEKS 75

Query: 187 KRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXX 366
            RF+IF  NVKFIE FNK G QSYKL V +F+D TNEEF+A+  N               
Sbjct: 76  VRFQIFMDNVKFIEEFNKDGRQSYKLAVNEFADQTNEEFQASR-NGYKMAVSSRPSQTTL 134

Query: 367 XXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQ 546
              E++  VP  +DWR+KGAVT +K+QG CG CWAFS +AA EGIT+++TG+L+ LSEQ+
Sbjct: 135 FRYENVTAVPSSMDWRKKGAVTPVKDQGQCGSCWAFSTIAATEGITKLKTGKLISLSEQE 194

Query: 547 LLDCNL--KNYGC 579
           L+DC+   ++ GC
Sbjct: 195 LVDCDKTGEDQGC 207



>gb:AF242372_1780149 Ipomoea batatas cysteine protease (SPCP1) mRNA,
           complete cds.
          Length = 339

 Score =  184 bits (466), Expect = 1e-45
 Identities = 96/189 (50%), Positives = 128/189 (67%), Gaps = 3/189 (1%)
 Frame = +1

Query: 22  MASNFDFQLILAAVLLLGAFASQATALDEEPS-MLERHEKWMVHHGRSYKNDAEKAKRFK 198
           MASN   +L++A  L+    A  AT+     S M+ RHE+WM  +GR YK +AEK KRF 
Sbjct: 1   MASN-SLKLLVALALVFATSAYLATSRTLSDSLMVVRHEQWMAQYGRVYKTEAEKTKRFN 59

Query: 199 IFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNE 378
           IF++NV++IESFNKAG + YKLG+  F+DLTN+EFKA+                     E
Sbjct: 60  IFKENVEYIESFNKAGTKPYKLGINAFADLTNQEFKAS---RNGYKLPHDCSSNTPFRYE 116

Query: 379 SLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC 558
           +++ VP  +DWR KGAVT +K+QG CGCCWAFSAVAAMEGIT++ TG L+ LSEQ+L+DC
Sbjct: 117 NVSSVPTTVDWRTKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDC 176

Query: 559 NLK--NYGC 579
           ++K  + GC
Sbjct: 177 DVKGTDQGC 185



>gb:AY055589_1563381 Ipomoea batatas cysteine proteinase precursor
           (SPG31) gene, complete cds.>gb:AF242185_1780135 Ipomoea
           batatas cysteine proteinase-like protein mRNA, complete
           cds.
          Length = 341

 Score =  183 bits (465), Expect = 2e-45
 Identities = 93/187 (49%), Positives = 126/187 (67%), Gaps = 3/187 (1%)
 Frame = +1

Query: 28  SNFDFQLILAAVLLLGAFASQATALDEEPS-MLERHEKWMVHHGRSYKNDAEKAKRFKIF 204
           SN   +L++A  L+    A  AT+     S M+ RHE+WM  +GR Y+N+ EK KRF IF
Sbjct: 4   SNSSLKLLVALALVFATSAYLATSRTLSDSLMVVRHEQWMAQYGRVYENEVEKTKRFNIF 63

Query: 205 EQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESL 384
           ++NV++IESFNKAG + YKLG+  F+DLTN+EFKA+                     E++
Sbjct: 64  KENVEYIESFNKAGTKPYKLGINAFADLTNQEFKAS---RNGYKLPHDCSSNTPFRYENV 120

Query: 385 AEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL 564
           + VP  +DWR KGAVT +K+QG CGCCWAFSAVAAMEGIT++ TG L+ LSEQ+L+DC++
Sbjct: 121 SSVPTTVDWRTKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDV 180

Query: 565 K--NYGC 579
           K  + GC
Sbjct: 181 KGIDQGC 187



>gb:AF493233_1805005 Lycopersicon pennellii cysteine protease (Rcr3)
           gene, complete cds.
          Length = 337

 Score =  178 bits (451), Expect = 6e-44
 Identities = 89/188 (47%), Positives = 116/188 (61%), Gaps = 2/188 (1%)
 Frame = +1

Query: 22  MASNFDFQLILAAVLLLGAFASQATALDEEP--SMLERHEKWMVHHGRSYKNDAEKAKRF 195
           MA   D   IL  +  + +  +  T    +P  S+ ERHE WM  HGR YK++ EK +RF
Sbjct: 1   MAMKIDLMSILITLFFVISMFNTQTRGRSQPKLSVSERHELWMSRHGRVYKDEVEKGERF 60

Query: 196 KIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXN 375
            IF++N+KFIES NKAGN SYKLG+ +F+D+T++EF A                     +
Sbjct: 61  MIFKENMKFIESVNKAGNLSYKLGMNEFADITSQEFLAKFTGLNIPNSYLSPSPINDLSD 120

Query: 376 ESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLD 555
           +   ++P  LDWRE GAVT +KNQG CGCCWAFSAV ++EG  +I TG LM  SEQ+LLD
Sbjct: 121 D---DMPSNLDWRESGAVTQVKNQGQCGCCWAFSAVGSLEGAYKIATGNLMEFSEQELLD 177

Query: 556 CNLKNYGC 579
           C   NYGC
Sbjct: 178 CTTNNYGC 185



>gb:AB098625_1526116 Daucus carota DcCysP2 mRNA for cysteine
           protease, complete cds.
          Length = 365

 Score =  178 bits (451), Expect = 6e-44
 Identities = 91/179 (50%), Positives = 119/179 (66%), Gaps = 3/179 (1%)
 Frame = +1

Query: 52  LAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIE 228
           LA +  +G  AS A A    E SM E H++WM  +GR YK   EK +R  IF++N+K+I+
Sbjct: 12  LALLFTIGVLASLAAARSLNEASMTETHDQWMARYGRVYKTANEKNRRSTIFQENLKYIQ 71

Query: 229 SFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLD 408
           +FNKA N+ YKLGV +F+DLTNEEF  +                     E++  VP  +D
Sbjct: 72  TFNKANNKPYKLGVNEFADLTNEEFTTS---RNKFKSHVCATVTNVFRYENVTAVPATMD 128

Query: 409 WREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC--NLKNYGC 579
           WR+KGAVT IKNQG CGCCWAFSAVAAMEGITQ++TG+L+ LSEQ+L+DC  N ++ GC
Sbjct: 129 WRKKGAVTPIKNQGQCGCCWAFSAVAAMEGITQLKTGKLISLSEQELVDCDTNGEDQGC 187



>gb:OSJN00031_1693569 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0052O21, complete sequence.
          Length = 339

 Score =  176 bits (447), Expect = 2e-43
 Identities = 88/179 (49%), Positives = 123/179 (68%), Gaps = 2/179 (1%)
 Frame = +1

Query: 49  ILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIE 228
           IL  + L  A  + A  L ++ +M  RHE+WM  +GR Y++DAEKA+RF++F+ NV FIE
Sbjct: 11  ILGCLCLCSAVLA-ARELSDDAAMAARHERWMAQYGRVYRDDAEKARRFEVFKANVAFIE 69

Query: 229 SFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLD 408
           SFN AGN ++ LGV +F+DLTN+EF+    N+G               N ++  +P  +D
Sbjct: 70  SFN-AGNHNFWLGVNQFADLTNDEFRWMKTNKGFIPSTTRVPTGFRYENVNIDALPATVD 128

Query: 409 WREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGC 579
           WR KGAVT IK+QG CGCCWAFSAVAAMEGI ++ TG+L+ LSEQ+L+DC++  ++ GC
Sbjct: 129 WRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDCDVHGEDQGC 187



>gb:AF493232_1805004 Lycopersicon pimpinellifolium cysteine protease
           (Rcr3) gene, complete cds.
          Length = 344

 Score =  176 bits (446), Expect = 2e-43
 Identities = 92/192 (47%), Positives = 119/192 (61%), Gaps = 6/192 (3%)
 Frame = +1

Query: 22  MASNFDFQLILAAVLLLGAFASQATALDEEP--SMLERHEKWMVHHGRSYKNDAEKAKRF 195
           MA   D   IL  +  + +  +  T    +P  S+ ERHE WM  HGR YK++ EK +RF
Sbjct: 1   MAMKVDLMNILITLFFVISMFNTQTRGRSQPKLSVSERHELWMSRHGRVYKDEVEKGERF 60

Query: 196 KIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEF--KATMLNEGXXXXXXXXXXXXXX 369
            IF++N+KFIES NKAGN SYKLG+ +F+D+T++EF  K T LN                
Sbjct: 61  MIFKENMKFIESVNKAGNLSYKLGMNEFADITSQEFLAKFTGLNIPNSYLSPSPMSSTEF 120

Query: 370 XNESLAE--VPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQ 543
               L++  +P  LDWRE GAVT +K+QG CGCCWAFSAV ++EG  +I TG LM  SEQ
Sbjct: 121 KINDLSDDYMPSNLDWRESGAVTQVKHQGRCGCCWAFSAVGSLEGAYKIATGNLMEFSEQ 180

Query: 544 QLLDCNLKNYGC 579
           +LLDC   NYGC
Sbjct: 181 ELLDCTTNNYGC 192



>gb:OSJN00114_1695146 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0035O13, complete sequence.
          Length = 339

 Score =  175 bits (443), Expect = 5e-43
 Identities = 90/179 (50%), Positives = 121/179 (67%), Gaps = 2/179 (1%)
 Frame = +1

Query: 49  ILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIE 228
           IL+ + L  A  + A    +  +M+ RHE+WM  +GR YK+  EKA+RF+IF+ NV FIE
Sbjct: 11  ILSCLCLCSAVLA-AREQSDHAAMVARHERWMEQYGRVYKDATEKARRFEIFKANVAFIE 69

Query: 229 SFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLD 408
           SFN AGN  + LGV +F+DLTN EF+AT  N+G               N S+  +P  +D
Sbjct: 70  SFN-AGNHKFWLGVNQFADLTNYEFRATKTNKGFIPSTVRVPTTFRYENVSIDTLPATVD 128

Query: 409 WREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGC 579
           WR KGAVT IK+QG CGCCWAFSAVAAMEGI ++ TG+L+ LSEQ+L+DC++  ++ GC
Sbjct: 129 WRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDCDVHGEDQGC 187



>gb:AGU13940_1811059 Alnus glutinosa cysteine proteinase mRNA,
           complete cds.
          Length = 340

 Score =  174 bits (441), Expect = 9e-43
 Identities = 94/180 (52%), Positives = 118/180 (65%), Gaps = 4/180 (2%)
 Frame = +1

Query: 52  LAAVLLLGAFASQATALD--EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFI 225
           L  ++ LGA ASQ  A    ++ SM ERHE+WM  +GR YK+  EK KR+KIFE+NV  I
Sbjct: 10  LVVMVTLGALASQLAAARSLQDASMRERHEEWMASYGRVYKDINEKQKRYKIFEENVALI 69

Query: 226 ESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYL 405
           ES NK  N+ YKL V +F+DLTNEEFKA+  N                 N S   VP  +
Sbjct: 70  ESSNKDANKPYKLSVNQFADLTNEEFKASR-NRFKGHICSTKSTSFKYGNVSA--VPSAM 126

Query: 406 DWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGC 579
           DWR KGAVT +K+QG CGCCWAFSAVAA EGIT++ TG+L+ LSEQ+L+DC+    + GC
Sbjct: 127 DWRMKGAVTPVKDQGQCGCCWAFSAVAATEGITKLTTGELISLSEQELVDCDTSGVDQGC 186



>gb:AY192364_1588669 Trifolium repens cysteine protease 8 gene,
           complete cds.
          Length = 343

 Score =  173 bits (439), Expect = 2e-42
 Identities = 90/190 (47%), Positives = 125/190 (65%), Gaps = 4/190 (2%)
 Frame = +1

Query: 22  MASNFD-FQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRF 195
           MASN   + + LA V  LG FA Q T+   ++ SM ERH +WM  +G+ YK+  E+  RF
Sbjct: 1   MASNNQVYHISLALVFCLGLFAIQVTSRTLQDDSMYERHGQWMSQYGKIYKDHQERETRF 60

Query: 196 KIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXN 375
           KIF +NV ++E+ N    +SYKLG+ +F+DLTNEEF A+  N+                 
Sbjct: 61  KIFTENVNYVEASNADDTKSYKLGINQFADLTNEEFVASR-NKFKGHMCSSITRTTTFKY 119

Query: 376 ESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLD 555
           E+++ +P  +DWR+KGAVT +KNQG CGCCWAFSAVAA EGI ++ TG+L+ LSEQ+L+D
Sbjct: 120 ENVSAIPSTVDWRKKGAVTPVKNQGQCGCCWAFSAVAATEGIHKLSTGKLISLSEQELVD 179

Query: 556 CNLK--NYGC 579
           C+ K  + GC
Sbjct: 180 CDTKGVDQGC 189



>gb:AF493234_1805006 Lycopersicon esculentum cysteine protease
           (Rcr3) gene, complete cds.
          Length = 345

 Score =  173 bits (438), Expect = 2e-42
 Identities = 88/193 (45%), Positives = 116/193 (60%), Gaps = 7/193 (3%)
 Frame = +1

Query: 22  MASNFDFQLILAAVLLLGAFASQATALDEEP--SMLERHEKWMVHHGRSYKNDAEKAKRF 195
           MA   D   IL  +  + +  +  T    +P  S+ ERHE WM  HGR YK++ EK +RF
Sbjct: 1   MAMKVDLMNILITLFFVISMFNTQTRGRSQPKLSVSERHELWMSRHGRVYKDEVEKGERF 60

Query: 196 KIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXN 375
            IF++N+KFIES NKAGN SYKLG+ +F+D+T++EF A                      
Sbjct: 61  MIFKENMKFIESVNKAGNLSYKLGMNEFADITSQEFLAKFTGLNIPNSYLSPSPMSSTEF 120

Query: 376 ESLAEV-----PEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSE 540
           + + ++     P  LDWRE GAVT +K+QG CGCCWAFSAV ++EG  +I TG LM  SE
Sbjct: 121 KKINDLSDDYMPSNLDWRESGAVTQVKHQGRCGCCWAFSAVGSLEGAYKIATGNLMEFSE 180

Query: 541 QQLLDCNLKNYGC 579
           Q+LLDC   NYGC
Sbjct: 181 QELLDCTTNNYGC 193



>gb:AY504966_1609832 Iris hollandica putative cysteine protease 1
           (CYS1) mRNA, complete cds.
          Length = 340

 Score =  173 bits (438), Expect = 2e-42
 Identities = 94/179 (52%), Positives = 118/179 (65%), Gaps = 5/179 (2%)
 Frame = +1

Query: 58  AVLLLGAFASQATA---LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIE 228
           A+L++  +ASQ  A   L E  SMLERHE+WM  HGR YKN AEKA RF+IF  NV+ IE
Sbjct: 14  ALLIVAIWASQGEAGRSLGENKSMLERHEQWMAQHGRVYKNAAEKAHRFEIFRANVERIE 73

Query: 229 SFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLD 408
           SFN A N  +KLGV +F+DLTNEEFK                       E++  VP  +D
Sbjct: 74  SFN-AENHKFKLGVNQFADLTNEEFKTR-----NTLKPSKMASTKSFKYENVTAVPATMD 127

Query: 409 WREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGC 579
           WR KGAVT IK+QG CG CWAFSAVAA EGIT++ TG+L+ LSEQ+++DC++   + GC
Sbjct: 128 WRTKGAVTPIKDQGQCGSCWAFSAVAATEGITKLSTGKLISLSEQEVVDCDVTSDDQGC 186



>gb:AY192366_1588671 Trifolium repens cysteine protease 12 gene,
           complete cds.
          Length = 343

 Score =  172 bits (435), Expect = 5e-42
 Identities = 92/190 (48%), Positives = 124/190 (65%), Gaps = 5/190 (2%)
 Frame = +1

Query: 25  ASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKI 201
           A+N  + + LA    LG  A Q T+   ++ S+ ERHE+WM H+G+ YKN  E+ KR +I
Sbjct: 3   ANNQLYHVSLALFFCLGLLAIQVTSRTLQDDSIFERHEQWMTHYGKVYKNPQEREKRLRI 62

Query: 202 FEQNVKFIESFNKAGNQS-YKLGVKKFSDLTNEEFKATMLN-EGXXXXXXXXXXXXXXXN 375
           F +N+K+IE+ N AGN+  YKLG+ +F+DLTNEEF A+    +G               N
Sbjct: 63  FTENLKYIEASNNAGNKKPYKLGINQFADLTNEEFIASRNKFKGHMCSSIIRTTTFKYEN 122

Query: 376 ESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLD 555
            S   VP  +DWR+KGAVT +KNQG CGCCWAFSA+AA EGI +I TG+L+ LSEQ+L+D
Sbjct: 123 TS---VPSTVDWRKKGAVTPVKNQGQCGCCWAFSAIAATEGIHKISTGKLVSLSEQELVD 179

Query: 556 C--NLKNYGC 579
           C  N  + GC
Sbjct: 180 CDTNGVDQGC 189



>gb:AY192363_1588668 Trifolium repens cysteine protease 5 gene,
           complete cds.
          Length = 343

 Score =  171 bits (434), Expect = 6e-42
 Identities = 92/190 (48%), Positives = 123/190 (64%), Gaps = 5/190 (2%)
 Frame = +1

Query: 25  ASNFDFQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKI 201
           A+N  + + LA    LG  A Q T+   ++ S+ ERHE+WM H+G+ YKN  E+ KR +I
Sbjct: 3   ANNQLYHVSLALFFCLGLLAIQVTSRTLQDDSIFERHEQWMTHYGKVYKNPQEREKRLRI 62

Query: 202 FEQNVKFIESFNKAGNQS-YKLGVKKFSDLTNEEFKATMLN-EGXXXXXXXXXXXXXXXN 375
           F +N+K+IE+ N AGN   YKLG+ +F+DLTNEEF A+    +G               N
Sbjct: 63  FTENLKYIEASNNAGNNKPYKLGINQFADLTNEEFIASRNKFKGHMCSSIIRTTTFKYEN 122

Query: 376 ESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLD 555
            S   VP  +DWR+KGAVT +KNQG CGCCWAFSA+AA EGI +I TG+L+ LSEQ+L+D
Sbjct: 123 TS---VPSTVDWRKKGAVTPVKNQGQCGCCWAFSAIAATEGIHKISTGKLVSLSEQELVD 179

Query: 556 C--NLKNYGC 579
           C  N  + GC
Sbjct: 180 CDTNGVDQGC 189



>gb:AY336982_1600287 Medicago truncatula putative cysteine
           proteinase mRNA, complete cds.
          Length = 345

 Score =  170 bits (430), Expect = 2e-41
 Identities = 90/182 (49%), Positives = 120/182 (65%), Gaps = 6/182 (3%)
 Frame = +1

Query: 52  LAAVLLLGAFASQATA--LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFI 225
           LA    LG FA Q T+  L ++  + E+HE+WMVH+G+ YK+  E+  R KIF++NV +I
Sbjct: 13  LALFFCLGLFAIQVTSRTLQDDSIIYEKHEQWMVHYGKVYKDLQERENRLKIFKENVNYI 72

Query: 226 ESFNKAGNQS-YKLGVKKFSDLTNEEFKATMLN-EGXXXXXXXXXXXXXXXNESLAEVPE 399
           E+ N AGN   YKLG+ +F+DLTNEEF A+    +G               N   A VP 
Sbjct: 73  EASNNAGNNKLYKLGINQFADLTNEEFIASRNKFKGHMCSSITKTSTFKYEN---ASVPS 129

Query: 400 YLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NY 573
            +DWR+KGAVT +KNQG CGCCWAFSAVAA EGI ++ TG+L+ LSEQ+L+DC+ K  + 
Sbjct: 130 TVDWRKKGAVTPVKNQGQCGCCWAFSAVAATEGIHKLSTGKLVSLSEQELVDCDTKGVDQ 189

Query: 574 GC 579
           GC
Sbjct: 190 GC 191



>gb:AB040454_1519513 Astragalus sinicus cysteine proteinase mRNA for
           cysteine proteinase, complete cds.
          Length = 343

 Score =  166 bits (420), Expect = 3e-40
 Identities = 86/183 (46%), Positives = 119/183 (65%), Gaps = 3/183 (1%)
 Frame = +1

Query: 40  FQLILAAVLLLGAFASQATALD-EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV 216
           + + LA ++ LG +A Q T+   ++ SM ERH++WM  + + Y +  E  KRF+IF++NV
Sbjct: 8   YYISLALLMCLGLWAVQVTSRTLQDASMYERHQQWMGQYAKIYNDHQEWEKRFQIFKENV 67

Query: 217 KFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVP 396
            +IE+ NK G + YKLGV +F DLTNEEF A   N                  E++  VP
Sbjct: 68  NYIETSNKEGGRFYKLGVNQFVDLTNEEFIAPR-NRFKGHMCSSIIRTNTYKYENVTTVP 126

Query: 397 EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--N 570
             +DWR+KGAVT +K+QG CGCCWAFSAVAA EGI Q+ TG+L+ LSEQ+L+DC+ K  +
Sbjct: 127 SNVDWRQKGAVTPVKDQGQCGCCWAFSAVAATEGIHQLSTGKLISLSEQELVDCDTKGVD 186

Query: 571 YGC 579
            GC
Sbjct: 187 QGC 189



>pir|T06207|T06207 cysteine proteinase (EC 3.4.22.-) -
           barley>gb:HVZ97022_1682877 Hordeum vulgare gene encoding
           cysteine proteinase.
          Length = 349

 Score =  164 bits (415), Expect = 1e-39
 Identities = 82/178 (46%), Positives = 114/178 (64%), Gaps = 8/178 (4%)
 Frame = +1

Query: 55  AAVLLLGAFASQATALDE----EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF 222
           +AV    A A++  A DE    + +M+ RHEKWM  HGR+Y N+ EKA+R ++F  N K 
Sbjct: 15  SAVAAPRALAARQLAGDEAITVDAAMVSRHEKWMAEHGRTYANEEEKARRLEVFRANAKL 74

Query: 223 IESFNKAGNQSYKLGVKKFSDLTNEEFKATMLN----EGXXXXXXXXXXXXXXXNESLAE 390
           I+SFN A + +++L   +F+DLT+EEF+A                         N SLA+
Sbjct: 75  IDSFNSAEDSTHRLATNRFADLTDEEFRAARTGLRRPPAAAAGAGSGAGGFRYENFSLAD 134

Query: 391 VPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL 564
               +DWR  GAVT +K+QG CGCCWAFSAVAA+EG+T+IRTG+L+ LSEQQL+DC++
Sbjct: 135 AAGSMDWRAMGAVTGVKDQGSCGCCWAFSAVAAVEGLTKIRTGRLVSLSEQQLVDCDV 192



>gb:AP003759_1833026 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1567_G09.>gb:AP004342_1840518 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0585H11.
          Length = 352

 Score =  161 bits (407), Expect = 8e-39
 Identities = 84/182 (46%), Positives = 111/182 (60%), Gaps = 5/182 (2%)
 Frame = +1

Query: 49  ILAAVLLL---GAFASQA--TALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQN 213
           ++AA LLL   G  ++ A  T      +M  RH+KWM  HGR+YK+ AEKA+RF++F+ N
Sbjct: 10  VMAASLLLVVAGGLSTMAKVTMASRAGTMEARHDKWMAEHGRTYKDAAEKARRFRVFKAN 69

Query: 214 VKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEV 393
           V  I+  N AGN+ Y+L   +F+DLT+ EF A                     +    + 
Sbjct: 70  VDLIDRSNAAGNKRYRLATNRFTDLTDAEFAAMYTGYNPANTMYAAANATTRLSSEDDQQ 129

Query: 394 PEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNY 573
           P  +DWR++GAVT +KNQ  CGCCWAFS VAA+EGI QI TG+L+ LSEQQLLDC   N 
Sbjct: 130 PAEVDWRQQGAVTGVKNQRSCGCCWAFSTVAAVEGIHQITTGELVSLSEQQLLDC-ADNG 188

Query: 574 GC 579
           GC
Sbjct: 189 GC 190



>gb:AC092556_1735445 Oryza sativa chromosome 3 BAC OSJNBa0047E24
           genomic sequence, complete sequence.>gb:AC135225_1742100
           Oryza sativa chromosome 3 BAC OJ1112_G08 genomic
           sequence, complete sequence.>gb:AF377947_1793303 Oryza
           sativa (japonica cultivar-group) chromosome 3, BAC clone
           OSJNBa0032E21, complete sequence.
          Length = 350

 Score =  160 bits (406), Expect = 1e-38
 Identities = 83/192 (43%), Positives = 119/192 (61%), Gaps = 15/192 (7%)
 Frame = +1

Query: 49  ILAAVLLLGAFA--------SQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIF 204
           +LA +++ GA A          A A   + +M  RHEKWM  HG++YK++ EKA+R ++F
Sbjct: 7   VLAVLVMSGAAALGRELAGDGAAAAAAADVAMASRHEKWMAKHGKTYKDEEEKARRLEVF 66

Query: 205 EQNVKFIESFNKA----GNQSYKLGVKKFSDLTNEEFKATMLN-EGXXXXXXXXXXXXXX 369
             N K I+SFN A    G   ++L   +F+DLT++EF+A     +               
Sbjct: 67  RANAKLIDSFNAAAEKDGGGGHRLATNRFADLTDDEFRAARTGYQRPPAAVAGAGGGFLY 126

Query: 370 XNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQL 549
            N SLA  P+ +DWR  GAVT +K+QG CGCCWAFSAVAA+EG+ +IRTGQL+ LSEQ+L
Sbjct: 127 ENFSLAAAPQSMDWRAMGAVTGVKDQGSCGCCWAFSAVAAVEGLAKIRTGQLVSLSEQEL 186

Query: 550 LDCNLK--NYGC 579
           +DC+++  + GC
Sbjct: 187 VDCDVRGEDQGC 198



>pir|T45839|T45839 probable cysteine proteinase (EC 3.4.22.-)
           [similarity] - Arabidopsis thaliana>gb:AC012329_1537568
           Arabidopsis thaliana chromosome 1 BAC T1G12 genomic
           sequence, complete sequence.>gb:ATF2K15_1550540
           Arabidopsis thaliana DNA chromosome 3, BAC clone F2K15.
          Length = 341

 Score =  160 bits (406), Expect = 1e-38
 Identities = 79/162 (48%), Positives = 107/162 (66%), Gaps = 5/162 (3%)
 Frame = +1

Query: 109 EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDL 288
           E S +E+HE+WM    R Y +D+EK  RF+IF  N+KF+ES N   N++Y L V +FSDL
Sbjct: 28  EASAVEKHEQWMSRFNRVYSDDSEKTSRFEIFTNNLKFVESINMNTNKTYTLDVNEFSDL 87

Query: 289 TNEEFKAT----MLNEGXXXXXXXXXXXXXXXN-ESLAEVPEYLDWREKGAVTDIKNQGY 453
           T+EEFKA     ++ EG                 E++ E  E +DW ++GAVT +K+Q  
Sbjct: 88  TDEEFKARYTGLVVPEGMTRISTTDSHETVSFRYENVGETGESMDWIQEGAVTSVKHQQQ 147

Query: 454 CGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           CGCCWAFSAVAA+EG+T+I  G+L+ LSEQQLLDC+ +N GC
Sbjct: 148 CGCCWAFSAVAAVEGMTKIANGELVSLSEQQLLDCSTENNGC 189



>pir|B84752|B84752 probable cysteine proteinase [imported] -
           Arabidopsis thaliana>gb:AC002341_1530549 Arabidopsis
           thaliana chromosome 2 clone T14G11 map TEn5, complete
           sequence.
          Length = 345

 Score =  157 bits (398), Expect = 9e-38
 Identities = 86/188 (45%), Positives = 115/188 (61%), Gaps = 10/188 (5%)
 Frame = +1

Query: 46  LILAAVLLLGAF----ASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQN 213
           L+   ++L   F    A+  T +  E SM+++HE+WM    R Y+++ EK  R  +F++N
Sbjct: 7   LVTVLIILFTGFRISQATSRTVIFREQSMVDKHEQWMARFSREYRDELEKNMRRDVFKKN 66

Query: 214 VKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATM-----LNEGXXXXXXXXXXXXXXXNE 378
           +KFIE+FNK GN+SYKLGV +F+D TNEEF A       L E                N 
Sbjct: 67  LKFIENFNKKGNKSYKLGVNEFADWTNEEFLAIHTGLKGLTEVSPSKVVAKTISSQTWNV 126

Query: 379 SLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC 558
           S   V E  DWR +GAVT +K QG CGCCWAFSAVAA+EG+ +I  G L+ LSEQQLLDC
Sbjct: 127 S-DMVVESKDWRAEGAVTPVKYQGQCGCCWAFSAVAAVEGVAKIAGGNLVSLSEQQLLDC 185

Query: 559 NLK-NYGC 579
           + + + GC
Sbjct: 186 DREYDRGC 193



>gb:SEN11_1714956 Hemerocallis hybrid cultivar cysteine proteinase
           (SEN11) mRNA, complete cds.
          Length = 359

 Score =  155 bits (393), Expect = 3e-37
 Identities = 82/185 (44%), Positives = 113/185 (61%), Gaps = 8/185 (4%)
 Frame = +1

Query: 49  ILAAVLLLGAFA-SQATALDE-----EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQ 210
           +L+ VL+LG+ A +Q+   DE     E S+   +EKW  HH  S   D +  KRF +F++
Sbjct: 8   LLSVVLVLGSVALAQSIPFDEKDLASEESLWSLYEKWRAHHAVSRDLD-DTDKRFNVFKE 66

Query: 211 NVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNE--GXXXXXXXXXXXXXXXNESL 384
           NVKFI  FN+  + +YKL + KF D+TN+EF++T                       E  
Sbjct: 67  NVKFIHEFNQKKDATYKLALNKFGDMTNQEFRSTYAGSKIDHHMTLRGVKDAGEFSYEKF 126

Query: 385 AEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL 564
            ++P  +DWREKGAVT +K+QG CG CWAFS V A+EGI QI+T +L+ LSEQQL+DC+ 
Sbjct: 127 HDLPTSVDWREKGAVTGVKDQGQCGSCWAFSTVVAVEGINQIKTNELVSLSEQQLVDCDT 186

Query: 565 KNYGC 579
           KN GC
Sbjct: 187 KNSGC 191



>pir|JC4848|JC4848 cysteine proteinase (EC 3.4.22.-) - Douglas
           fir>gb:PMU41902_1700823 Pseudosuga menziesii cysteine
           protease pseudotzain (PM33cysP) mRNA, complete cds.
          Length = 454

 Score =  155 bits (391), Expect = 6e-37
 Identities = 84/192 (43%), Positives = 111/192 (57%), Gaps = 14/192 (7%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALD------------EEPSMLERHEKWMVHHGRSYKNDAEKAK 189
           L+L AVL L A A  A+  D             + +++E +E W+  H ++Y    EK K
Sbjct: 4   LLLFAVLALSAMAGSASRADFSIISYDSQDLIGDDAIMELYELWLAQHKKAYNGLDEKQK 63

Query: 190 RFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXX 369
           +F +F+ N  +I   N  GN SYKLG+ +F+DL++EEFKA  L                 
Sbjct: 64  KFSVFKDNFLYIHQHNNQGNPSYKLGLNQFADLSHEEFKAAYLGTKLDAKKRLSRSPSPR 123

Query: 370 XNESLAE-VPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQ 546
              S+ E +PE +DWREKGAVT +KNQG CG CWAFS VAA+EGI QI TG L  LSEQ+
Sbjct: 124 YQYSVGEDLPESIDWREKGAVTAVKNQGSCGSCWAFSTVAAVEGINQIVTGNLTSLSEQE 183

Query: 547 LLDCNLK-NYGC 579
           L+DC+   N GC
Sbjct: 184 LVDCDTSYNQGC 195



>pir|T03941|T03941 cysteine proteinase (EC 3.4.22.-) precursor -
           common tobacco>gb:NTCYSTPRO_1691532 Nicotiana tabacum
           mRNA for cysteine proteinase precursor.
          Length = 374

 Score =  154 bits (390), Expect = 8e-37
 Identities = 79/199 (39%), Positives = 123/199 (61%), Gaps = 7/199 (3%)
 Frame = +1

Query: 4   TNILSSMASNFDFQLILAAV-LLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAE 180
           T +L ++ S+  + + ++ +      +A + T   +E  +  R+E W+  HGR+Y    E
Sbjct: 7   TTLLFALFSSLSYAIDMSIIDYKNNHYARKWTLQSDEDQVKNRYEMWLAEHGRAYNALGE 66

Query: 181 KAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXX 360
           K KRF+IF+ N++FIE  N +GN++YK+G+ +F+DLTNEE++   L  G           
Sbjct: 67  KEKRFEIFKDNLRFIEGHNNSGNRTYKVGLNQFADLTNEEYRTMYL--GTKSDARRRFVK 124

Query: 361 XXXXNESLAE-----VPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQL 525
               ++  A      +P  +DWR++GAV  IKNQG CG CWAFS VAA+EGI QI TG++
Sbjct: 125 SKNPSQRYASRPNELMPHSVDWRKRGAVAPIKNQGSCGSCWAFSTVAAVEGINQIVTGEM 184

Query: 526 MRLSEQQLLDCN-LKNYGC 579
           + LSEQ+L+DC+ ++N GC
Sbjct: 185 ITLSEQELVDCDRVQNSGC 203



>sp|P00784|PAPA_CARPA Papain precursor (EC 3.4.22.2) (Papaya
           proteinase I) (PPI).>pir|A26466|PPPA papain (EC
           3.4.22.2) precursor - papaya>gb:CPAPAP_1648545 Carica
           papaya papain mRNA, complete cds.>gb:SYNPAPAIN_2153514
           Synthetic papain gene, complete cds.
          Length = 345

 Score =  154 bits (390), Expect = 8e-37
 Identities = 72/154 (46%), Positives = 98/154 (63%)
 Frame = +1

Query: 118 MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNE 297
           +++  E WM+ H + YKN  EK  RF+IF+ N+K+I+  NK  N SY LG+  F+D++N+
Sbjct: 44  LIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNN-SYWLGLNVFADMSND 102

Query: 298 EFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFS 477
           EFK                      N+    +PEY+DWR+KGAVT +KNQG CG CWAFS
Sbjct: 103 EFKEKYTGSIAGNYTTTELSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWAFS 162

Query: 478 AVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           AV  +EGI +IRTG L   SEQ+LLDC+ ++YGC
Sbjct: 163 AVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGC 196



>pir|T07840|T07840 ananain (EC 3.4.22.31) AN8 precursor -
           pineapple>gb:ACO9829_1745388 Ananas comosus mRNA for
           stem cysteine proteinase precursor, clone pAN8.
          Length = 356

 Score =  154 bits (389), Expect = 1e-36
 Identities = 79/181 (43%), Positives = 111/181 (61%), Gaps = 2/181 (1%)
 Frame = +1

Query: 43  QLILAAVLLLGAFASQATALDEEPS--MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV 216
           QL+   + L   +AS + A  +EPS  M++R E+WMV +GR YK++ EK +RF+IF+ NV
Sbjct: 6   QLVFLFLFLCVMWASPSAASADEPSDPMMKRFEEWMVEYGRVYKDNDEKMRRFQIFKNNV 65

Query: 217 KFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVP 396
             IE+FN     SY LG+ +F+D+TN EF A                     +  ++ VP
Sbjct: 66  NHIETFNSRNKDSYTLGINQFTDMTNNEFVAQYTGGISRPLNIEREPVVSFDDVDISAVP 125

Query: 397 EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYG 576
           + +DWR+ GAVT +KNQ  CG CWAF+A+A +E I +I+ G L  LSEQQ+LDC  K YG
Sbjct: 126 QSIDWRDYGAVTSVKNQNPCGACWAFAAIATVESIYKIKKGILEPLSEQQVLDC-AKGYG 184

Query: 577 C 579
           C
Sbjct: 185 C 185



>gb:OSJN00114_1695150 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0035O13, complete sequence.
          Length = 314

 Score =  153 bits (387), Expect = 2e-36
 Identities = 77/158 (48%), Positives = 102/158 (64%), Gaps = 4/158 (2%)
 Frame = +1

Query: 118 MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQ-SYKLGVKKFSDLTN 294
           M +RHE+WM  HGR+Y +DAEKA+R ++F  NV FIES N A +Q  + L   +F+DLTN
Sbjct: 1   MAQRHERWMAKHGRAYADDAEKARRLEVFRDNVAFIESVNAAASQHKFWLEENQFADLTN 60

Query: 295 EEFKATMLN-EGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWA 471
            EF+AT                     N S  ++P  +DWR KGAV  +K+QG CGCCWA
Sbjct: 61  AEFRATRTGLRPSSSRGNRAPTSFRYANVSTGDLPASVDWRGKGAVNPVKDQGDCGCCWA 120

Query: 472 FSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGC 579
           FSAVAAMEG  ++ TG+L+ LSEQQL+ C++K  + GC
Sbjct: 121 FSAVAAMEGAVKLATGKLVSLSEQQLVSCDVKGEDQGC 158



>gb:AY604196_1617470 Gossypium hirsutum putative cysteine protease
           (ccyp) mRNA, complete cds.
          Length = 344

 Score =  153 bits (387), Expect = 2e-36
 Identities = 86/187 (45%), Positives = 122/187 (65%), Gaps = 10/187 (5%)
 Frame = +1

Query: 49  ILAAVLLLGAFASQATALD----EEPSMLERHEKWMVHHGRSYKNDAE--KAKRFKIFEQ 210
           +  A++L   F+ Q   L     +E SM  RHE+WM  HGR Y ++ E  K KRF +F++
Sbjct: 8   LFVALVLSFCFSIQLAGLSRPLLDEDSM--RHEEWMSQHGRVYADEQEDHKNKRFNVFKE 65

Query: 211 NVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLN-EGXXXXXXXXXXXXXXXNESLA 387
           NV+ IE FN    +++KL + +F+DLTNEEF+A+    +G                E+++
Sbjct: 66  NVERIEEFNDG--KTFKLAINQFADLTNEEFRASYNGFKGPMVLSSQITKPTPFRYENVS 123

Query: 388 E-VPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL 564
             +P  +DWR+KGAVT +KNQG CGCCWAFSAVAA+EGITQI TG+L+ LSEQ+L+DC+ 
Sbjct: 124 SALPVSVDWRKKGAVTPVKNQGQCGCCWAFSAVAAIEGITQISTGKLISLSEQELVDCDT 183

Query: 565 K--NYGC 579
           K  ++GC
Sbjct: 184 KGIDHGC 190



>gb:AY017413_1558850 Nicotiana tabacum CPR1-like cysteine proteinase
           gene, complete cds.
          Length = 374

 Score =  153 bits (386), Expect = 2e-36
 Identities = 78/199 (39%), Positives = 123/199 (61%), Gaps = 7/199 (3%)
 Frame = +1

Query: 4   TNILSSMASNFDFQLILAAV-LLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAE 180
           T +L +++S+  + + ++ +      +A + T   +E  +  R+E W+  HGR+Y    E
Sbjct: 7   TTLLFALSSSLSYAIDMSIIDYKNNHYARKWTLQSDEDQVKNRYEMWLAEHGRAYNALGE 66

Query: 181 KAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXX 360
           K KRF+IF+ N++FIE  N +GN++YK+G+ +F+DLTNEE++   L  G           
Sbjct: 67  KEKRFEIFKDNLRFIEEHNNSGNRTYKVGLNQFADLTNEEYRTMYL--GTKSDARRRFVK 124

Query: 361 XXXXNESLAE-----VPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQL 525
               ++  A      +P  +DWR++GAV  IKNQG CG CWAFS VAA+ GI QI TG++
Sbjct: 125 SKNPSQRYASRPNELMPHSVDWRKRGAVAPIKNQGSCGSCWAFSTVAAVGGINQIVTGEM 184

Query: 526 MRLSEQQLLDCN-LKNYGC 579
           + LSEQ+L+DC+ ++N GC
Sbjct: 185 ITLSEQELVDCDRVQNSGC 203



>pir|T10503|T10503 fruit bromelain (EC 3.4.22.33) FB18 precursor -
           pineapple>gb:D14059_1674468 Ananas comosus mRNA for
           bromelain, complete cds.
          Length = 351

 Score =  153 bits (386), Expect = 2e-36
 Identities = 76/181 (41%), Positives = 115/181 (63%), Gaps = 2/181 (1%)
 Frame = +1

Query: 43  QLILAAVLLLGAFASQATALDEEPS--MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV 216
           QL+   + L   +AS + A  +EP+  M++R E+WM  +GR YK+D EK +RF+IF+ NV
Sbjct: 6   QLVFLFLFLCAMWASPSAASRDEPNDPMMKRFEEWMAEYGRVYKDDDEKMRRFQIFKNNV 65

Query: 217 KFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVP 396
           K IE+FN     SY LG+ +F+D+T  EF A                     + +++ VP
Sbjct: 66  KHIETFNSRNENSYTLGINQFTDMTKSEFVAQYTGV-SLPLNIEREPVVSFDDVNISAVP 124

Query: 397 EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYG 576
           + +DWR+ GAV ++KNQ  CG CW+F+A+A +EGI +I+TG L+ LSEQ++LDC + +YG
Sbjct: 125 QSIDWRDYGAVNEVKNQNPCGSCWSFAAIATVEGIYKIKTGYLVSLSEQEVLDCAV-SYG 183

Query: 577 C 579
           C
Sbjct: 184 C 184



>pir|T10514|T10514 probable stem bromelain (EC 3.4.22.32) precursor
           - pineapple>gb:D38532_1674559 Ananas comosus mRNA for
           FBSB precursor, complete cds.
          Length = 356

 Score =  152 bits (385), Expect = 3e-36
 Identities = 78/181 (43%), Positives = 111/181 (61%), Gaps = 2/181 (1%)
 Frame = +1

Query: 43  QLILAAVLLLGAFASQATALDEEPS--MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV 216
           Q++   + L   +AS + A  +EPS  M++R E+WMV +GR YK++ EK +RF+IF+ NV
Sbjct: 6   QVVFLFLFLCVMWASPSAASADEPSDPMMKRFEEWMVEYGRVYKDNDEKMRRFQIFKNNV 65

Query: 217 KFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVP 396
             IE+FN     SY LG+ +F+D+TN EF A                     +  ++ VP
Sbjct: 66  NHIETFNSRNENSYTLGINQFTDMTNNEFIAQYTGGISRPLNIEREPVVSFDDVDISAVP 125

Query: 397 EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYG 576
           + +DWR+ GAVT +KNQ  CG CWAF+A+A +E I +I+ G L  LSEQQ+LDC  K YG
Sbjct: 126 QSIDWRDYGAVTSVKNQNPCGACWAFAAIATVESIYKIKKGILEPLSEQQVLDC-AKGYG 184

Query: 577 C 579
           C
Sbjct: 185 C 185



>gb:OSJN00046_1693820 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0005B05, complete sequence.
          Length = 323

 Score =  152 bits (384), Expect = 4e-36
 Identities = 75/149 (50%), Positives = 99/149 (66%)
 Frame = +1

Query: 49  ILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIE 228
           IL  + L  A  + A  L ++ +M  RHE+WM  +GR YK+DAEKA+RF++F+ NV FIE
Sbjct: 11  ILGCLCLCSAVLA-ARELSDDAAMAARHERWMAQYGRMYKDDAEKARRFEVFKANVAFIE 69

Query: 229 SFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLD 408
           SFN AGN  + LGV +F+DLTN+EF++T  N+G               N ++  +P  +D
Sbjct: 70  SFN-AGNHKFWLGVNQFADLTNDEFRSTKTNKGFIPSTTRVPTGFRNENVNIDALPATMD 128

Query: 409 WREKGAVTDIKNQGYCGCCWAFSAVAAME 495
           WR KG VT IK+QG CGCCWAFSAVAAME
Sbjct: 129 WRTKGVVTPIKDQGQCGCCWAFSAVAAME 157



>gb:AY563270_1615020 Bromelia fastuosa fastuosain precursor mRNA,
           partial cds.
          Length = 324

 Score =  152 bits (384), Expect = 4e-36
 Identities = 76/159 (47%), Positives = 103/159 (64%), Gaps = 2/159 (1%)
 Frame = +1

Query: 109 EPS--MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFS 282
           EPS  M+ER E+WM  +GR Y ++AEK +RF+IF+ NV  IE+FN     SY LGV +F+
Sbjct: 1   EPSDPMMERFEEWMAEYGRVYNDNAEKMRRFQIFKNNVNHIETFNNRSGNSYTLGVNQFT 60

Query: 283 DLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGC 462
           D+TN EF A                     +  ++ VP+ +DWR+ GAVT +KNQG CG 
Sbjct: 61  DMTNNEFLARYTG-ASLPLNIERDPVVSFDDVDISAVPQSIDWRDYGAVTSVKNQGSCGS 119

Query: 463 CWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           CWAFSA+A +EGI +I+ G L+ LSEQ++LDC L +YGC
Sbjct: 120 CWAFSAIATVEGIYKIKAGNLISLSEQEVLDCAL-SYGC 157



>pir|T10501|T10501 fruit bromelain (EC 3.4.22.33) FB13 precursor -
           pineapple>gb:D14058_1674467 Ananas comosus mRNA for
           bromelain, complete cds.>gb:D38531_1674558 Ananas
           comosus mRNA for FB31 precursor (FB13 precursor),
           complete cds.
          Length = 352

 Score =  152 bits (384), Expect = 4e-36
 Identities = 78/181 (43%), Positives = 113/181 (62%), Gaps = 2/181 (1%)
 Frame = +1

Query: 43  QLILAAVLLLGAFASQATALDEEPS--MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV 216
           QL+   + L   +AS + A  +EPS  M++R E+WM  +GR YK++ EK +RF+IF+ NV
Sbjct: 6   QLVFLFLFLCVMWASPSAASRDEPSDPMMKRFEEWMAEYGRVYKDNDEKMRRFQIFKNNV 65

Query: 217 KFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVP 396
             IE+FN     SY LG+ KF+D+TN EF A                     + +++ V 
Sbjct: 66  NHIETFNNRNGNSYTLGINKFTDMTNNEFVAQYTGGISRPLNIEKEPVVSFDDVNISAVG 125

Query: 397 EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYG 576
           + +DWR+ GAVT++K+Q  CG CWAFSA+A +EGI +I TG L+ LSEQ++LDC + N G
Sbjct: 126 QSIDWRDYGAVTEVKDQNPCGSCWAFSAIATVEGIYKIVTGYLVSLSEQEVLDCAVSN-G 184

Query: 577 C 579
           C
Sbjct: 185 C 185



>gb:AF089848_1767322 Brassica napus senescence-specific cysteine
           protease (SAG12-1) gene, complete cds.
          Length = 346

 Score =  152 bits (383), Expect = 5e-36
 Identities = 79/185 (42%), Positives = 111/185 (60%), Gaps = 8/185 (4%)
 Frame = +1

Query: 49  ILAAVLLLGAFASQATA---LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK 219
           I   V L+ +F    T    LD+E  M ++H++WM  HGR+Y +  EK  R+ +F++NV+
Sbjct: 8   IFLIVSLVSSFCFSTTLSRLLDDELIMQKKHDEWMAEHGRTYADMNEKNNRYVVFKRNVE 67

Query: 220 FIESFNKA-GNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXX----NESL 384
            IE  N     +++KL V +F+DLTN+EF+                          N   
Sbjct: 68  RIERLNNVPAGRTFKLAVNQFADLTNDEFRFMYTGYKGDFVLFSQSQTKSTSFRYQNVFF 127

Query: 385 AEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL 564
             +P  +DWR+KGAVT IKNQG CGCCWAFSAVAA+EG TQI+ G+L+ LSEQQL+DC+ 
Sbjct: 128 GALPIAVDWRKKGAVTPIKNQGSCGCCWAFSAVAAIEGATQIKKGKLISLSEQQLVDCDT 187

Query: 565 KNYGC 579
            ++GC
Sbjct: 188 NDFGC 192



>gb:AF454956_1801124 Brassica oleracea senescence-associated
           cysteine protease (CP1) mRNA, partial cds.
          Length = 445

 Score =  151 bits (382), Expect = 6e-36
 Identities = 78/181 (43%), Positives = 111/181 (61%), Gaps = 3/181 (1%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEE--PSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK 219
           L+   VLL  +  S  TA  +   P  ++  E+W+V + ++Y    EK KRF+IF  N+K
Sbjct: 7   LVTLLVLLASSSLSGVTAKADHRNPEEVKMFERWLVENHKNYNGLGEKDKRFEIFMDNLK 66

Query: 220 FIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPE 399
           F++  N   NQSY+LG+ +F+DLTNEEF+A  L                  N    ++P+
Sbjct: 67  FVQEHNSVPNQSYELGLTRFADLTNEEFRAIYLRSKMERTRDSVKSERYLHNVG-DKLPD 125

Query: 400 YLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYG 576
            +DWR KGAV  +K+QG CG CWAFSA+ A+EGI QI+TG+L+ LSEQ+L+DC+   N G
Sbjct: 126 EVDWRAKGAVVPVKDQGSCGSCWAFSAIGAVEGINQIKTGELVSLSEQELVDCDTSYNNG 185

Query: 577 C 579
           C
Sbjct: 186 C 186



>gb:BT004146_1637245 Arabidopsis thaliana clone RAFL16-01-H24
           (R50046) putative cysteine proteinase (At1g29090) mRNA,
           complete cds.
          Length = 355

 Score =  151 bits (381), Expect = 8e-36
 Identities = 82/199 (41%), Positives = 121/199 (60%), Gaps = 8/199 (4%)
 Frame = +1

Query: 7   NILSSMASNFDFQLILAAVLLLGAFASQATA--LDEEPSMLERHEKWMVHHGRSYKNDAE 180
           + +++  ++  F L+   +L +    SQAT+     EP + E H++WM    R Y ++ E
Sbjct: 4   SFINNKMTSILFMLVSLTILSMNLKVSQATSRVTFHEPIVAEHHQQWMTRFSRVYSDELE 63

Query: 181 KAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKAT---MLNEGXXXXXXXX 351
           K  RF +F++N+KFIE FNK G+++YKLGV +F+D T EEF AT   +            
Sbjct: 64  KQMRFDVFKKNLKFIEKFNKKGDRTYKLGVNEFADWTREEFIATHTGLKGVNGIPSSEFV 123

Query: 352 XXXXXXXNESLAEVP--EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQL 525
                  N ++++V   E  DWR +GAVT +K QG CGCCWAFS+VAA+EG+T+I    L
Sbjct: 124 DEMIPSWNWNVSDVAGRETKDWRYEGAVTPVKYQGQCGCCWAFSSVAAVEGLTKIVGNNL 183

Query: 526 MRLSEQQLLDCNL-KNYGC 579
           + LSEQQLLDC+  ++ GC
Sbjct: 184 VSLSEQQLLDCDRERDNGC 202



>gb:AF259983_1781462 Ipomoea batatas putative cysteine protease
           mRNA, complete cds.
          Length = 462

 Score =  150 bits (379), Expect = 1e-35
 Identities = 76/163 (46%), Positives = 106/163 (65%), Gaps = 4/163 (2%)
 Frame = +1

Query: 103 DEEPSMLERHEKWMVHHGRSYKN-DAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKF 279
           DEE   L  +E W+V HG+SY     EK KRF+IF+ N+++I+  N  G++SYKLG+ +F
Sbjct: 42  DEEVMAL--YESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSRGDRSYKLGLNRF 99

Query: 280 SDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLA--EVPEYLDWREKGAVTDIKNQGY 453
           +DLTNEE+++T L                      A   +P+ +DWREKGAV ++K+QG 
Sbjct: 100 ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKAGGSLPDSIDWREKGAVAEVKDQGS 159

Query: 454 CGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
           CG CWAFS +AA+EGI QI TG+L+ LSEQ+L+DC+   N GC
Sbjct: 160 CGSCWAFSTIAAVEGINQIVTGELISLSEQELVDCDTSYNEGC 202



>gb:D38533_1674560 Ananas comosus mRNA for FB22 precursor, partial
           cds.
          Length = 340

 Score =  150 bits (378), Expect = 2e-35
 Identities = 78/181 (43%), Positives = 113/181 (62%), Gaps = 2/181 (1%)
 Frame = +1

Query: 43  QLILAAVLLLGAFASQATALDEEPS--MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV 216
           QL+   + L   +AS + A  +EPS  M++R E+WM  +GR YK++ EK +RF+IF+ NV
Sbjct: 6   QLVFLFLFLCVMWASPSAASRDEPSDPMMKRFEEWMAEYGRVYKDNDEKMRRFQIFKNNV 65

Query: 217 KFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVP 396
             IE+FN     SY LG+ KF+D+TN EF  T                    + +++ V 
Sbjct: 66  NHIETFNNRNGNSYTLGINKFTDMTNNEF-VTQYTGVSLPLNFKREPVVSFDDVNISAVG 124

Query: 397 EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYG 576
           + +DWR+ GAVT++K+Q  CG CWAFSA+A +EGI +I TG L+ LSEQ++LDC + N G
Sbjct: 125 QSIDWRDYGAVTEVKDQNPCGSCWAFSAIATVEGIYKIVTGYLVSLSEQEVLDCAVSN-G 183

Query: 577 C 579
           C
Sbjct: 184 C 184



>pir|T10516|T10516 fruit bromelain (EC 3.4.22.33) FB22 precursor -
           pineapple  (fragment)
          Length = 340

 Score =  150 bits (378), Expect = 2e-35
 Identities = 78/181 (43%), Positives = 113/181 (62%), Gaps = 2/181 (1%)
 Frame = +1

Query: 43  QLILAAVLLLGAFASQATALDEEPS--MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV 216
           QL+   + L   +AS + A  +EPS  M++R E+WM  +GR YK++ EK +RF+IF+ NV
Sbjct: 6   QLVFLFLFLCVMWASPSAASRDEPSDPMMKRFEEWMAEYGRVYKDNDEKMRRFQIFKNNV 65

Query: 217 KFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVP 396
             IE+FN     SY LG+ KF+D+TN EF  T                    + +++ V 
Sbjct: 66  NHIETFNNRNGNSYTLGINKFTDMTNNEF-VTQYTGVSLPLNFKREPVVSFDDVNISAVG 124

Query: 397 EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYG 576
           + +DWR+ GAVT++K+Q  CG CWAFSA+A +EGI +I TG L+ LSEQ++LDC + N G
Sbjct: 125 QSIDWRDYGAVTEVKDQNPCGSCWAFSAIATVEGIYKIVTGYLVSLSEQEVLDCAVSN-G 183

Query: 577 C 579
           C
Sbjct: 184 C 184



>gb:AB109190_1526795 Helianthus annuus scp5 mRNA for cysteine
           protease-5, complete cds.
          Length = 365

 Score =  149 bits (377), Expect = 2e-35
 Identities = 78/186 (41%), Positives = 112/186 (60%), Gaps = 6/186 (3%)
 Frame = +1

Query: 40  FQLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK 219
           + L+L  +LL   + +  T  DEE  +   +E W+  HG++Y    EK  RF+IF  N+K
Sbjct: 8   YALLLTCLLLTITYVTSNTRTDEE--VRNTYELWLARHGKTYNALGEKESRFRIFADNLK 65

Query: 220 FIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAE--- 390
           FI+  N +GN+SYK+G+ +F+DLTNEE+++  L                  +   A    
Sbjct: 66  FIDEHNLSGNRSYKVGLNQFADLTNEEYRSMYLGTKVDPYRRIAKMQRGEISRRYAVQEN 125

Query: 391 --VPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL 564
              P  +DWRE+GAV+ +KNQG CG CWAFS VA++EGI +I TG L+ LSEQ+L+DC+ 
Sbjct: 126 EMFPAKVDWRERGAVSPVKNQGGCGSCWAFSTVASVEGINKIVTGDLISLSEQELVDCDN 185

Query: 565 K-NYGC 579
           K N GC
Sbjct: 186 KYNSGC 191



>gb:AB016870_1512880 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K15I22.>gb:AY040073_1560570 Arabidopsis
           thaliana putative senescence-specific cysteine protease
           SAG12 (At5g45890) mRNA, complete
           cds.>gb:AF370131_1792019 Arabidopsis thaliana putative
           senescence-specific cysteine protease SAG12 (At5g45890)
           mRNA, complete cds.
          Length = 346

 Score =  149 bits (376), Expect = 3e-35
 Identities = 75/165 (45%), Positives = 102/165 (61%), Gaps = 5/165 (3%)
 Frame = +1

Query: 100 LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKA-GNQSYKLGVKK 276
           LD E  M +RH +WM  HGR Y +  E+  R+ +F+ NV+ IE  N     +++KL V +
Sbjct: 28  LDNELIMQKRHIEWMTKHGRVYADVKEENNRYVVFKNNVERIEHLNSIPAGRTFKLAVNQ 87

Query: 277 FSDLTNEEFKATMLN----EGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKN 444
           F+DLTN+EF++                         N S   +P  +DWR+KGAVT IKN
Sbjct: 88  FADLTNDEFRSMYTGFKGVSALSSQSQTKMSPFRYQNVSSGALPVSVDWRKKGAVTPIKN 147

Query: 445 QGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           QG CGCCWAFSAVAA+EG TQI+ G+L+ LSEQQL+DC+  ++GC
Sbjct: 148 QGSCGCCWAFSAVAAIEGATQIKKGKLISLSEQQLVDCDTNDFGC 192



>sp|P80884|ANAN_ANACO Ananain precursor (EC
           3.4.22.31).>pir|T07839|T07839 ananain (EC 3.4.22.31)
           precursor - pineapple>gb:ACAJ2477_1745318 Ananas comosus
           mRNA for ananain precursor, complete cds.
          Length = 345

 Score =  149 bits (376), Expect = 3e-35
 Identities = 76/181 (41%), Positives = 112/181 (61%), Gaps = 2/181 (1%)
 Frame = +1

Query: 43  QLILAAVLLLGAFASQATALDEEPS--MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV 216
           QL+   + L   +AS + A  +EPS  M+++ E+WM  +GR YK++ EK  RF+IF+ NV
Sbjct: 6   QLVFLFLFLCVMWASPSAASCDEPSDPMMKQFEEWMAEYGRVYKDNDEKMLRFQIFKNNV 65

Query: 217 KFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVP 396
             IE+FN     SY LG+ +F+D+TN EF A                     +  ++ VP
Sbjct: 66  NHIETFNNRNGNSYTLGINQFTDMTNNEFVAQYTGLSLPLNIKREPVVSFD-DVDISSVP 124

Query: 397 EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYG 576
           + +DWR+ GAVT +KNQG CG CWAF+++A +E I +I+ G L+ LSEQQ+LDC + +YG
Sbjct: 125 QSIDWRDSGAVTSVKNQGRCGSCWAFASIATVESIYKIKRGNLVSLSEQQVLDCAV-SYG 183

Query: 577 C 579
           C
Sbjct: 184 C 184



>pir|T06416|T06416 cysteine proteinase (EC 3.4.22.-) precursor -
           tomato>gb:LEAJ3137_1684222 Lycopersicon esculentum mRNA
           for cysteine protease CYP1, complete
           CDS.>gb:AF172856_1774434 Lycopersicon esculentum
           cysteine protease TDI-65 (tdi-65) mRNA, complete cds.
          Length = 466

 Score =  148 bits (374), Expect = 5e-35
 Identities = 78/164 (47%), Positives = 104/164 (63%), Gaps = 5/164 (3%)
 Frame = +1

Query: 103 DEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFS 282
           D+E S L  +E W++ HG+SY    EK KRF+IF+ N+++I+  N   NQSYKLG+ KF+
Sbjct: 42  DDEVSAL--YESWLIEHGKSYNALGEKDKRFQIFKDNLRYIDEQNSVPNQSYKLGLTKFA 99

Query: 283 DLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEV----PEYLDWREKGAVTDIKNQG 450
           DLTNEE+++  L  G               +  L +V    PE +DWREKG +  +K+QG
Sbjct: 100 DLTNEEYRSIYL--GTKSSGDRKKLSKNKSDRYLPKVGDSLPESIDWREKGVLVGVKDQG 157

Query: 451 YCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
            CG CWAFSAVAAME I  I TG L+ LSEQ+L+DC+   N GC
Sbjct: 158 SCGSCWAFSAVAAMESINAIVTGNLISLSEQELVDCDRSYNEGC 201



>gb:STU245924_1723006 Solanum tuberosum mRNA for cysteine protease
           (cyp gene).
          Length = 466

 Score =  148 bits (373), Expect = 7e-35
 Identities = 78/164 (47%), Positives = 104/164 (63%), Gaps = 5/164 (3%)
 Frame = +1

Query: 103 DEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFS 282
           D+E S L  +E W++ HG+SY    EK KRF+IF+ N+K+I+  N   NQSYKLG+ KF+
Sbjct: 42  DDEVSAL--YESWLIEHGKSYNALGEKDKRFQIFKDNLKYIDEQNSVPNQSYKLGLTKFA 99

Query: 283 DLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEV----PEYLDWREKGAVTDIKNQG 450
           DLTNEE+++  L  G               +  L +V    PE +DWR+KG +  +K+QG
Sbjct: 100 DLTNEEYRSIYL--GTKSSGDRRKLSKNKSDRYLPKVGDSLPESVDWRDKGVLVGVKDQG 157

Query: 451 YCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
            CG CWAFSAVAAME I  I TG L+ LSEQ+L+DC+   N GC
Sbjct: 158 SCGSCWAFSAVAAMESINAIVTGNLISLSEQELVDCDKSYNEGC 201



>gb:AY867764_1631390 Pinus taeda isolate FBRC3 cysteine protease
           gene, partial cds.>gb:AY867774_1631400 Pinus taeda
           isolate FBRC12 cysteine protease gene, partial
           cds.>gb:AY867780_1631406 Pinus taeda isolate FBRC10
           cysteine protease gene, partial cds.>gb:AY867786_1631412
           Pinus taeda isolate FBRC11 cysteine protease gene,
           partial cds.>gb:AY867789_1631415 Pinus taeda isolate
           FBRC4 cysteine protease gene, partial cds.
          Length = 193

 Score =  148 bits (373), Expect = 7e-35
 Identities = 82/190 (43%), Positives = 113/190 (59%), Gaps = 12/190 (6%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALD----------EEPSMLERHEKWMVHHGRSYKNDAEKAKRF 195
           L+  A+L + A A  A+  D          E+ +++E +E W+  H ++Y    EK KRF
Sbjct: 4   LLFFALLAMLAMAGNASRADFSIISNKDLREDDAIMELYELWLAEHKKAYNGLDEKQKRF 63

Query: 196 KIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXN 375
            +F+ N  +I   N+ GNQSYKLG+ +F+DL++EEFKAT L                   
Sbjct: 64  TVFKDNFLYIHEHNQ-GNQSYKLGLNQFADLSHEEFKATYLGAKLDTKKRLLRSPSPRYQ 122

Query: 376 ESLAE-VPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLL 552
            S  E +P+ +DWREKGAV  +K+QG CG CWAFS VAA+EGI QI TG L+ LSEQ+L+
Sbjct: 123 YSDGEDLPKSIDWREKGAVAPVKDQGACGSCWAFSTVAAVEGINQIVTGDLISLSEQELV 182

Query: 553 DCNLK-NYGC 579
           DC+   N GC
Sbjct: 183 DCDTSYNQGC 192



>gb:AY867761_1631387 Pinus taeda isolate FBRC16 cysteine protease
           gene, partial cds.>gb:AY867763_1631389 Pinus taeda
           isolate FBRC2 cysteine protease gene, partial
           cds.>gb:AY867765_1631391 Pinus taeda isolate FBRC9
           cysteine protease gene, partial cds.>gb:AY867775_1631401
           Pinus taeda isolate FBRC23 cysteine protease gene,
           partial cds.>gb:AY867781_1631407 Pinus taeda isolate
           FBRC28 cysteine protease gene, partial
           cds.>gb:AY867784_1631410 Pinus taeda isolate FBRC30
           cysteine protease gene, partial cds.>gb:AY867788_1631414
           Pinus taeda isolate FBRC32 cysteine protease gene,
           partial cds.>gb:AY867790_1631416 Pinus taeda isolate
           FBRC13 cysteine protease gene, partial cds.
          Length = 193

 Score =  148 bits (373), Expect = 7e-35
 Identities = 81/190 (42%), Positives = 113/190 (59%), Gaps = 12/190 (6%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALD----------EEPSMLERHEKWMVHHGRSYKNDAEKAKRF 195
           L+  A+L + A A  A+  D          E+ +++E +E W+  H ++Y    EK KRF
Sbjct: 4   LLFFALLAMSAMAGSASRADFSIISNKDLREDDAIMELYELWLAEHKKAYNGLDEKQKRF 63

Query: 196 KIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXN 375
            +F+ N  +I   N+ GN+SYKLG+ +F+DL++EEFKAT L                   
Sbjct: 64  TVFKDNFLYIHEHNQ-GNRSYKLGLNQFADLSHEEFKATYLGAKLDTKKRLLRSPSPRYQ 122

Query: 376 ESLAE-VPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLL 552
            S  E +P+ +DWREKGAV  +K+QG CG CWAFS VAA+EGI QI TG L+ LSEQ+L+
Sbjct: 123 YSDGEDLPKSIDWREKGAVAPVKDQGACGSCWAFSTVAAVEGINQIVTGDLISLSEQELV 182

Query: 553 DCNLK-NYGC 579
           DC+   N GC
Sbjct: 183 DCDTSYNQGC 192



>gb:AY867769_1631395 Pinus taeda isolate FBRC5 cysteine protease
           gene, partial cds.>gb:AY867770_1631396 Pinus taeda
           isolate FBRC18 cysteine protease gene, partial
           cds.>gb:AY867782_1631408 Pinus taeda isolate FBRC29
           cysteine protease gene, partial cds.>gb:AY867783_1631409
           Pinus taeda isolate FBRC33 cysteine protease gene,
           partial cds.>gb:AY867785_1631411 Pinus taeda isolate
           FBRC31 cysteine protease gene, partial cds.
          Length = 193

 Score =  147 bits (372), Expect = 9e-35
 Identities = 81/190 (42%), Positives = 113/190 (59%), Gaps = 12/190 (6%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALD----------EEPSMLERHEKWMVHHGRSYKNDAEKAKRF 195
           L+  A+L + A A  A+  D          E+ +++E +E W+  H ++Y    EK KRF
Sbjct: 4   LLFFALLAMSAMAGSASRADFSIISNKDLREDDAIMELYELWVAEHKKAYNGLDEKQKRF 63

Query: 196 KIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXN 375
            +F+ N  +I   N+ GN+SYKLG+ +F+DL++EEFKAT L                   
Sbjct: 64  TVFKDNFLYIHEHNQ-GNRSYKLGLNQFADLSHEEFKATYLGAKLDTKKRLLRSPSPRYQ 122

Query: 376 ESLAE-VPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLL 552
            S  E +P+ +DWREKGAV  +K+QG CG CWAFS VAA+EGI QI TG L+ LSEQ+L+
Sbjct: 123 YSDGEDLPKSIDWREKGAVAPVKDQGACGSCWAFSTVAAVEGINQIVTGDLISLSEQELV 182

Query: 553 DCNLK-NYGC 579
           DC+   N GC
Sbjct: 183 DCDTSYNQGC 192



>gb:AY867762_1631388 Pinus taeda isolate FBRC1 cysteine protease
           gene, partial cds.
          Length = 192

 Score =  147 bits (371), Expect = 1e-34
 Identities = 81/190 (42%), Positives = 114/190 (60%), Gaps = 12/190 (6%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALD----------EEPSMLERHEKWMVHHGRSYKNDAEKAKRF 195
           ++L A+L + A A  A+  D          E+ +++E +E W+  H ++Y    EK KRF
Sbjct: 3   ILLFALLAMLAMAGNASRADFSIISNKDLREDDAIMELYELWLAEHKKAYNGLDEKQKRF 62

Query: 196 KIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXN 375
            +F+ N  +I   N+ GN+SYKLG+ +F+DL++EEFKAT L                   
Sbjct: 63  TVFKDNFLYIHEHNQ-GNRSYKLGLNQFADLSHEEFKATYLGAKLDTKKRLLRSPSPRYQ 121

Query: 376 ESLAE-VPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLL 552
            S  E +P+ +DWREKGAV  +K+QG CG CWAFS VAA+EGI QI TG L+ LSEQ+L+
Sbjct: 122 YSDGEDLPKSIDWREKGAVAPVKDQGACGSCWAFSTVAAVEGINQIVTGDLISLSEQELV 181

Query: 553 DCNLK-NYGC 579
           DC+   N GC
Sbjct: 182 DCDTSYNQGC 191



>gb:ATU37336_1556938 Arabidopsis thaliana senescence-specific
           protein (SAG12) gene, promoter region and complete cds.
          Length = 346

 Score =  147 bits (371), Expect = 1e-34
 Identities = 75/165 (45%), Positives = 101/165 (61%), Gaps = 5/165 (3%)
 Frame = +1

Query: 100 LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKA-GNQSYKLGVKK 276
           LD E  M +RH +WM  HGR Y +  E+  R+ +F+ NV+ IE  N     +++KL V +
Sbjct: 28  LDNELIMQKRHIEWMTKHGRVYADVKEENNRYVVFKNNVERIEHLNSIPAGRTFKLAVNQ 87

Query: 277 FSDLTNEEFKATMLN----EGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKN 444
           F+DLTN+EF +                         N S   +P  +DWR+KGAVT IKN
Sbjct: 88  FADLTNDEFCSMYTGFKGVSALSSQSQTKMSPFRYQNVSSGALPVSVDWRKKGAVTPIKN 147

Query: 445 QGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           QG CGCCWAFSAVAA+EG TQI+ G+L+ LSEQQL+DC+  ++GC
Sbjct: 148 QGSCGCCWAFSAVAAIEGATQIKKGKLISLSEQQLVDCDTNDFGC 192



>pir|F84672|F84672 probable cysteine proteinase [imported] -
           Arabidopsis thaliana>gb:AC006232_1533749 Arabidopsis
           thaliana chromosome 2 clone F10A12 map B68, complete
           sequence.>gb:AY064033_1565971 Arabidopsis thaliana
           putative cysteine proteinase (At2g27420) mRNA, complete
           cds.>gb:AY096388_1575934 Arabidopsis thaliana putative
           cysteine proteinase (At2g27420) mRNA, complete cds.
          Length = 348

 Score =  147 bits (371), Expect = 1e-34
 Identities = 78/186 (41%), Positives = 112/186 (60%), Gaps = 13/186 (6%)
 Frame = +1

Query: 61  VLLLGAFASQATALDE------EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF 222
           + +L  F S  T+L        E S +E+HE+WM    R Y ++ EK  RF IF++N++F
Sbjct: 6   IFILTIFLSYRTSLATSRGSLFEASAIEKHEQWMARFNRVYSDETEKRNRFNIFKKNLEF 65

Query: 223 IESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNE------SL 384
           +++FN     +YK+ + +FSDLT+EEF+AT                    N       ++
Sbjct: 66  VQNFNMNNKITYKVDINEFSDLTDEEFRATHTGLVVPEAITRISTLSSGKNTVPFRYGNV 125

Query: 385 AEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL 564
           ++  E +DWR++GAVT +K QG CG CWAFSAVAA+EGIT+I  G+L+ LSEQQLLDC+ 
Sbjct: 126 SDNGESMDWRQEGAVTPVKYQGRCGGCWAFSAVAAVEGITKITKGELVSLSEQQLLDCDR 185

Query: 565 K-NYGC 579
             N GC
Sbjct: 186 DYNQGC 191



>pir|C86413|C86413 cysteine proteinase (EC 3.4.22.-) [similarity] -
           Arabidopsis thaliana>gb:AE005172_891763 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC021043_1538673 Arabidopsis thaliana
           chromosome I BAC F28N24 genomic sequence, complete
           sequence.
          Length = 346

 Score =  147 bits (370), Expect = 2e-34
 Identities = 80/189 (42%), Positives = 115/189 (60%), Gaps = 8/189 (4%)
 Frame = +1

Query: 37  DFQLILAAVLLLGAFASQAT---ALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFE 207
           +F  ++  +  +    S+AT   AL +  S+++ H++WM+   R Y ++ EK  R ++  
Sbjct: 5   EFVCVVLTIFFMDLKISEATSRVALYKPSSIVDYHQQWMIQFSRVYDDEFEKQLRLQVLT 64

Query: 208 QNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKAT---MLNEGXXXXXXXXXXXXXXXNE 378
           +N+KFIESFN  GNQSYKLGV +F+D T EEF AT   +                   N 
Sbjct: 65  ENLKFIESFNNMGNQSYKLGVNEFTDWTKEEFLATYTGLRGVNVTSPFEVVNETKPAWNW 124

Query: 379 SLAEV-PEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLD 555
           ++++V     DWR +GAVT +K+QG CG CWAFSA+AA+EG+T+I  G L+ LSEQQLLD
Sbjct: 125 TVSDVLGTNKDWRNEGAVTPVKSQGECGGCWAFSAIAAVEGLTKIARGNLISLSEQQLLD 184

Query: 556 CNL-KNYGC 579
           C   +N GC
Sbjct: 185 CTREQNNGC 193



>sp|P05994|PAP4_CARPA Papaya proteinase IV precursor (EC 3.4.22.25)
           (PPIV) (Papaya peptidase B) (Glycyl
           endopeptidase).>pir|T09798|T09798 glycyl endopeptidase
           (EC 3.4.22.25) - papaya>gb:CPPIVM_1648683 C.papaya
           proteinase IV mRNA.
          Length = 348

 Score =  147 bits (370), Expect = 2e-34
 Identities = 70/154 (45%), Positives = 101/154 (65%)
 Frame = +1

Query: 118 MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNE 297
           +++    WM+ H ++YKN  EK  RF+IF+ N+K+I+  NK  N  Y LG+ +FSDL+N+
Sbjct: 44  LIQLFNSWMLKHNKNYKNVDEKLYRFEIFKDNLKYIDERNKMIN-GYWLGLNEFSDLSND 102

Query: 298 EFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFS 477
           EFK   +                  NE + ++PE +DWR KGAVT +K+QGYC  CWAFS
Sbjct: 103 EFKEKYVGS-LPEDYTNQPYDEEFVNEDIVDLPESVDWRAKGAVTPVKHQGYCESCWAFS 161

Query: 478 AVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
            VA +EGI +I+TG L+ LSEQ+L+DC+ ++YGC
Sbjct: 162 TVATVEGINKIKTGNLVELSEQELVDCDKQSYGC 195



>gb:AY867766_1631392 Pinus taeda isolate FBRC21 cysteine protease
           gene, partial cds.
          Length = 193

 Score =  146 bits (369), Expect = 2e-34
 Identities = 81/190 (42%), Positives = 113/190 (59%), Gaps = 12/190 (6%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALD----------EEPSMLERHEKWMVHHGRSYKNDAEKAKRF 195
           L+  A+L + A A  A+  D          E+ +++E +E W+  H ++Y    EK KRF
Sbjct: 4   LLFFALLAMLAMAGNASRADFSIISNKDLREDDAIMELYELWLAEHKKAYNGLDEKQKRF 63

Query: 196 KIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXN 375
            +F+ N  +I   N+ GN+SYKLG+ +F+DL++EEFKAT L                   
Sbjct: 64  TVFKDNFLYIHEHNQ-GNRSYKLGLNQFADLSHEEFKATYLGAKLDTKKRLLRSPSPRYQ 122

Query: 376 ESLAE-VPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLL 552
            S  E +P+ +DWREKGAV  +K+QG CG CWAFS VAA+EGI QI TG L+ LSEQ+L+
Sbjct: 123 YSDGEDLPKSIDWREKGAVVPVKDQGACGSCWAFSTVAAVEGINQIVTGDLISLSEQELV 182

Query: 553 DCNLK-NYGC 579
           DC+   N GC
Sbjct: 183 DCDTSYNQGC 192



>gb:AY867759_1631385 Pinus taeda isolate FBRC14 cysteine protease
           gene, partial cds.>gb:AY867760_1631386 Pinus taeda
           isolate FBRC15 cysteine protease gene, partial
           cds.>gb:AY867767_1631393 Pinus taeda isolate FBRC17
           cysteine protease gene, partial cds.>gb:AY867768_1631394
           Pinus taeda isolate FBRC22 cysteine protease gene,
           partial cds.>gb:AY867771_1631397 Pinus taeda isolate
           FBRC6 cysteine protease gene, partial
           cds.>gb:AY867772_1631398 Pinus taeda isolate FBRC7
           cysteine protease gene, partial cds.>gb:AY867773_1631399
           Pinus taeda isolate FBRC20 cysteine protease gene,
           partial cds.>gb:AY867776_1631402 Pinus taeda isolate
           FBRC24 cysteine protease gene, partial
           cds.>gb:AY867777_1631403 Pinus taeda isolate FBRC25
           cysteine protease gene, partial cds.>gb:AY867778_1631404
           Pinus taeda isolate FBRC26 cysteine protease gene,
           partial cds.>gb:AY867779_1631405 Pinus taeda isolate
           FBRC27 cysteine protease gene, partial
           cds.>gb:AY867787_1631413 Pinus taeda isolate FBRC19
           cysteine protease gene, partial cds.
          Length = 193

 Score =  146 bits (369), Expect = 2e-34
 Identities = 81/190 (42%), Positives = 113/190 (59%), Gaps = 12/190 (6%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALD----------EEPSMLERHEKWMVHHGRSYKNDAEKAKRF 195
           L+  A+L + A A  A+  D          E+ +++E +E W+  H ++Y    EK KRF
Sbjct: 4   LLFFALLAMLAMAGNASRADFSIISNKDLREDDAIMELYELWLAEHKKAYNGLDEKQKRF 63

Query: 196 KIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXN 375
            +F+ N  +I   N+ GN+SYKLG+ +F+DL++EEFKAT L                   
Sbjct: 64  TVFKDNFLYIHEHNQ-GNRSYKLGLNQFADLSHEEFKATYLGAKLDTKKRLLRSPSPRYQ 122

Query: 376 ESLAE-VPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLL 552
            S  E +P+ +DWREKGAV  +K+QG CG CWAFS VAA+EGI QI TG L+ LSEQ+L+
Sbjct: 123 YSDGEDLPKSIDWREKGAVAPVKDQGACGSCWAFSTVAAVEGINQIVTGDLISLSEQELV 182

Query: 553 DCNLK-NYGC 579
           DC+   N GC
Sbjct: 183 DCDTSYNQGC 192



>pir|JN0634|JN0634 caricain (EC 3.4.22.30) II precursor -
           papaya>gb:CPPPOII_1648687 C.papaya mRNA for papaya
           proteinase omega.
          Length = 367

 Score =  146 bits (369), Expect = 2e-34
 Identities = 67/154 (43%), Positives = 102/154 (66%)
 Frame = +1

Query: 118 MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNE 297
           +++    WM++H + Y+N  EK  RF+IF+ N+ +I+  NK  N SY+LG+ +F+DL+N+
Sbjct: 44  LIQLFNSWMLNHNKFYENVDEKLYRFEIFKDNLNYIDETNKKNN-SYRLGLNEFADLSND 102

Query: 298 EFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFS 477
           EF    +                  NE +  +PE +DWR+KGAVT +++QG CG CWAFS
Sbjct: 103 EFNEKYVGS-LIDATIEQSYDEEFINEDIVNLPENVDWRKKGAVTPVRHQGSCGSCWAFS 161

Query: 478 AVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           AVA +EGI +IRTG+L+ LSEQ+L+DC  +++GC
Sbjct: 162 AVATVEGINKIRTGKLVELSEQELVDCERRSHGC 195



>gb:AF089849_1767323 Brassica napus senescence-specific cysteine
           protease (SAG12-2) gene, complete cds.
          Length = 344

 Score =  146 bits (368), Expect = 3e-34
 Identities = 78/193 (40%), Positives = 113/193 (58%), Gaps = 3/193 (1%)
 Frame = +1

Query: 10  ILSSMASNFDFQLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAK 189
           ++ S+ S+F   + L+  LL            +E +M +RH +WM  HGR Y +  EK  
Sbjct: 10  LIVSLVSSFSLSITLSRPLL------------DEVAMQKRHAEWMTEHGRVYADANEKNN 57

Query: 190 RFKIFEQNVKFIESFNKA-GNQSYKLGVKKFSDLTNEEFKA--TMLNEGXXXXXXXXXXX 360
           R+ +F++NV+ IE  N      ++KL V +F+DLTNEEF++  T                
Sbjct: 58  RYAVFKRNVERIERLNDVQSGLTFKLAVNQFADLTNEEFRSMYTGFKGNSVLSSRTKPTS 117

Query: 361 XXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSE 540
               N S   +P  +DWR+KGAVT IK+QG CG CWAFSAVAA+EG+ QI+ G+L+ LSE
Sbjct: 118 FRYQNVSSDALPVSVDWRKKGAVTPIKDQGLCGSCWAFSAVAAIEGVAQIKKGKLISLSE 177

Query: 541 QQLLDCNLKNYGC 579
           Q+L+DC+  + GC
Sbjct: 178 QELVDCDTNDGGC 190



>gb:AP002866_1823377 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0410E01.
          Length = 360

 Score =  145 bits (367), Expect = 4e-34
 Identities = 77/176 (43%), Positives = 111/176 (63%), Gaps = 11/176 (6%)
 Frame = +1

Query: 64  LLLGAFASQATALDEEP----SMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIES 231
           LL+ A A+ A A  ++P    SM  RHE+WM   GR+Y + AEKA+R ++F  N + +++
Sbjct: 17  LLVVAVAAAAAARGDQPRRGHSMAARHERWMARFGRAYADAAEKARRMEVFAANAERVDA 76

Query: 232 FNKAG-NQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLA------E 390
            N+AG +++Y LG+ +FSDLT++EF  T L                  N + A      +
Sbjct: 77  ANRAGGDRTYTLGLNQFSDLTDDEFAQTHLGYSWAPPPPSHRHGHRAENGTAAAAADDTD 136

Query: 391 VPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC 558
           VP+ +DWR +GAVT++KNQ  CG CWAF+AVAA EG+ Q+ TG L+ LSEQQ+LDC
Sbjct: 137 VPDSVDWRARGAVTEVKNQRSCGSCWAFAAVAATEGLVQLATGNLVSLSEQQVLDC 192



>pir|D86413|D86413 cysteine proteinase (EC 3.4.22.-) [similarity] -
           Arabidopsis thaliana>gb:AE005172_891764 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC021043_1538672 Arabidopsis thaliana
           chromosome I BAC F28N24 genomic sequence, complete
           sequence.
          Length = 331

 Score =  145 bits (367), Expect = 4e-34
 Identities = 79/173 (45%), Positives = 109/173 (63%), Gaps = 8/173 (4%)
 Frame = +1

Query: 85  SQATA--LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSY 258
           SQAT+     EP + E H++WM    R Y ++ EK  RF +F++N+KFIE FNK G+++Y
Sbjct: 6   SQATSRVTFHEPIVAEHHQQWMTRFSRVYSDELEKQMRFDVFKKNLKFIEKFNKKGDRTY 65

Query: 259 KLGVKKFSDLTNEEFKAT---MLNEGXXXXXXXXXXXXXXXNESLAEVP--EYLDWREKG 423
           KLGV +F+D T EEF AT   +                   N ++++V   E  DWR +G
Sbjct: 66  KLGVNEFADWTREEFIATHTGLKGVNGIPSSEFVDEMIPSWNWNVSDVAGRETKDWRYEG 125

Query: 424 AVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL-KNYGC 579
           AVT +K QG CGCCWAFS+VAA+EG+T+I    L+ LSEQQLLDC+  ++ GC
Sbjct: 126 AVTPVKYQGQCGCCWAFSSVAAVEGLTKIVGNNLVSLSEQQLLDCDRERDNGC 178



>pir|T07851|T07851 ananain (EC 3.4.22.31) precursor AN11 -
           pineapple>gb:ACO9830_1745389 Ananas comosus mRNA for
           stem cysteine proteinase precursor, clone pAN11.
          Length = 357

 Score =  145 bits (367), Expect = 4e-34
 Identities = 76/181 (41%), Positives = 110/181 (60%), Gaps = 2/181 (1%)
 Frame = +1

Query: 43  QLILAAVLLLGAFASQATALDEEPS--MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV 216
           QL+   + L   +AS + A  +EPS  M++R E+WM  +GR YK++ EK +RF+IF+ NV
Sbjct: 6   QLVFLFLFLCVMWASPSAASRDEPSDPMMKRFEEWMAEYGRVYKDNDEKMRRFQIFKNNV 65

Query: 217 KFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVP 396
             IE+FN     SY LG+ +F+D+TN EF A                     +  ++ VP
Sbjct: 66  NHIETFNSRNGNSYTLGINQFTDMTNNEFVAQYTGV-SLPLNIEREPVVSFDDVDISAVP 124

Query: 397 EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYG 576
           + +DWR  GAVT +KN   CG CWAF+A+A +E I +I+ G L+ LSEQQ+LDC + +YG
Sbjct: 125 QSIDWRNYGAVTSVKNHIPCGSCWAFAAIATVESIYKIKRGYLISLSEQQVLDCAV-SYG 183

Query: 577 C 579
           C
Sbjct: 184 C 184



>sp|Q9LT77|CPR1_ARATH Putative cysteine proteinase At3g19400
           precursor (EC 3.4.22.-).>gb:AB025624_1516469 Arabidopsis
           thaliana genomic DNA, chromosome 3, P1 clone: MLD14.
          Length = 362

 Score =  144 bits (364), Expect = 8e-34
 Identities = 74/183 (40%), Positives = 113/183 (61%), Gaps = 5/183 (2%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPSMLE---RHEKWMVHHGRSYKNDAEKAKRFKIFEQNV 216
           L++ +VLLL +    AT  + E +  E    +E+W+V + ++Y    EK +RFKIF+ N+
Sbjct: 13  LVILSVLLLSSSLGVATETEIERNETEVRLMYEQWLVENRKNYNGLGEKERRFKIFKDNL 72

Query: 217 KFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVP 396
           KF++  N   ++++++G+ +F+DLTNEEF+A  L +                 E    +P
Sbjct: 73  KFVDEHNSVPDRTFEVGLTRFADLTNEEFRAIYLRKKMERTKDSVKTERYLYKEGDV-LP 131

Query: 397 EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCN--LKN 570
           + +DWR  GAV  +K+QG CG CWAFSAV A+EGI QI TG+L+ LSEQ+L+DC+    N
Sbjct: 132 DEVDWRANGAVVSVKDQGNCGSCWAFSAVGAVEGINQITTGELISLSEQELVDCDRGFVN 191

Query: 571 YGC 579
            GC
Sbjct: 192 AGC 194



>gb:AP003724_1832447 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0498C03.
          Length = 357

 Score =  144 bits (363), Expect = 1e-33
 Identities = 76/161 (47%), Positives = 101/161 (62%), Gaps = 3/161 (1%)
 Frame = +1

Query: 106 EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQ-SYKLGVKKFS 282
           ++ +M ER+EKW   HGR+YK+  EKA+RF++F  N  FI+SFN AG + S +L   KF+
Sbjct: 41  DDSAMRERYEKWAADHGRTYKDSLEKARRFEVFRTNALFIDSFNAAGGKKSPRLTTNKFA 100

Query: 283 DLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGC 462
           DLTNEEF                       N   ++VP  ++WR++GAVT +KNQ  C  
Sbjct: 101 DLTNEEFAEYYGRP--FSTPVIGGSGFMYGNVRTSDVPANINWRDRGAVTQVKNQKDCAS 158

Query: 463 CWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--KNYGC 579
           CWAFSAVAA+EGI QIR+  L+ LS QQLLDC+    N+GC
Sbjct: 159 CWAFSAVAAVEGIHQIRSHNLVALSTQQLLDCSTGRNNHGC 199



>gb:AK118509_1816482 Arabidopsis thaliana At3g19400 mRNA for
           putative cysteine proteinase RD21A precursor, complete
           cds, clone: RAFL19-74-E13.
          Length = 362

 Score =  144 bits (363), Expect = 1e-33
 Identities = 74/183 (40%), Positives = 113/183 (61%), Gaps = 5/183 (2%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPSMLE---RHEKWMVHHGRSYKNDAEKAKRFKIFEQNV 216
           L++ +VLLL +    AT  + E +  E    +E+W+V + ++Y    EK +RFKIF+ N+
Sbjct: 13  LVILSVLLLSSSLGVATETEIERNETEVRLMYEQWLVENRKNYNGLGEKERRFKIFKDNL 72

Query: 217 KFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVP 396
           KF++  N   ++++++G+ +F+DLTNEEF+A  L +                 E    +P
Sbjct: 73  KFVDEHNSVPDRTFEVGLTRFADLTNEEFRAIYLRKKMERNKDSVKTERYLYKEGDV-LP 131

Query: 397 EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCN--LKN 570
           + +DWR  GAV  +K+QG CG CWAFSAV A+EGI QI TG+L+ LSEQ+L+DC+    N
Sbjct: 132 DEVDWRANGAVVSVKDQGNCGSCWAFSAVGAVEGINQITTGELISLSEQELVDCDRGFVN 191

Query: 571 YGC 579
            GC
Sbjct: 192 AGC 194



>gb:AB109186_1526791 Helianthus annuus scp1 mRNA for cysteine
           protease-1, complete cds.
          Length = 461

 Score =  144 bits (362), Expect = 1e-33
 Identities = 78/196 (39%), Positives = 120/196 (61%), Gaps = 7/196 (3%)
 Frame = +1

Query: 13  LSSMASNFDFQLI-LAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAK 189
           L S+ S  D  +I   A  +  + +S     D+E + L  +E W+V HG++Y    EK +
Sbjct: 14  LISIISAMDMSIINYDATHMSSSSSSAPLRTDDEVNAL--YESWLVKHGKTYNALGEKDR 71

Query: 190 RFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATM-----LNEGXXXXXXXXX 354
           RF+IF+ N++FI+  N +G+ +YKLG+ KF+DLTNEE++ T      +++          
Sbjct: 72  RFQIFKDNLRFIDEHN-SGDHTYKLGLNKFADLTNEEYRMTYTGIKTIDDKKKLSKMKSD 130

Query: 355 XXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRL 534
                  +SL   PEY+DWRE+GAVTD+K+QG CG CWAFS   ++EG+ +I TG L+ +
Sbjct: 131 RYAYRSGDSL---PEYVDWREQGAVTDVKDQGSCGSCWAFSTTGSVEGVNKIVTGDLISV 187

Query: 535 SEQQLLDCNLK-NYGC 579
           SEQ+L++C+   N GC
Sbjct: 188 SEQELVNCDTSYNQGC 203



>gb:D38534_1674561 Ananas comosus mRNA for FB1035 precursor, partial
           cds.
          Length = 324

 Score =  143 bits (361), Expect = 2e-33
 Identities = 68/154 (44%), Positives = 101/154 (65%)
 Frame = +1

Query: 118 MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNE 297
           M++R E+WM  +GR YK++ EK +RF+IF+ NVK IE+FN     SY LG+ +F+D+T  
Sbjct: 6   MMKRFEEWMAEYGRIYKDNDEKMRRFQIFKNNVKHIETFNSRNGNSYTLGINQFTDMTKS 65

Query: 298 EFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFS 477
           EF A                     + +++ VP+ +DWR+ GAV ++KNQ  CG CWAF+
Sbjct: 66  EFVAQYTGVSLPLNIEREPVVSFD-DVNISAVPQSIDWRDYGAVNEVKNQNPCGSCWAFA 124

Query: 478 AVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           A+A +EGI +I+TG L+ LSEQ++LDC + +YGC
Sbjct: 125 AIATVEGIYKIKTGYLVSLSEQEVLDCAV-SYGC 157



>pir|T10518|T10518 fruit bromelain (EC 3.4.22.33) FB1035 precursor -
           pineapple  (fragment)
          Length = 324

 Score =  143 bits (361), Expect = 2e-33
 Identities = 68/154 (44%), Positives = 101/154 (65%)
 Frame = +1

Query: 118 MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNE 297
           M++R E+WM  +GR YK++ EK +RF+IF+ NVK IE+FN     SY LG+ +F+D+T  
Sbjct: 6   MMKRFEEWMAEYGRIYKDNDEKMRRFQIFKNNVKHIETFNSRNGNSYTLGINQFTDMTKS 65

Query: 298 EFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFS 477
           EF A                     + +++ VP+ +DWR+ GAV ++KNQ  CG CWAF+
Sbjct: 66  EFVAQYTGVSLPLNIEREPVVSFD-DVNISAVPQSIDWRDYGAVNEVKNQNPCGSCWAFA 124

Query: 478 AVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           A+A +EGI +I+TG L+ LSEQ++LDC + +YGC
Sbjct: 125 AIATVEGIYKIKTGYLVSLSEQEVLDCAV-SYGC 157



>sp|P10056|PAP3_CARPA Caricain precursor (EC 3.4.22.30) (Papaya
           proteinase omega) (Papaya proteinase III) (PPIII)
           (Papaya peptidase A).>pir|JN0633|JN0633 caricain (EC
           3.4.22.30) I precursor - papaya>gb:CPPROO_1648688
           C.papaya mRNA for proteinase omega.
          Length = 348

 Score =  143 bits (361), Expect = 2e-33
 Identities = 67/154 (43%), Positives = 100/154 (64%)
 Frame = +1

Query: 118 MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNE 297
           +++    WM++H + Y+N  EK  RF+IF+ N+ +I+  NK  N SY LG+ +F+DL+N+
Sbjct: 44  LIQLFNSWMLNHNKFYENVDEKLYRFEIFKDNLNYIDETNKKNN-SYWLGLNEFADLSND 102

Query: 298 EFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFS 477
           EF    +                  NE    +PE +DWR+KGAVT +++QG CG CWAFS
Sbjct: 103 EFNEKYVGS-LIDATIEQSYDEEFINEDTVNLPENVDWRKKGAVTPVRHQGSCGSCWAFS 161

Query: 478 AVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           AVA +EGI +IRTG+L+ LSEQ+L+DC  +++GC
Sbjct: 162 AVATVEGINKIRTGKLVELSEQELVDCERRSHGC 195



>gb:AB025624_1516468 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MLD14.>gb:AY062725_1565381 Arabidopsis
           thaliana cysteine proteinase (At3g19400; MLD14.12) mRNA,
           complete cds.>gb:AY093350_1575304 Arabidopsis thaliana
           cysteine proteinase (At3g19400) mRNA, complete cds.
          Length = 452

 Score =  142 bits (359), Expect = 3e-33
 Identities = 71/193 (36%), Positives = 114/193 (59%), Gaps = 4/193 (2%)
 Frame = +1

Query: 13  LSSMASNFDFQLILAAVLLLGAFASQATALD---EEPSMLERHEKWMVHHGRSYKNDAEK 183
           +++   +    L++ +VLL+       TA +    E      +E+W+V + ++Y    EK
Sbjct: 1   MATSIKSITLALLIFSVLLISLSLGSVTATETTRNEAEARRMYERWLVENRKNYNGLGEK 60

Query: 184 AKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXX 363
            +RF+IF+ N+KF+E  +   N++Y++G+ +F+DLTN+EF+A  L               
Sbjct: 61  ERRFEIFKDNLKFVEEHSSIPNRTYEVGLTRFADLTNDEFRAIYLRSKMERTRVPVKGEK 120

Query: 364 XXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQ 543
                    +P+ +DWR KGAV  +K+QG CG CWAFSA+ A+EGI QI+TG+L+ LSEQ
Sbjct: 121 YLYKVG-DSLPDAIDWRAKGAVNPVKDQGSCGSCWAFSAIGAVEGINQIKTGELISLSEQ 179

Query: 544 QLLDCNLK-NYGC 579
           +L+DC+   N GC
Sbjct: 180 ELVDCDTSYNDGC 192



>gb:AB098628_1526118 Daucus carota DcCysP5 mRNA for cysteine
           protease, complete cds.
          Length = 437

 Score =  142 bits (358), Expect = 4e-33
 Identities = 72/197 (36%), Positives = 118/197 (59%), Gaps = 4/197 (2%)
 Frame = +1

Query: 1   TTNILSSMASNFDFQLILAAVLLLGAFASQATALDE-EPSMLERHEKWMVHHGRSYKNDA 177
           + N+L  ++ +F    + + + ++    +   +L   +  ++  +  W+V HG+SY    
Sbjct: 5   SNNLLLFLSLSFFISALASDMSIINYDQTHTNSLIRTDDEVMTMYNSWLVKHGKSYNALG 64

Query: 178 EKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXX 357
           EK  RF+IF+ N+++I++ N   ++SY+LG+ +F+DLTNEE++A  L             
Sbjct: 65  EKETRFQIFKDNLRYIDNHNADPDRSYELGLNRFADLTNEEYRAKYLGTKSRESRPKLSK 124

Query: 358 XXXXXNESLA--EVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMR 531
                   +   E+P+ +DWREKGAV  +K+QG CG CWAFSA+ A+EGI QI TG+L+ 
Sbjct: 125 GPSDRYAPVEGEELPDSIDWREKGAVAAVKDQGSCGSCWAFSAIGAVEGINQITTGELIT 184

Query: 532 LSEQQLLDCNLK-NYGC 579
           LSEQ+L+DC+   N GC
Sbjct: 185 LSEQELVDCDRSYNEGC 201



>gb:AF133839_1770952 Sandersonia aurantiaca papain-like cysteine
           protease (PRT5) mRNA, complete cds.
          Length = 357

 Score =  142 bits (357), Expect = 5e-33
 Identities = 82/195 (42%), Positives = 113/195 (57%), Gaps = 9/195 (4%)
 Frame = +1

Query: 22  MASNFDFQLILAAVLLLGAFAS---QATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKR 192
           MAS F   L+LA  L  G+  S   +   L+ E S+   +E+W  HH  S   D +K KR
Sbjct: 1   MASLFPVLLVLA--LAFGSTLSIPIKEKDLESEDSLWSLYERWRSHHAVSRDLD-QKQKR 57

Query: 193 FKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXX 372
           F +F++NVKFI  FNK  + ++KL + KF D+TN+EF+A                     
Sbjct: 58  FNVFKENVKFIHEFNKNKDVTFKLALNKFGDMTNQEFRAKYAGSKVHHHRTMKGSRHGSG 117

Query: 373 NESL-----AEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLS 537
           + +      A  P  +DWRE+GAV  +KNQG CG CWAFSA+AA+EGI QI T +L+ LS
Sbjct: 118 SGAKFMYENAVAPPSIDWRERGAVAAVKNQGQCGSCWAFSAIAAVEGINQIVTKELVPLS 177

Query: 538 EQQLLDCNL-KNYGC 579
           EQ+L+DC+  +N GC
Sbjct: 178 EQELIDCDTDQNQGC 192



>gb:AY087918_1572943 Arabidopsis thaliana clone 39621 mRNA, complete
           sequence.
          Length = 376

 Score =  142 bits (357), Expect = 5e-33
 Identities = 77/184 (41%), Positives = 111/184 (60%), Gaps = 6/184 (3%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDE---EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV 216
           L+  +VLL+       TA +    E  +L  +E+W+V +G++Y    EK +RFKIF+ N+
Sbjct: 10  LLTLSVLLISISLGVVTATESQRNEGGVLTMYEQWLVENGKNYNGLGEKERRFKIFKDNL 69

Query: 217 KFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVP 396
           K IE  N   N+SY+ G+ KFSDLT +EF+A+ L  G                +    +P
Sbjct: 70  KRIEEHNSDPNRSYERGLNKFSDLTADEFQASYLG-GKMEKKSLSDVAERYQYKEGDVLP 128

Query: 397 EYLDWREKGAVTD-IKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--K 567
           + +DWRE+GAV   +K QG CG CWAF+A  A+EGI QI TG+L+ LSEQ+L+DC+    
Sbjct: 129 DEVDWRERGAVVPRVKRQGECGSCWAFAATGAVEGINQITTGELVSLSEQELIDCDRGND 188

Query: 568 NYGC 579
           N+GC
Sbjct: 189 NFGC 192



>sp|Q9LXW3|CPR2_ARATH Putative cysteine proteinase At3g43960
           precursor (EC 3.4.22.-).>pir|T48950|T48950 cysteine
           proteinase-like protein - Arabidopsis
           thaliana>gb:ATT15B3_1554503 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T15B3.>gb:AK118634_1816600
           Arabidopsis thaliana At3g43960 mRNA for putative
           cysteine proteinase, complete cds, clone: RAFL19-90-C07.
          Length = 376

 Score =  142 bits (357), Expect = 5e-33
 Identities = 77/184 (41%), Positives = 111/184 (60%), Gaps = 6/184 (3%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDE---EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV 216
           L+  +VLL+       TA +    E  +L  +E+W+V +G++Y    EK +RFKIF+ N+
Sbjct: 10  LLTLSVLLISISLGVVTATESQRNEGEVLTMYEQWLVENGKNYNGLGEKERRFKIFKDNL 69

Query: 217 KFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVP 396
           K IE  N   N+SY+ G+ KFSDLT +EF+A+ L  G                +    +P
Sbjct: 70  KRIEEHNSDPNRSYERGLNKFSDLTADEFQASYLG-GKMEKKSLSDVAERYQYKEGDVLP 128

Query: 397 EYLDWREKGAVTD-IKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL--K 567
           + +DWRE+GAV   +K QG CG CWAF+A  A+EGI QI TG+L+ LSEQ+L+DC+    
Sbjct: 129 DEVDWRERGAVVPRVKRQGECGSCWAFAATGAVEGINQITTGELVSLSEQELIDCDRGND 188

Query: 568 NYGC 579
           N+GC
Sbjct: 189 NFGC 192



>gb:AY700587_1623605 Zingiber officinale cysteine protease gp3a
           mRNA, complete cds.
          Length = 475

 Score =  141 bits (355), Expect = 9e-33
 Identities = 71/172 (41%), Positives = 107/172 (62%), Gaps = 4/172 (2%)
 Frame = +1

Query: 76  AFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKA---G 246
           A+A+ A   DEE  ++  +++W V H  +  +      R ++F++N++F++  N A   G
Sbjct: 36  AWAAPAGRSDEEVRII--YQEWRVKHRPAENDQYVGDYRLEVFKENLRFVDEHNAAADRG 93

Query: 247 NQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEV-PEYLDWREKG 423
             +Y+LG+ +F+DLTNEE++A  L +                     +V P+ +DWREKG
Sbjct: 94  EHAYRLGMNRFADLTNEEYRARFLRDLSRLGRSTSGEISNQYRLREGDVLPDSIDWREKG 153

Query: 424 AVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           AV  +KNQG CG CWAF+A+AA+EGI QI TG L+ LSEQQL+DC+ +NYGC
Sbjct: 154 AVVAVKNQGRCGSCWAFAAIAAVEGINQIVTGDLISLSEQQLVDCSTRNYGC 205



>gb:AF448505_1800669 Brassica napus cysteine proteinase (CysP1)
           mRNA, complete cds.>gb:AF448506_1800670 Brassica napus
           cysteine proteinase (CysP1) gene, complete cds.
          Length = 343

 Score =  140 bits (353), Expect = 1e-32
 Identities = 76/182 (41%), Positives = 109/182 (59%), Gaps = 5/182 (2%)
 Frame = +1

Query: 49  ILAAVLLLGAFASQATALD--EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF 222
           I   V L+ +F+   T     +E +M +RH  WM  HGR Y +  EK  R+ +F++NV+ 
Sbjct: 8   IFLIVSLVSSFSLSTTLSRPLDEVTMQKRHAAWMTEHGRVYADANEKNNRYVVFKRNVES 67

Query: 223 IESFNKAG-NQSYKLGVKKFSDLTNEEFKA--TMLNEGXXXXXXXXXXXXXXXNESLAEV 393
           IE  N+     ++KL V +F+DLTNEEF++  T                    + S   +
Sbjct: 68  IERLNEVQYGLTFKLAVNQFADLTNEEFRSMYTGYKGNSVLSSRTKPTSFRYQHVSSDAL 127

Query: 394 PEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNY 573
           P  +DWR+KGAVT IK+QG CG CWAFSAVAA+EG+ QI+ G+L+ LSEQ+L+DC+  + 
Sbjct: 128 PISVDWRKKGAVTPIKDQGSCGSCWAFSAVAAIEGVAQIKKGKLISLSEQELVDCDTNDD 187

Query: 574 GC 579
           GC
Sbjct: 188 GC 189



>gb:PSU34747_1702498 Phalaenopsis sp. 'hybrid SM9108' cysteine
           proteinase mRNA, complete cds.
          Length = 359

 Score =  140 bits (353), Expect = 1e-32
 Identities = 79/192 (41%), Positives = 107/192 (55%), Gaps = 12/192 (6%)
 Frame = +1

Query: 40  FQLILAAVLLLGAFASQATALDE----EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFE 207
           F LIL A  L    A+     D+    E S+   +E+W  HH  S   D EK KRF +F+
Sbjct: 4   FSLILVASFLASVAATAIDIADKDLETEDSLWNLYERWRSHHTVSRDLD-EKQKRFNVFK 62

Query: 208 QNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLA 387
           +N ++I  FNK  +  YKL + KF+DLTN EF++T                      S  
Sbjct: 63  ENPRYIHDFNKRKDIPYKLRLNKFADLTNHEFRSTYAGSRINHHRSLRGSRRGGATNSFM 122

Query: 388 -------EVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQ 546
                   +P  +DWR+KGAVT +K+QG CG CWAFS VAA+EGI QI+T +L+ LSEQ+
Sbjct: 123 YQSLDSRSLPASIDWRQKGAVTAVKDQGQCGSCWAFSTVAAVEGINQIKTKKLLSLSEQE 182

Query: 547 LLDCNL-KNYGC 579
           L+DC+  +N GC
Sbjct: 183 LIDCDTDENNGC 194



>pir|T06122|T06122 cysteine proteinase (EC 3.4.22.-) F23E12.90 -
           Arabidopsis thaliana>gb:ATCHRIV83_1547496 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           83.>gb:ATF23E12_1549726 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F23E12 (ESSA
           project).>gb:BT005179_1638125 Arabidopsis thaliana clone
           U50467 unknown protein (At4g35350) mRNA, complete
           cds.>gb:AF191027_1775461 Arabidopsis thaliana
           papain-type cysteine endopeptidase XCP1 mRNA, complete
           cds.>gb:AK117394_1815432 Arabidopsis thaliana At4g35350
           mRNA for putative cysteine proteinase, complete cds,
           clone: RAFL16-98-B02.
          Length = 355

 Score =  140 bits (353), Expect = 1e-32
 Identities = 77/185 (41%), Positives = 105/185 (56%), Gaps = 8/185 (4%)
 Frame = +1

Query: 49  ILAAVLLLGAFASQATALDEEPS-------MLERHEKWMVHHGRSYKNDAEKAKRFKIFE 207
           I A+ LL  AFA   + +   P        +LE  E WM  H ++YK+  EK  RF++F 
Sbjct: 17  ISASALLCCAFARDFSIVGYTPEHLTNTDKLLELFESWMSEHSKAYKSVEEKVHRFEVFR 76

Query: 208 QNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLA 387
           +N+  I+  N   N SY LG+ +F+DLT+EEFK   L                     + 
Sbjct: 77  ENLMHIDQRNNEIN-SYWLGLNEFADLTHEEFKGRYLGLAKPQFSRKRQPSANFRYRDIT 135

Query: 388 EVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK 567
           ++P+ +DWR+KGAV  +K+QG CG CWAFS VAA+EGI QI TG L  LSEQ+L+DC+  
Sbjct: 136 DLPKSVDWRKKGAVAPVKDQGQCGSCWAFSTVAAVEGINQITTGNLSSLSEQELIDCDTT 195

Query: 568 -NYGC 579
            N GC
Sbjct: 196 FNSGC 200



>gb:AY251055_1592749 Anthurium andraeanum senescence-associated
           cysteine protease mRNA, complete cds.
          Length = 460

 Score =  140 bits (352), Expect = 2e-32
 Identities = 78/184 (42%), Positives = 113/184 (61%), Gaps = 6/184 (3%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFI 225
           L+L A++   +    A   +EE  +L  +E W+V +G++Y    EK +RF+IF  N+++I
Sbjct: 12  LLLLALVAASSRGIVAERTEEEVRLL--YEGWLVGNGKAYNLLGEKERRFEIFWDNLRYI 69

Query: 226 ESFNKA-GNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLA----E 390
           +  N+A  N SY LG+ +F+DLTNEE+++T L                     L+    +
Sbjct: 70  DDHNRAENNHSYTLGLTRFADLTNEEYRSTYLGVKPGQVRPRRANRAPGRGRDLSANGDD 129

Query: 391 VPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK- 567
           +P+ +DWREKGAV  IK+QG CG CWAFS VAA+EGI QI TG L+ LSEQ+L+DC+   
Sbjct: 130 LPQKVDWREKGAVAPIKDQGGCGSCWAFSTVAAVEGINQIVTGDLIVLSEQELVDCDTAY 189

Query: 568 NYGC 579
           N GC
Sbjct: 190 NEGC 193



>gb:AP004047_1836874 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1191_G08.
          Length = 366

 Score =  139 bits (351), Expect = 3e-32
 Identities = 79/189 (41%), Positives = 109/189 (57%), Gaps = 17/189 (8%)
 Frame = +1

Query: 64  LLLGAFASQATALDEEPSMLERHEK--------------WMVHHGRSYKNDAEKAKRFKI 201
           LLLG  A  ATA   +PS++   ++              W V H + Y +  EK KR++I
Sbjct: 19  LLLGFVACSATASHHDPSVVGYSQEDLALPNKLVGLFTSWSVKHSKIYASPKEKVKRYEI 78

Query: 202 FEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLN--EGXXXXXXXXXXXXXXXN 375
           F++N++ I   N+  N SY LG+  F+D+ +EEFKA+ L    G                
Sbjct: 79  FKRNLRHIVETNRR-NGSYWLGLNHFADIAHEEFKASYLGLKPGLARRDAQPHGSTTFRY 137

Query: 376 ESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLD 555
            +   +P  +DWR+KGAVT +KNQG CG CWAFS VAA+EGI QI TG+L+ LSEQ+L+D
Sbjct: 138 ANAVNLPWAVDWRKKGAVTPVKNQGECGSCWAFSTVAAVEGINQIVTGKLVSLSEQELMD 197

Query: 556 C-NLKNYGC 579
           C N  N+GC
Sbjct: 198 CDNTFNHGC 206



>gb:AB098631_1526121 Daucus carota DcCysP8 mRNA for cysteine
           protease, complete cds.
          Length = 460

 Score =  139 bits (351), Expect = 3e-32
 Identities = 74/195 (37%), Positives = 113/195 (57%), Gaps = 5/195 (2%)
 Frame = +1

Query: 10  ILSSMASNFDFQLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAK 189
           ILS ++ +     + AA + +  +         +  ++  +E W+V HG+SY    EK +
Sbjct: 4   ILSLLSLSLLAAAVTAADMSIITYDQTHAVGSTDDVIMAAYESWLVKHGKSYNALGEKEQ 63

Query: 190 RFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLN----EGXXXXXXXXXX 357
           RF+IF+ N  +I+  N A ++S+KLG+ +F+DLTNEE+++        +           
Sbjct: 64  RFQIFKDNFLYIDEQNAAKDRSFKLGLNRFADLTNEEYRSKYTGIRTKDSRKKVSGKSQR 123

Query: 358 XXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLS 537
                 ESL   PE +DWRE GAV  +K+QG CG CWAFS ++A+EGI QI TG+L+ LS
Sbjct: 124 YASLAGESL---PESVDWREHGAVASVKDQGQCGSCWAFSTISAVEGINQIATGKLITLS 180

Query: 538 EQQLLDCNLK-NYGC 579
           EQ+L+DC+   N GC
Sbjct: 181 EQELVDCDRSYNEGC 195



>gb:AB098627_1526117 Daucus carota DcCysP4 mRNA for cysteine
           protease, complete cds.
          Length = 423

 Score =  139 bits (349), Expect = 4e-32
 Identities = 71/147 (48%), Positives = 95/147 (64%), Gaps = 1/147 (0%)
 Frame = +1

Query: 142 MVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLN 321
           +V H ++Y     K KRF+IF+ N++FI+  NK  NQS+KLG+ KF+DL+NEE+K+  L 
Sbjct: 11  LVKHHKNYNALGAKEKRFEIFKDNLRFIDEHNKGVNQSFKLGLNKFADLSNEEYKSMFLG 70

Query: 322 EGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGI 501
            G                    E+P+ +DWREKGAV  +K+QG CG CWAFS VAA+EGI
Sbjct: 71  -GRMVRDRKGFESDRFKYGVGDELPQSVDWREKGAVAPVKDQGQCGSCWAFSTVAAVEGI 129

Query: 502 TQIRTGQLMRLSEQQLLDCNLK-NYGC 579
            QI TG L+ LSEQ+L+DC+   N GC
Sbjct: 130 NQIATGDLISLSEQELVDCDKGFNQGC 156



>gb:AB098624_1526115 Daucus carota DcCysP1 mRNA for cysteine
           protease, complete cds.
          Length = 474

 Score =  139 bits (349), Expect = 4e-32
 Identities = 71/159 (44%), Positives = 100/159 (62%), Gaps = 5/159 (3%)
 Frame = +1

Query: 118 MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNE 297
           +L  +E W+V H ++Y    EK  RF IF+ NV F++  N   NQSYKLG+ KF+DLTN+
Sbjct: 56  LLSLYESWLVKHHKNYNALGEKETRFGIFKDNVGFVDRHNSMRNQSYKLGLNKFADLTND 115

Query: 298 EFKATMLNEGXXXXXXXXXXXXXXXNESLAE----VPEYLDWREKGAVTDIKNQGYCGCC 465
           E+++  L+ G               +  + E    +PE +DWR++GAV  +K+QG CG C
Sbjct: 116 EYRSLYLS-GKMMKRERKNEDGFRSDRFVFEDGDHLPESVDWRDRGAVAPVKDQGQCGSC 174

Query: 466 WAFSAVAAMEGITQIRTGQLMRLSEQQLLDC-NLKNYGC 579
           WAFS V A+EGI +I TG+L+ LSEQ+L+DC N  N GC
Sbjct: 175 WAFSTVGAVEGINKIVTGELISLSEQELVDCDNGYNQGC 213



>pir|T12039|T12039 cysteine proteinase (EC 3.4.22.-) 1 precursor -
           kidney bean>gb:PVZ99952_1703076 Phaseolus vulgaris
           Moldavian encoding cysteine proteinase precursor (clone
           cp6a).
          Length = 364

 Score =  138 bits (347), Expect = 7e-32
 Identities = 75/186 (40%), Positives = 112/186 (60%), Gaps = 8/186 (4%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALD----EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQN 213
           +++  +LLL    S ATA+      E  +++ +E+W+V H + Y    EK KRF++F+ N
Sbjct: 4   MLIPTLLLLSFTFSHATAMSIINYSENEVMDMYEEWLVKHRKVYNGLDEKEKRFQVFKDN 63

Query: 214 VKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLN---EGXXXXXXXXXXXXXXXNESL 384
           + FI+  N A N +Y LG+ KF+D+TNEE++A  L    +                  S 
Sbjct: 64  LGFIQDHN-AQNNTYTLGLNKFADITNEEYRAMYLGTRTDAKRRVMKTQNTGHRYAYNSG 122

Query: 385 AEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL 564
            ++P ++DWR KGAV  IK+QG CG CWAFS VAA+EGI  I TG+ + LSEQ+L+DC+ 
Sbjct: 123 DQLPVHVDWRLKGAVGPIKDQGNCGSCWAFSTVAAVEGINNIVTGEFVSLSEQELVDCDR 182

Query: 565 K-NYGC 579
           + + GC
Sbjct: 183 EYDEGC 188



>gb:AB098629_1526119 Daucus carota DcCysP6 mRNA for cysteine
           protease, complete cds.
          Length = 496

 Score =  137 bits (346), Expect = 1e-31
 Identities = 69/161 (42%), Positives = 101/161 (62%), Gaps = 2/161 (1%)
 Frame = +1

Query: 103 DEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFS 282
           D+E + L   E W+V HG+SY    E+ KRF+IF+ N+++I+  N   ++ +KLG+ KF+
Sbjct: 38  DDEATTL--FESWLVTHGKSYNALGEEEKRFQIFKNNLRYIDEQNLVEDRGFKLGLNKFA 95

Query: 283 DLTNEEFKATMLN-EGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCG 459
           DLTNEE+++     +                  S   +PE +DWRE GAV  +K+QG CG
Sbjct: 96  DLTNEEYRSKYTGIKSKDLRKKVSAKSGRYATLSGESLPESVDWRESGAVATVKDQGSCG 155

Query: 460 CCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
            CWAFS ++A+EGI QI TG+L+ LSEQ+L+DC+   N GC
Sbjct: 156 SCWAFSTISAVEGINQIATGKLITLSEQELVDCDRSYNEGC 196



>pir|S12618|TAGB actinidain (EC 3.4.22.14) precursor - kiwi
           fruit>gb:ACTACT_1745418 Actinidia deliciosa actinidin
           gene, complete cds.
          Length = 380

 Score =  137 bits (346), Expect = 1e-31
 Identities = 70/173 (40%), Positives = 107/173 (61%), Gaps = 2/173 (1%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPS--MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK 219
           L+  + LL+ + A  A  L +  +  +   +E W++ +G+SY +  E  +RF+IF++ ++
Sbjct: 12  LLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYGKSYNSLGEWERRFEIFKETLR 71

Query: 220 FIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPE 399
           FI+  N   N+SYK+G+ +F+DLT+EEF++T L  G                     +P 
Sbjct: 72  FIDEHNADTNRSYKVGLNQFADLTDEEFRSTYL--GFTSGSNKTKVSNRYEPRVGQVLPS 129

Query: 400 YLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC 558
           Y+DWR  GAV DIK+QG CG CWAFSA+A +EGI +I TG L+ LSEQ+L+DC
Sbjct: 130 YVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDC 182



>sp|P00785|ACTN_ACTCH Actinidain precursor (EC 3.4.22.14)
           (Actinidin) (Allergen Act c 1).>gb:ACTINID_1745424
           Actinidia deliciosa actinidin gene for
           actinidin/cysteine protease.
          Length = 380

 Score =  137 bits (346), Expect = 1e-31
 Identities = 70/173 (40%), Positives = 107/173 (61%), Gaps = 2/173 (1%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPS--MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK 219
           L+  + LL+ + A  A  L +  +  +   +E W++ +G+SY +  E  +RF+IF++ ++
Sbjct: 12  LLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYGKSYNSLGEWERRFEIFKETLR 71

Query: 220 FIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPE 399
           FI+  N   N+SYK+G+ +F+DLT+EEF++T L  G                     +P 
Sbjct: 72  FIDEHNADTNRSYKVGLNQFADLTDEEFRSTYL--GFTSGSNKTKVSNRYEPRFGQVLPS 129

Query: 400 YLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC 558
           Y+DWR  GAV DIK+QG CG CWAFSA+A +EGI +I TG L+ LSEQ+L+DC
Sbjct: 130 YVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDC 182



>pir|T12382|T12382 cysteine proteinase (EC 3.4.22.-) - common ice
           plant>gb:MCU30322_1685858 Mesembryanthemum crystallinum
           cysteine proteinase (Sep1) mRNA, complete cds.
          Length = 367

 Score =  137 bits (345), Expect = 1e-31
 Identities = 79/193 (40%), Positives = 108/193 (55%), Gaps = 7/193 (3%)
 Frame = +1

Query: 22  MASNFDFQLILAAVLLLGAFASQATALD-------EEPSMLERHEKWMVHHGRSYKNDAE 180
           MA N    L+L ++ LL      +  +D        + ++ + +E+W   +  S ++  E
Sbjct: 1   MAYNKCNTLLLVSLALLAMIVGLSEGIDFTDKDLESDETLWDLYERWRSVY-TSARSFGE 59

Query: 181 KAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXX 360
           K  RF +F++NVK+I   NK  ++ YKL + +F DLT  EF  T  N             
Sbjct: 60  KQNRFHVFKENVKYINEVNKM-DKPYKLRLNQFGDLTPSEFARTYANSKIIEGTRNESGG 118

Query: 361 XXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSE 540
               N    EVP  +DWR KGAVT +KNQG CG CWAFSA AA+EGI QI TGQL+ LSE
Sbjct: 119 FMYEN---VEVPRSIDWRVKGAVTPVKNQGRCGGCWAFSAAAAVEGINQITTGQLISLSE 175

Query: 541 QQLLDCNLKNYGC 579
           QQL+DC+ +N GC
Sbjct: 176 QQLIDCDTQNSGC 188



>gb:AY881010_1631908 Nicotiana tabacum cysteine protease (CP2) mRNA,
           complete cds.
          Length = 361

 Score =  137 bits (344), Expect = 2e-31
 Identities = 77/181 (42%), Positives = 109/181 (60%), Gaps = 5/181 (2%)
 Frame = +1

Query: 52  LAAVLLLG-AFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIE 228
           LA VL LG +F      L+ E  + E +E+W  HH  S   D EK KRF +F+ NV ++ 
Sbjct: 11  LALVLRLGESFDFHEKELETEEKLWELYERWRSHHTVSRSLD-EKDKRFNVFKANVHYVH 69

Query: 229 SFNKAGNQSYKLGVKKFSDLTNEEFK---ATMLNEGXXXXXXXXXXXXXXXNESLAEVPE 399
           +FNK  ++ YKL + KF+D+TN EF+   A    +                  ++ +VP 
Sbjct: 70  NFNKK-DKPYKLKLNKFADMTNHEFRHHYAGSKIKHHRSFLGASRANGTFMYANVEDVPP 128

Query: 400 YLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL-KNYG 576
            +DWR+KGAVT +K+QG CG CWAFS V A+EGI QI+T +L+ LSEQ+L+DC+  +N G
Sbjct: 129 SVDWRKKGAVTPVKDQGKCGSCWAFSTVVAVEGINQIKTNELVSLSEQELVDCDTSQNQG 188

Query: 577 C 579
           C
Sbjct: 189 C 189



>gb:AB177386_1528888 Dianthus caryophyllus DC-CP2 mRNA for cysteine
           proteinase, complete cds.
          Length = 459

 Score =  137 bits (344), Expect = 2e-31
 Identities = 72/189 (38%), Positives = 112/189 (59%), Gaps = 11/189 (5%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDE-----EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQ 210
           L+ + + ++ + A   + +D      +  +   +E W+V HG++Y    EK  RF IF+ 
Sbjct: 10  LLFSIIFIVSSSALDLSIIDRAFNRPDDEIASLYETWLVKHGKNYNGLGEKQLRFNIFKD 69

Query: 211 NVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLA- 387
           N++F++  N   N S+KLG+ +F+DLTNEE+++  L  G               ++  A 
Sbjct: 70  NLRFVDERNSE-NLSFKLGLNRFADLTNEEYRSVYL--GTRPRSVAVARSGRSKSDRYAF 126

Query: 388 ----EVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLD 555
                +PE +DWR+KGAV  IK+QG CG CWAFSA+AA+EG+ QI TG L+ LSEQ+L++
Sbjct: 127 RAGDTLPESVDWRKKGAVAGIKDQGSCGSCWAFSAIAAVEGVNQIVTGDLISLSEQELVE 186

Query: 556 CNLK-NYGC 579
           C+   N GC
Sbjct: 187 CDTSYNDGC 195



>pir|T12041|T12041 cysteine proteinase (EC 3.4.22.-) 3 precursor -
           kidney bean>gb:PVZ99954_1703078 Phaseolus vulgaris
           Moldavian encoding cysteine proteinase precursor (clone
           cp71).
          Length = 455

 Score =  137 bits (344), Expect = 2e-31
 Identities = 72/161 (44%), Positives = 104/161 (64%), Gaps = 2/161 (1%)
 Frame = +1

Query: 103 DEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFS 282
           DEE + L  +E+W+V HG+ Y    EK KRF+IF+ N++FI+  N A N++YKLG+ +F+
Sbjct: 33  DEEVNSL--YEEWLVKHGKLYNALGEKDKRFQIFKDNLRFIDQQN-AENRTYKLGLNRFA 89

Query: 283 DLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAE-VPEYLDWREKGAVTDIKNQGYCG 459
           DLTNEE++A  L                     + E +P+ +DWR++GAV  +K+Q  CG
Sbjct: 90  DLTNEEYRARYLGTKIDPNRRLGRTPSNRYAPRVGETLPDSVDWRKEGAVVPVKDQASCG 149

Query: 460 CCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL-KNYGC 579
            CWAFSA+ A+EGI +I TG L+ LSEQ+L+DC+   N GC
Sbjct: 150 SCWAFSAIGAVEGINKIVTGDLISLSEQELVDCDTGYNMGC 190



>gb:AJ606073_1811951 Gossypium hirsutum mRNA for cysteine proteinase
           (cys1 gene), strain Xuzhou 142.
          Length = 372

 Score =  136 bits (343), Expect = 2e-31
 Identities = 61/162 (37%), Positives = 105/162 (64%), Gaps = 3/162 (1%)
 Frame = +1

Query: 85  SQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKL 264
           S +++   +  ++  ++ W++ HG++Y    E+ KRF+IF+ N++FI+  N   N +YKL
Sbjct: 31  SSSSSWRSDDEVMGLYKSWVIQHGKAYNGIGEEEKRFEIFKDNLRFIDEHNSNNNTTYKL 90

Query: 265 GVKKFSDLTNEEFKATMLN---EGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTD 435
           G+ KF+DLTN+E++A  L    +                + +   +P+ ++WR+ GAV+ 
Sbjct: 91  GLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKIPSSRYAHRAGDNLPDSVNWRDHGAVSR 150

Query: 436 IKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCN 561
           +K+QG CG CWAFSA+AA+EGI +I +G+L+ LSEQ+L+DC+
Sbjct: 151 VKDQGSCGSCWAFSAIAAVEGINKIVSGELISLSEQELVDCD 192



>gb:AF343446_1789638 Actinidia chinensis actinidin protease mRNA,
           complete cds.
          Length = 380

 Score =  136 bits (343), Expect = 2e-31
 Identities = 70/174 (40%), Positives = 108/174 (62%), Gaps = 3/174 (1%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPS--MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK 219
           L+  + LL+ + A  A  L +  +  +   +E W++ +G+SY +  E  +RF+IF++ ++
Sbjct: 12  LLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYGKSYNSLGEWERRFEIFKETLR 71

Query: 220 FIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEV-P 396
           FI+  N   N+SYK+G+ +F+DLT+EEF++T L                     + +V P
Sbjct: 72  FIDEHNADTNRSYKVGLNQFADLTDEEFRSTYLR---FTSGSNKTKVSNRYEPRVGQVLP 128

Query: 397 EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC 558
            Y+DWR  GAV DIK+QG CG CWAFSA+A +EGI +I TG L+ LSEQ+L+DC
Sbjct: 129 SYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDC 182



>pir|T46630|T46630 cysteine proteinase (EC 3.4.22.-) 1 precursor
           [similarity] - kidney bean>gb:PVA224766_1702912
           Phaseolus vulgaris mRNA for cotyledon cysteine protease
           (PVCEP-1 gene).>gb:PVU52970_1703040 Phaseolus vulgaris
           cysteine endopeptidase 1 (PvCEP-1) mRNA, complete cds.
          Length = 364

 Score =  136 bits (343), Expect = 2e-31
 Identities = 74/186 (39%), Positives = 112/186 (60%), Gaps = 8/186 (4%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALD----EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQN 213
           +++  +LLL    S ATA+      E  +++ +E+W+V H + Y    EK KRF++F+ N
Sbjct: 4   MLIPTLLLLSFTFSHATAMSIINYSENEVMDMYEEWLVKHRKVYNGLDEKEKRFQVFKDN 63

Query: 214 VKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLN---EGXXXXXXXXXXXXXXXNESL 384
           + FI+  N A N +Y LG+ KF+D+TN+E++A  L    +                  S 
Sbjct: 64  LGFIQDHN-AQNNTYTLGLNKFADITNKEYRAMYLGTRTDAKRRVMKTQNTGHRYAYNSG 122

Query: 385 AEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL 564
            ++P ++DWR KGAV  IK+QG CG CWAFS VAA+EGI  I TG+ + LSEQ+L+DC+ 
Sbjct: 123 DQLPVHVDWRLKGAVGPIKDQGNCGSCWAFSTVAAVEGINNIVTGEFVSLSEQELVDCDR 182

Query: 565 K-NYGC 579
           + + GC
Sbjct: 183 EYDEGC 188



>sp|P12412|CYSP_VIGMU Vignain precursor (EC 3.4.22.-) (Bean
           endopeptidase) (Cysteine proteinase)
           (Sulfhydryl-endopeptidase) (SH-EP).>pir|S12581|S12581
           cysteine proteinase (EC 3.4.22.-) precursor - black
           gram>gb:VMSHEP_1727281 Vigna mungo mRNA for
           sulfhydryl-endopeptidase.>gb:VMSHEPG_1727282 Vigna mungo
           gene for sulfhydryl-endopeptidase.
          Length = 362

 Score =  136 bits (342), Expect = 3e-31
 Identities = 74/185 (40%), Positives = 111/185 (60%), Gaps = 7/185 (3%)
 Frame = +1

Query: 46  LILAAVLLLG---AFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV 216
           ++L+  L+LG   +F      L+ E S+ + +E+W  HH  S ++  EK KRF +F+ NV
Sbjct: 9   VVLSLSLVLGVANSFDFHEKDLESEESLWDLYERWRSHHTVS-RSLGEKHKRFNVFKANV 67

Query: 217 KFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXN---ESLA 387
             + + NK  ++ YKL + KF+D+TN EF++T                        E + 
Sbjct: 68  MHVHNTNKM-DKPYKLKLNKFADMTNHEFRSTYAGSKVNHHKMFRGSQHGSGTFMYEKVG 126

Query: 388 EVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL- 564
            VP  +DWR+KGAVTD+K+QG CG CWAFS + A+EGI QI+T +L+ LSEQ+L+DC+  
Sbjct: 127 SVPASVDWRKKGAVTDVKDQGQCGSCWAFSTIVAVEGINQIKTNKLVSLSEQELVDCDKE 186

Query: 565 KNYGC 579
           +N GC
Sbjct: 187 ENQGC 191



>sp|P43156|CYSP_HEMSP Thiol protease SEN102 precursor (EC
           3.4.22.-).>pir|S57777|S57777 cysteine proteinase (EC
           3.4.22.-) precursor - Hemerocallis x hybrida (cv. Cradle
           Song)>gb:HSPSEN102_1682140 Hemerocallis sp. mRNA for
           thiol-protease.
          Length = 360

 Score =  135 bits (341), Expect = 4e-31
 Identities = 70/165 (42%), Positives = 100/165 (60%), Gaps = 5/165 (3%)
 Frame = +1

Query: 100 LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKF 279
           L  E S+   +EKW  HH  +   D EK +RF +F++NVKFI  FN+  +  YKL + KF
Sbjct: 30  LASEDSLWNLYEKWRTHHTVARDLD-EKNRRFNVFKENVKFIHEFNQKKDAPYKLALNKF 88

Query: 280 SDLTNEEFKATMLNEGXXXXXXXXXXXXXXXN---ESLAEVPEY-LDWREKGAVTDIKNQ 447
            D+TN+EF++                     +   E++  +P   +DWR KGAVT +K+Q
Sbjct: 89  GDMTNQEFRSKYAGSKIQHHRSQRGIQKNTGSFMYENVGSLPAASIDWRAKGAVTGVKDQ 148

Query: 448 GYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
           G CG CWAFS +A++EGI QI+TG+L+ LSEQ+L+DC+   N GC
Sbjct: 149 GQCGSCWAFSTIASVEGINQIKTGELVSLSEQELVDCDTSYNEGC 193



>gb:VRU49445_1727379 Vigna radiata cysteinyl endopeptidase mRNA,
           complete cds.
          Length = 362

 Score =  135 bits (340), Expect = 5e-31
 Identities = 75/185 (40%), Positives = 111/185 (60%), Gaps = 7/185 (3%)
 Frame = +1

Query: 46  LILAAVLLLG---AFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV 216
           ++L+  L+LG   +F      L  E S+ + +E+W  HH  S ++  EK KRF +F++NV
Sbjct: 9   VVLSLSLVLGVANSFDFHEKDLASEESLWDLYERWRSHHTVS-RSLTEKHKRFNVFKENV 67

Query: 217 KFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXN---ESLA 387
             + + NK  ++ YKL + KF+D+TN EF++T                        E + 
Sbjct: 68  MHVHNTNKM-DKPYKLKLNKFADMTNHEFRSTYAGSKVNHHKMFRGTQHGNGTFMYEKVG 126

Query: 388 EVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL- 564
            VP  +DWR+KGAVTD+K+QG CG CWAFS V A+EGI QI+T +L+ LSEQ+L+DC+  
Sbjct: 127 SVPASVDWRKKGAVTDVKDQGQCGSCWAFSTVVAVEGINQIKTDKLVSLSEQELVDCDKE 186

Query: 565 KNYGC 579
           +N GC
Sbjct: 187 ENQGC 191



>pir|S24602|S24602 cysteine proteinase tpp (EC 3.4.22.-) - garden
           pea>gb:PSTHIOL_1702422 P.sativum mRNA for thiolprotease.
          Length = 464

 Score =  135 bits (339), Expect = 6e-31
 Identities = 66/158 (41%), Positives = 100/158 (63%), Gaps = 4/158 (2%)
 Frame = +1

Query: 118 MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNE 297
           +L  +E+W+V HG++Y    EK KRF+IF+ N+ FI+  N   N S++LG+ +F+DLTNE
Sbjct: 43  VLTMYEEWLVKHGKNYNALGEKEKRFEIFKDNLGFIDEHNSK-NLSFRLGLNRFADLTNE 101

Query: 298 EFKATMLNEGXXXXXXXXXXXXXXXNESLA---EVPEYLDWREKGAVTDIKNQGYCGCCW 468
           E++   L                    +     ++PE +DWR++GAV  +K+QG CG CW
Sbjct: 102 EYRTRFLGTRINPNRRNRKVNSQTNRYATRVGDKLPESVDWRKEGAVVGVKDQGSCGSCW 161

Query: 469 AFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
           AFSA+AA+EG+ ++ TG L+ LSEQ+L+DC+   N GC
Sbjct: 162 AFSAIAAVEGVNKLATGDLISLSEQELVDCDTSYNEGC 199



>pir|T01207|T01207 cysteine proteinase mir3 (EC 3.4.22.-) -
           maize>gb:AF019147_1761578 Zea mays cysteine proteinase
           Mir3 (mir3) mRNA, complete cds.
          Length = 480

 Score =  134 bits (338), Expect = 8e-31
 Identities = 69/174 (39%), Positives = 105/174 (60%), Gaps = 4/174 (2%)
 Frame = +1

Query: 70  LGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKA-- 243
           L +  S     DEE   +  + +WM  HGR+Y     + +R+++F  N+++I++ N A  
Sbjct: 26  LMSIVSYGERTDEEARRM--YAEWMAAHGRTYNAVGAEERRYQVFRDNLRYIDAHNAAAD 83

Query: 244 -GNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREK 420
            G  S++LG+ +F+DLTN+E+ AT L                   ++  ++PE +DWR K
Sbjct: 84  AGVHSFRLGLNRFADLTNDEYPATYLGARTRPQRDRKLGARYHAADN-EDLPESVDWRAK 142

Query: 421 GAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
           GAV ++K+QG CG CWAFS +AA+EGI QI TG L+ LSEQ+L+DC+   N GC
Sbjct: 143 GAVAEVKDQGSCGTCWAFSTIAAVEGINQIVTGDLISLSEQELVDCDTSYNQGC 196



>gb:AF454958_1801126 Brassica oleracea senescence-associated
           cysteine protease (CP3) mRNA, complete cds.
          Length = 485

 Score =  134 bits (337), Expect = 1e-30
 Identities = 69/160 (43%), Positives = 102/160 (63%), Gaps = 1/160 (0%)
 Frame = +1

Query: 103 DEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFS 282
           D E S L  +E+W+V HG++  +  EK +RF+IF+ N++FI+  N   N SY+LG+ KF+
Sbjct: 41  DAEVSRL--YEEWLVKHGKAQNSLTEKDRRFEIFKDNLRFIDEHN-GKNLSYRLGLTKFA 97

Query: 283 DLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGC 462
           DLTN+E+++  L  G                     +PE +DWR++GAV ++K+QG CG 
Sbjct: 98  DLTNDEYRSMYL--GSRLKRKATKSSLRYEVRVGDAIPESVDWRKEGAVAEVKDQGSCGS 155

Query: 463 CWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
           CWAFS + A+EGI +I TG L+ LSEQ+L+DC+   N GC
Sbjct: 156 CWAFSTIGAVEGINKIVTGDLITLSEQELVDCDTSYNEGC 195



>gb:AC079022_1541706 Oryza sativa chromosome 5 clone P0574H01,
           complete sequence.>gb:AY335487_1600217 Oryza sativa
           (japonica cultivar-group) cysteine protease CP1 mRNA,
           complete cds.>gb:AC129716_1740610 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBa0068N01,
           complete sequence.
          Length = 358

 Score =  134 bits (337), Expect = 1e-30
 Identities = 70/159 (44%), Positives = 97/159 (61%), Gaps = 5/159 (3%)
 Frame = +1

Query: 118 MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNE 297
           ++E  EKW+  + ++Y +  EK +RF++F+ N+  I+  NK    SY LG+ +F+DLT++
Sbjct: 47  LIELFEKWVAKYRKAYASFEEKVRRFEVFKDNLNHIDDINKKVT-SYWLGLNEFADLTHD 105

Query: 298 EFKATMLN----EGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCC 465
           EFKAT L                        S  EVP+ +DWR+K AVT++KNQG CG C
Sbjct: 106 EFKATYLGLTPPPTRSNSKHYSSEEFRYGKMSNGEVPKEMDWRKKNAVTEVKNQGQCGSC 165

Query: 466 WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
           WAFS VAA+EGI  I TG L  LSEQ+L+DC+   N GC
Sbjct: 166 WAFSTVAAVEGINAIVTGNLTSLSEQELIDCSTDGNNGC 204



>gb:AB109189_1526794 Helianthus annuus scp4 mRNA for cysteine
           protease-4, complete cds.
          Length = 352

 Score =  134 bits (337), Expect = 1e-30
 Identities = 74/186 (39%), Positives = 104/186 (55%), Gaps = 8/186 (4%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPS-------MLERHEKWMVHHGRSYKNDAEKAKRFKIF 204
           L+  +VL   A A++ + L   P        ++   E W+  H + Y++  EK  RF+IF
Sbjct: 14  LVFVSVLACSALANEFSILGYAPEDLTSIHKVIHLFESWLAKHSKIYESLDEKLHRFEIF 73

Query: 205 EQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESL 384
             N+K I+  NK  + +Y LG+ +F+DLT+EEFK   L                      
Sbjct: 74  MDNLKHIDDTNKKVS-NYWLGLNEFADLTHEEFKNKFLGLKGELPERKDESIEEFSYRDF 132

Query: 385 AEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL 564
            ++P+ +DWR+KGAV  +KNQG CG CWAFS VAA+EGI QI TG L  LSEQ+L+DC+ 
Sbjct: 133 VDLPKSVDWRKKGAVAPVKNQGQCGSCWAFSTVAAVEGINQIVTGNLTMLSEQELIDCDT 192

Query: 565 K-NYGC 579
             N GC
Sbjct: 193 TFNNGC 198



>gb:AB020961_1514764 Zea mays mRNA for cysteine protease component
           of protease-inhibitor complex, complete cds.
          Length = 465

 Score =  134 bits (337), Expect = 1e-30
 Identities = 73/188 (38%), Positives = 109/188 (57%), Gaps = 13/188 (6%)
 Frame = +1

Query: 55  AAVLLLGAFASQATALD---------EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFE 207
           AA LLL    S A A D          +      + +WM  HGR+Y    E+ +R+++F 
Sbjct: 10  AASLLLLLLVSLAAAADMSIVSYGERSDEEARRMYAEWMAAHGRTYNAVGEEERRYQVFR 69

Query: 208 QNVKFIESFNKA---GNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNE 378
            N+++I++ N A   G  S++LG+ +F+DLTN+E++AT L                   +
Sbjct: 70  DNLRYIDAHNAAADAGVHSFRLGLNRFADLTNDEYRATYLGARTRPQRERKLGARYHAAD 129

Query: 379 SLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC 558
           +  ++PE +DWR KGAV ++K+QG  G CWAFS +AA+EGI QI TG L+ LSEQ+L+DC
Sbjct: 130 N-EDLPESVDWRAKGAVAEVKDQGSYGSCWAFSTIAAVEGINQIVTGDLISLSEQELVDC 188

Query: 559 NLK-NYGC 579
           +   N GC
Sbjct: 189 DTSYNQGC 196



>gb:AB004819_1509189 Oryza sativa Rep1 gene for cysteine
           endopeptidase, complete cds.>gb:AP003380_1828843 Oryza
           sativa (japonica cultivar-group) genomic DNA, chromosome
           1, PAC clone:P0497A05.>gb:AP006531_1862300 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1417F08.
          Length = 371

 Score =  134 bits (337), Expect = 1e-30
 Identities = 69/182 (37%), Positives = 103/182 (56%), Gaps = 4/182 (2%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFI 225
           + +AAV L  A       L+ + ++ + +E+W  HH    ++  EK +RF  F+ NV++I
Sbjct: 18  MAMAAVELCAAIPFDERDLESDEALWDLYERWQEHH-HVPRHHGEKHRRFGAFKDNVRYI 76

Query: 226 ESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXN---ESLAEVP 396
              NK G + Y+L + +F D+  EEF+AT                        E + ++P
Sbjct: 77  HEHNKRGGRGYRLRLNRFGDMGREEFRATFAGSHANDLRRDGLAAPPLPGFMYEGVRDLP 136

Query: 397 EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCN-LKNY 573
             +DWR KGAVT +K+QG CG CWAFS V ++EGI  IRTG+L+ LSEQ+L+DC+   N 
Sbjct: 137 RAVDWRRKGAVTGVKDQGKCGSCWAFSTVVSVEGINAIRTGRLVSLSEQELIDCDTADNS 196

Query: 574 GC 579
           GC
Sbjct: 197 GC 198



>gb:AP003277_1827059 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0518C01.
          Length = 365

 Score =  134 bits (336), Expect = 1e-30
 Identities = 83/203 (40%), Positives = 116/203 (57%), Gaps = 17/203 (8%)
 Frame = +1

Query: 22  MASNFDFQLILAAVLLL-GAFASQATALDEEPS--------------MLERHEKWMVHHG 156
           MA++ + +L LA VLLL    A  A A+  E S              ++E  EK+M  + 
Sbjct: 1   MAASMNSKLPLALVLLLLCGGACVAVAMPSELSIVGYSEEDLASHERLMELFEKFMAKYR 60

Query: 157 RSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXX 336
           ++Y +  EK +RF++F+ N+  I+  NK     Y LG+ +F+DLT++EFKA  L      
Sbjct: 61  KAYSSLEEKLRRFEVFKDNLNHIDEENKKIT-GYWLGLNEFADLTHDEFKAAYLGLTLTP 119

Query: 337 XXXXXXXXXXXXNE-SLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIR 513
                        E   A +P+ +DWR+KGAVT++KNQG CG CWAFS VAA+EGI  I 
Sbjct: 120 ARRNSNDQLFRYEEVEAASLPKEVDWRKKGAVTEVKNQGQCGSCWAFSTVAAVEGINAIV 179

Query: 514 TGQLMRLSEQQLLDCNLK-NYGC 579
           TG L RLSEQ+L+DC+   N GC
Sbjct: 180 TGNLTRLSEQELIDCDTDGNNGC 202



>gb:AY039606_1560319 Arabidopsis thaliana F2G19.31/F2G19.31 mRNA,
           complete cds.>gb:AY081730_1568990 Arabidopsis thaliana
           F2G19.31/F2G19.31 mRNA, complete cds.
          Length = 462

 Score =  134 bits (336), Expect = 1e-30
 Identities = 66/160 (41%), Positives = 102/160 (63%), Gaps = 3/160 (1%)
 Frame = +1

Query: 109 EPSMLERHEKWMVHHGRSYKNDA--EKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFS 282
           E  ++  +E W+V HG++   ++  EK +RF+IF+ N++F++  N+  N SY+LG+ +F+
Sbjct: 43  EAEVMSIYEAWLVKHGKAQSQNSLVEKDRRFEIFKDNLRFVDEHNEK-NLSYRLGLTRFA 101

Query: 283 DLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGC 462
           DLTN+E+++  L                       E+PE +DWR+KGAV ++K+QG CG 
Sbjct: 102 DLTNDEYRSKYLGAKMEKKGERRTSLRYEARVG-DELPESIDWRKKGAVAEVKDQGGCGS 160

Query: 463 CWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
           CWAFS + A+EGI QI TG L+ LSEQ+L+DC+   N GC
Sbjct: 161 CWAFSTIGAVEGINQIVTGDLITLSEQELVDCDTSYNEGC 200



>gb:AC069251_1540748 Genomic sequence for Arabidopsis thaliana BAC
           F2D10 from chromosome I, complete sequence.
          Length = 315

 Score =  134 bits (336), Expect = 1e-30
 Identities = 81/200 (40%), Positives = 115/200 (57%), Gaps = 11/200 (5%)
 Frame = +1

Query: 13  LSSMASNFDFQLILAAVLLLGAFASQA--TALDEEPSMLERHEK-------WMVHHGRSY 165
           LSS +    F L L+A  L  +FAS    + +   P  LE H+K       W+ +  ++Y
Sbjct: 3   LSSPSRILCFALALSAASLSLSFASSHDYSIVGYSPEDLESHDKLIELFENWISNFEKAY 62

Query: 166 KNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLN-EGXXXXX 342
           +   EK  RF++F+ N+K I+  NK G +SY LG+ +F+DL++EEFK   L  +      
Sbjct: 63  ETVEEKFLRFEVFKDNLKHIDETNKKG-KSYWLGLNEFADLSHEEFKKMYLGLKTDIVRR 121

Query: 343 XXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQ 522
                        +  VP+ +DWR+KGAV ++KNQG CG CWAFS VAA+EGI +I TG 
Sbjct: 122 DEERSYAEFAYRDVEAVPKSVDWRKKGAVAEVKNQGSCGSCWAFSTVAAVEGINKIVTGN 181

Query: 523 LMRLSEQQLLDCNLK-NYGC 579
           L  LSEQ+L+DC+   N GC
Sbjct: 182 LTTLSEQELIDCDTTYNNGC 201



>gb:AB092557_1525080 Glycine max CysP2 mRNA for cysteine proteinase,
           complete cds.>gb:AB092558_1525081 Glycine max CysP2 gene
           for cysteine proteinase, complete cds.
          Length = 362

 Score =  134 bits (336), Expect = 1e-30
 Identities = 73/185 (39%), Positives = 112/185 (60%), Gaps = 7/185 (3%)
 Frame = +1

Query: 46  LILAAVLLLG---AFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV 216
           ++L+  L+LG   +F      L+ E S+ + +E+W  HH  S ++  +K KRF +F+ N+
Sbjct: 9   VVLSLSLVLGVANSFDFHDKDLESEESLWDLYERWRSHHTVS-RSLGDKHKRFNVFKANM 67

Query: 217 KFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXN---ESLA 387
             + + NK  ++ YKL + KF+D+TN EF++T                        E + 
Sbjct: 68  MHVHNTNKM-DKPYKLKLNKFADMTNHEFRSTYAGSKVNHHRMFRDMPRGNGTFMYEKVG 126

Query: 388 EVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL- 564
            VP  +DWR+KGAVTD+K+QG+CG CWAFS V A+EGI QI+T +L+ LSEQ+L+DC+  
Sbjct: 127 SVPASVDWRKKGAVTDVKDQGHCGSCWAFSTVVAVEGINQIKTNKLVSLSEQELVDCDTE 186

Query: 565 KNYGC 579
           +N GC
Sbjct: 187 ENAGC 191



>gb:AB091070_1524989 Zinnia elegans ZCP4 mRNA for cysteine
           proteinase, complete cds.
          Length = 352

 Score =  134 bits (336), Expect = 1e-30
 Identities = 77/186 (41%), Positives = 105/186 (56%), Gaps = 4/186 (2%)
 Frame = +1

Query: 34  FDFQLILAAVLLLGAFASQATALDEEPSM---LERHEKWMVHHGRSYKNDAEKAKRFKIF 204
           F F  ILA   L   F+    A ++  S+   +   E W+V H + Y++  EK  RF+IF
Sbjct: 14  FLFVSILACSALAHEFSILGYAPEDLTSIHKVIHLFESWLVKHSKFYESLDEKLHRFEIF 73

Query: 205 EQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESL 384
             N+K I+  NK  + +Y LG+ +F+DLT+EEFK   L                      
Sbjct: 74  MDNLKHIDETNKKVS-NYWLGLNEFADLTHEEFKHKFLGFKGELAERKDESSKEFGYRDF 132

Query: 385 AEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL 564
            ++P+ +DWR+KGAV  +KNQG CG CWAFS VAA+EGI QI TG L  LSEQ+L+DC+ 
Sbjct: 133 VDLPKSVDWRKKGAVAPVKNQGQCGSCWAFSTVAAVEGINQIVTGNLTMLSEQELIDCDT 192

Query: 565 K-NYGC 579
             N GC
Sbjct: 193 TFNNGC 198



>gb:AB024031_1515760 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K6A12.>gb:AY091087_1574314 Arabidopsis
           thaliana putative cysteine proteinase (At5g50260) mRNA,
           complete cds.
          Length = 361

 Score =  134 bits (336), Expect = 1e-30
 Identities = 73/164 (44%), Positives = 99/164 (60%), Gaps = 4/164 (2%)
 Frame = +1

Query: 100 LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKF 279
           ++ E S+ E +E+W  HH  + ++  EKAKRF +F+ NVK I   NK  ++SYKL + KF
Sbjct: 28  VESENSLWELYERWRSHHTVA-RSLEEKAKRFNVFKHNVKHIHETNKK-DKSYKLKLNKF 85

Query: 280 SDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEV---PEYLDWREKGAVTDIKNQG 450
            D+T+EEF+ T                    +   A V   P  +DWR+ GAVT +KNQG
Sbjct: 86  GDMTSEEFRRTYAGSNIKHHRMFQGEKKATKSFMYANVNTLPTSVDWRKNGAVTPVKNQG 145

Query: 451 YCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL-KNYGC 579
            CG CWAFS V A+EGI QIRT +L  LSEQ+L+DC+  +N GC
Sbjct: 146 QCGSCWAFSTVVAVEGINQIRTKKLTSLSEQELVDCDTNQNQGC 189



>gb:AB008267_1510432 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MMG4.>gb:AY062608_1565264 Arabidopsis thaliana
           cysteine protease component of protease-inhibitor
           complex (At5g43060; MMG4.7) mRNA, complete
           cds.>gb:AY114661_1578703 Arabidopsis thaliana cysteine
           protease component of protease-inhibitor complex
           (At5g43060) mRNA, complete cds.
          Length = 463

 Score =  134 bits (336), Expect = 1e-30
 Identities = 73/168 (43%), Positives = 102/168 (60%), Gaps = 6/168 (3%)
 Frame = +1

Query: 94  TALDEEPSMLER-HEKWMVHHGRSYKND----AEKAKRFKIFEQNVKFIESFNKAGNQSY 258
           T      S +ER +E WMV HG+   N     AEK +RF+IF+ N++FI+  N   N SY
Sbjct: 37  TETSRSDSEVERIYEAWMVEHGKKKMNQNGLGAEKDQRFEIFKDNLRFIDEHNTK-NLSY 95

Query: 259 KLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDI 438
           KLG+ +F+DLTNEE+++  L  G                     +P+ +DWR++GAV D+
Sbjct: 96  KLGLTRFADLTNEEYRSMYL--GAKPTKRVLKTSDRYQARVGDALPDSVDWRKEGAVADV 153

Query: 439 KNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
           K+QG CG CWAFS + A+EGI +I TG L+ LSEQ+L+DC+   N GC
Sbjct: 154 KDQGSCGSCWAFSTIGAVEGINKIVTGDLISLSEQELVDCDTSYNQGC 201



>pir|A86341|A86341 cysteine proteinase (EC 3.4.22.-) [similarity] -
           Arabidopsis thaliana>gb:AE005172_891044 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC007369_1535817 Arabidopsis thaliana
           chromosome I BAC F9H16 genomic sequence, complete
           sequence.>gb:BT004822_1637856 Arabidopsis thaliana
           At1g20850 gene, complete cds.>gb:AF191028_1775462
           Arabidopsis thaliana papain-type cysteine endopeptidase
           XCP2 mRNA, complete cds.
          Length = 356

 Score =  134 bits (336), Expect = 1e-30
 Identities = 81/200 (40%), Positives = 115/200 (57%), Gaps = 11/200 (5%)
 Frame = +1

Query: 13  LSSMASNFDFQLILAAVLLLGAFASQA--TALDEEPSMLERHEK-------WMVHHGRSY 165
           LSS +    F L L+A  L  +FAS    + +   P  LE H+K       W+ +  ++Y
Sbjct: 3   LSSPSRILCFALALSAASLSLSFASSHDYSIVGYSPEDLESHDKLIELFENWISNFEKAY 62

Query: 166 KNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLN-EGXXXXX 342
           +   EK  RF++F+ N+K I+  NK G +SY LG+ +F+DL++EEFK   L  +      
Sbjct: 63  ETVEEKFLRFEVFKDNLKHIDETNKKG-KSYWLGLNEFADLSHEEFKKMYLGLKTDIVRR 121

Query: 343 XXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQ 522
                        +  VP+ +DWR+KGAV ++KNQG CG CWAFS VAA+EGI +I TG 
Sbjct: 122 DEERSYAEFAYRDVEAVPKSVDWRKKGAVAEVKNQGSCGSCWAFSTVAAVEGINKIVTGN 181

Query: 523 LMRLSEQQLLDCNLK-NYGC 579
           L  LSEQ+L+DC+   N GC
Sbjct: 182 LTTLSEQELIDCDTTYNNGC 201



>sp|P43297|RD21_ARATH Cysteine proteinase RD21a precursor (EC
           3.4.22.-) (RD21).>pir|JN0719|JN0719 drought-inducible
           cysteine proteinase (EC 3.4.22.-) RD21A precursor -
           Arabidopsis thaliana>gb:AE005173_892683 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:ATHRD21A_1553342 Arabidopsis thaliana rd21A
           gene for thiol protease, complete
           cds.>gb:AY072130_1567024 Arabidopsis thaliana putative
           cysteine proteinase RD21A (At1g47128) mRNA, complete
           cds.>gb:AY133781_1581601 Arabidopsis thaliana clone
           U11707 putative cysteine proteinase RD21A (At1g47128)
           mRNA, complete cds.>gb:AC083835_1733197 Arabidopsis
           thaliana chromosome 1 BAC F2G19 genomic sequence,
           complete sequence.
          Length = 462

 Score =  134 bits (336), Expect = 1e-30
 Identities = 66/160 (41%), Positives = 102/160 (63%), Gaps = 3/160 (1%)
 Frame = +1

Query: 109 EPSMLERHEKWMVHHGRSYKNDA--EKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFS 282
           E  ++  +E W+V HG++   ++  EK +RF+IF+ N++F++  N+  N SY+LG+ +F+
Sbjct: 43  EAEVMSIYEAWLVKHGKAQSQNSLVEKDRRFEIFKDNLRFVDEHNEK-NLSYRLGLTRFA 101

Query: 283 DLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGC 462
           DLTN+E+++  L                       E+PE +DWR+KGAV ++K+QG CG 
Sbjct: 102 DLTNDEYRSKYLGAKMEKKGERRTSLRYEARVG-DELPESIDWRKKGAVAEVKDQGGCGS 160

Query: 463 CWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
           CWAFS + A+EGI QI TG L+ LSEQ+L+DC+   N GC
Sbjct: 161 CWAFSTIGAVEGINQIVTGDLITLSEQELVDCDTSYNEGC 200



>sp|P25250|CYS2_HORVU Cysteine proteinase EP-B 2 precursor (EC
           3.4.22.-).>pir|JQ1110|JQ1110 cysteine proteinase (EC
           3.4.22.-) EP-B 4 precursor - barley>gb:HVU19384_1682571
           Hordeum vulgare cysteine proteinase EPB2 gene, complete
           cds.
          Length = 373

 Score =  134 bits (336), Expect = 1e-30
 Identities = 72/181 (39%), Positives = 106/181 (58%), Gaps = 3/181 (1%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFI 225
           L +AAV L  A   +   L+ E ++ + +E+W   H R  ++ AEK +RF  F+ N  FI
Sbjct: 18  LAVAAVELCSAIPMEDKDLESEEALWDLYERWQSAH-RVRRHHAEKHRRFGTFKSNAHFI 76

Query: 226 ESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESL--AEVPE 399
            S NK G+  Y+L + +F D+   EF+AT + +                  +L  +++P 
Sbjct: 77  HSHNKRGDHPYRLHLNRFGDMDQAEFRATFVGDLRRDTPSKPPSVPGFMYAALNVSDLPP 136

Query: 400 YLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCN-LKNYG 576
            +DWR+KGAVT +K+QG CG CWAFS V ++EGI  IRTG L+ LSEQ+L+DC+   N G
Sbjct: 137 SVDWRQKGAVTGVKDQGKCGSCWAFSTVVSVEGINAIRTGSLVSLSEQELIDCDTADNDG 196

Query: 577 C 579
           C
Sbjct: 197 C 197



>sp|P25249|CYS1_HORVU Cysteine proteinase EP-B 1 precursor (EC
           3.4.22.-).>pir|JQ1111|JQ1111 cysteine proteinase (EC
           3.4.22.-) EP-B 1 precursor - barley>gb:HVU19359_1682570
           Hordeum vulgare cysteine proteinase EPB1 gene, complete
           cds.
          Length = 371

 Score =  134 bits (336), Expect = 1e-30
 Identities = 72/181 (39%), Positives = 106/181 (58%), Gaps = 3/181 (1%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFI 225
           L +AAV L  A   +   L+ E ++ + +E+W   H R  ++ AEK +RF  F+ N  FI
Sbjct: 18  LAVAAVELCSAIPMEDKDLESEEALWDLYERWQSAH-RVRRHHAEKHRRFGTFKSNAHFI 76

Query: 226 ESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESL--AEVPE 399
            S NK G+  Y+L + +F D+   EF+AT + +                  +L  +++P 
Sbjct: 77  HSHNKRGDHPYRLHLNRFGDMDQAEFRATFVGDLRRDTPAKPPSVPGFMYAALNVSDLPP 136

Query: 400 YLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCN-LKNYG 576
            +DWR+KGAVT +K+QG CG CWAFS V ++EGI  IRTG L+ LSEQ+L+DC+   N G
Sbjct: 137 SVDWRQKGAVTGVKDQGKCGSCWAFSTVVSVEGINAIRTGSLVSLSEQELIDCDTADNDG 196

Query: 577 C 579
           C
Sbjct: 197 C 197



>gb:AY504967_1609833 Iris hollandica putative cysteine protease 2
           (CYS2) mRNA, complete cds.
          Length = 359

 Score =  133 bits (335), Expect = 2e-30
 Identities = 69/164 (42%), Positives = 102/164 (62%), Gaps = 4/164 (2%)
 Frame = +1

Query: 100 LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKF 279
           L  E S+   +E+W  HH  S ++ +EK KRF +F++N KFI  FNK  +  YKLG+ KF
Sbjct: 30  LASEESLWGLYERWRSHHTVS-RDLSEKNKRFNVFKENAKFIHEFNKK-DAPYKLGLNKF 87

Query: 280 SDLTNEEFKATMLNEGXXXXXXXXXXXXXXXN---ESLAEVPEYLDWREKGAVTDIKNQG 450
           +D+TN+EF++T                    +   E++  +P  +DWR +GAV  +K+QG
Sbjct: 88  ADMTNQEFRSTYAGSKIHHHRTQRGTPRATGSFMYENVHSIPASVDWRTQGAVAPVKDQG 147

Query: 451 YCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL-KNYGC 579
            CG CWAFS +A++EGI +I+T QL+ LS QQL+DC+  +N GC
Sbjct: 148 QCGSCWAFSTIASVEGINKIKTNQLVPLSGQQLVDCDTDQNEGC 191



>gb:AY192361_1588666 Trifolium repens cysteine protease 14 mRNA,
           complete cds.
          Length = 351

 Score =  133 bits (335), Expect = 2e-30
 Identities = 74/188 (39%), Positives = 108/188 (57%), Gaps = 1/188 (0%)
 Frame = +1

Query: 19  SMASNFDFQLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFK 198
           S+A   DF ++       G  +    ++D+   ++E  E WM  HG+ Y+   EK  RF+
Sbjct: 20  SLAFGRDFSIV-------GYSSEDLKSMDK---LIELFESWMSRHGKIYETIEEKLLRFE 69

Query: 199 IFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNE 378
           +F+ N+K I+  NK  + +Y LG+ +F+DL+++EFK   L                    
Sbjct: 70  VFKDNLKHIDERNKIVS-NYWLGLNEFADLSHQEFKNKYLGLKVNLSQRRESSNEEEFTY 128

Query: 379 SLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC 558
              ++P+ +DWR+KGAVT +KNQG CG CWAFS VAA+EGI QI TG L  LSEQ+L+DC
Sbjct: 129 RDVDLPKSVDWRKKGAVTPVKNQGQCGSCWAFSTVAAVEGINQIVTGNLTSLSEQELIDC 188

Query: 559 NLK-NYGC 579
           +   N GC
Sbjct: 189 DTTYNNGC 196



>gb:AY192360_1588665 Trifolium repens cysteine protease 14 gene,
           complete cds.
          Length = 351

 Score =  133 bits (335), Expect = 2e-30
 Identities = 74/188 (39%), Positives = 108/188 (57%), Gaps = 1/188 (0%)
 Frame = +1

Query: 19  SMASNFDFQLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFK 198
           S+A   DF ++       G  +    ++D+   ++E  E WM  HG+ Y+   EK  RF+
Sbjct: 20  SLAFGRDFSIV-------GYSSEDLKSMDK---LIELFESWMSRHGKIYETIEEKLLRFE 69

Query: 199 IFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNE 378
           +F+ N+K I+  NK  + +Y LG+ +F+DL+++EFK   L                    
Sbjct: 70  VFKDNLKHIDDRNKIVS-NYWLGLNEFADLSHQEFKNKYLGLKVDLSQRRESSNEEEFTY 128

Query: 379 SLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC 558
              ++P+ +DWR+KGAVT +KNQG CG CWAFS VAA+EGI QI TG L  LSEQ+L+DC
Sbjct: 129 RDVDLPKSVDWRKKGAVTPVKNQGQCGSCWAFSTVAAVEGINQIVTGNLTSLSEQELIDC 188

Query: 559 NLK-NYGC 579
           +   N GC
Sbjct: 189 DTTYNNGC 196



>gb:AF388175_1794932 Arabidopsis thaliana papain-like cysteine
           peptidase XBCP3 mRNA, complete cds.
          Length = 437

 Score =  133 bits (334), Expect = 2e-30
 Identities = 72/188 (38%), Positives = 107/188 (56%), Gaps = 1/188 (0%)
 Frame = +1

Query: 19  SMASNFDFQLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFK 198
           SM+S+    L    +LL+ + +S          + E  + W   HG++Y ++ E+ +R +
Sbjct: 2   SMSSSSFISLTFFFLLLVSSSSSS-------DDISELFDDWCQKHGKTYGSEEERQQRIQ 54

Query: 199 IFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNE 378
           IF+ N  F+   N   N +Y L +  F+DLT+ EFKA+ L                    
Sbjct: 55  IFKDNHDFVTQHNLITNATYSLSLNAFADLTHHEFKASRLGLSVSAPSVIMASKGQSLGG 114

Query: 379 SLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC 558
           S+ +VP+ +DWR+KGAVT++K+QG CG CW+FSA  AMEGI QI TG L+ LSEQ+L+DC
Sbjct: 115 SV-KVPDSVDWRKKGAVTNVKDQGSCGACWSFSATGAMEGINQIVTGDLISLSEQELIDC 173

Query: 559 NLK-NYGC 579
           +   N GC
Sbjct: 174 DKSYNAGC 181



>gb:OSJN00065_1694210 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0085F13, complete sequence.
          Length = 383

 Score =  133 bits (334), Expect = 2e-30
 Identities = 78/216 (36%), Positives = 111/216 (51%), Gaps = 36/216 (16%)
 Frame = +1

Query: 22  MASNFDFQLILAAVLLLGAFAS------------QATALDEEPS-------MLERHEKWM 144
           MAS+  F+L LA VLLL                  AT  +E          M++R  +WM
Sbjct: 1   MASSPPFRLPLAVVLLLAIICVLLASPSCHADDLTATMTNEHEKEHQLMMMMMDRFHRWM 60

Query: 145 VHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLN- 321
             H RSY +  EK +RF+++  N++FIE+ N+ G+ ++KLG   F+DLT+EEF AT    
Sbjct: 61  ATHNRSYASADEKLRRFEVYRSNMEFIEATNRNGSLTFKLGETPFTDLTHEEFLATYTGD 120

Query: 322 ----------------EGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGY 453
                           E                      VPE +DWR++GAVT  K+QG 
Sbjct: 121 VRLPPERRGMQDDSDEEDAVITTSAGYVAGAGAGRRTVAVPESVDWRKEGAVTPAKHQGQ 180

Query: 454 CGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCN 561
           C  CWAF+AVAA+E + +I+ G L+ LSEQ+L+DC+
Sbjct: 181 CAACWAFAAVAAIESLHKIKGGDLISLSEQELVDCD 216



>gb:H0212B02_1681314 Oryza sativa genomic DNA, chromosome 4, BAC
           clone:H0212B02, complete sequence.
          Length = 461

 Score =  133 bits (334), Expect = 2e-30
 Identities = 78/191 (40%), Positives = 112/191 (58%), Gaps = 13/191 (6%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATAL-------DEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIF 204
           L  AA+LLL + A+   ++       +EE   L  + +W   HG++Y    E+ +R+  F
Sbjct: 7   LAAAALLLLLSLAAADMSIVSYGERSEEEARRL--YAEWKAEHGKNYNAVGEEERRYAAF 64

Query: 205 EQNVKFIESFNKA---GNQSYKLGVKKFSDLTNEEFKATMLN--EGXXXXXXXXXXXXXX 369
             N+++I+  N A   G  S++LG+ +F+DLTNEE++ T L                   
Sbjct: 65  RDNLRYIDEHNAAADAGVHSFRLGLNRFADLTNEEYRDTYLGLRNKPRRERKVSDRYLAA 124

Query: 370 XNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQL 549
            NE+L   PE +DWR KGAV +IK+QG CG CWAFSA+AA+EGI QI TG L+ LSEQ+L
Sbjct: 125 DNEAL---PESVDWRTKGAVAEIKDQGGCGSCWAFSAIAAVEGINQIVTGDLISLSEQEL 181

Query: 550 LDCNLK-NYGC 579
           +DC+   N GC
Sbjct: 182 VDCDTSYNEGC 192



>gb:CPA131996_1648455 Carica papaya mRNA for chymopapain isoform
           III.
          Length = 361

 Score =  133 bits (334), Expect = 2e-30
 Identities = 64/155 (41%), Positives = 94/155 (60%), Gaps = 1/155 (0%)
 Frame = +1

Query: 118 MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNE 297
           +++  + WM+ H + Y++  EK  RF+IF  N+ +I+  NK  N SY LG+  F+DL+N+
Sbjct: 44  LIQLFDSWMLKHNKIYESIDEKIYRFEIFRDNLMYIDETNKKNN-SYWLGLNGFADLSND 102

Query: 298 EFKATMLN-EGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAF 474
           EFK   +                    + +   P+ +DWR KGAVT +KNQG CG CWAF
Sbjct: 103 EFKKKYVGFVAEDFTGLEHFDNEDFTYKHVTNYPQSIDWRAKGAVTPVKNQGACGSCWAF 162

Query: 475 SAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           S +A +EGI +I TG L+ LSEQ+L+DC+  +YGC
Sbjct: 163 STIATVEGINKIVTGNLLELSEQELVDCDKHSYGC 197



>gb:CPA131995_1648454 Carica papaya mRNA for chymopapain isoform II.
          Length = 352

 Score =  133 bits (334), Expect = 2e-30
 Identities = 64/155 (41%), Positives = 94/155 (60%), Gaps = 1/155 (0%)
 Frame = +1

Query: 118 MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNE 297
           +++  + WM+ H + Y++  EK  RF+IF  N+ +I+  NK  N SY LG+  F+DL+N+
Sbjct: 44  LIQLFDSWMLKHNKIYESIDEKIYRFEIFRDNLMYIDETNKKNN-SYWLGLNGFADLSND 102

Query: 298 EFKATMLN-EGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAF 474
           EFK   +                    + +   P+ +DWR KGAVT +KNQG CG CWAF
Sbjct: 103 EFKKKYVGFVAEDFTGLEHFDNEDFTYKHVTNYPQSIDWRAKGAVTPVKNQGACGSCWAF 162

Query: 475 SAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           S +A +EGI +I TG L+ LSEQ+L+DC+  +YGC
Sbjct: 163 STIATVEGINKIVTGNLLELSEQELVDCDKHSYGC 197



>pir|D86198|D86198 cysteine proteinase (EC 3.4.22.-) [similarity] -
           Arabidopsis thaliana>gb:AE005172_889644 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:F9P14_1678765 Sequence of BAC F9P14 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 343

 Score =  133 bits (334), Expect = 2e-30
 Identities = 74/187 (39%), Positives = 106/187 (56%), Gaps = 3/187 (1%)
 Frame = +1

Query: 28  SNFDFQLILAAVLLLGAFAS-QATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIF 204
           SN    +++  VL+     S  ++  D   ++ +R EKW+  H + Y    E   RF I+
Sbjct: 8   SNLTLAVLICFVLIASKLCSVDSSVYDPHKTLKQRFEKWLKTHSKLYGGRDEWMLRFGIY 67

Query: 205 EQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESL 384
           + NV+ I+  N   +  +KL   +F+D+TN EFKA  L  G                +  
Sbjct: 68  QSNVQLIDYINSL-HLPFKLTDNRFADMTNSEFKAHFL--GLNTSSLRLHKKQRPVCDPA 124

Query: 385 AEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL 564
             VP+ +DWR +GAVT I+NQG CG CWAFSAVAA+EGI +I+TG L+ LSEQQL+DC++
Sbjct: 125 GNVPDAVDWRTQGAVTPIRNQGKCGGCWAFSAVAAIEGINKIKTGNLVSLSEQQLIDCDV 184

Query: 565 KNY--GC 579
             Y  GC
Sbjct: 185 GTYNKGC 191



>sp|P14080|PAP2_CARPA Chymopapain precursor (EC 3.4.22.6) (Papaya
           proteinase II) (PPII).>pir|T09760|T09760 chymopapain (EC
           3.4.22.6) precursor [validated] -
           papaya>gb:CPCHYM_1648560 C.papaya mRNA for chymopapain.
          Length = 352

 Score =  133 bits (334), Expect = 2e-30
 Identities = 64/155 (41%), Positives = 94/155 (60%), Gaps = 1/155 (0%)
 Frame = +1

Query: 118 MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNE 297
           +++  + WM+ H + Y++  EK  RF+IF  N+ +I+  NK  N SY LG+  F+DL+N+
Sbjct: 44  LIQLFDSWMLKHNKIYESIDEKIYRFEIFRDNLMYIDETNKKNN-SYWLGLNGFADLSND 102

Query: 298 EFKATMLN-EGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAF 474
           EFK   +                    + +   P+ +DWR KGAVT +KNQG CG CWAF
Sbjct: 103 EFKKKYVGFVAEDFTGLEHFDNEDFTYKHVTNYPQSIDWRAKGAVTPVKNQGACGSCWAF 162

Query: 475 SAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           S +A +EGI +I TG L+ LSEQ+L+DC+  +YGC
Sbjct: 163 STIATVEGINKIVTGNLLELSEQELVDCDKHSYGC 197



>gb:OSJN00032_1693605 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0043A12, complete sequence.
          Length = 466

 Score =  132 bits (333), Expect = 3e-30
 Identities = 69/172 (40%), Positives = 105/172 (61%), Gaps = 9/172 (5%)
 Frame = +1

Query: 91  ATALDEEPSMLER---HEKWMVHHGRSYKN--DAEKAKRFKIFEQNVKFIESFNKAGNQ- 252
           A  L+E P+  E    ++ W+  +G    N    E  +RF +F  N+KF+++ N   ++ 
Sbjct: 36  ARGLEEGPTEAEARAAYDLWLAENGGGSPNALGGEHERRFLVFWDNLKFVDAHNARADER 95

Query: 253 -SYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAV 429
             ++LG+ +F+DLTNEEF+AT L  G               ++ + E+PE +DWREKGAV
Sbjct: 96  GGFRLGMNRFADLTNEEFRATFL--GAKVAERSRAAGERYRHDGVEELPESVDWREKGAV 153

Query: 430 TDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC--NLKNYGC 579
             +KNQG CG CWAFSAV+ +E I Q+ TG+++ LSEQ+L++C  N +N GC
Sbjct: 154 APVKNQGQCGSCWAFSAVSTVESINQLVTGEMITLSEQELVECSTNGQNSGC 205



>pir|S22502|S22502 cysteine proteinase (EC 3.4.22.-) - kidney bean
          Length = 362

 Score =  132 bits (333), Expect = 3e-30
 Identities = 76/193 (39%), Positives = 113/193 (58%), Gaps = 7/193 (3%)
 Frame = +1

Query: 22  MASNFDFQLILAAVLLLG---AFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKR 192
           MA+     ++L+  L+LG   +F      L  E S+ + +E+W  HH  S ++  EK KR
Sbjct: 1   MATKKLLWVVLSFSLVLGVANSFDFHDKDLASEESLWDLYERWRSHHTVS-RSLGEKHKR 59

Query: 193 FKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXX---XX 363
           F +F+ N+  + + NK  ++ YKL + KF+D+TN EF++T                    
Sbjct: 60  FNVFKANLMHVHNTNKM-DKPYKLKLNKFADMTNHEFRSTYAGSKVNHHRMFRGTPHENG 118

Query: 364 XXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQ 543
               E +  VP  +DWR+KGAVTD+K+QG CG CWAFS V A+EGI QI+T +L+ LSEQ
Sbjct: 119 AFMYEKVVSVPPSVDWRKKGAVTDVKDQGQCGSCWAFSTVVAVEGINQIKTNKLVALSEQ 178

Query: 544 QLLDCNL-KNYGC 579
           +L+DC+  +N GC
Sbjct: 179 ELVDCDKEENQGC 191



>sp|P25777|ORYB_ORYSA Oryzain beta chain precursor (EC
           3.4.22.-).>pir|JU0389|KHRZOB oryzain (EC 3.4.22.-) beta
           precursor - rice>gb:RICOZB_1703710 Oryza sativa
           (japonica cultivar-group) mRNA for oryzain beta,
           complete cds.
          Length = 471

 Score =  132 bits (333), Expect = 3e-30
 Identities = 69/172 (40%), Positives = 105/172 (61%), Gaps = 9/172 (5%)
 Frame = +1

Query: 91  ATALDEEPSMLER---HEKWMVHHGRSYKN--DAEKAKRFKIFEQNVKFIESFNKAGNQS 255
           A  L+E P+  E    ++ W+  +G    N    E  +RF +F  N+KF+++ N   ++ 
Sbjct: 35  ARGLEEGPTEAEARAAYDLWLAENGGGSPNALGGEHERRFLVFWDNLKFVDAHNARADEG 94

Query: 256 --YKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAV 429
             ++LG+ +F+DLTNEEF+AT L  G               ++ + E+PE +DWREKGAV
Sbjct: 95  GGFRLGMNRFADLTNEEFRATFL--GAKVAERSRAAGERYRHDGVEELPESVDWREKGAV 152

Query: 430 TDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC--NLKNYGC 579
             +KNQG CG CWAFSAV+ +E I Q+ TG+++ LSEQ+L++C  N +N GC
Sbjct: 153 APVKNQGQCGSCWAFSAVSTVESINQLVTGEMITLSEQELVECSTNGQNSGC 204



>gb:AP001633_1821394 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0515G01.>gb:AP002861_1823230 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0665D10.
          Length = 349

 Score =  132 bits (332), Expect = 4e-30
 Identities = 74/182 (40%), Positives = 101/182 (55%), Gaps = 6/182 (3%)
 Frame = +1

Query: 52  LAAVLLLGAFASQATALD------EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQN 213
           +A +LL    A QA A D      ++    +  E+WM   G+ Y    EK  RF +F  N
Sbjct: 9   IAVILLCTFLAFQAMAADAYGGGGDDGVTTQMFEEWMAKFGKKYPCHGEKEYRFGVFRDN 68

Query: 214 VKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEV 393
           V+FI S+      +  L V +F+DLTN+EF +T                          +
Sbjct: 69  VRFIRSYRPPAGYNSALRVNQFADLTNDEFVST------HTGAKPPCPKDAPRGVDPIWL 122

Query: 394 PEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNY 573
           P  +DWR KGAVTD+K+QG CG CWAF+AVAA+EG+TQIRTG+L  LSEQ+L+DC+  + 
Sbjct: 123 PCCIDWRYKGAVTDVKDQGACGSCWAFAAVAAIEGLTQIRTGKLTPLSEQELVDCDTGSS 182

Query: 574 GC 579
           GC
Sbjct: 183 GC 184



>gb:PVEPC1_1702940 Phaseolus vulgaris mRNA for endopeptidase
           (EP-C1).
          Length = 361

 Score =  132 bits (332), Expect = 4e-30
 Identities = 74/185 (40%), Positives = 110/185 (59%), Gaps = 7/185 (3%)
 Frame = +1

Query: 46  LILAAVLLLG---AFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV 216
           ++L+  L+LG   +F      L  E S+ + +E+W  HH  S ++  EK KRF +F+ N+
Sbjct: 8   VVLSFSLVLGVANSFDFHDKDLASEESLWDLYERWRSHHTVS-RSLGEKHKRFNVFKANL 66

Query: 217 KFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXX---XXXXXNESLA 387
             + + NK  ++ YKL + KF+D+TN EF++T                        E + 
Sbjct: 67  MHVHNTNKM-DKPYKLKLNKFADMTNHEFRSTYAGSKVNHHRMFRGTPHENGAFMYEKVV 125

Query: 388 EVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL- 564
            VP  +DWR+KGAVTD+K+QG CG CWAFS V A+EGI QI+T +L+ LSEQ+L+DC+  
Sbjct: 126 SVPPSVDWRKKGAVTDVKDQGQCGSCWAFSTVVAVEGINQIKTNKLVALSEQELVDCDKE 185

Query: 565 KNYGC 579
           +N GC
Sbjct: 186 ENQGC 190



>gb:D14057_1674466 Ananas comosus mRNA for bromelain, partial cds.
          Length = 312

 Score =  132 bits (332), Expect = 4e-30
 Identities = 65/146 (44%), Positives = 92/146 (63%)
 Frame = +1

Query: 142 MVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLN 321
           M  +GR YK++ EK +RF+IF+ NV  IE+FN     SY LG+ KF+D+TN EF A    
Sbjct: 1   MAEYGRVYKDNDEKMRRFQIFKNNVNHIETFNNRNGNSYTLGINKFTDMTNNEFVAQYTG 60

Query: 322 EGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGI 501
                            + +++ V + +DWR+ GAVT++K+Q  CG CWAFSA+A +EGI
Sbjct: 61  GISRPLNIEKEPVVSFDDVNISAVGQSIDWRDYGAVTEVKDQNPCGSCWAFSAIATVEGI 120

Query: 502 TQIRTGQLMRLSEQQLLDCNLKNYGC 579
            +I TG L+ LSEQ++LDC + N GC
Sbjct: 121 YKIVTGYLVSLSEQEVLDCAVSN-GC 145



>sp|P25803|CYSP_PHAVU Vignain precursor (EC 3.4.22.-) (Bean
           endopeptidase) (Cysteine proteinase
           EP-C1).>gb:PVENDO_1702939 P.vulgaris gene for
           endopeptidase.
          Length = 362

 Score =  132 bits (332), Expect = 4e-30
 Identities = 76/193 (39%), Positives = 113/193 (58%), Gaps = 7/193 (3%)
 Frame = +1

Query: 22  MASNFDFQLILAAVLLLG---AFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKR 192
           MA+     ++L+  L+LG   +F      L  E S+ + +E+W  HH  S ++  EK KR
Sbjct: 1   MATKKLLWVVLSFSLVLGVANSFDFHDKDLASEESLWDLYERWRSHHTVS-RSLGEKHKR 59

Query: 193 FKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXX---XX 363
           F +F+ N+  + + NK  ++ YKL + KF+D+TN EF++T                    
Sbjct: 60  FNVFKANLMHVHNTNKM-DKPYKLKLNKFADMTNHEFRSTYAGSKVNHPRMFRGTPHENG 118

Query: 364 XXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQ 543
               E +  VP  +DWR+KGAVTD+K+QG CG CWAFS V A+EGI QI+T +L+ LSEQ
Sbjct: 119 AFMYEKVVSVPPSVDWRKKGAVTDVKDQGQCGSCWAFSTVVAVEGINQIKTNKLVALSEQ 178

Query: 544 QLLDCNL-KNYGC 579
           +L+DC+  +N GC
Sbjct: 179 ELVDCDKEENQGC 191



>gb:AY700588_1623606 Zingiber officinale cysteine protease gp3b
           mRNA, complete cds.
          Length = 466

 Score =  132 bits (331), Expect = 5e-30
 Identities = 72/194 (37%), Positives = 111/194 (57%), Gaps = 18/194 (9%)
 Frame = +1

Query: 52  LAAVLLLGAFASQATAL--------------DEEPSMLERHEKWMVHHGRSYKNDAEKAK 189
           +A VLLL   +S  TA+              DEE  ++  +++W   H  +  +      
Sbjct: 5   VAVVLLLLLSSSALTAVSAVPHLDILPAGRSDEEVRII--YQEWRAKHRPAENDQYVGDY 62

Query: 190 RFKIFEQNVKFIESFNKA---GNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXX 360
           R ++F++N++F++  N A   G  +Y+LG+ +F+DLTNEE++A  L +            
Sbjct: 63  RLEVFKENLRFVDEHNAAADRGEHAYRLGMNRFADLTNEEYRARFLRDLSRLGRSTSGEI 122

Query: 361 XXXXNESLAEV-PEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLS 537
                    +V P+ +DWREKGAV  +K+QG CG CWAF+A+A +EGI QI TG L+ LS
Sbjct: 123 SNQYRLREGDVLPDSIDWREKGAVVAVKSQGRCGSCWAFAAIATVEGINQIVTGDLISLS 182

Query: 538 EQQLLDCNLKNYGC 579
           EQQL+DC+ +N+GC
Sbjct: 183 EQQLVDCSTRNHGC 196



>gb:AY192362_1588667 Trifolium repens cysteine protease 1 gene,
           partial cds.
          Length = 292

 Score =  132 bits (331), Expect = 5e-30
 Identities = 68/137 (49%), Positives = 91/137 (66%), Gaps = 3/137 (2%)
 Frame = +1

Query: 178 EKAKRFKIFEQNVKFIESFNKA-GNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXX 354
           E+ KR +IF +NV +IE+ N A  N+ YKL + KF+DLTNEEF A+  N+          
Sbjct: 3   EREKRLRIFNKNVNYIEASNSAVNNKLYKLSINKFADLTNEEFIASR-NKFKGHMCSSII 61

Query: 355 XXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRL 534
                  E+ + +P  +DWR+KGAVT +KNQG CG CWAFSAVAA EGI Q+ TG+L+ L
Sbjct: 62  RTTTFKYENASAIPSTVDWRKKGAVTPVKNQGQCGSCWAFSAVAATEGIHQLSTGKLVSL 121

Query: 535 SEQQLLDCNLK--NYGC 579
           SEQ+L+DC+ K  + GC
Sbjct: 122 SEQELIDCDTKGVDQGC 138



>pir|G86232|G86232 cysteine proteinase (EC 3.4.22.-) [similarity] -
           Arabidopsis thaliana>gb:AE005172_889990 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:F21M12_1677863 Sequence of BAC F21M12 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 416

 Score =  132 bits (331), Expect = 5e-30
 Identities = 65/153 (42%), Positives = 93/153 (60%), Gaps = 1/153 (0%)
 Frame = +1

Query: 124 ERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEF 303
           E  + W   HG++Y ++ E+ +R +IF+ N  F+   N   N +Y L +  F+DLT+ EF
Sbjct: 28  ELFDDWCQKHGKTYGSEEERQQRIQIFKDNHDFVTQHNLITNATYSLSLNAFADLTHHEF 87

Query: 304 KATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAV 483
           KA+ L                    S+ +VP+ +DWR+KGAVT++K+QG CG CW+FSA 
Sbjct: 88  KASRLGLSVSAPSVIMASKGQSLGGSV-KVPDSVDWRKKGAVTNVKDQGSCGACWSFSAT 146

Query: 484 AAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
            AMEGI QI TG L+ LSEQ+L+DC+   N GC
Sbjct: 147 GAMEGINQIVTGDLISLSEQELIDCDKSYNAGC 179



>sp|P25776|ORYA_ORYSA Oryzain alpha chain precursor (EC
           3.4.22.-).>pir|JU0388|KHRZOA oryzain (EC 3.4.22.-) alpha
           precursor - rice>gb:RICOZA_1703709 Oryza sativa
           (japonica cultivar-group) mRNA for oryzain alpha,
           complete cds.
          Length = 458

 Score =  131 bits (330), Expect = 7e-30
 Identities = 78/191 (40%), Positives = 111/191 (58%), Gaps = 13/191 (6%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATAL-------DEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIF 204
           L  AA+LLL + A+   ++       +EE   L  + +W   HG+SY    E+ +R+  F
Sbjct: 7   LAAAALLLLLSLAAADMSIVSYGERSEEEARRL--YAEWKAEHGKSYNAVGEEERRYAAF 64

Query: 205 EQNVKFIESFNKA---GNQSYKLGVKKFSDLTNEEFKATMLN--EGXXXXXXXXXXXXXX 369
             N+++I+  N A   G  S++LG+ +F+DLTNEE++ T L                   
Sbjct: 65  RDNLRYIDEHNAAADAGVHSFRLGLNRFADLTNEEYRDTYLGLRNKPRRERKVSDRYLAA 124

Query: 370 XNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQL 549
            NE+L   PE +DWR KGAV +IK+QG CG CWAFSA+AA+E I QI TG L+ LSEQ+L
Sbjct: 125 DNEAL---PESVDWRTKGAVAEIKDQGGCGSCWAFSAIAAVEDINQIVTGDLISLSEQEL 181

Query: 550 LDCNLK-NYGC 579
           +DC+   N GC
Sbjct: 182 VDCDTSYNEGC 192



>gb:AP003928_1835387 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1150_A11.
          Length = 385

 Score =  131 bits (329), Expect = 9e-30
 Identities = 75/188 (39%), Positives = 108/188 (57%), Gaps = 12/188 (6%)
 Frame = +1

Query: 52  LAAVLLLGAFASQATALD-------EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQ 210
           +A V+LLGA A  A+A++        E ++ E +E+W   H R  ++  EKA+RF +F+ 
Sbjct: 15  VAVVVLLGAAAPAASAMEFGDKDVASEEALWELYERWRGQH-RVARDLGEKARRFNVFKD 73

Query: 211 NVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLA- 387
           NV+ I  FN+  ++ YKL + +F D+T +EF+    +                     A 
Sbjct: 74  NVRLIHEFNRR-DEPYKLRLNRFGDMTADEFRRAYASSRVSHHRMFRGRGERRSGFMYAG 132

Query: 388 --EVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCN 561
             ++P  +DWREKGAV  +K+QG CG CWAFS +AA+EGI  IRT  L  LSEQQL+DC+
Sbjct: 133 ARDLPAAVDWREKGAVGAVKDQGQCGSCWAFSTIAAVEGINAIRTSNLTALSEQQLVDCD 192

Query: 562 LK--NYGC 579
            K  N GC
Sbjct: 193 TKTGNAGC 200



>gb:DCU17135_1675750 Dianthus caryophyllus cysteine proteinase
           (DCCP1) mRNA, partial cds.
          Length = 427

 Score =  130 bits (328), Expect = 1e-29
 Identities = 66/154 (42%), Positives = 92/154 (59%), Gaps = 5/154 (3%)
 Frame = +1

Query: 133 EKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNK----AGNQSYKLGVKKFSDLTNEE 300
           + W+V H ++Y    EK KRF IF  N++FI+  N      G   ++LG+ KF+DLTN+E
Sbjct: 6   QSWLVKHRKNYNALGEKEKRFAIFRDNLEFIDQHNNNNNGGGGGEFELGLNKFADLTNDE 65

Query: 301 FKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSA 480
           F+                       E   E+PE +DWR+KGAV+ +K+QG CG CWAFSA
Sbjct: 66  FRRIYFGVKRPEKAESVKSDRYAVKEG-DELPESVDWRKKGAVSHVKDQGQCGSCWAFSA 124

Query: 481 VAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
           + A+EGI +I TG L+ LSEQ+L+DC+   N GC
Sbjct: 125 IGAVEGINKIVTGDLITLSEQELVDCDTSYNSGC 158



>pir|S57776|S57776 cysteine proteinase (EC 3.4.22.-) - clove pink
           (fragment)
          Length = 427

 Score =  130 bits (328), Expect = 1e-29
 Identities = 66/154 (42%), Positives = 92/154 (59%), Gaps = 5/154 (3%)
 Frame = +1

Query: 133 EKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNK----AGNQSYKLGVKKFSDLTNEE 300
           + W+V H ++Y    EK KRF IF  N++FI+  N      G   ++LG+ KF+DLTN+E
Sbjct: 6   QSWLVKHRKNYNALGEKEKRFAIFRDNLEFIDQHNNNNNGGGGGEFELGLNKFADLTNDE 65

Query: 301 FKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSA 480
           F+                       E   E+PE +DWR+KGAV+ +K+QG CG CWAFSA
Sbjct: 66  FRRIYFGVKRPEKAESVKSDRYAVKEG-DELPESVDWRKKGAVSHVKDQGQCGSCWAFSA 124

Query: 481 VAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
           + A+EGI +I TG L+ LSEQ+L+DC+   N GC
Sbjct: 125 IGAVEGINKIVTGDLITLSEQELVDCDTSYNSGC 158



>gb:AY093066_1575020 Arabidopsis thaliana drought-inducible cysteine
           proteinase RD21A precursor-like protein (At4g11310)
           mRNA, complete cds.>gb:BT000099_1634377 Arabidopsis
           thaliana drought-inducible cysteine proteinase RD21A
           precursor-like protein (At4g11310) mRNA, complete cds.
          Length = 357

 Score =  130 bits (327), Expect = 2e-29
 Identities = 68/164 (41%), Positives = 101/164 (61%), Gaps = 2/164 (1%)
 Frame = +1

Query: 94  TALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVK 273
           +  D E S++   E WMV HG+ Y + AEK +R  IFE N++FI + N A N SY+LG+ 
Sbjct: 32  SVFDAEASLI--FESWMVKHGKVYGSVAEKERRLTIFEDNLRFINNRN-AENLSYRLGLT 88

Query: 274 KFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAE--VPEYLDWREKGAVTDIKNQ 447
            F+DL+  E+K                       ++ A+  +P+ +DWR +GAVT++K+Q
Sbjct: 89  GFADLSLHEYKEVCHGADPRPPRNHVFMTSSDRYKTSADDVLPKSVDWRNEGAVTEVKDQ 148

Query: 448 GYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           G+C  CWAFS V A+EG+ +I TG+L+ LSEQ L++CN +N GC
Sbjct: 149 GHCRSCWAFSTVGAVEGLNKIVTGELVTLSEQDLINCNKENNGC 192



>pir|T06708|T06708 cysteine proteinase (EC 3.4.22.-) T29H11.140 -
           Arabidopsis thaliana>gb:ATT29H11_1555646 Arabidopsis
           thaliana DNA chromosome 3, BAC clone T29H11.
          Length = 361

 Score =  130 bits (327), Expect = 2e-29
 Identities = 69/166 (41%), Positives = 103/166 (62%), Gaps = 6/166 (3%)
 Frame = +1

Query: 100 LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKF 279
           ++ E  +   +++W  HH    ++  E+ KRF +F  NV  + + NK  N+SYKL + KF
Sbjct: 28  IESEEGLSTLYDRWRSHHSVP-RSLNEREKRFNVFRHNVMHVHNTNKK-NRSYKLKLNKF 85

Query: 280 SDLTNEEFK-----ATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKN 444
           +DLT  EFK     + + +                 +E+L+++P  +DWR+KGAVT+IKN
Sbjct: 86  ADLTINEFKNAYTGSNIKHHRMLQGPKRGSKQFMYDHENLSKLPSSVDWRKKGAVTEIKN 145

Query: 445 QGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
           QG CG CWAFS VAA+EGI +I+T +L+ LSEQ+L+DC+ K N GC
Sbjct: 146 QGKCGSCWAFSTVAAVEGINKIKTNKLVSLSEQELVDCDTKQNEGC 191



>sp|Q9SUT0|CPR3_ARATH Putative cysteine proteinase At4g11310
           precursor (EC 3.4.22.-).>pir|T13022|T13022
           drought-inducible cysteine proteinase (EC 3.4.22.-)
           F8L21.100 - Arabidopsis thaliana>gb:ATCHRIV31_1544896
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 31.>gb:ATF8L21_1551242 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F8L21 (ESSA project).
          Length = 364

 Score =  130 bits (327), Expect = 2e-29
 Identities = 68/164 (41%), Positives = 101/164 (61%), Gaps = 2/164 (1%)
 Frame = +1

Query: 94  TALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVK 273
           +  D E S++   E WMV HG+ Y + AEK +R  IFE N++FI + N A N SY+LG+ 
Sbjct: 39  SVFDAEASLI--FESWMVKHGKVYGSVAEKERRLTIFEDNLRFINNRN-AENLSYRLGLT 95

Query: 274 KFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAE--VPEYLDWREKGAVTDIKNQ 447
            F+DL+  E+K                       ++ A+  +P+ +DWR +GAVT++K+Q
Sbjct: 96  GFADLSLHEYKEVCHGADPRPPRNHVFMTSSDRYKTSADDVLPKSVDWRNEGAVTEVKDQ 155

Query: 448 GYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           G+C  CWAFS V A+EG+ +I TG+L+ LSEQ L++CN +N GC
Sbjct: 156 GHCRSCWAFSTVGAVEGLNKIVTGELVTLSEQDLINCNKENNGC 199



>pir|T06529|T06529 cysteine proteinase (EC 3.4.22.-) - garden
           pea>gb:PSU44947_1702507 Pisum sativum putative cysteine
           protease NTH1 mRNA, complete cds.
          Length = 367

 Score =  129 bits (325), Expect = 3e-29
 Identities = 73/183 (39%), Positives = 110/183 (60%), Gaps = 3/183 (1%)
 Frame = +1

Query: 40  FQLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK 219
           + LIL  ++ L      ++    +  ++  +EKW+V H + Y    EK +RF+IF+ N+ 
Sbjct: 6   YSLILFGLITLSLSLDMSSGRSNK-EVMTMYEKWLVKHQKVYYGLGEKNQRFQIFKDNLI 64

Query: 220 FIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNES--LAEV 393
           FI+  N A N SY++G+ +FSD+TN+E++ T L+                  ++    ++
Sbjct: 65  FIDEHN-APNHSYRVGLNEFSDITNKEYRDTYLSRWSNNNIKNKITSVRYAYKAGHNNKL 123

Query: 394 PEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCN-LKN 570
           P  +DWR  GA+T IKNQG CG CWAFSAVAA+E I +I TG L+ LSEQ+L+DC+  KN
Sbjct: 124 PVSVDWR--GALTPIKNQGSCGACWAFSAVAAVEAINKIVTGSLVSLSEQELVDCDRTKN 181

Query: 571 YGC 579
            GC
Sbjct: 182 KGC 184



>gb:AP003852_1834273 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0440D10.
          Length = 342

 Score =  129 bits (323), Expect = 4e-29
 Identities = 72/176 (40%), Positives = 98/176 (55%)
 Frame = +1

Query: 52  LAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIES 231
           L A+  +GA A      D+  +M +  E+WM   G++YK   EK  RF IF  NV FI  
Sbjct: 18  LMALQAMGADAYYNNGSDDGVTM-QMFEEWMAKFGKTYKCHGEKEHRFGIFRDNVHFIRG 76

Query: 232 FNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDW 411
           +         +G+ +F+DLTN+EF AT                           P  +DW
Sbjct: 77  YKPQVTYDSAVGINQFADLTNDEFVATYTGAKPPHPKEAPRPVDPIWT------PCCIDW 130

Query: 412 REKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           R +GAVT +K+QG CG CWAF+AVAA+EG+T+IRTGQL  LSEQ+L+DC+  + GC
Sbjct: 131 RFRGAVTGVKDQGACGSCWAFAAVAAIEGLTKIRTGQLTPLSEQELVDCDTNSNGC 186



>gb:PSA004958_1701891 Pisum sativum mRNA for TPE4A thiol-protease.
          Length = 360

 Score =  129 bits (323), Expect = 4e-29
 Identities = 73/185 (39%), Positives = 104/185 (56%), Gaps = 5/185 (2%)
 Frame = +1

Query: 40  FQLILAAVL-LLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV 216
           F L LA +      F      LD E S+ + +E+W  HH  +   D EK  RF +F+ NV
Sbjct: 9   FSLSLALIFRATNTFDFNEHDLDSEKSLWDLYERWRSHHTVTRSLD-EKHNRFNVFKANV 67

Query: 217 KFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXN---ESLA 387
             + + NK  ++ YKL + KF+D+TN EF+    +                     E++ 
Sbjct: 68  MHVHNTNKL-DKPYKLKLNKFADMTNYEFRRIYADSKVSHHRMFRGMSNENGTFMYENVK 126

Query: 388 EVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL- 564
            VP  +DWR+KGAVTD+K+QG CG CWAFS + A+EGI QI+T +L+ LSEQ+L+DC+  
Sbjct: 127 NVPSSIDWRKKGAVTDVKDQGQCGSCWAFSTIVAVEGINQIKTQKLVSLSEQELVDCDTG 186

Query: 565 KNYGC 579
            N GC
Sbjct: 187 GNEGC 191



>gb:AY043294_1560995 Arabidopsis thaliana cysteine proteinase (GCP1)
           mRNA, complete cds.
          Length = 376

 Score =  129 bits (323), Expect = 4e-29
 Identities = 69/158 (43%), Positives = 96/158 (60%), Gaps = 10/158 (6%)
 Frame = +1

Query: 136 KWMVHHGRSYKNDA----EKAKRFKIFEQNVKFIESFNKAG-NQSYKLGVKKFSDLTNEE 300
           +W   HG++  N+     ++ KRF IF+ N++FI+  N+   N +YKLG+ KF+DLTN+E
Sbjct: 51  QWSAEHGKTNNNNNGIINDQDKRFNIFKDNLRFIDLHNENNKNATYKLGLTKFTDLTNDE 110

Query: 301 FKATMLNEGXXXXXXXXXXXXXXXNESLA----EVPEYLDWREKGAVTDIKNQGYCGCCW 468
           ++   L                    S A    EVPE +DWR+KGAV  IK+QG CG CW
Sbjct: 111 YRKLYLGARTEPARRIAKAKNVNQKYSAAVNGKEVPETVDWRQKGAVNPIKDQGTCGSCW 170

Query: 469 AFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
           AFS  AA+EGI +I TG+L+ LSEQ+L+DC+   N GC
Sbjct: 171 AFSTTAAVEGINKIVTGELISLSEQELVDCDKSYNQGC 208



>gb:AB092555_1525078 Glycine max CysP1 mRNA for cysteine proteinase,
           complete cds.>gb:AB092556_1525079 Glycine max CysP1 gene
           for cysteine proteinase, complete cds.
          Length = 362

 Score =  129 bits (323), Expect = 4e-29
 Identities = 73/185 (39%), Positives = 107/185 (57%), Gaps = 7/185 (3%)
 Frame = +1

Query: 46  LILAAVLLLGA---FASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNV 216
           ++L+  L+LG+   F      L  E S  + +E+W  HH  S ++  +K KRF +F+ NV
Sbjct: 9   VVLSLSLVLGSANSFDFHDKDLASEESFWDLYERWRSHHTVS-RSLGDKHKRFNVFKANV 67

Query: 217 KFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXN---ESLA 387
             + + NK  ++ YKL + KF+D+TN EF++T                        E + 
Sbjct: 68  MHVHNTNKM-DKPYKLKLNKFADMTNHEFRSTYAGSKVNHHRMFQGTPRGNGTFMYEKVG 126

Query: 388 EVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL- 564
            VP  +DWR+ GAVT +K+QG CG CWAFS V A+EGI QI+T +L+ LSEQ+L+DC+  
Sbjct: 127 SVPPSVDWRKNGAVTGVKDQGQCGSCWAFSTVVAVEGINQIKTNKLVSLSEQELVDCDTK 186

Query: 565 KNYGC 579
           KN GC
Sbjct: 187 KNAGC 191



>sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1
           precursor (EC 3.4.22.-).>pir|E85435|E85435 cysteine
           proteinase (EC 3.4.22.-) precursor [imported] -
           Arabidopsis thaliana>gb:ATAP21_1544009 Arabidopsis
           thaliana DNA chromosome 4, ESSA I AP2 contig fragment
           No. 1.>gb:ATCHRIV86_1547643 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 86.
          Length = 376

 Score =  129 bits (323), Expect = 4e-29
 Identities = 69/158 (43%), Positives = 96/158 (60%), Gaps = 10/158 (6%)
 Frame = +1

Query: 136 KWMVHHGRSYKNDA----EKAKRFKIFEQNVKFIESFNKAG-NQSYKLGVKKFSDLTNEE 300
           +W   HG++  N+     ++ KRF IF+ N++FI+  N+   N +YKLG+ KF+DLTN+E
Sbjct: 51  QWSAEHGKTNNNNNGIINDQDKRFNIFKDNLRFIDLHNEDNKNATYKLGLTKFTDLTNDE 110

Query: 301 FKATMLNEGXXXXXXXXXXXXXXXNESLA----EVPEYLDWREKGAVTDIKNQGYCGCCW 468
           ++   L                    S A    EVPE +DWR+KGAV  IK+QG CG CW
Sbjct: 111 YRKLYLGARTEPARRIAKAKNVNQKYSAAVNGKEVPETVDWRQKGAVNPIKDQGTCGSCW 170

Query: 469 AFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
           AFS  AA+EGI +I TG+L+ LSEQ+L+DC+   N GC
Sbjct: 171 AFSTTAAVEGINKIVTGELISLSEQELVDCDKSYNQGC 208



>gb:OSJN00105_1694997 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0059K02, complete sequence.
          Length = 458

 Score =  128 bits (322), Expect = 6e-29
 Identities = 77/191 (40%), Positives = 110/191 (57%), Gaps = 13/191 (6%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATAL-------DEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIF 204
           L  AA+LLL + A+   ++       +EE   L  + +W   HG+SY    E+ +R+  F
Sbjct: 7   LAAAALLLLLSLAAADMSIVSYGERSEEEARRL--YAEWKAEHGKSYNAVGEEERRYAAF 64

Query: 205 EQNVKFIESFNKA---GNQSYKLGVKKFSDLTNEEFKATMLN--EGXXXXXXXXXXXXXX 369
             N+++I+  N A   G  S++LG+ +F+DLTNEE++ T L                   
Sbjct: 65  RDNLRYIDEHNAAADAGVHSFRLGLNRFADLTNEEYRDTYLGLRNKPRRERKVSDRYLAA 124

Query: 370 XNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQL 549
            NE+L   PE +DWR KGAV +IK+Q   G CWAFSA+AA+EGI QI TG L+ LSEQ+L
Sbjct: 125 DNEAL---PESVDWRTKGAVAEIKDQEVAGSCWAFSAIAAVEGINQIVTGDLISLSEQEL 181

Query: 550 LDCNLK-NYGC 579
           +DC+   N GC
Sbjct: 182 VDCDTSYNEGC 192



>gb:AP003852_1834274 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0440D10.
          Length = 335

 Score =  127 bits (320), Expect = 1e-28
 Identities = 70/180 (38%), Positives = 101/180 (56%), Gaps = 2/180 (1%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALD--EEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK 219
           L++  ++ L A A+ A   +  ++   ++  E+WM   G++YK   EK  RF IF  NV 
Sbjct: 6   LLVCTLMALQAMAASAYYNNGSDDGVTMQMFEEWMAKFGKTYKCHGEKEHRFGIFRDNVH 65

Query: 220 FIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPE 399
           FI  +         +G+ +F+DLTN+EF AT                           P 
Sbjct: 66  FIRGYKPQVTYDSAVGINQFADLTNDEFVATYTGAKPPHPKEAPRPVDPIWT------PC 119

Query: 400 YLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
            +DWR +GAVT +K+QG CG CWAF+AVAA+EG+T+IRTGQL  LSEQ+L+DC+  + GC
Sbjct: 120 CIDWRFRGAVTGVKDQGACGSCWAFAAVAAIEGLTKIRTGQLTPLSEQELVDCDTNSNGC 179



>gb:AY700586_1623604 Zingiber officinale cysteine protease gp2b
           mRNA, complete cds.
          Length = 379

 Score =  127 bits (320), Expect = 1e-28
 Identities = 67/163 (41%), Positives = 95/163 (58%), Gaps = 4/163 (2%)
 Frame = +1

Query: 103 DEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKA---GNQSYKLGVK 273
           DEE  ML    +   H    Y +  E   R ++F++N++F++  N A   G  +++LG+ 
Sbjct: 44  DEEVRMLYLEWRAKNHPAEKYLDLNEY--RLEVFKENLQFVDKHNAAADRGEHTFRLGMN 101

Query: 274 KFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXN-ESLAEVPEYLDWREKGAVTDIKNQG 450
           +F+DLTNEE++   L +                      ++P+ +DWREKGAV  +KNQG
Sbjct: 102 RFADLTNEEYRTRFLRDFSRLRRSASGKISSRYRLREGDDLPDSIDWREKGAVVPVKNQG 161

Query: 451 YCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
            CG CWAFS VAA+EGI QI TG L+ LSEQQL+DC   N+GC
Sbjct: 162 GCGSCWAFSTVAAVEGINQIVTGDLISLSEQQLVDCTTANHGC 204



>pir|T06707|T06707 cysteine proteinase (EC 3.4.22.-) T29H11.130 -
           Arabidopsis thaliana>gb:ATT29H11_1555647 Arabidopsis
           thaliana DNA chromosome 3, BAC clone
           T29H11.>gb:AK119026_1816971 Arabidopsis thaliana
           At3g48350 mRNA for putative cysteine endopeptidase
           precursor, complete cds, clone: RAFL21-34-N20.
          Length = 364

 Score =  127 bits (320), Expect = 1e-28
 Identities = 72/187 (38%), Positives = 108/187 (57%), Gaps = 7/187 (3%)
 Frame = +1

Query: 40  FQLILAAVLLLGA---FASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQ 210
           F ++++ + LL A   F      L+ E ++ + +E+W  HH  S +   E  KRF +F  
Sbjct: 5   FIVLISFLSLLQASKGFDFDEKELETEENVWKLYERWRGHHSVS-RASHEAIKRFNVFRH 63

Query: 211 NVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXN---ES 381
           NV  +   NK  N+ YKL + +F+D+T+ EF+++                        E+
Sbjct: 64  NVLHVHRTNKK-NKPYKLKINRFADITHHEFRSSYAGSNVKHHRMLRGPKRGSGGFMYEN 122

Query: 382 LAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCN 561
           +  VP  +DWREKGAVT++KNQ  CG CWAFS VAA+EGI +IRT +L+ LSEQ+L+DC+
Sbjct: 123 VTRVPSSVDWREKGAVTEVKNQQDCGSCWAFSTVAAVEGINKIRTNKLVSLSEQELVDCD 182

Query: 562 L-KNYGC 579
             +N GC
Sbjct: 183 TEENQGC 189



>pir|T05390|T05390 probable cysteine proteinase (EC 3.4.22.-)
           F16G20.220 - Arabidopsis thaliana>gb:ATCHRIV59_1546189
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 59.>gb:ATF16G20_1548791 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F16G20 (ESSAII project).
          Length = 355

 Score =  127 bits (320), Expect = 1e-28
 Identities = 65/150 (43%), Positives = 98/150 (65%), Gaps = 1/150 (0%)
 Frame = +1

Query: 133 EKWMVHHGRSYKND-AEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKA 309
           + WM  HG++Y N   EK +RF+ F+ N++FI+  N A N SY+LG+ +F+DLT +E++ 
Sbjct: 48  QMWMSKHGKTYTNALGEKERRFQNFKDNLRFIDQHN-AKNLSYQLGLTRFADLTVQEYR- 105

Query: 310 TMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAA 489
            +                     +  ++PE +DWR++GAV++IK+QG C  CWAFS VAA
Sbjct: 106 DLFPGSPKPKQRNLKTSRRYVPLAGDQLPESVDWRQEGAVSEIKDQGTCNSCWAFSTVAA 165

Query: 490 MEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           +EG+ +I TG+L+ LSEQ+L+DCNL N GC
Sbjct: 166 VEGLNKIVTGELISLSEQELVDCNLVNNGC 195



>gb:VSCYSPROA_1727386 V.sativa L. (PROT A) mRNA for cysteine
           proteinase.
          Length = 359

 Score =  127 bits (319), Expect = 1e-28
 Identities = 68/164 (41%), Positives = 97/164 (59%), Gaps = 4/164 (2%)
 Frame = +1

Query: 100 LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKF 279
           L+ E S+   +E+W  HH  + +N  EK  RF +F+ NV  + + NK  ++ YKL + KF
Sbjct: 30  LESEKSLWNLYERWRSHHTVT-RNLDEKHNRFNVFKANVMHVHNTNKL-DKPYKLKLNKF 87

Query: 280 SDLTNEEFKATMLNEGXXXXXXXXXXXXXXXN---ESLAEVPEYLDWREKGAVTDIKNQG 450
            D+TN EF+    +                     E+  +VP  +DWR KGAVT +K+QG
Sbjct: 88  GDMTNYEFRRIYADSKISHHRMFRGMSHENGTFMYENAVDVPSSIDWRNKGAVTGVKDQG 147

Query: 451 YCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL-KNYGC 579
            CG CWAFS +AA+EGI QI+T +L+ LSEQQL+DC+  +N GC
Sbjct: 148 QCGSCWAFSTIAAVEGINQIKTQKLVSLSEQQLVDCDTEENEGC 191



>pir|S49166|S49166 cysteine proteinase (EC 3.4.22.-) precursor -
           spring vetch
          Length = 357

 Score =  127 bits (319), Expect = 1e-28
 Identities = 68/164 (41%), Positives = 97/164 (59%), Gaps = 4/164 (2%)
 Frame = +1

Query: 100 LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKF 279
           L+ E S+   +E+W  HH  + +N  EK  RF +F+ NV  + + NK  ++ YKL + KF
Sbjct: 30  LESEKSLWNLYERWRSHHTVT-RNLDEKHNRFNVFKANVMHVHNTNKL-DKPYKLKLNKF 87

Query: 280 SDLTNEEFKATMLNEGXXXXXXXXXXXXXXXN---ESLAEVPEYLDWREKGAVTDIKNQG 450
            D+TN EF+    +                     E+  +VP  +DWR KGAVT +K+QG
Sbjct: 88  GDMTNYEFRRIYADSKISHHRMFRGMSHENGTFMYENAVDVPSSIDWRNKGAVTGVKDQG 147

Query: 451 YCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL-KNYGC 579
            CG CWAFS +AA+EGI QI+T +L+ LSEQQL+DC+  +N GC
Sbjct: 148 QCGSCWAFSTIAAVEGINQIKTQKLVSLSEQQLVDCDTEENEGC 191



>sp|O65039|CYSP_RICCO Vignain precursor (EC 3.4.22.-) (Cysteine
           endopeptidase).>pir|T08122|T08122 cysteine endopeptidase
           (EC 3.4.22.-) precursor - castor
           bean>gb:AF050756_1764184 Ricinus communis cysteine
           endopeptidase precursor (CysEP) mRNA, complete cds.
          Length = 360

 Score =  127 bits (319), Expect = 1e-28
 Identities = 75/185 (40%), Positives = 107/185 (57%), Gaps = 7/185 (3%)
 Frame = +1

Query: 46  LILAAVLLLG-AFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF 222
           L LA VL +  +F      L+ E S+   +E+W  HH  S ++  EK KRF +F+ N   
Sbjct: 9   LSLALVLAITESFDFHEKELESEESLWGLYERWRSHHTVS-RSLHEKQKRFNVFKHNAMH 67

Query: 223 IESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXN-----ESLA 387
           + + NK  ++ YKL + KF+D+TN EF+ T    G               N     E + 
Sbjct: 68  VHNANKM-DKPYKLKLNKFADMTNHEFRNTY--SGSKVKHHRMFRGGPRGNGTFMYEKVD 124

Query: 388 EVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNL- 564
            VP  +DWR+KGAVT +K+QG CG CWAFS + A+EGI QI+T +L+ LSEQ+L+DC+  
Sbjct: 125 TVPASVDWRKKGAVTSVKDQGQCGSCWAFSTIVAVEGINQIKTNKLVSLSEQELVDCDTD 184

Query: 565 KNYGC 579
           +N GC
Sbjct: 185 QNQGC 189



>gb:AY700585_1623603 Zingiber officinale cysteine protease gp2a
           mRNA, complete cds.
          Length = 381

 Score =  126 bits (317), Expect = 2e-28
 Identities = 76/208 (36%), Positives = 110/208 (52%), Gaps = 22/208 (10%)
 Frame = +1

Query: 22  MASNFDFQLILAAVLLLGAFASQATA------------------LDEEPSMLERHEKWMV 147
           MAS  D  L+L  +L   A A+ ++A                   DEE  ML  + +W V
Sbjct: 1   MASTVDNILLLLLLLSSSALAAVSSAPYQDVLTLSKQGGAVPVRSDEEVRML--YLEWRV 58

Query: 148 HHGRSYKNDAEKAKRFKIFEQNVKFIESFNKA---GNQSYKLGVKKFSDLTNEEFKATML 318
            +  + K       R ++F++N++F++  N A   G  ++ LG+ +F+DLTNEE++   L
Sbjct: 59  KNHPAEKYLDLNEYRLEVFKENLQFVDEHNAAADRGEHTFLLGMNRFADLTNEEYRTRFL 118

Query: 319 NEGXXXXXXXXXXXXXXXN-ESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAME 495
            +                      ++P+ +DWRE GAV  +KNQG CG CWAFS VAA+E
Sbjct: 119 RDFSRLRRSASGKISSRYRLREGDDLPDSIDWRENGAVVPVKNQGGCGSCWAFSTVAAVE 178

Query: 496 GITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           GI QI TG L+ LSEQQL+DC   N+GC
Sbjct: 179 GINQIVTGDLISLSEQQLVDCTTANHGC 206



>gb:AY662993_1620480 Petunia x hybrida cysteine proteinase (CP7)
           mRNA, partial cds.
          Length = 210

 Score =  126 bits (317), Expect = 2e-28
 Identities = 67/146 (45%), Positives = 93/146 (63%), Gaps = 3/146 (2%)
 Frame = +1

Query: 151 HGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGX 330
           HG+ Y++  EK  RF+IF++N+K I+  NK  + +Y LG+ +FSDL+++EFK   L    
Sbjct: 4   HGKIYESIEEKLHRFEIFKENLKHIDERNKIVS-NYWLGLNEFSDLSHDEFKKMYLGLKV 62

Query: 331 XXXXXXXXXXXXXXNE--SLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGIT 504
                          E     ++P+ +DWR+KGAVT +KNQG CG CWAFS VAA+EGI 
Sbjct: 63  DHDLLNNKKQSQQDFEYRDFVDLPKSVDWRKKGAVTPVKNQGQCGSCWAFSTVAAVEGIN 122

Query: 505 QIRTGQLMRLSEQQLLDCNLK-NYGC 579
           QI+TG L  LSEQ+L+DC+   N GC
Sbjct: 123 QIKTGNLTSLSEQELIDCDTTYNNGC 148



>gb:AF454957_1801125 Brassica oleracea senescence-associated
           cysteine protease (CP2) mRNA, complete cds.
          Length = 460

 Score =  126 bits (316), Expect = 3e-28
 Identities = 65/155 (41%), Positives = 96/155 (61%), Gaps = 5/155 (3%)
 Frame = +1

Query: 130 HEKWMVHHGRSYKNDA----EKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNE 297
           +E WM  HG+  +++     EK +RF+IF+ N++FI+  N   N SYKLG+ +F+DLTNE
Sbjct: 49  YEAWMEKHGKKAQSNGLVGEEKDQRFEIFKDNLRFIDEHNNK-NLSYKLGLTRFADLTNE 107

Query: 298 EFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFS 477
           E+++  L  G                     +P+ +DWR++GAV  +K+QG CG CWAFS
Sbjct: 108 EYRSIYL--GAKSKKRVLKTSDRYQPRVGDAIPDSVDWRKEGAVAAVKDQGSCGSCWAFS 165

Query: 478 AVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
            + A+EGI +I TG L+ LSEQ+L+DC+   N GC
Sbjct: 166 TIGAVEGINKIVTGDLISLSEQELVDCDTSYNQGC 200



>pir|S47434|S47434 cysteine proteinase (EC 3.4.22.-) -
           rice>gb:AB004648_1509168 Oryza sativa (japonica
           cultivar-group) RepA gene for cysteine endopeptidase,
           complete cds.>gb:OSCYSPRO_1692985 O.sativa mRNA for
           cysteine protease.
          Length = 378

 Score =  126 bits (316), Expect = 3e-28
 Identities = 71/202 (35%), Positives = 107/202 (52%), Gaps = 22/202 (10%)
 Frame = +1

Query: 40  FQLILAAVLLLGAFASQATA-------LDEEPSMLERHEKWMVHH--------GRSYKND 174
           F +  AAV L  A A+ A A       L  E S+   +E+W   +        G    +D
Sbjct: 5   FLVAAAAVALAAAAAAPARAIPFTESDLSSEESLRALYERWRSRYTVSRPAASGGVGNDD 64

Query: 175 AEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATML------NEGXXX 336
            E  +RF +F +N ++I   N+ G + ++L + KF+D+T +EF+ T        +     
Sbjct: 65  GEARRRFNVFVENARYIHEANRRGGRPFRLALNKFADMTTDEFRRTYAGSRARHHRSLSG 124

Query: 337 XXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRT 516
                        +    +P  +DWRE+GAVT IK+QG CG CWAFS VAA+EG+ +I+T
Sbjct: 125 GRGGEGGSFRYGGDDEDNLPPAVDWRERGAVTGIKDQGQCGSCWAFSTVAAVEGVNKIKT 184

Query: 517 GQLMRLSEQQLLDCNL-KNYGC 579
           G+L+ LSEQ+L+DC+   N GC
Sbjct: 185 GRLVTLSEQELVDCDTGDNQGC 206



>pir|S71773|S71773 cysteine proteinase (EC 3.4.22.-) precursor -
           Zinnia elegans>gb:ZEU19267_1731385 Zinnia elegans
           cysteine proteinase mRNA, complete cds.
          Length = 342

 Score =  126 bits (316), Expect = 3e-28
 Identities = 67/150 (44%), Positives = 91/150 (60%), Gaps = 1/150 (0%)
 Frame = +1

Query: 133 EKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKAT 312
           E  +V H + Y++  EK  RF+IF  N+K I+  NK  + +Y LG+ +F+DLT+EEFK  
Sbjct: 50  ESSLVKHSKIYESFDEKLHRFEIFMDNLKHIDETNKKVS-NYWLGLNEFADLTHEEFKNK 108

Query: 313 MLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAM 492
            L                       ++P+ +DWR+KGAV+ +KNQG CG CWAFS VAA+
Sbjct: 109 FLGFKGELAERKDESIEQFRYRDFVDLPKSVDWRKKGAVSPVKNQGQCGSCWAFSTVAAV 168

Query: 493 EGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
           EGI QI TG L  LSEQ+L+DC+   N GC
Sbjct: 169 EGINQIVTGNLTVLSEQELIDCDTTFNNGC 198



>sp|Q9SUS9|CPR4_ARATH Putative cysteine proteinase At4g11320
           precursor (EC 3.4.22.-).>pir|T13023|T13023
           drought-inducible cysteine proteinase (EC 3.4.22.-)
           F8L21.110 - Arabidopsis thaliana>gb:ATCHRIV31_1544897
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 31.>gb:ATF8L21_1551243 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F8L21 (ESSA
           project).>gb:AY035055_1559832 Arabidopsis thaliana
           putative cysteine proteinase (At4g11320) mRNA, complete
           cds.>gb:AY051062_1562537 Arabidopsis thaliana putative
           cysteine proteinase (At4g11320) mRNA, complete cds.
          Length = 371

 Score =  126 bits (316), Expect = 3e-28
 Identities = 72/193 (37%), Positives = 108/193 (55%), Gaps = 4/193 (2%)
 Frame = +1

Query: 13  LSSMASNFDFQLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKR 192
           +S ++SN +  +        G F ++AT +          E WMV HG+ Y + AEK +R
Sbjct: 26  MSVVSSNDNHHVTAGPGRRQGIFDAEATLM---------FESWMVKHGKVYDSVAEKERR 76

Query: 193 FKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXX 372
             IFE N++FI + N A N SY+LG+ +F+DL+  E+    +  G               
Sbjct: 77  LTIFEDNLRFITNRN-AENLSYRLGLNRFADLSLHEYGE--ICHGADPRPPRNHVFMTSS 133

Query: 373 NESLAE----VPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSE 540
           N         +P+ +DWR +GAVT++K+QG C  CWAFS V A+EG+ +I TG+L+ LSE
Sbjct: 134 NRYKTSDGDVLPKSVDWRNEGAVTEVKDQGLCRSCWAFSTVGAVEGLNKIVTGELVTLSE 193

Query: 541 QQLLDCNLKNYGC 579
           Q L++CN +N GC
Sbjct: 194 QDLINCNKENNGC 206



>gb:AP006170_1861285 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC
           clone:OSJNBa0042B15.>gb:AP006171_1861292 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OSJNBa0070E11.
          Length = 374

 Score =  125 bits (315), Expect = 4e-28
 Identities = 67/158 (42%), Positives = 93/158 (58%), Gaps = 4/158 (2%)
 Frame = +1

Query: 100 LDEEPSMLERHEKWMVHHGR---SYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGV 270
           L+ E SM   +++W   +G    S ++ A+K  RF++F++N ++I  FN+    SYKLG+
Sbjct: 33  LESEESMWSLYQRWRHVYGAASSSPRDLADKGSRFEVFKKNARYIHDFNRKKGMSYKLGL 92

Query: 271 KKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLA-EVPEYLDWREKGAVTDIKNQ 447
            KF+DLT EEF A                       ++A + P   DWRE GAVT +K+Q
Sbjct: 93  NKFADLTLEEFTAKYTGANPGPITGLKNGTGSPPLAAVAGDAPPAWDWREHGAVTRVKDQ 152

Query: 448 GYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCN 561
           G CG CWAFS V A+EGI  I TG L+ LSEQQ+LDC+
Sbjct: 153 GPCGSCWAFSVVEAVEGINAIMTGNLLTLSEQQVLDCS 190



>gb:AB057372_1521685 Daucus carota CSCP gene for cysteine
           proteinase, partial cds.
          Length = 208

 Score =  125 bits (314), Expect = 5e-28
 Identities = 67/162 (41%), Positives = 94/162 (58%), Gaps = 2/162 (1%)
 Frame = +1

Query: 100 LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKF 279
           L  + S+ + +E+W  HH  S ++  EK  RF +F+ NVK I   N+  N+ YKL V KF
Sbjct: 30  LATDESLWDLYERWRSHHTVS-RDLTEKQIRFNVFKTNVKHIHKVNQM-NKPYKLEVNKF 87

Query: 280 SDLTNEEFKATMLNEGXXXXXXXXXXXXXXX--NESLAEVPEYLDWREKGAVTDIKNQGY 453
           +D+T  EF+ +                      +E+   +P  +DWR+ GAVT IKNQG 
Sbjct: 88  ADMTYHEFRNSYGGSKVKHFRSLRGDRARTGFMHENTKHLPSSVDWRKHGAVTPIKNQGR 147

Query: 454 CGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           CG CWAFSA+  +EGI +I+T QL+ LSEQ+L+DC   N GC
Sbjct: 148 CGSCWAFSAIVGVEGINKIKTNQLVSLSEQELVDCESDNQGC 189



>pir|JC7787|JC7787 carrot seed cysteine proteinase (EC 3.4.-.-),
           CSCP - carrot
          Length = 358

 Score =  125 bits (314), Expect = 5e-28
 Identities = 67/162 (41%), Positives = 94/162 (58%), Gaps = 2/162 (1%)
 Frame = +1

Query: 100 LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKF 279
           L  + S+ + +E+W  HH  S ++  EK  RF +F+ NVK I   N+  N+ YKL V KF
Sbjct: 30  LATDESLWDLYERWRSHHTVS-RDLTEKQIRFNVFKTNVKHIHKVNQM-NKPYKLEVNKF 87

Query: 280 SDLTNEEFKATMLNEGXXXXXXXXXXXXXXX--NESLAEVPEYLDWREKGAVTDIKNQGY 453
           +D+T  EF+ +                      +E+   +P  +DWR+ GAVT IKNQG 
Sbjct: 88  ADMTYHEFRNSYGGSKVKHFRSLRGDRARTGFMHENTKHLPSSVDWRKHGAVTPIKNQGR 147

Query: 454 CGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           CG CWAFSA+  +EGI +I+T QL+ LSEQ+L+DC   N GC
Sbjct: 148 CGSCWAFSAIVGVEGINKIKTNQLVSLSEQELVDCESDNQGC 189



>gb:AB109187_1526792 Helianthus annuus scp2 mRNA for cysteine
           protease-2, complete cds.
          Length = 362

 Score =  125 bits (313), Expect = 6e-28
 Identities = 71/194 (36%), Positives = 111/194 (57%), Gaps = 8/194 (4%)
 Frame = +1

Query: 22  MASNFDFQLILAAVLLLG---AFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKR 192
           MA N    + L+  L+LG   +F      L+ E ++ + +E+W     +   N  EK +R
Sbjct: 1   MAINKFLLVSLSLSLVLGVAWSFDFHEKELETEDNLWDMYERW---RHKVATNHGEKLRR 57

Query: 193 FKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKA----TMLNEGXXXXXXXXXXX 360
           F +F+ NV  +   NK  ++ YKL + KF+D+TN EF++    + ++             
Sbjct: 58  FNVFKSNVLHVHETNKM-DKPYKLKLNKFADMTNHEFRSVYAGSKIHHHDRSLQGDRSGS 116

Query: 361 XXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSE 540
                 ++  VP  +DWR+KGAV  +K+QG CG CWAFS VAA+EGI +I+T +L+ LSE
Sbjct: 117 KTFMYANVESVPTSVDWRKKGAVAPVKDQGQCGSCWAFSTVAAVEGINKIKTNELVSLSE 176

Query: 541 QQLLDCN-LKNYGC 579
           Q+L+DC+ L+N GC
Sbjct: 177 QELVDCDTLENQGC 190



>gb:AC130601_1740746 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0108E17, complete sequence.
          Length = 450

 Score =  124 bits (311), Expect = 1e-27
 Identities = 64/152 (42%), Positives = 86/152 (56%), Gaps = 3/152 (1%)
 Frame = +1

Query: 133 EKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKAT 312
           E W   HGRSY    E+A R   F  N  F+ + N A   SY L +  F+DLT++EF+A 
Sbjct: 39  EAWCAEHGRSYATPGERAARLAAFADNAAFVAAHNGAP-ASYALALNAFADLTHDEFRAA 97

Query: 313 MLNE--GXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVA 486
            L                    +  +  VP+ +DWR+ GAVT +K+QG CG CW+FSA  
Sbjct: 98  RLGRLAAAGGPGRDGGAPYLGVDGGVGAVPDAVDWRQSGAVTKVKDQGSCGACWSFSATG 157

Query: 487 AMEGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
           AMEGI +I+TG L+ LSEQ+L+DC+   N GC
Sbjct: 158 AMEGINKIKTGSLISLSEQELIDCDRSYNSGC 189



>gb:ZMSEE1_1732027 Z.mays mRNA for cysteine proteinase, See1.
          Length = 360

 Score =  123 bits (308), Expect = 2e-27
 Identities = 62/153 (40%), Positives = 92/153 (60%), Gaps = 2/153 (1%)
 Frame = +1

Query: 127 RHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFK 306
           R  ++ V +G+SY++ AE  KRF+IF ++++ + S N+ G  SY+LG+ +F+D++ EEF+
Sbjct: 58  RFARFAVRYGKSYESAAEVHKRFRIFSESLQLVRSTNRKG-LSYRLGINRFADMSWEEFR 116

Query: 307 ATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVA 486
           AT L  G                 +   +PE  DWRE G V+ +KNQG+CG CW FS   
Sbjct: 117 ATRL--GAAQNCSATLTGNHRMRAAAVALPETKDWREDGIVSPVKNQGHCGSCWTFSTTG 174

Query: 487 AMEGITQIRTGQLMRLSEQQLLDCNL--KNYGC 579
           A+E      TG+ + LSEQQL+DC L   N+GC
Sbjct: 175 ALEAAYTQATGKPISLSEQQLVDCGLAFNNFGC 207



>gb:AY251054_1592748 Anthurium andraeanum cysteine protease mRNA,
           complete cds.
          Length = 502

 Score =  123 bits (308), Expect = 2e-27
 Identities = 71/201 (35%), Positives = 102/201 (50%), Gaps = 23/201 (11%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPSM---------------LERHEKWMVHHGRSYKNDAE 180
           ++L +V+LL    S + +  E PS                 E  E+WM  H + Y +  E
Sbjct: 8   VLLLSVVLLSVAPSGSCSAGEWPSSGQGPEDVGAGGVEGGQELFERWMEKHRKVYAHPGE 67

Query: 181 KAKRFKIFEQNVKFIESFNKAGNQSYK----LGVKKFSDLTNEEFKATMLNEGXXXXXXX 348
           KA+R+  F  N+ F+   N  G ++      +G+  F+DL+NEEF+    +         
Sbjct: 68  KARRYANFLSNLAFVRKRNAEGRRAPSSGQGVGMNVFADLSNEEFREVYSSRVLRKKAAE 127

Query: 349 XXXXXXXXNESLA----EVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRT 516
                    E       + P  LDWR++GAVT +KNQG CG CWAFS+  AMEGI  I T
Sbjct: 128 GRGARRRAGEGRVVAGCDAPASLDWRKRGAVTAVKNQGDCGSCWAFSSTGAMEGINAITT 187

Query: 517 GQLMRLSEQQLLDCNLKNYGC 579
           G+L+ LSEQ+L+DC+  N GC
Sbjct: 188 GELISLSEQELVDCDTTNEGC 208



>pir|S51817|S47312 cysteine proteinase (EC 3.4.22.-) precursor -
           spring vetch>gb:VSCYSPRO_1727385 V.sativa L. mRNA for
           cysteine protease.
          Length = 368

 Score =  123 bits (308), Expect = 2e-27
 Identities = 64/158 (40%), Positives = 95/158 (60%), Gaps = 4/158 (2%)
 Frame = +1

Query: 118 MLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNE 297
           ++  +E+W+V H + Y    EK +RF+IF+ N+ FI+  N A N +Y +G+ KF+D+TNE
Sbjct: 35  VMTMYEEWLVKHQKVYNGLREKDQRFQIFKDNLNFIDEHN-AQNYTYIVGLNKFADMTNE 93

Query: 298 EFKATMLNEGXXXXXXXXXXXXXXXN---ESLAEVPEYLDWREKGAVTDIKNQGYCGCCW 468
           E++   L                       S   +P ++DWR KGA+T IK+QG CG CW
Sbjct: 94  EYRDMYLGTRSDIKRRIMKNKITGHRYAYNSGDRLPVHVDWRLKGAITHIKDQGSCGSCW 153

Query: 469 AFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
           AFS +A +E I +I TG+L+ LSEQ+L+DC+   N GC
Sbjct: 154 AFSTIATVEAINKIVTGKLVSLSEQELVDCDRAFNEGC 191



>pir|S49451|S49451 cysteine proteinase (EC 3.4.22.-) -
           chickpea>gb:CACPMRNA_1644877 Cicer arietinum mRNA for
           cysteine proteinase.
          Length = 325

 Score =  123 bits (308), Expect = 2e-27
 Identities = 66/155 (42%), Positives = 92/155 (59%), Gaps = 5/155 (3%)
 Frame = +1

Query: 130 HEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFK- 306
           +EKW+V H + Y    EK  RF+IF+ N++FI+  N A N SYK+G+ KF+D+ NEE++ 
Sbjct: 4   YEKWLVKHQKMYNGLGEKDTRFQIFKDNLRFIDEHN-AQNYSYKVGLNKFADINNEEYRD 62

Query: 307 ---ATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFS 477
               T  +                 N  +  V   +DWR KGAVT IK+QG CG CWAFS
Sbjct: 63  MYLGTKSDAKRRVMKTKITGHRITYNSVIVTVK--VDWRLKGAVTHIKDQGSCGSCWAFS 120

Query: 478 AVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
            +A +E I +I TG+ + LSEQ+L+DC+   N GC
Sbjct: 121 TIATVEAINKIVTGKFVSLSEQELVDCDRAFNEGC 155



>pir|T06276|T06276 benzothiadiazole-induced protein (clone WCI-4) -
           wheat>gb:TAU32430_1724704 Triticum aestivum thiol
           protease mRNA, complete cds.
          Length = 374

 Score =  123 bits (308), Expect = 2e-27
 Identities = 70/170 (41%), Positives = 95/170 (55%), Gaps = 9/170 (5%)
 Frame = +1

Query: 97  ALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKK 276
           AL++   M+ER   WM  HG+SY    EK +RF IF +NV+FIE+ N+ G  SY LGV +
Sbjct: 39  ALEDSLLMMERFHGWMAKHGKSYAGVEEKLRRFDIFRRNVEFIEAANRDGRLSYTLGVNQ 98

Query: 277 FSDLTNEEFKATMLN-------EGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTD 435
           F+DLT+EEF AT  +       E                  +   VP  ++W  +  VT 
Sbjct: 99  FADLTHEEFLATHTSRRVVPSEEMVITTRAGVVVEGANCQPAPNAVPRSINWVNQSKVTP 158

Query: 436 IKNQG-YCGCCWAFSAVAAMEGITQI-RTGQLMRLSEQQLLDCNLKNYGC 579
           +KNQG  CG CWAFSAVA +E    I + G+   LSEQ+L+DC+  + GC
Sbjct: 159 VKNQGKVCGACWAFSAVATIESAYAIAKRGEPPVLSEQELIDCDTFDRGC 208



>pir|T06206|T06206 probable cysteine proteinase (EC 3.4.22.-)
           precursor - barley>gb:HVZ97021_1682876 Hordeum vulgare
           gene encoding cysteine endopeptidase EP-A.
          Length = 365

 Score =  122 bits (307), Expect = 3e-27
 Identities = 70/185 (37%), Positives = 107/185 (57%), Gaps = 7/185 (3%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKN---DAEKAKRFKIFEQNV 216
           L LA    LG   ++     EE S+   +E+W  H+  S +    DAE+ +RF +F++N 
Sbjct: 14  LALAPAPALGVPFTEKDLASEE-SLRGLYERWRSHYTVSRRGLGADAEE-RRFNVFKENA 71

Query: 217 KFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAE-- 390
           +++   NK  ++ ++L + KF+D+T +EF+ T                        A+  
Sbjct: 72  RYVHEGNKR-DRPFRLALNKFADMTTDEFRRTYAGSRVRHHLSLSGGRRGDGGFRYADAD 130

Query: 391 -VPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC-NL 564
            +P  +DWR+KGAVT IK+QG CG CWAFS + A+EGI +IRTG+L+ LSEQ+L+DC N+
Sbjct: 131 NLPPAVDWRQKGAVTAIKDQGQCGSCWAFSTIVAVEGINKIRTGKLVSLSEQELMDCDNV 190

Query: 565 KNYGC 579
            N GC
Sbjct: 191 NNQGC 195



>gb:AP006170_1861279 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OSJNBa0042B15.
          Length = 416

 Score =  122 bits (306), Expect = 4e-27
 Identities = 67/156 (42%), Positives = 88/156 (56%), Gaps = 2/156 (1%)
 Frame = +1

Query: 100 LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN-KAGNQSYKLGVKK 276
           L+ E SM   +E+W   +  S ++ ++   RF++F+ N ++I  FN K+   SY LG+ K
Sbjct: 16  LETEESMWSLYERWRAVYAPS-RDLSDMESRFEVFKANARYIHEFNQKSKGMSYVLGLNK 74

Query: 277 FSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYL-DWREKGAVTDIKNQGY 453
           FSDLT EEF A                      E    VP    DWR  GAVTD+K+QG 
Sbjct: 75  FSDLTYEEFAAKYTGVKVDASAFATATTSSPDEELPVGVPPATWDWRLNGAVTDVKDQGQ 134

Query: 454 CGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCN 561
           CG CW FSAV A+EGI  I TG L+ LSEQQ+LDC+
Sbjct: 135 CGSCWVFSAVGAVEGINAIMTGNLLTLSEQQVLDCS 170



>gb:AY171099_1586735 Gossypium hirsutum cysteine protease mRNA,
           complete cds.
          Length = 389

 Score =  122 bits (306), Expect = 4e-27
 Identities = 62/161 (38%), Positives = 92/161 (57%), Gaps = 4/161 (2%)
 Frame = +1

Query: 109 EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN---KAGNQSYKLGVKKF 279
           E  +LE  ++W   H + Y++  E  KRF+ F+ N+K+I   N   KA    + +G+ KF
Sbjct: 42  EERVLEIFQQWKEKHRKVYRHAEEAEKRFENFKGNLKYILERNAKRKANKWEHHVGLNKF 101

Query: 280 SDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNE-SLAEVPEYLDWREKGAVTDIKNQGYC 456
           +D++NEEF+   L++                 +    + P  LDWR  G VT +K+QG C
Sbjct: 102 ADMSNEEFRKAYLSKVKKPINKGITLSRNMRRKVQSCDAPSSLDWRNYGVVTAVKDQGSC 161

Query: 457 GCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           G CWAFS+  AMEGI  + TG L+ LSEQ+L++C+  NYGC
Sbjct: 162 GSCWAFSSTGAMEGINALVTGDLISLSEQELVECDTSNYGC 202



>pir|T06208|T06208 cysteine proteinase (EC 3.4.22.-) -
           barley>gb:HVZ97023_1682878 Hordeum vulgare mRNA encoding
           cysteine endopeptidase EP-A.
          Length = 365

 Score =  122 bits (305), Expect = 5e-27
 Identities = 70/185 (37%), Positives = 105/185 (56%), Gaps = 7/185 (3%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKN---DAEKAKRFKIFEQNV 216
           L LA    LG   ++     EE S+   +E+W  H+  S +    DAE+ +RF +F+QN 
Sbjct: 14  LALAPAPALGVPFTEKDLASEE-SLRGLYERWRSHYTVSRRGLGADAEE-RRFNVFKQNA 71

Query: 217 KFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAE-- 390
           +++   NK  +  ++L + KF+D+T +EF+ T                         +  
Sbjct: 72  RYVHEGNKR-DMPFRLALNKFADMTTDEFRRTYAGSRVRHHLSLSGGRRGDGGFRYGDAD 130

Query: 391 -VPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC-NL 564
            +P  +DWR+KGAVT IK+QG CG CWAFS + A+EGI +IRTG+L+ LSEQ+L+DC N+
Sbjct: 131 NLPPAVDWRQKGAVTAIKDQGQCGSCWAFSTIVAVEGINKIRTGKLVSLSEQELMDCDNV 190

Query: 565 KNYGC 579
            N GC
Sbjct: 191 NNQGC 195



>gb:OSJN00032_1693610 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0043A12, complete sequence.
          Length = 490

 Score =  121 bits (304), Expect = 7e-27
 Identities = 64/161 (39%), Positives = 99/161 (61%), Gaps = 11/161 (6%)
 Frame = +1

Query: 130 HEKWMVHHGRSYKNDA------EKAKRFKIFEQNVKFIESFNKAGNQ--SYKLGVKKFSD 285
           ++ W+  H R     +      E  +RF++F  N+KF+++ N   ++   ++LG+ +F+D
Sbjct: 62  YDLWLARHRRGGGGGSRNGFIGEHERRFRVFWDNLKFVDAHNARADERGGFRLGMNRFAD 121

Query: 286 LTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVT-DIKNQGYCGC 462
           LTN EF+AT L  G               ++ +  +P+ +DWR+KGAV   +KNQG CG 
Sbjct: 122 LTNGEFRATYL--GTTPAGRGRRVGEAYRHDGVEALPDSVDWRDKGAVVAPVKNQGQCGS 179

Query: 463 CWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC--NLKNYGC 579
           CWAFSAVAA+EGI +I TG+L+ LSEQ+L++C  N +N GC
Sbjct: 180 CWAFSAVAAVEGINKIVTGELVSLSEQELVECARNGQNSGC 220



>sp|Q10717|CYS2_MAIZE Cysteine proteinase 2 precursor (EC
           3.4.22.-).>pir|S59598|S59598 cysteine proteinase (EC
           3.4.22.-) 2 precursor [similarity] -
           maize>gb:MZECYPA_1687898 Corn mRNA for cysteine
           proteinase, clone CCP2, complete cds.
          Length = 360

 Score =  121 bits (304), Expect = 7e-27
 Identities = 61/153 (39%), Positives = 91/153 (59%), Gaps = 2/153 (1%)
 Frame = +1

Query: 127 RHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFK 306
           R  ++ V +G+SY++ AE  KRF+IF ++++ + S N+ G  SY+LG+ +F+D++ EEF+
Sbjct: 58  RFARFAVRYGKSYESAAEVHKRFRIFSESLQLVRSTNRKG-LSYRLGINRFADMSWEEFR 116

Query: 307 ATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVA 486
           AT L  G                 +   +PE  DWRE G V+ +KNQG+CG CW FS   
Sbjct: 117 ATRL--GAAQNCSATLTGNHRMRAAAVALPETKDWREDGIVSPVKNQGHCGSCWTFSTTG 174

Query: 487 AMEGITQIRTGQLMRLSEQQLLDCN--LKNYGC 579
           A+E      TG+ + LSEQQL+DC     N+GC
Sbjct: 175 ALEAAYTQATGKPISLSEQQLVDCGFAFNNFGC 207



>gb:AP002866_1823379 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0410E01.
          Length = 359

 Score =  121 bits (303), Expect = 9e-27
 Identities = 74/185 (40%), Positives = 102/185 (55%), Gaps = 14/185 (7%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPSM--LERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK 219
           LILAA     A AS A A +++P M    RH  WM   GR+Y + AEKA+RF++F  N +
Sbjct: 10  LILAAAA--AAAASGAPAPEDDPGMPMAARHRCWMARVGRTYADAAEKARRFEVFRANAE 67

Query: 220 FIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAE--- 390
            I++ N+AG+ +Y LG+  F+DLT +EF+A  L                   E  A+   
Sbjct: 68  RIDAANRAGDLTYTLGLTPFADLTADEFRARHLMPDADVDEPATARVLFEQEEKAAKQHL 127

Query: 391 -------VPEYLDWREKGAVTDIKNQG--YCGCCWAFSAVAAMEGITQIRTGQLMRLSEQ 543
                  V    DWR+ GAVT +++QG   C  CWAF+ VAA EG+ +I TG +  LS Q
Sbjct: 128 PPSRPPAVWGSKDWRDLGAVTPVQDQGKNNCNSCWAFAVVAATEGLIKIETGNVTPLSAQ 187

Query: 544 QLLDC 558
           Q+LDC
Sbjct: 188 QVLDC 192



>gb:AY345219_1321634 Acanthoscelides obtectus cathepsin L-like
           cysteine proteinase precursor, mRNA, complete cds.
          Length = 321

 Score =  121 bits (303), Expect = 9e-27
 Identities = 65/184 (35%), Positives = 108/184 (58%), Gaps = 6/184 (3%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFI 225
           L + AVL++ A       L E+    E+ +++ + HGR+Y+   E+ +RF+IF+ N++ I
Sbjct: 4   LAIVAVLIIAA-----NGLSEQ----EKWQQFKIQHGRTYRTLLEEKRRFEIFKFNLRTI 54

Query: 226 ESFNKA---GNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVP 396
           E  N+    G +++++G+ +F D+T EEFK  +  +                 +++ ++P
Sbjct: 55  EEHNERYHNGEETFEMGINQFGDMTQEEFKRMLALQKPQMPLPRGDEVSF---DNVNDIP 111

Query: 397 EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC---NLK 567
           + +DWREKGAVT++K QG CG CWAFSAV ++EG   ++ G L  LS Q L+DC      
Sbjct: 112 KTVDWREKGAVTEVKKQGNCGSCWAFSAVGSIEGQVFLKNGSLESLSAQNLVDCAGIEYG 171

Query: 568 NYGC 579
           N+GC
Sbjct: 172 NFGC 175



>sp|P25251|CYS4_BRANA Cysteine proteinase COT44 precursor (EC
           3.4.22.-) (Fragment).>pir|JQ1121|JQ1121 cysteine
           proteinase (EC 3.4.22.-) COT44 [similarity] - rape
          Length = 328

 Score =  121 bits (303), Expect = 9e-27
 Identities = 66/158 (41%), Positives = 95/158 (60%), Gaps = 10/158 (6%)
 Frame = +1

Query: 136 KWMVHHGRSYKNDA----EKAKRFKIFEQNVKFIESFNKAG-NQSYKLGVKKFSDLTNEE 300
           +W + HG+S  N      ++ +RF IF+ N++FI+  N+   N +YKLG+  F++LTN+E
Sbjct: 6   RWSLEHGKSNSNSNGIINQQDERFNIFKDNLRFIDLHNENNKNATYKLGLTIFANLTNDE 65

Query: 301 FKATMLNEGXXXXXXXXXXXXXXXNESLA----EVPEYLDWREKGAVTDIKNQGYCGCCW 468
           +++  L                    S A    EVP  +DWR+KGAV  IK+QG CG CW
Sbjct: 66  YRSLYLGARTEPVRRITKAKNVNMKYSAAVNVDEVPVTVDWRQKGAVNAIKDQGTCGSCW 125

Query: 469 AFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
           AFS  AA+EGI +I TG+L+ LSEQ+L+DC+   N GC
Sbjct: 126 AFSTAAAVEGINKIVTGELVSLSEQELVDCDKSYNQGC 163



>gb:AP002869_1823473 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0554D10.>gb:AP003143_1824885 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0489E06.
          Length = 357

 Score =  120 bits (302), Expect = 1e-26
 Identities = 76/193 (39%), Positives = 101/193 (52%), Gaps = 14/193 (7%)
 Frame = +1

Query: 22  MASNFDFQLILAAVLLLGAF-ASQATALD-----------EEPSMLERHEKWMVHHGRSY 165
           MASN     I   VLL+  F A QA A D           ++   ++  E+WM   G++Y
Sbjct: 1   MASN-----IAVVVLLVCTFMALQAMAADAYYDNNGGGGGDDSVTMQMFEEWMAKFGKTY 55

Query: 166 KNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXX 345
           K   EK  RF +F  NV+FI S+         + + +F+DLTN EF AT           
Sbjct: 56  KCHGEKEHRFAVFRDNVRFIRSYRPEATYDSAVRINQFADLTNGEFVATYTGVKQPPPAT 115

Query: 346 XXXXXXXXXNESLAEV--PEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTG 519
                       +  +  P  +DWR KGAVT +K+QG CG  WAF+AVAAMEG+ +IRTG
Sbjct: 116 HPHPHPEEAPRPVDPIWMPCCIDWRFKGAVTGVKDQGACGSSWAFAAVAAMEGLMKIRTG 175

Query: 520 QLMRLSEQQLLDC 558
           QL  LSEQ+L+DC
Sbjct: 176 QLTPLSEQELVDC 188



>gb:AF182079_1774901 Matricaria chamomilla thiol protease (ctp)
           mRNA, complete cds.
          Length = 501

 Score =  120 bits (301), Expect = 2e-26
 Identities = 59/154 (38%), Positives = 92/154 (59%), Gaps = 6/154 (3%)
 Frame = +1

Query: 136 KWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN--KAGNQSYKLGVKKFSDLTNEEFKA 309
           KW   HG++Y+++ E+  R + F+++VKF+   N  +     + +G+ KF+DL+NEEFK 
Sbjct: 52  KWKELHGKTYQHEEEENLRLENFKKSVKFVMEKNSERKSELDHTVGLNKFADLSNEEFKE 111

Query: 310 TMLNEGXXXXXXXXXXXXXXXNESLA----EVPEYLDWREKGAVTDIKNQGYCGCCWAFS 477
             +++                N S++    + P  LDWR+KG VT +K+QG CG CWAFS
Sbjct: 112 MYMSKVKGSRSNELKMGGVKRNMSVSSRTCDAPTSLDWRDKGVVTPMKDQGQCGSCWAFS 171

Query: 478 AVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
              ++E    I TG L+RLSEQ+L+DC+  +YGC
Sbjct: 172 VSGSIESANAIATGDLIRLSEQELVDCDTYDYGC 205



>gb:HVU94591_1682853 Hordeum vulgare cysteine proteinase precursor,
           mRNA, complete cds.
          Length = 365

 Score =  120 bits (301), Expect = 2e-26
 Identities = 68/184 (36%), Positives = 102/184 (55%), Gaps = 6/184 (3%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKA--KRFKIFEQNVK 219
           L LA    LG   ++     EE S+   +E+W  H+  S +     A  +RF +F+QN +
Sbjct: 14  LALAPAPALGVPLTEKDLASEE-SLRGLYERWRSHYTVSRRGLGADAGERRFNVFKQNAR 72

Query: 220 FIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAE--- 390
           ++   NK  +  ++L + KF+D+T +EF+ T                         +   
Sbjct: 73  YVHEGNKR-DMPFRLALNKFADMTTDEFRRTYAGSRVRHHLSLSGGRRGDGGFRYGDADN 131

Query: 391 VPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC-NLK 567
           +P  +DWR+KGAVT IK+QG CG CWAFS + A+EGI +IRTG+L+ LSEQ+L+DC N+ 
Sbjct: 132 LPPAVDWRQKGAVTAIKDQGQCGSCWAFSTIVAVEGINKIRTGKLVSLSEQELMDCDNVN 191

Query: 568 NYGC 579
           N GC
Sbjct: 192 NQGC 195



>gb:AY515271_1332446 Taenia cellulosae cathepsin L-like cysteine
           proteinase mRNA, complete cds.
          Length = 339

 Score =  120 bits (301), Expect = 2e-26
 Identities = 68/183 (37%), Positives = 100/183 (54%), Gaps = 8/183 (4%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPSMLERHEK-----WMVHHGRSYKNDAEKAKRFKIFEQ 210
           ++   +LLL A  S A  ++    + ER        W + HGR Y    E+A R  +F +
Sbjct: 2   IVTPLLLLLLAIHSLAVVVETSALLTERELSRQWAGWKLQHGRVYSGK-EEAYRRGVFAR 60

Query: 211 NVKFIESFNK---AGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNES 381
           N+ +I+  N+   AG +SY  G+ +F+DL + EF    L                    S
Sbjct: 61  NLLYIKGQNRRFNAGLESYSTGLNQFADLESSEFSERFLGTRPESRVAGRRGRIWKALAS 120

Query: 382 LAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCN 561
            A +P+ +DWR+K  VT++KNQG CG CWAFS+  A+EG    +TG+L+ LSEQQL+DC+
Sbjct: 121 AAGLPDTVDWRDKNLVTEVKNQGNCGSCWAFSSTGALEGAFAKKTGKLISLSEQQLVDCS 180

Query: 562 LKN 570
           LKN
Sbjct: 181 LKN 183



>gb:AF157961_1246018 Hypera postica cysteine proteinase mRNA,
           complete cds.
          Length = 324

 Score =  120 bits (300), Expect = 2e-26
 Identities = 61/147 (41%), Positives = 88/147 (59%), Gaps = 3/147 (2%)
 Frame = +1

Query: 127 RHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN---KAGNQSYKLGVKKFSDLTNE 297
           + + + + HG++Y N AE++KRF IF  NV+ IE+ N   + G  SYK G+ KF+D++ E
Sbjct: 25  KFQAFKLEHGKTYLNQAEESKRFNIFTDNVRAIEAHNALYEQGKVSYKKGINKFTDMSQE 84

Query: 298 EFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFS 477
           EFK TML                       E+P  +DWR++G VT +K+QG CG CWAFS
Sbjct: 85  EFK-TMLTLSASRKPTLETTSYVKTG---VEIPSSVDWRKEGRVTGVKDQGDCGSCWAFS 140

Query: 478 AVAAMEGITQIRTGQLMRLSEQQLLDC 558
              + EG    ++G+L+ LSEQQL+DC
Sbjct: 141 ITGSTEGAYARKSGKLVSLSEQQLIDC 167



>pir|T03694|T03694 cysteine proteinase (EC 3.4.22.-) -
           rice>gb:D76415_1674750 Rice seedling mRNA for cysteine
           proteinase, complete cds.
          Length = 368

 Score =  120 bits (300), Expect = 2e-26
 Identities = 67/182 (36%), Positives = 98/182 (53%), Gaps = 4/182 (2%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFI 225
           + +AAV L  A       L+ + ++ + +E+W  HH    ++  EK +RF  F+ NV++I
Sbjct: 18  MAMAAVELCAAIPFDERDLESDEALWDLYERWQEHH-HVPRHHGEKHRRFGAFKDNVRYI 76

Query: 226 ESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXN---ESLAEVP 396
              NK       L   +F D+  EEF+AT                        E + ++P
Sbjct: 77  HEHNKRAPGYAPLN--RFGDMGREEFRATFAGSHANDLRRDGLAAPPLPGFMYEGVRDLP 134

Query: 397 EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCN-LKNY 573
             +DWR KGAVT +K+QG CG CWAFS V ++EGI  IRTG+L+ LSEQ+L+DC+   N 
Sbjct: 135 RAVDWRRKGAVTGVKDQGKCGSCWAFSTVVSVEGINAIRTGRLVSLSEQELIDCDTADNS 194

Query: 574 GC 579
           GC
Sbjct: 195 GC 196



>gb:AB128161_2466293 Cyprinus carpio CTSL mRNA for cathepsin L
           preproprotein, complete cds.
          Length = 337

 Score =  119 bits (299), Expect = 3e-26
 Identities = 71/181 (39%), Positives = 102/181 (56%), Gaps = 9/181 (4%)
 Frame = +1

Query: 64  LLLGAFASQATALDEEPSM---LERH-EKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIES 231
           + L AFA   +A+   P++   L+ H E+W   HG+ Y ++ E+  R  ++E+N++ IE 
Sbjct: 3   VFLAAFALCLSAVFAAPTLDKQLDNHWEQWKNWHGKKY-HEKEEGWRRMVWEKNLQKIEL 61

Query: 232 FN---KAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEY 402
            N     G  +Y+LG+ +F D+T+EEF+  M   G                 +  EVP  
Sbjct: 62  HNLEHSMGTHTYRLGMNRFGDMTHEEFRQVM--NGYKHKKERRFRGSLFMEPNFLEVPNS 119

Query: 403 LDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYG 576
           LDWREKG VT +K+QG CG CWAFS   AMEG    +TG+L+ LSEQ L+DC+    N G
Sbjct: 120 LDWREKGYVTPVKDQGECGSCWAFSTTGAMEGQMFRKTGKLVSLSEQNLVDCSRPEGNEG 179

Query: 577 C 579
           C
Sbjct: 180 C 180



>gb:AF099203_1767963 Oryza sativa cysteine endopeptidase precursor
           (EP3A) gene, complete cds.
          Length = 368

 Score =  119 bits (299), Expect = 3e-26
 Identities = 67/182 (36%), Positives = 98/182 (53%), Gaps = 4/182 (2%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFI 225
           + +AAV L  A       L+ + ++ + +E+W  HH    ++  EK +RF  F+ NV++I
Sbjct: 18  MAMAAVELCAAIPFDERDLESDEALWDLYERWQEHH-HVPRHHGEKHRRFGAFKDNVRYI 76

Query: 226 ESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXN---ESLAEVP 396
              NK       L   +F D+  EEF+AT                        E + ++P
Sbjct: 77  HEHNKRAPGYPPLN--RFGDMGREEFRATFAGSHANDLRRDGLAAPPLPGFMYEGVRDLP 134

Query: 397 EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCN-LKNY 573
             +DWR KGAVT +K+QG CG CWAFS V ++EGI  IRTG+L+ LSEQ+L+DC+   N 
Sbjct: 135 RAVDWRRKGAVTGVKDQGKCGSCWAFSTVVSVEGINAIRTGRLVSLSEQELIDCDTADNS 194

Query: 574 GC 579
           GC
Sbjct: 195 GC 196



>gb:AY192365_1588670 Trifolium repens cysteine protease 10 gene,
           partial cds.
          Length = 272

 Score =  119 bits (299), Expect = 3e-26
 Identities = 60/119 (50%), Positives = 79/119 (66%), Gaps = 2/119 (1%)
 Frame = +1

Query: 229 SFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLD 408
           S +   N+ YKLG+ KF+DLTNEEFKA+  N+                 E+ + +P  +D
Sbjct: 1   SNSNVNNKLYKLGINKFADLTNEEFKASR-NKFKGHMCSSIIRTTTFKYENASAIPSTVD 59

Query: 409 WREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGC 579
           WR+KGAVT +KNQG CG CWAFSAVAA EGI Q+ TG+L+ LSEQ+L+DC+ K  + GC
Sbjct: 60  WRKKGAVTPVKNQGQCGSCWAFSAVAATEGIHQLSTGKLVSLSEQELIDCDTKGVDQGC 118



>gb:AJ583511_1282280 Diabrotica virgifera virgifera mRNA for
           cathepsin L-like proteinase, clone DvRS30.
          Length = 326

 Score =  119 bits (299), Expect = 3e-26
 Identities = 68/177 (38%), Positives = 102/177 (57%), Gaps = 4/177 (2%)
 Frame = +1

Query: 61  VLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNK 240
           V +L AFAS     D+E  +     ++ V + +SY+N  E+ KRF IF+ +++ IE+ N 
Sbjct: 5   VFILLAFASVHALSDKEEWV-----QFKVRNNKSYRNYIEEQKRFTIFQGSLRKIENHND 59

Query: 241 A---GNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDW 411
               G  ++KLGV KF+DLT +EF   +   G                  + ++P   DW
Sbjct: 60  KYDHGLSTFKLGVTKFADLTEKEFSDML---GISRSTKSSRPRVIHSLTPVKDLPSKFDW 116

Query: 412 REKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKN-YGC 579
           REKGAVT++K+QG CG CW+FS    +EG   ++TG+L+ LSEQ L+DC  ++ YGC
Sbjct: 117 REKGAVTEVKDQGSCGSCWSFSTTGTVEGAYFLKTGKLVSLSEQNLVDCAKEDCYGC 173



>gb:TRBACYSPRO_1400578 Trypanosoma congolense cysteine protease
           mRNA, complete cds.
          Length = 444

 Score =  119 bits (297), Expect = 5e-26
 Identities = 62/160 (38%), Positives = 93/160 (58%)
 Frame = +1

Query: 100 LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKF 279
           L  E S+ ++   +   + RSYK+  E+A RF++F+QN++  +    A N     GV +F
Sbjct: 31  LHAEQSLQQQFAAFKQKYSRSYKDATEEAFRFRVFKQNMERAKE-EAAANPYATFGVTRF 89

Query: 280 SDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCG 459
           SD++ EEF+AT  N G               N S  + PE +DWR+KGAVT +K+QG CG
Sbjct: 90  SDMSPEEFRATYHN-GAEYYAAALKRPRKVVNVSTGKAPEAVDWRKKGAVTPVKDQGQCG 148

Query: 460 CCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
            CWAFSA+  +EG  ++   +L  LSEQ L+ C+  ++GC
Sbjct: 149 SCWAFSAIGNIEGQWKVAGHELTSLSEQMLVSCDTNDFGC 188



>gb:AP006170_1861276 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OSJNBa0042B15.
          Length = 283

 Score =  118 bits (296), Expect = 6e-26
 Identities = 68/179 (37%), Positives = 92/179 (51%), Gaps = 11/179 (6%)
 Frame = +1

Query: 58  AVLLLGAFASQATA---------LDEEPSMLERHEKWM--VHHGRSYKNDAEKAKRFKIF 204
           AVL+  A A+ A           L+ E SM   +++W   VH      + AE   RF+ F
Sbjct: 11  AVLMATAMAASAPQPHVPFTDEDLESEESMWSLYQRWRGAVHTSSLDMDVAETESRFEAF 70

Query: 205 EQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESL 384
           + N +++  FNK    +YKLG+ KF+D+T EEF A                      E  
Sbjct: 71  KANARYVSEFNKKEGMTYKLGLNKFADMTLEEFVAKYTGTKVDAAAMARAPQAEEELELA 130

Query: 385 AEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCN 561
            +V    DWR+ GAVT  + QG C  CWAFSAV A+EG   I TG+L+ LSEQQ+LDC+
Sbjct: 131 GDVAASWDWRQHGAVTPAREQGTCESCWAFSAVGAVEGANAIATGKLVTLSEQQVLDCS 189



>gb:AB109188_1526793 Helianthus annuus scp3 mRNA for cysteine
           protease-3, complete cds.
          Length = 348

 Score =  118 bits (295), Expect = 8e-26
 Identities = 72/192 (37%), Positives = 101/192 (52%), Gaps = 6/192 (3%)
 Frame = +1

Query: 22  MASNFDFQLILAAVLLLGA-----FASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKA 186
           M  N  F L ++  L +G      F  +  A D+  S+ + +E+W   H  S   D EK 
Sbjct: 1   MECNKVFVLSISLALFIGVVNCIDFTEKDLATDK--SLWDLYERWGSQHMVSRAPD-EKK 57

Query: 187 KRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXX 366
           KRF +F+ NV  I   N+ G + YKL + +F+D+TN EFKA   ++              
Sbjct: 58  KRFNVFKYNVNHINRVNQLG-KPYKLKLNEFADMTNHEFKAGFDSKILHFRMLKGKRRQT 116

Query: 367 -XXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQ 543
              +    + P  +DWR  GAV  IKNQG CG CWAFS +  +EGI +I+T QL+ LSEQ
Sbjct: 117 PFTHAKTTDPPPSIDWRTNGAVNPIKNQGRCGSCWAFSTIVGVEGINKIKTNQLVSLSEQ 176

Query: 544 QLLDCNLKNYGC 579
           +L+DC     GC
Sbjct: 177 ELVDCETDCEGC 188



>gb:AY156691_1937293 Saimiri boliviensis cathepsin S preproprotein
           (CTSS) mRNA, complete cds.
          Length = 330

 Score =  117 bits (294), Expect = 1e-25
 Identities = 67/178 (37%), Positives = 98/178 (55%), Gaps = 5/178 (2%)
 Frame = +1

Query: 61  VLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN- 237
           V +L   +S  T L ++P++      W   +G+ YK   E+A R  I+E+N+KF+   N 
Sbjct: 5   VCVLFVCSSAVTQLHKDPTLDHHWNLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNL 64

Query: 238 --KAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDW 411
               G  SY LG+    D+T+EE  + M +                 N+ L   P+ +DW
Sbjct: 65  EHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPNQWQRNITYKSNPNQML---PDSVDW 121

Query: 412 REKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGC 579
           REKG VT++K QG CG CWAFSAV A+E   +++TG+L+ LS Q L+DC+ K  N GC
Sbjct: 122 REKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSEKYGNKGC 179



>gb:AF190653_1249496 Diabrotica virgifera virgifera cathepsin L-like
           cysteine proteinase CAL1 (CAL1) mRNA, partial cds.
          Length = 322

 Score =  117 bits (294), Expect = 1e-25
 Identities = 64/157 (40%), Positives = 91/157 (57%), Gaps = 3/157 (1%)
 Frame = +1

Query: 115 SMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN---KAGNQSYKLGVKKFSD 285
           S+ +  E + V HG+ YKN  E+  RF +F+ N+K I   N   + G   Y + V +F+D
Sbjct: 16  SLNQHWESFKVQHGKVYKNPIEERVRFSVFQANLKTINEHNAKYEQGLVGYTMAVNQFAD 75

Query: 286 LTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCC 465
           +T EEFKA +  +                N   AEVP+ +DWR+KGAV  +K+QG CG C
Sbjct: 76  MTPEEFKAKLGMQAKNMPKIKKSRHVKNVN---AEVPDSVDWRQKGAVLGVKDQGQCGSC 132

Query: 466 WAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYG 576
           WAFSA  ++EG   I  G+   LSEQ+LLDC+++ YG
Sbjct: 133 WAFSATGSLEGQNYIVNGKSEPLSEQELLDCSVE-YG 168



>gb:TCCYSPROT_1399672 T.congolense mRNA for (prepro) cysteine
           proteinase.
          Length = 442

 Score =  117 bits (293), Expect = 1e-25
 Identities = 62/160 (38%), Positives = 92/160 (57%)
 Frame = +1

Query: 100 LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKF 279
           L  E S+ ++   +   + RSYK+  E+A RF++F+QN++  +    A N     GV +F
Sbjct: 26  LHAEQSLQQQFAAFKQKYSRSYKDATEEAFRFRVFKQNMERAKE-EAAANPYATFGVTRF 84

Query: 280 SDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCG 459
           SD++ EEF+AT  N G               N S  + P  +DWR+KGAVT +K+QG CG
Sbjct: 85  SDMSPEEFRATYHN-GAEYYAAALKRPRKVVNVSTGKAPPAVDWRKKGAVTPVKDQGACG 143

Query: 460 CCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
            CWAFSA+  +EG  ++   +L  LSEQ L+ C+  +YGC
Sbjct: 144 SCWAFSAIGNIEGQWKVAGHELTSLSEQMLVSCDTTDYGC 183



>pir|S37048|S37048 cysteine proteinase - Trypanosoma congolense
          Length = 447

 Score =  117 bits (293), Expect = 1e-25
 Identities = 62/160 (38%), Positives = 92/160 (57%)
 Frame = +1

Query: 100 LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKF 279
           L  E S+ ++   +   + RSYK+  E+A RF++F+QN++  +    A N     GV +F
Sbjct: 31  LHAEQSLQQQFAAFKQKYSRSYKDATEEAFRFRVFKQNMERAKE-EAAANPYATFGVTRF 89

Query: 280 SDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCG 459
           SD++ EEF+AT  N G               N S  + P  +DWR+KGAVT +K+QG CG
Sbjct: 90  SDMSPEEFRATYHN-GAEYYAAALKRPRKVVNVSTGKAPPAVDWRKKGAVTPVKDQGACG 148

Query: 460 CCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
            CWAFSA+  +EG  ++   +L  LSEQ L+ C+  +YGC
Sbjct: 149 SCWAFSAIGNIEGQWKVAGHELTSLSEQMLVSCDTTDYGC 188



>gb:AJ784223_1284201 Suberites domuncula mRNA for cathepsin H (cat-H
           gene).
          Length = 335

 Score =  117 bits (292), Expect = 2e-25
 Identities = 63/159 (39%), Positives = 88/159 (55%), Gaps = 3/159 (1%)
 Frame = +1

Query: 112 PSMLERHEK-WMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDL 288
           P + E + K W   HG+ Y  + E   R K+F +NV +I++ NK G+ SY+L V +++D+
Sbjct: 28  PGLYEDYFKEWQEKHGKVYSTEEESQSRLKVFMKNVIYIDNHNKQGH-SYELEVNEYADM 86

Query: 289 TNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCW 468
           T +EFK   L E                     + P+ +DWR KGAVT +KNQG CG CW
Sbjct: 87  TLDEFKDQYLMEPQHCSATHSLKSDP---PKYRDPPKAIDWRSKGAVTPVKNQGQCGSCW 143

Query: 469 AFSAVAAMEGITQIRTGQLMRLSEQQLLDC--NLKNYGC 579
            FS    +E    ++TGQL+ LSEQQL+DC     N GC
Sbjct: 144 TFSTTGCLESHHFLKTGQLVSLSEQQLVDCAQAFNNNGC 182



>gb:HUMCATS_2029864 Homo sapiens cathepsin S (CTSS) mRNA, complete
           cds.
          Length = 331

 Score =  116 bits (291), Expect = 2e-25
 Identities = 64/175 (36%), Positives = 95/175 (54%), Gaps = 3/175 (1%)
 Frame = +1

Query: 61  VLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN- 237
           V +L   +S    L ++P++      W   +G+ YK   E+A R  I+E+N+KF+   N 
Sbjct: 5   VCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNL 64

Query: 238 --KAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDW 411
               G  SY LG+    D+T+EE  + M +                 N  L   P+ +DW
Sbjct: 65  EHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRIL---PDSVDW 121

Query: 412 REKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYG 576
           REKG VT++K QG CG CWAFSAV A+E   +++TG+L+ LS Q L+DC+ + YG
Sbjct: 122 REKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYG 176



>gb:AL356292_1924398 Human DNA sequence from clone RP11-363I22 on
           chromosome 1 Contains the 5' end of the gene for
           GPP34-related protein (GPP34R), the gene for a novel
           protein (DKFZp434A1315), the CTSS gene for cathepsin S,
           a pseudogene similar to part of short coiled-coil
           protein (SCOC) and the 3' end of the CTSK gene for
           cathepsin K (pycnodysostosis), complete sequence.
          Length = 331

 Score =  116 bits (291), Expect = 2e-25
 Identities = 64/175 (36%), Positives = 95/175 (54%), Gaps = 3/175 (1%)
 Frame = +1

Query: 61  VLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN- 237
           V +L   +S    L ++P++      W   +G+ YK   E+A R  I+E+N+KF+   N 
Sbjct: 5   VCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNL 64

Query: 238 --KAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDW 411
               G  SY LG+    D+T+EE  + M +                 N  L   P+ +DW
Sbjct: 65  EHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRIL---PDSVDW 121

Query: 412 REKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYG 576
           REKG VT++K QG CG CWAFSAV A+E   +++TG+L+ LS Q L+DC+ + YG
Sbjct: 122 REKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYG 176



>sp|P25774|CATS_HUMAN Cathepsin S precursor (EC 3.4.22.27).
          Length = 331

 Score =  116 bits (291), Expect = 2e-25
 Identities = 64/175 (36%), Positives = 95/175 (54%), Gaps = 3/175 (1%)
 Frame = +1

Query: 61  VLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN- 237
           V +L   +S    L ++P++      W   +G+ YK   E+A R  I+E+N+KF+   N 
Sbjct: 5   VCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNL 64

Query: 238 --KAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDW 411
               G  SY LG+    D+T+EE  + M +                 N  L   P+ +DW
Sbjct: 65  EHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRIL---PDSVDW 121

Query: 412 REKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYG 576
           REKG VT++K QG CG CWAFSAV A+E   +++TG+L+ LS Q L+DC+ + YG
Sbjct: 122 REKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVTLSAQNLVDCSTEKYG 176



>gb:AF358668_2489199 Oncorhynchus mykiss procathepsin L mRNA,
           complete cds.
          Length = 338

 Score =  116 bits (290), Expect = 3e-25
 Identities = 72/184 (39%), Positives = 99/184 (53%), Gaps = 6/184 (3%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPSMLERH-EKWMVHHGRSYKNDAEKAKRFKIFEQNVKF 222
           L LA ++L  +    A   D   S LE H   W   H + Y +++E+  R  ++E+N+K 
Sbjct: 4   LYLAVLVLCVSAVCAAPRFD---SQLEDHWHLWKNWHSKHY-HESEEGWRRMVWEKNLKK 59

Query: 223 IESFN---KAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEV 393
           IE  N     G  SY+LG+  F D+TNEEF+ TM   G                 +  + 
Sbjct: 60  IEIHNLEHTMGKHSYRLGMNHFGDMTNEEFRQTM--NGYKQTTERKFKGSLFMEPNYLQA 117

Query: 394 PEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-- 567
           P+ +DWREKG VT +K+QG CG CWAFS   AMEG    +TG+L+ LSEQ L+DC+    
Sbjct: 118 PKAVDWREKGYVTPVKDQGSCGSCWAFSTTGAMEGQQFRKTGKLVSLSEQNLVDCSRPEG 177

Query: 568 NYGC 579
           N GC
Sbjct: 178 NEGC 181



>gb:AP006170_1861281 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OSJNBa0042B15.
          Length = 369

 Score =  115 bits (289), Expect = 4e-25
 Identities = 72/182 (39%), Positives = 100/182 (54%), Gaps = 12/182 (6%)
 Frame = +1

Query: 52  LAAVLLLGAFASQATA------LDEEPSMLERHEKWMVHHGRSYKN----DAEKAKRFKI 201
           L+A+LLL A A+          L+ E +M + +E+W   +  S ++    D  K+ RF+ 
Sbjct: 11  LSAILLLAAAAADVDVTVRDSDLESEETMWDLYERWRRVYASSSQDLPSSDMMKS-RFEA 69

Query: 202 FEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNES 381
           F+ N + +  FNK    SY LG+ KFSD++ EEF A     G               +  
Sbjct: 70  FKANARQVNEFNKKEGMSYTLGLNKFSDMSYEEFAAKYTG-GMPGSIADDRSSAGAVSCK 128

Query: 382 LAE--VPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLD 555
           L E  VP   DWR+  AVT +K+QG CG CWAFS V A+E I +IRTG L+ LSEQQ+LD
Sbjct: 129 LREKNVPLTWDWRDSRAVTPVKDQGPCGSCWAFSVVGAVESINKIRTGILLTLSEQQVLD 188

Query: 556 CN 561
           C+
Sbjct: 189 CS 190



>gb:AF019145_1761576 Zea mays cysteine protease Mir1 (mir1) mRNA,
           complete cds.
          Length = 398

 Score =  115 bits (289), Expect = 4e-25
 Identities = 71/207 (34%), Positives = 108/207 (52%), Gaps = 29/207 (14%)
 Frame = +1

Query: 46  LILAAVLLLGAFA----SQATALDEEPSMLER--------HEKWMVHHGR--SYKNDAEK 183
           L+LA  L L A A    S  T     P+  ER        +E W   HGR  S  +D + 
Sbjct: 14  LLLAVALALAATAAARHSYTTTTTRVPAPAERADEEVRRMYEAWKSKHGRGGSSNDDCDM 73

Query: 184 AK------------RFKIFEQNVKFIESFNK---AGNQSYKLGVKKFSDLTNEEFKATML 318
           A             R ++F  N+++I++ N    AG  +++LG+  F+DLT EE++  +L
Sbjct: 74  APGDDEQEEEDRRLRLEVFRDNLRYIDAHNAEADAGLHTFRLGLTPFADLTLEEYRGRVL 133

Query: 319 NEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEG 498
                                  ++P+ +DWR+ GAVT++K+Q  CG CWAFSAVAA+EG
Sbjct: 134 GFRARGRRSGARYGSGYSVRG-GDLPDAIDWRQLGAVTEVKDQQQCGGCWAFSAVAAIEG 192

Query: 499 ITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           +  I TG L+ LSEQ+++DC+ ++ GC
Sbjct: 193 VNAIATGNLVSLSEQEIIDCDAQDSGC 219



>gb:AJ583510_1282279 Diabrotica virgifera virgifera partial mRNA for
           cathepsin L-like proteinase, clone DvRS29.
          Length = 317

 Score =  115 bits (289), Expect = 4e-25
 Identities = 66/158 (41%), Positives = 94/158 (59%), Gaps = 8/158 (5%)
 Frame = +1

Query: 130 HEKWM---VHHGRSYKNDAEKAKRFKIFEQNVKFIESFN---KAGNQSYKLGVKKFSDLT 291
           H++W    V+H + Y +  E+  RF++F QN++ IE  N   + G  S+ LGV +F+D+T
Sbjct: 13  HQQWAQFKVNHSKKYGHLKEEQVRFQVFSQNLQKIEQHNARYQNGEVSFYLGVNQFADMT 72

Query: 292 NEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWA 471
           +EEFKA ML+                 +  L  VPE +DWREKGAV  +++Q  CG CWA
Sbjct: 73  SEEFKA-MLDSQLIHKPKRDITSRFVADPQLT-VPESIDWREKGAVNPVRDQEQCGSCWA 130

Query: 472 FSAVAAMEGITQIRTGQLMRLSEQQLLDC--NLKNYGC 579
           FSA  A+EG   ++ G+L  LS QQL+DC  + KN GC
Sbjct: 131 FSAAGALEGQRFLKEGKLEVLSTQQLVDCSRDYKNEGC 168



>gb:BC002642_1968284 Homo sapiens cathepsin S, mRNA (cDNA clone
           MGC:3886 IMAGE:3610589), complete
           cds.>gb:CR541676_1993906 Homo sapiens full open reading
           frame cDNA clone RZPDo834D0328D for gene CTSS, cathepsin
           S; complete cds, incl. stopcodon.
          Length = 331

 Score =  115 bits (288), Expect = 5e-25
 Identities = 64/175 (36%), Positives = 95/175 (54%), Gaps = 3/175 (1%)
 Frame = +1

Query: 61  VLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN- 237
           V +L   +S    L ++P++      W   +G+ YK   E+A R  I+E+N+KF+   N 
Sbjct: 5   VCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNL 64

Query: 238 --KAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDW 411
               G  SY LG+    D+T+EE  + M +                 N  L   P+ +DW
Sbjct: 65  EHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNWIL---PDSVDW 121

Query: 412 REKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYG 576
           REKG VT++K QG CG CWAFSAV A+E   +++TG+L+ LS Q L+DC+ + YG
Sbjct: 122 REKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYG 176



>gb:AF038546_2051874 Mus musculus cathepsin S precursor, mRNA,
           complete cds.
          Length = 340

 Score =  115 bits (287), Expect = 7e-25
 Identities = 62/163 (38%), Positives = 91/163 (55%), Gaps = 4/163 (2%)
 Frame = +1

Query: 100 LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN---KAGNQSYKLGV 270
           L  +P++    + W   H + YK+  E+  R  I+E+N+KFI   N     G  +Y++G+
Sbjct: 26  LQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGM 85

Query: 271 KKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQG 450
               D+TNEE    M   G               + S   +P+ +DWREKG VT++K QG
Sbjct: 86  NDMGDMTNEEISCRM---GALRISRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQG 142

Query: 451 YCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC-NLKNYG 576
            CG CWAFSAV A+EG  +++TG+L+ LS Q L+DC N + YG
Sbjct: 143 SCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYG 185



>gb:AY528229_1333138 Leptinotarsa decemlineata clone IntB11
           digestive cysteine proteinase intestain mRNA, complete
           cds.
          Length = 326

 Score =  115 bits (287), Expect = 7e-25
 Identities = 73/176 (41%), Positives = 98/176 (55%), Gaps = 6/176 (3%)
 Frame = +1

Query: 67  LLGAFASQATALDEEPSMLERHEKWMVH---HGRSYKNDAEKAKRFKIFEQNVKFIESFN 237
           LL  FAS   A++     L   ++W+     HG++YK+  E+  RF IF+ N++ IE  N
Sbjct: 3   LLAVFASVLLAVNA----LTDKDQWVAFKQTHGKTYKSLLEERTRFGIFQSNLRKIEEHN 58

Query: 238 KA---GNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLD 408
                G +SY LGV  F+DLT++EFK  +  +                 E L EVP+ +D
Sbjct: 59  AKYDKGEESYFLGVTPFADLTHDEFKDELRRQ--IKTKPNVEATLAVFPEGL-EVPDSID 115

Query: 409 WREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYG 576
           W +KGAV D+K QG CG CWAFSA  A+EG   I     + LSEQQLLDC+ K YG
Sbjct: 116 WTQKGAVLDVKYQGGCGSCWAFSATGALEGQNAIVNNVKIPLSEQQLLDCS-KPYG 170



>gb:AF115280_1242488 Sarcocystis muris thiolproteinase SmTP1 (smtp1)
           mRNA, complete cds.
          Length = 394

 Score =  115 bits (287), Expect = 7e-25
 Identities = 68/182 (37%), Positives = 99/182 (54%), Gaps = 16/182 (8%)
 Frame = +1

Query: 82  ASQATALDEEPSMLERHEKWMVHHGRS------------YKNDAEKAKRFKIFEQNVKFI 225
           AS ++  D +    E+  +W  HH +S            Y  + E+ KR+ IF+ N+ +I
Sbjct: 61  ASPSSITDGDAKYPEKIWEWKDHHFQSQFYQFQRDHNKFYATEEERLKRYAIFKNNLTYI 120

Query: 226 ESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAE--VPE 399
            + N  G  SY L + KF DLT EEF+   L                   ES+ +  +P 
Sbjct: 121 HNHNMQG-YSYVLKMNKFGDLTLEEFRQRYLGYKKPDLRTPPREVDTTL-ESVEDNDIPT 178

Query: 400 YLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCN--LKNY 573
           ++DWR++G VT +K+QG CG CWAFSA  AMEG+   +TG+L+ LS+QQL+DC+  L N 
Sbjct: 179 HVDWRQRGCVTSVKDQGDCGSCWAFSATGAMEGVYCAKTGKLVNLSQQQLVDCSRFLGNQ 238

Query: 574 GC 579
           GC
Sbjct: 239 GC 240



>pir|A25492|KHBH aleurain (EC 3.4.22.-) precursor - barley
          Length = 361

 Score =  115 bits (287), Expect = 7e-25
 Identities = 59/153 (38%), Positives = 88/153 (57%), Gaps = 2/153 (1%)
 Frame = +1

Query: 127 RHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFK 306
           R  ++ V +G+SY++ AE  +RF+IF ++++ + S N+ G   Y+LG+ +FSD++ EEF+
Sbjct: 60  RFARFAVRYGKSYESAAEVRRRFRIFSESLEEVRSTNRKG-LPYRLGINRFSDMSWEEFQ 118

Query: 307 ATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVA 486
           AT L                      A +PE  DWRE G V+ +KNQ +CG CW FS   
Sbjct: 119 ATRLGAAQTCSATLAGNHLM---RDAAALPETKDWREDGIVSPVKNQAHCGSCWTFSTTG 175

Query: 487 AMEGITQIRTGQLMRLSEQQLLDC--NLKNYGC 579
           A+E      TG+ + LSEQQL+DC     N+GC
Sbjct: 176 ALEAAYTQATGKNISLSEQQLVDCAGGFNNFGC 208



>sp|O70370|CATS_MOUSE Cathepsin S precursor (EC
           3.4.22.27).>gb:MMCATS7_2114427 Mus musculus cathepsin S
           (CatS) gene, exon 8 and complete cds.
          Length = 340

 Score =  115 bits (287), Expect = 7e-25
 Identities = 62/163 (38%), Positives = 91/163 (55%), Gaps = 4/163 (2%)
 Frame = +1

Query: 100 LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN---KAGNQSYKLGV 270
           L  +P++    + W   H + YK+  E+  R  I+E+N+KFI   N     G  +Y++G+
Sbjct: 26  LQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGM 85

Query: 271 KKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQG 450
               D+TNEE    M   G               + S   +P+ +DWREKG VT++K QG
Sbjct: 86  NDMGDMTNEEISCRM---GALRISRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQG 142

Query: 451 YCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC-NLKNYG 576
            CG CWAFSAV A+EG  +++TG+L+ LS Q L+DC N + YG
Sbjct: 143 SCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYG 185



>sp|P05167|ALEU_HORVU Thiol protease aleurain precursor (EC
           3.4.22.16).>gb:HVLEU_1682441 Barley gene for thiol
           protease aleurain.
          Length = 362

 Score =  115 bits (287), Expect = 7e-25
 Identities = 59/153 (38%), Positives = 88/153 (57%), Gaps = 2/153 (1%)
 Frame = +1

Query: 127 RHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFK 306
           R  ++ V +G+SY++ AE  +RF+IF ++++ + S N+ G   Y+LG+ +FSD++ EEF+
Sbjct: 60  RFARFAVRYGKSYESAAEVRRRFRIFSESLEEVRSTNRKG-LPYRLGINRFSDMSWEEFQ 118

Query: 307 ATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVA 486
           AT L                      A +PE  DWRE G V+ +KNQ +CG CW FS   
Sbjct: 119 ATRLGAAQTCSATLAGNHLM---RDAAALPETKDWREDGIVSPVKNQAHCGSCWTFSTTG 175

Query: 487 AMEGITQIRTGQLMRLSEQQLLDC--NLKNYGC 579
           A+E      TG+ + LSEQQL+DC     N+GC
Sbjct: 176 ALEAAYTQATGKNISLSEQQLVDCAGGFNNFGC 208



>gb:DRCATHEPL_2571000 D.rerio mRNA for cathepsin L.
          Length = 336

 Score =  114 bits (286), Expect = 9e-25
 Identities = 64/178 (35%), Positives = 95/178 (53%), Gaps = 6/178 (3%)
 Frame = +1

Query: 64  LLLGAFASQATALDEEPSMLERH-EKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN- 237
           LL+  + S   A       L+ H   W   HG+SY  D E  +R  I+E+N++ IE  N 
Sbjct: 5   LLVTLYISAVFAAPSIDIQLDDHWNSWKSQHGKSYHEDVEVGRRM-IWEENLRKIEQHNF 63

Query: 238 --KAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDW 411
               GN ++K+G+ +F D+TNEEF+  M   G                 S    P+ +DW
Sbjct: 64  EYSYGNHTFKMGMNQFGDMTNEEFRQAM--NGYTHDPNQTSQGPLFMEPSFFAAPQQVDW 121

Query: 412 REKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGC 579
           R++G VT +K+Q  CG CW+FS+  A+EG    +TG+L+ +SEQ L+DC+    N GC
Sbjct: 122 RQRGYVTPVKDQKQCGSCWSFSSTGALEGQLFRKTGKLISMSEQNLVDCSRPQGNQGC 179



>gb:AP006170_1861277 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OSJNBa0042B15.
          Length = 369

 Score =  114 bits (286), Expect = 9e-25
 Identities = 58/155 (37%), Positives = 86/155 (55%), Gaps = 1/155 (0%)
 Frame = +1

Query: 100 LDEEPSMLERHEKWMVHHGRSYKN-DAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKK 276
           L+ E SM   +++W   +  S  +   +   RF+ F+ N +++  FNK    +Y+LG+ K
Sbjct: 38  LESEQSMWNLYDRWRAVYASSSSHLGGDIESRFEAFKANARYVSEFNKKEGMTYELGLNK 97

Query: 277 FSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYC 456
           F+D+T EEF A                      E + +VP   DWR+ G VT +K+QG C
Sbjct: 98  FADMTLEEFVAKYAG-AKVDAAAALASVPEAEEEVVGDVPAAWDWRQHGVVTPVKDQGSC 156

Query: 457 GCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCN 561
           G CWAFS+V A+E    I T +L+RLSEQQ+LDC+
Sbjct: 157 GSCWAFSSVGAVESAYAIATKKLLRLSEQQVLDCS 191



>gb:LMU249847_1685158 Lolium multiflorum mRNA for cysteine protease
           (see1 gene).
          Length = 359

 Score =  114 bits (286), Expect = 9e-25
 Identities = 62/153 (40%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = +1

Query: 127 RHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFK 306
           R  ++ V HG+SY + AE  +RF+IF +++  + S N+ G  SYKLG+ +FSD+T EEF+
Sbjct: 57  RFARFAVRHGKSYGSAAEVQRRFRIFSESLDEVRSTNRKG-LSYKLGINRFSDMTWEEFQ 115

Query: 307 ATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVA 486
           AT L                    +L   PE  DWRE G V+ +K+Q  CG CW FS   
Sbjct: 116 ATKLGAAQTCSATLAGNHLMRDANAL---PETKDWRETGIVSPVKDQASCGSCWTFSTTG 172

Query: 487 AMEGITQIRTGQLMRLSEQQLLDC--NLKNYGC 579
           A+E      TG+ + LSEQQL+DC     N+GC
Sbjct: 173 ALEAAYTQATGKNISLSEQQLVDCAGAYNNFGC 205



>gb:AY336947_1320742 Anthonomus grandis cysteine proteinase (cys1)
           mRNA, complete cds.
          Length = 322

 Score =  114 bits (286), Expect = 9e-25
 Identities = 66/163 (40%), Positives = 89/163 (54%), Gaps = 8/163 (4%)
 Frame = +1

Query: 115 SMLERH----EKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN---KAGNQSYKLGVK 273
           S++E+H    E + V +G+SY+N  E+ +RF IF  NV  IE  N   + G  SYK  + 
Sbjct: 17  SLIEKHQALFETFKVENGKSYRNQVEEVQRFNIFRANVLEIEQHNALYEQGLVSYKKAIN 76

Query: 274 KFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGY 453
           +F+DLT EEFKA +                        EVP  +DWR  G VT +KNQG 
Sbjct: 77  QFTDLTQEEFKAYL-----GLHVKPVLNNTIQYELKGLEVPTSVDWRSAGQVTGVKNQGS 131

Query: 454 CGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-NYGC 579
           CG CW+F+   + EG    +  QL+ LSEQQL+DC+   NYGC
Sbjct: 132 CGSCWSFALTGSTEGAYYRKHKQLVSLSEQQLVDCSTSINYGC 174



>pir|T01206|T01206 cysteine proteinase mir2 (EC 3.4.22.-) -
           maize>gb:AF019146_1761577 Zea mays cysteine proteinase
           Mir2 (mir2) mRNA, complete cds.
          Length = 493

 Score =  114 bits (286), Expect = 9e-25
 Identities = 57/140 (40%), Positives = 92/140 (65%), Gaps = 6/140 (4%)
 Frame = +1

Query: 178 EKAKRFKIFEQNVKFIESFNK---AGNQSYKLGVKKFSDLTNEEFKATML--NEGXXXXX 342
           + A+R ++F  N+++I++ N    AG   ++LG+ +F+DLT EE++A +L  + G     
Sbjct: 88  DDARRLEVFRDNLRYIDAHNAEADAGLHGFRLGLTRFADLTLEEYRARLLLGSRGRNGTA 147

Query: 343 XXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQ 522
                       +  ++P+ +DWRE+GAV ++K+QG CG CWAFSAVAA+EGI +I TG 
Sbjct: 148 VGVVGRRRYLPLAGEQLPDAVDWRERGAVAEVKDQGQCGGCWAFSAVAAVEGINKIVTGS 207

Query: 523 LMRLSEQQLLDCN-LKNYGC 579
           L+ LSEQ+L+DC+  ++ GC
Sbjct: 208 LISLSEQELIDCDKFQDQGC 227



>gb:MMCATHEPS_2114426 Mus musculus mRNA for cathepsin S.
          Length = 330

 Score =  114 bits (285), Expect = 1e-24
 Identities = 63/164 (38%), Positives = 91/164 (55%), Gaps = 4/164 (2%)
 Frame = +1

Query: 97  ALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN---KAGNQSYKLG 267
           A  E P++    + W   H + YK+  E+  R  I+E+N+KFI   N     G  +Y++G
Sbjct: 15  ATAERPTLDHHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVG 74

Query: 268 VKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQ 447
           +    D+TNEE    M   G               + S   +P+ +DWREKG VT++K Q
Sbjct: 75  MNDMGDMTNEEILCRM---GALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQ 131

Query: 448 GYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC-NLKNYG 576
           G CG CWAFSAV A+EG  +++TG+L+ LS Q L+DC N + YG
Sbjct: 132 GSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYG 175



>gb:AH005369S6_1906625 Human cathepsin S gene, exon 6, partial cds.
          Length = 267

 Score =  114 bits (285), Expect = 1e-24
 Identities = 63/175 (36%), Positives = 94/175 (53%), Gaps = 3/175 (1%)
 Frame = +1

Query: 61  VLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN- 237
           V +L   +S    L ++P++      W   +G+ YK   E+A R  I+E+N+KF+   N 
Sbjct: 5   VCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNL 64

Query: 238 --KAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDW 411
               G  SY LG+    D+T+EE  +   +                 N  L   P+ +DW
Sbjct: 65  EHSMGMHSYDLGMNHLGDMTSEEVMSLTSSLRVPSQWQRNITYKSNPNRIL---PDSVDW 121

Query: 412 REKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYG 576
           REKG VT++K QG CG CWAFSAV A+E   +++TG+L+ LS Q L+DC+ + YG
Sbjct: 122 REKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVTLSAQNLVDCSTEKYG 176



>gb:AE014297_1137928 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003603_1217466 Drosophila melanogaster
           chromosome 3R, section 5 of 118 of the complete
           sequence.
          Length = 475

 Score =  114 bits (285), Expect = 1e-24
 Identities = 59/149 (39%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = +1

Query: 136 KWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKA-T 312
           K+ V  GR Y + AE+  R +IF QN+K IE  N     S K G+ +F+D+T+ E+K  T
Sbjct: 171 KFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAKYGITEFADMTSSEYKERT 230

Query: 313 MLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAM 492
            L +                     E+P+  DWR+K AVT +KNQG CG CWAFS    +
Sbjct: 231 GLWQRDEAKATGGSAAVVPAYHG--ELPKEFDWRQKDAVTQVKNQGSCGSCWAFSVTGNI 288

Query: 493 EGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           EG+  ++TG+L   SEQ+LLDC+  +  C
Sbjct: 289 EGLYAVKTGELKEFSEQELLDCDTTDSAC 317



>pir|A42482|A42482 cathepsin S (EC 3.4.22.27) precursor -
           human>gb:HUMCATSS_2029865 Human cathepsin S mRNA,
           complete cds.>gb:S93414_2042206 cathepsin
           S=elastinolytic cysteine protease [human, alveolar
           macrophages, mRNA, 1255 nt].
          Length = 331

 Score =  114 bits (285), Expect = 1e-24
 Identities = 63/175 (36%), Positives = 94/175 (53%), Gaps = 3/175 (1%)
 Frame = +1

Query: 61  VLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN- 237
           V +L   +S    L ++P++      W   +G+ YK   E+A R  I+E+N+KF+   N 
Sbjct: 5   VCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNL 64

Query: 238 --KAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDW 411
               G  SY LG+    D+T+EE  +   +                 N  L   P+ +DW
Sbjct: 65  EHSMGMHSYDLGMNHLGDMTSEEVMSLTSSLRVPSQWQRNITYKSNPNRIL---PDSVDW 121

Query: 412 REKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYG 576
           REKG VT++K QG CG CWAFSAV A+E   +++TG+L+ LS Q L+DC+ + YG
Sbjct: 122 REKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVTLSAQNLVDCSTEKYG 176



>sp|Q9VN93|CPR1_DROME Putative cysteine proteinase CG12163 precursor
           (EC 3.4.22.-).>gb:AE014297_1137929 Drosophila
           melanogaster chromosome 3R, complete
           sequence.>gb:AE003603_1217467 Drosophila melanogaster
           chromosome 3R, section 5 of 118 of the complete
           sequence.>gb:BT003231_1356742 Drosophila melanogaster
           LP08529 full insert cDNA.
          Length = 614

 Score =  114 bits (285), Expect = 1e-24
 Identities = 59/149 (39%), Positives = 83/149 (55%), Gaps = 1/149 (0%)
 Frame = +1

Query: 136 KWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKA-T 312
           K+ V  GR Y + AE+  R +IF QN+K IE  N     S K G+ +F+D+T+ E+K  T
Sbjct: 310 KFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAKYGITEFADMTSSEYKERT 369

Query: 313 MLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAM 492
            L +                     E+P+  DWR+K AVT +KNQG CG CWAFS    +
Sbjct: 370 GLWQRDEAKATGGSAAVVPAYHG--ELPKEFDWRQKDAVTQVKNQGSCGSCWAFSVTGNI 427

Query: 493 EGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           EG+  ++TG+L   SEQ+LLDC+  +  C
Sbjct: 428 EGLYAVKTGELKEFSEQELLDCDTTDSAC 456



>gb:BC075887_2558777 Danio rerio zgc:92089, mRNA (cDNA clone
           MGC:92089 IMAGE:7047077), complete cds.
          Length = 334

 Score =  114 bits (284), Expect = 1e-24
 Identities = 66/183 (36%), Positives = 101/183 (55%), Gaps = 7/183 (3%)
 Frame = +1

Query: 52  LAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIES 231
           +  +++  AF + A+A       +E H  W +  G+SY++  E++ R   +  N K +  
Sbjct: 1   MRVLVVAAAFLAVASAASLSLEDMEFHA-WKLKFGKSYRSAEEESHRQLTWLTNRKLVLV 59

Query: 232 FNKAGNQ---SYKLGVKKFSDLTNEEFKATMLNE--GXXXXXXXXXXXXXXXNESLAEVP 396
            N   +Q   SY+LG+  F+D++NEE++  +     G                   A VP
Sbjct: 60  HNMMADQGLKSYRLGMTYFADMSNEEYRQLVFRGCLGSMNNTKARGGSTFFRLRKAAVVP 119

Query: 397 EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC--NLKN 570
           + +DWR+KG VTDIK+Q  CG CWAFSA  ++EG T  +TG+L+ LSEQQL+DC  +  N
Sbjct: 120 DTVDWRDKGYVTDIKDQKQCGSCWAFSATGSLEGQTFRKTGKLVSLSEQQLVDCSGSYGN 179

Query: 571 YGC 579
           YGC
Sbjct: 180 YGC 182



>gb:TBR297265_1399271 Trypanosoma brucei rhodesiense partial mRNA
           for cysteine protease (rhodesain gene).
          Length = 450

 Score =  114 bits (284), Expect = 1e-24
 Identities = 67/179 (37%), Positives = 93/179 (51%), Gaps = 3/179 (1%)
 Frame = +1

Query: 52  LAAVLLLGAFASQATALDE---EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF 222
           L  VLL  A    + AL     E S+  R   +   +G+ YK+  E+A RF+ FE+N++ 
Sbjct: 12  LPVVLLAMAACLASVALGSLHVEESLEMRFAAFKKKYGKVYKDAKEEAFRFRAFEENMEQ 71

Query: 223 IESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEY 402
            +    A N     GV  FSD+T EEF+A   N G               N +    P  
Sbjct: 72  AK-IQAAANPYATFGVTPFSDMTREEFRARYRN-GASYFAAAQKRLRKTVNVTTGRAPAA 129

Query: 403 LDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           +DWREKGAVT +K+QG CG CWAFS +  +EG  Q+    L+ LSEQ L+ C+  ++GC
Sbjct: 130 VDWREKGAVTPVKDQGQCGSCWAFSTIGNIEGQWQVAGNPLVSLSEQMLVSCDTIDFGC 188



>gb:AY528230_1333139 Leptinotarsa decemlineata clone IntB12
           digestive cysteine proteinase intestain mRNA, complete
           cds.
          Length = 326

 Score =  114 bits (284), Expect = 1e-24
 Identities = 72/176 (40%), Positives = 98/176 (55%), Gaps = 6/176 (3%)
 Frame = +1

Query: 67  LLGAFASQATALDEEPSMLERHEKWMVH---HGRSYKNDAEKAKRFKIFEQNVKFIESFN 237
           LL  FA+   A++     L   ++W+     HG++YK+  E+  RF IF+ N++ IE  N
Sbjct: 3   LLAVFATVLLAVNA----LTDKDQWVAFKQTHGKTYKSLLEERTRFGIFQSNLRKIEEHN 58

Query: 238 KA---GNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLD 408
                G +SY LGV  F+DLT++EFK  +  +                 E L EVP+ +D
Sbjct: 59  AKYDKGEESYFLGVTPFADLTHDEFKDKLRRQ--IKTKPNVEATLAVFPEGL-EVPDSID 115

Query: 409 WREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYG 576
           W +KGAV D+K QG CG CWAFSA  A+EG   I     + LSEQQLLDC+ K YG
Sbjct: 116 WTQKGAVLDVKYQGGCGSCWAFSATGALEGQNAIVNNVKIPLSEQQLLDCS-KPYG 170



>gb:AY231965_1177258 Drosophila yakuba clone yak-em_CG12163 mRNA
           sequence.
          Length = 213

 Score =  114 bits (284), Expect = 1e-24
 Identities = 59/152 (38%), Positives = 81/152 (53%), Gaps = 4/152 (2%)
 Frame = +1

Query: 136 KWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKAT- 312
           K+ V  GR Y + AE+  R +IF QN+K IE  N     S K G+ +F+D+T+ E+K   
Sbjct: 39  KFQVRFGRRYVSTAERQMRLRIFRQNLKTIEQLNVNEMGSAKYGITEFADMTSSEYKERT 98

Query: 313 ---MLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAV 483
                NE                     E+P+  DWR+K AVT +KNQG CG CWAFS  
Sbjct: 99  GLWQRNEAKATGGSVAVVPAYH-----GELPKEFDWRQKNAVTQVKNQGSCGSCWAFSVT 153

Query: 484 AAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
             +EG+  ++TG L   SEQ+LLDC+  +  C
Sbjct: 154 GNIEGLHAVKTGDLKEFSEQELLDCDTTDSAC 185



>pir|T14625|T14625 hypothetical protein - Trypanosoma
           cruzi>gb:AC137988_1208174 Trypanosoma cruzi strain
           Brener chromosome 3 clone cosmids 1o17, 1m17, 1b21,
           2n11, complete sequence.
          Length = 322

 Score =  114 bits (284), Expect = 1e-24
 Identities = 68/180 (37%), Positives = 98/180 (54%), Gaps = 2/180 (1%)
 Frame = +1

Query: 46  LILAAVLLLGA-FASQATA-LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK 219
           L+LAAVL++ A     ATA L  E ++  +  ++   HGR Y++ AE+A R  +F +N+ 
Sbjct: 41  LLLAAVLVVMACLVPAATASLHAEETLASQFAEFKQKHGRVYESAAEEAFRLSVFRENL- 99

Query: 220 FIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPE 399
           F+   + A N     GV  FSDLT EEF++   N G               +  +   P 
Sbjct: 100 FLARLHAAANPHATFGVTPFSDLTREEFRSRYHN-GAAHFAAAQERARVPVDVEVVGAPA 158

Query: 400 YLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
             DWR++GAVT +KNQG CG CWAF+A+  +E    +    L RLSEQ L+ C+  N+GC
Sbjct: 159 AKDWRKEGAVTAVKNQGLCGSCWAFAAIGNVESQWFLAGHPLTRLSEQMLVSCDDTNFGC 218



>pir|S12099|S12099 cysteine proteinase (EC 3.4.22.-) precursor -
           Trypanosoma brucei>gb:TBCSTPRO_1398998 Trypanosome mRNA
           for a cysteine protease.
          Length = 450

 Score =  114 bits (284), Expect = 1e-24
 Identities = 67/179 (37%), Positives = 93/179 (51%), Gaps = 3/179 (1%)
 Frame = +1

Query: 52  LAAVLLLGAFASQATALDE---EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF 222
           L  VLL  A    + AL     E S+  R   +   +G+ YK+  E+A RF+ FE+N++ 
Sbjct: 12  LPVVLLAMAACLASVALGSLHVEESLEMRFAAFKKKYGKVYKDAKEEAFRFRAFEENMEQ 71

Query: 223 IESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEY 402
            +    A N     GV  FSD+T EEF+A   N G               N +    P  
Sbjct: 72  AK-IQAAANPYATFGVTPFSDMTREEFRARYRN-GASYFAAAQKRVRKTVNVTTGRAPAA 129

Query: 403 LDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           +DWREKGAVT +K+QG CG CWAFS +  +EG  Q+    L+ LSEQ L+ C+  ++GC
Sbjct: 130 VDWREKGAVTPVKDQGQCGSCWAFSTIGNIEGQWQVAGNPLVSLSEQMLVSCDTIDFGC 188



>gb:BC002125_2088888 Mus musculus cathepsin S, mRNA (cDNA clone
           MGC:6643 IMAGE:3495719), complete cds.
          Length = 340

 Score =  113 bits (283), Expect = 2e-24
 Identities = 62/163 (38%), Positives = 91/163 (55%), Gaps = 4/163 (2%)
 Frame = +1

Query: 100 LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN---KAGNQSYKLGV 270
           L  +P++    + W   H + YK+  E+  R  I+E+N+KFI   N     G  +Y++G+
Sbjct: 26  LQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGM 85

Query: 271 KKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQG 450
               D+TNEE    M   G               + S   +P+ +DWREKG VT++K QG
Sbjct: 86  NDMGDMTNEEILCRM---GALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQG 142

Query: 451 YCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC-NLKNYG 576
            CG CWAFSAV A+EG  +++TG+L+ LS Q L+DC N + YG
Sbjct: 143 SCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYG 185



>gb:AY156692_1425816 Canis familiaris cathepsin S preproprotein
           (CTSS) mRNA, complete cds.
          Length = 331

 Score =  113 bits (283), Expect = 2e-24
 Identities = 62/178 (34%), Positives = 97/178 (54%), Gaps = 3/178 (1%)
 Frame = +1

Query: 52  LAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIES 231
           L  +L L ++A     + ++P++      W   + + YK + E+  R  I+E+N+KF+  
Sbjct: 4   LVGLLPLCSYA--VAQVHKDPTLDHHWNLWKKTYSKQYKEENEEVARRLIWEKNLKFVML 61

Query: 232 FN---KAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEY 402
            N     G  SY LG+    D+T EE  + M   G               + S  ++P+ 
Sbjct: 62  HNLEHSMGMHSYDLGMNHLGDMTGEEVISLM---GSLRVPSQWQRNVTYRSNSNQKLPDS 118

Query: 403 LDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYG 576
           +DWREKG VT++K QG CG CWAFSAV A+E   +++TG+L+ LS Q L+DC+ + YG
Sbjct: 119 VDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYG 176



>gb:AF544844_1280690 Callosobruchus maculatus putative gut cathepsin
           L-like cysteine protease (CPB1) mRNA, complete cds.
          Length = 323

 Score =  113 bits (283), Expect = 2e-24
 Identities = 65/180 (36%), Positives = 104/180 (57%), Gaps = 3/180 (1%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFI 225
           L++ A L+L A AS         S+ E  +++ + HG++Y++  E+ +RF +F++N+  I
Sbjct: 4   LVVVATLVLVAGAS---------SVYEEWQQFKLDHGKTYRSVVEEKRRFSVFQKNLIDI 54

Query: 226 ESFNKA---GNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVP 396
           +  NK    G  S+   V +F+D+T+EEF   +  +G                E+  E  
Sbjct: 55  QEHNKKYERGEVSFAKKVTQFADMTHEEFLDLLKLQGVPALPSDAVYF----EETDIEEK 110

Query: 397 EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYG 576
           + +DWR++GAVT +KNQG+CG CWAFSAV A+EG    + G L+ LS Q+L+DC  + YG
Sbjct: 111 DAVDWRKEGAVTPVKNQGHCGSCWAFSAVGAIEGQFFKKNGTLVSLSAQELVDCATEYYG 170



>gb:AK028366_1160949 Mus musculus 18 days pregnant adult female
           placenta and extra embryonic tissue cDNA, RIKEN
           full-length enriched library, clone:3830425I01
           product:cathepsin S, full insert sequence.
          Length = 342

 Score =  113 bits (283), Expect = 2e-24
 Identities = 62/163 (38%), Positives = 91/163 (55%), Gaps = 4/163 (2%)
 Frame = +1

Query: 100 LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN---KAGNQSYKLGV 270
           L  +P++    + W   H + YK+  E+  R  I+E+N+KFI   N     G  +Y++G+
Sbjct: 28  LQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGM 87

Query: 271 KKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIKNQG 450
               D+TNEE    M   G               + S   +P+ +DWREKG VT++K QG
Sbjct: 88  NDMGDMTNEEILCRM---GALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQG 144

Query: 451 YCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC-NLKNYG 576
            CG CWAFSAV A+EG  +++TG+L+ LS Q L+DC N + YG
Sbjct: 145 SCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYG 187



>sp|Q28944|CATL_PIG Cathepsin L precursor (EC
           3.4.22.15).>pir|A58195|A58195 cathepsin L (EC 3.4.22.15)
           precursor - pig>gb:PIGPCL_1443237 Boar mRNA for porcine
           cathepsin L, complete cds.>gb:SSC315771_1445168 Sus
           scrofa CTSL gene for cathepsin L, exons 1-8.
          Length = 334

 Score =  113 bits (283), Expect = 2e-24
 Identities = 74/184 (40%), Positives = 100/184 (54%), Gaps = 6/184 (3%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFI 225
           L L A+ L    AS A  LD+  ++     KW   HGR Y  + E  +R  ++E+N+K I
Sbjct: 5   LFLTALCL--GIASAAPKLDQ--NLDADWYKWKATHGRLYGMNEEGWRR-AVWEKNMKMI 59

Query: 226 ESFNKA---GNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLA-EV 393
           E  N+    G   + + +  F D+TNEEF+  M                   +ESL  EV
Sbjct: 60  ELHNQEYSQGKHGFSMAMNAFGDMTNEEFRQVM-----NGFQNQKHKKGKVFHESLVLEV 114

Query: 394 PEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-- 567
           P+ +DWREKG VT +KNQG CG CWAFSA  A+EG    +TG+L+ LSEQ L+DC+    
Sbjct: 115 PKSVDWREKGYVTAVKNQGQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQG 174

Query: 568 NYGC 579
           N GC
Sbjct: 175 NQGC 178



>gb:BC066490_2554378 Danio rerio cathepsin L, a, mRNA (cDNA clone
           MGC:76945 IMAGE:6525005), complete cds.
          Length = 337

 Score =  113 bits (282), Expect = 3e-24
 Identities = 69/184 (37%), Positives = 99/184 (53%), Gaps = 5/184 (2%)
 Frame = +1

Query: 43  QLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF 222
           ++ LAA  L  +    A  LD++  + +  ++W   H + Y +  E+  R  I+E+N+K 
Sbjct: 2   RVFLAAFTLCLSAVFAAPTLDQQ--LNDHWDQWKKWHSKKY-HATEEGWRRVIWEKNLKK 58

Query: 223 IESFN---KAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEV 393
           IE  N     G  +Y+LG+  F D+T+EEF+  M   G                 +  EV
Sbjct: 59  IEMHNLEHSMGIHTYRLGMNHFGDMTHEEFRQVM--NGFKHKKDRRFRGSLFMEPNFIEV 116

Query: 394 PEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK-- 567
           P  LDWREKG VT +K+QG CG CWAFS   A+EG    +TG+L+ LSEQ L+DC+    
Sbjct: 117 PNKLDWREKGYVTPVKDQGECGSCWAFSTTGALEGQMFRKTGKLVSLSEQNLVDCSRPEG 176

Query: 568 NYGC 579
           N GC
Sbjct: 177 NEGC 180



>gb:AY333300_2528357 Paralabidochromis chilotes isolate
           Pach-cathepsin18 cathepsin mRNA, complete cds.
          Length = 334

 Score =  113 bits (282), Expect = 3e-24
 Identities = 70/179 (39%), Positives = 95/179 (53%), Gaps = 6/179 (3%)
 Frame = +1

Query: 61  VLLLGAFASQATALDEEPSMLERH-EKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN 237
           +LLL +  +   A+ E  S L+ H E W   HG+SYKND E A R +++  N+K I   N
Sbjct: 9   LLLLISLCAGVAAMFE--STLDAHWELWKKTHGKSYKNDVENAHRRELWGNNLKMITVHN 66

Query: 238 ---KAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLD 408
                G  +Y+LG+    DLT EE      +                   S + +P+ +D
Sbjct: 67  LEASMGLHTYELGMNHMGDLTEEEIMQFFAS--LTPPTDIQRAPSPFAGASGSGIPDTMD 124

Query: 409 WREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--NYGC 579
           WREKG VT +K QG CG CWAFSA  A+EG     TG+L+ LS Q L+DC+ K  N+GC
Sbjct: 125 WREKGCVTKVKMQGACGSCWAFSAAGALEGQLAKSTGKLVDLSPQNLVDCSGKYGNHGC 183



>gb:TRBCYSPRNS_1400635 Trypanosoma cruzi cysteine proteinase gene,
           partial cds.
          Length = 467

 Score =  113 bits (282), Expect = 3e-24
 Identities = 70/180 (38%), Positives = 95/180 (52%), Gaps = 2/180 (1%)
 Frame = +1

Query: 46  LILAAVLLLGA-FASQATA-LDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVK 219
           L LAAVL++ A     ATA L  E ++  +  ++   HGR Y + AE+A R  +F  N+ 
Sbjct: 8   LSLAAVLVVMACLVPAATASLHAEETLASQFAEFKQKHGRVYGSAAEEAFRLSVFRANL- 66

Query: 220 FIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPE 399
           F+   + A N     GV  FSDLT EEF++   N G               +  +   P 
Sbjct: 67  FLARLHAAANPHATFGVTPFSDLTREEFRSRYHN-GAAHFAAAEERARVPVDVEVVGAPA 125

Query: 400 YLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
             DWRE+GAVT +KNQG CG CWAF+A+  +EG   +    L RLSEQ L+ C+  N GC
Sbjct: 126 AKDWREEGAVTAVKNQGICGSCWAFAAIGNIEGQWFLAGNPLTRLSEQMLVSCDNTNSGC 185



>gb:AY795054_1352260 Artemia franciscana cathepsin L precursor,
           gene, partial cds.
          Length = 338

 Score =  113 bits (282), Expect = 3e-24
 Identities = 67/185 (36%), Positives = 100/185 (54%), Gaps = 9/185 (4%)
 Frame = +1

Query: 52  LAAVLLLGAFASQATALDEEPSMLERHEKWMVH---HGRSYKNDAEKAKRFKIFEQNVKF 222
           +  + LLGA   Q +A     ++L   ++W +    H + Y +  E+  R KI+ +N   
Sbjct: 4   ITLIFLLGAVLVQLSAALSLTNLLA--DEWHLFKATHKKEYPSQLEEKFRMKIYLENKHK 61

Query: 223 IESFN---KAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESL-AE 390
           +   N   + G +SY++ + KF DL + EF++ M                    E    E
Sbjct: 62  VAKHNILYEKGEKSYQVAMNKFGDLLHHEFRSIMNGYQHKKQNSSRAESTFTFMEPANVE 121

Query: 391 VPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK- 567
           VPE +DWREKGA+T +K+QG CG CWAFS+  A+EG T  +TG+L+ LSEQ L+DC+ K 
Sbjct: 122 VPESVDWREKGAITPVKDQGQCGSCWAFSSTGALEGQTFRKTGKLISLSEQNLIDCSGKY 181

Query: 568 -NYGC 579
            N GC
Sbjct: 182 GNEGC 186



>gb:AJ583512_1282281 Diabrotica virgifera virgifera mRNA for
           cathepsin L-like proteinase, clone DvRS33.
          Length = 325

 Score =  113 bits (282), Expect = 3e-24
 Identities = 62/171 (36%), Positives = 95/171 (55%), Gaps = 4/171 (2%)
 Frame = +1

Query: 79  FASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNKA---GN 249
           F   ATA  +  +  E   ++ V + +SYK+  E+  RF+IF++N++ IE+ N+    G 
Sbjct: 6   FIFLATAAVQALNDKEEWVQFKVKNNKSYKSYVEEQTRFRIFQENLRKIENHNEKYNNGE 65

Query: 250 QSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAV 429
            ++K GV KF+DLT +EF   ++                     L ++P   DWR+KGAV
Sbjct: 66  STFKFGVTKFTDLTEKEFLDLLVLSKNARPNRTHATHLLA---PLRDLPSAFDWRDKGAV 122

Query: 430 TDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKN-YGC 579
           T++K+QG CG CW FS   ++E    ++TG L+ LSEQ L+DC     YGC
Sbjct: 123 TEVKDQGMCGSCWTFSTTGSVEAAHFLKTGNLVSLSEQNLVDCAKDTCYGC 173



>sp|Q26636|CATL_SARPE Cathepsin L precursor (EC
           3.4.22.15).>pir|A53810|A53810 cathepsin L (EC 3.4.22.15)
           precursor - flesh fly (Sarcophaga
           peregrina)>gb:SPECL_1397934 Sarcophaga peregrina mRNA
           for cathepsin L, complete cds.
          Length = 339

 Score =  113 bits (282), Expect = 3e-24
 Identities = 68/186 (36%), Positives = 97/186 (52%), Gaps = 9/186 (4%)
 Frame = +1

Query: 49  ILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIE 228
           +L A+L L A     + LD    + E    + + H ++Y N+ E+  R KIF +N   I 
Sbjct: 4   VLVALLALVALTQAISPLD---LIKEEWHTYKLQHRKNYANEVEERFRMKIFNENRHKIA 60

Query: 229 SFNKA---GNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESL----A 387
             N+    G  SYKLG+ K++D+ + EFK TM                      +     
Sbjct: 61  KHNQLFAQGKVSYKLGLNKYADMLHHEFKETMNGYNHTLRQLMRERTGLVGATYIPPAHV 120

Query: 388 EVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK 567
            VP+ +DWRE GAVT +K+QG+CG CWAFS+  A+EG    + G L+ LSEQ L+DC+ K
Sbjct: 121 TVPKSVDWREHGAVTGVKDQGHCGSCWAFSSTGALEGQHFRKAGVLVSLSEQNLVDCSTK 180

Query: 568 --NYGC 579
             N GC
Sbjct: 181 YGNNGC 186



>gb:BC080004_2561441 Xenopus laevis MGC81823 protein, mRNA (cDNA
           clone MGC:81823 IMAGE:7008062), complete cds.
          Length = 335

 Score =  112 bits (281), Expect = 3e-24
 Identities = 69/183 (37%), Positives = 98/183 (53%), Gaps = 5/183 (2%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFI 225
           L+ AA+ L   FA+  T    +P++ +    W   H +SY    E  +R  ++E+N++ I
Sbjct: 5   LVAAALCLTTVFAAPTT----DPALDDHWHLWKNWHKKSYLPKEEGWRRV-LWEKNLRTI 59

Query: 226 ESFN---KAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVP 396
           E  N     G  SY+LG+ +F D+TNEEF+  M   G               N    E P
Sbjct: 60  EFHNLDHSLGKHSYRLGMNQFGDMTNEEFRQLM--NGYKNQKMIKGSTFLAPNNF--EAP 115

Query: 397 EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--N 570
           + +DWREKG VT +K+QG CG CWAFS   A+EG    + G+L+ LSEQ L+DC+    N
Sbjct: 116 KTVDWREKGYVTPVKDQGQCGSCWAFSTTGALEGQHYRKAGKLISLSEQNLVDCSRAQGN 175

Query: 571 YGC 579
            GC
Sbjct: 176 QGC 178



>gb:BC060335_2552818 Xenopus laevis cDNA clone MGC:68554
           IMAGE:4031347, complete cds.
          Length = 335

 Score =  112 bits (281), Expect = 3e-24
 Identities = 69/183 (37%), Positives = 98/183 (53%), Gaps = 5/183 (2%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFI 225
           LI+ A+ L   +A+ AT    +P++      W   H ++Y    E  +R  ++E+N+K I
Sbjct: 5   LIIGAICLTTLYAAPAT----DPALDNHWYSWKDWHKKTYAPKEEGWRRV-LWEKNLKMI 59

Query: 226 ESFN---KAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVP 396
           E  N     G  SY+LG+ +F D+TNEEFK  M   G               N    E P
Sbjct: 60  EFHNLDHSLGKHSYRLGMNQFGDMTNEEFKQLM--NGYKNQKMIRGSTFLAPNNF--EAP 115

Query: 397 EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--N 570
           + +DWR+KG VT +K+QG CG CWAFS   A+EG    +T +L+ LSEQ L+DC+    N
Sbjct: 116 KSVDWRKKGYVTPVKDQGQCGSCWAFSTTGALEGQHYRKTSKLISLSEQNLVDCSRAQGN 175

Query: 571 YGC 579
            GC
Sbjct: 176 EGC 178



>gb:AP005419_1851485 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0046G12.
          Length = 362

 Score =  112 bits (281), Expect = 3e-24
 Identities = 67/197 (34%), Positives = 107/197 (54%), Gaps = 5/197 (2%)
 Frame = +1

Query: 4   TNILSSMASNFDFQLILAAVLLLGAFASQAT---ALDEEPSMLERHEKWMVHHGRSYKND 174
           T+ +++ +S FD    + +V    A A ++T   AL      L R  ++ V HG+ Y + 
Sbjct: 18  TSAVAAASSGFDDSNPIRSVTDHAASALESTVIAALGRTRDAL-RFARFAVRHGKRYGDA 76

Query: 175 AEKAKRFKIFEQNVKFIESFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXX 354
           AE  +RF+IF ++++ + S N+ G   Y+LG+ +F+D++ EEF+A+ L            
Sbjct: 77  AEVQRRFRIFSESLELVRSTNRRG-LPYRLGINRFADMSWEEFQASRLGAAQNCSATLAG 135

Query: 355 XXXXXXNESLAEVPEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRL 534
                     A +PE  DWRE G V+ +K+QG+CG CW FS   ++E      TG+ + L
Sbjct: 136 NHRM---RDAAALPETKDWREDGIVSPVKDQGHCGSCWTFSTTGSLEAAYTQATGKPVSL 192

Query: 535 SEQQLLDC--NLKNYGC 579
           SEQQL+DC     N+GC
Sbjct: 193 SEQQLVDCATAYNNFGC 209



>gb:AP005312_1850386 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0505H05.>gb:AP005702_1856358 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, PAC
           clone:P0027G10.
          Length = 358

 Score =  112 bits (281), Expect = 3e-24
 Identities = 65/184 (35%), Positives = 97/184 (52%), Gaps = 8/184 (4%)
 Frame = +1

Query: 52  LAAVLLLGAFASQATALDE-EPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIE 228
           L A  +L A A+  + LD  +  M++R   W   H RSY +  E  +RF ++ +N +FI+
Sbjct: 20  LLATSMLPARATAGSCLDVGDMVMMDRFRAWQGAHNRSYPSAEEALQRFDVYRRNAEFID 79

Query: 229 SFNKAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLA------E 390
           + N  G+ +Y+L   +F+DLT EEF AT                     +  A      +
Sbjct: 80  AVNLRGDLTYQLAENEFADLTEEEFLATYTGYYAGDGPVDDSVITTGAGDVDASFSYRVD 139

Query: 391 VPEYLDWREKGAVTDIKNQ-GYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK 567
           VP  +DWR +GAV   K+Q   C  CWAF   A +E +  I+TG+L+ LSEQQL+DC+  
Sbjct: 140 VPASVDWRAQGAVVPPKSQTSTCSSCWAFVTAATIESLNMIKTGKLVSLSEQQLVDCDSY 199

Query: 568 NYGC 579
           + GC
Sbjct: 200 DGGC 203



>gb:AF039554_1235484 Acanthamoeba culbertsoni cysteine proteinase
           mRNA, partial cds.
          Length = 482

 Score =  112 bits (281), Expect = 3e-24
 Identities = 64/183 (34%), Positives = 91/183 (49%), Gaps = 9/183 (4%)
 Frame = +1

Query: 58  AVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFN 237
           A+L+L      +     E  +  +   WM  H RSY ND E  +R+  + +N+ FIE FN
Sbjct: 40  ALLVLACLTLVSCVSLRERELQGQFNSWMRRHARSYSND-EFLERYNTWRENMDFIEEFN 98

Query: 238 KAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXX-------XXXXXXXXXXNESLAEVP 396
           + GN ++ + + +  DLT EEF    + +                       + + A +P
Sbjct: 99  R-GNHTFTVAMNEHGDLTPEEFARLYMGQVSPASEQELQERIAAESAMEDEHHHTRASIP 157

Query: 397 EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC--NLKN 570
              DWR KGAVT +KNQG C  CWAF A  A+EG+ +I  G L+ LS+Q LLDC     N
Sbjct: 158 ANWDWRTKGAVTPVKNQGSCASCWAFVATGAVEGVRKIAGGSLVSLSDQMLLDCAVGTGN 217

Query: 571 YGC 579
            GC
Sbjct: 218 QGC 220



>gb:FHECATHES_1385098 Fasciola hepatica cathepsin L-like protease
           mRNA, complete cds.
          Length = 326

 Score =  112 bits (279), Expect = 6e-24
 Identities = 69/184 (37%), Positives = 96/184 (52%), Gaps = 5/184 (2%)
 Frame = +1

Query: 43  QLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF 222
           +L++  +L++G FAS            +   +W   + + YK  A+   R  I+EQNVK 
Sbjct: 2   RLVILTLLIVGVFASND----------DLWHQWKRIYNKEYKG-ADDDHRRNIWEQNVKH 50

Query: 223 IESFN---KAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEV 393
           I+  N     G  +YKLG+ +F+D+T EEFKA  L E                N+    V
Sbjct: 51  IQEHNLRHDLGLVTYKLGLNQFTDMTFEEFKAKYLTEMPRASELLSHGIPYKANKRA--V 108

Query: 394 PEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCN--LK 567
           P+ +DWRE G VT++K+QG CG CWAFS   AMEG         +  SEQQL+DC+    
Sbjct: 109 PDRIDWRESGYVTEVKDQGGCGSCWAFSTTGAMEGQYMKNEKTSISFSEQQLVDCSGPFG 168

Query: 568 NYGC 579
           NYGC
Sbjct: 169 NYGC 172



>gb:AY795056_1352262 Artemia parthenogenetica cathepsin L1 gene,
           complete cds.
          Length = 338

 Score =  112 bits (279), Expect = 6e-24
 Identities = 67/183 (36%), Positives = 98/183 (53%), Gaps = 6/183 (3%)
 Frame = +1

Query: 49  ILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIE 228
           +LAAVL+  + A   T L     + +    +   H + Y +  E+  R KI+ +N   + 
Sbjct: 9   LLAAVLVQLSAALSLTNL-----LADEWHLFKATHKKEYPSQLEEKLRMKIYLENKHKVA 63

Query: 229 SFN---KAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESL-AEVP 396
             N   + G +SY++ + KF DL + EF++ M                    E    EVP
Sbjct: 64  KHNILYEKGEKSYQVAMNKFGDLLHHEFRSIMNGYQHKKQNSSRAESTFTFMEPANVEVP 123

Query: 397 EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--N 570
           E +DWREKGA+T +K+QG CG CWAFS+  A+EG T  +TG+L+ LSEQ L+DC+ K  N
Sbjct: 124 ESVDWREKGAITPVKDQGQCGSCWAFSSTGALEGQTFRKTGKLVSLSEQNLIDCSGKYGN 183

Query: 571 YGC 579
            GC
Sbjct: 184 EGC 186



>gb:AY528231_1333140 Leptinotarsa decemlineata clone IntC14
           digestive cysteine proteinase intestain mRNA, complete
           cds.
          Length = 324

 Score =  112 bits (279), Expect = 6e-24
 Identities = 62/166 (37%), Positives = 92/166 (55%), Gaps = 3/166 (1%)
 Frame = +1

Query: 91  ATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIESFNK---AGNQSYK 261
           A A  E  S  E+ + + ++  +SY+N  E+ +RF IF  N+  IE  N+    G  +Y+
Sbjct: 10  ALAATEALSDKEKWQNFKINFSKSYQNVVEEKRRFNIFLSNLLRIEEHNQNFSRGLSTYE 69

Query: 262 LGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEYLDWREKGAVTDIK 441
           +GV KF+DLT EEF                       +    ++P  +DW ++GAVT++K
Sbjct: 70  MGVNKFADLTPEEFMERFRPLRKTKPKFLSEQAKFNFD---GDLPAEVDWTKQGAVTEVK 126

Query: 442 NQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYGC 579
           +QG CG CWAFS   ++E    I+TG+L+ LSEQQL+DC   N GC
Sbjct: 127 SQGSCGSCWAFSTTGSVESHNFIKTGKLISLSEQQLVDCVKNNSGC 172



>gb:AY333293_1320329 Branchiostoma lanceolatum isolate Brla-beta2115
           cathepsin mRNA, complete cds.
          Length = 334

 Score =  112 bits (279), Expect = 6e-24
 Identities = 65/181 (35%), Positives = 95/181 (52%), Gaps = 8/181 (4%)
 Frame = +1

Query: 61  VLLLGAFASQATALDEEPSMLERH---EKWMVHHGRSYKNDAEKAKRFKIFEQNVKFIES 231
           +L+LGA  S ATA      +L  +   E W + HG+ Y+ +AE+  R  IFE+N   I  
Sbjct: 3   LLILGAVISMATA-----GVLPHNKEWEMWKLQHGKQYETEAEEYSRRFIFEKNTVKIAE 57

Query: 232 FN---KAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVPEY 402
            N     G  SY L + KF D+ +EEF   ++                  N+    +P+ 
Sbjct: 58  HNIRASLGMHSYTLAMNKFGDMHHEEFHQRIMGGCLKIVKKPLLGSDVGDNDDNGTLPKS 117

Query: 403 LDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC--NLKNYG 576
           +DWR    V+++K+QG CG CWAFS   ++EG    +TG+L+ LSEQQL+DC  +  N G
Sbjct: 118 VDWRNSHMVSEVKDQGECGSCWAFSTTGSLEGQHSSKTGKLVDLSEQQLVDCSKDFGNQG 177

Query: 577 C 579
           C
Sbjct: 178 C 178



>gb:AF544839_1280685 Callosobruchus maculatus putative gut cathepsin
           L-like cysteine protease (CPA16) mRNA, complete cds.
          Length = 326

 Score =  112 bits (279), Expect = 6e-24
 Identities = 63/180 (35%), Positives = 104/180 (57%), Gaps = 3/180 (1%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFI 225
           L++ A L+L A AS         S+ E  +++ + HG++Y++  E+ +RF +F++N+  I
Sbjct: 4   LVVVATLVLVAGAS---------SVYEEWQQFKLDHGKTYRSLVEEKRRFSVFQKNLVDI 54

Query: 226 ESFNKA---GNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVP 396
           +  NK    G +S+   V +F+D+T+EEF   +  +G               +  + E  
Sbjct: 55  QEHNKKYERGEESFAKKVTQFADMTHEEFLDLLKLQGVPALPSNAVHFDNFEDIDMEE-K 113

Query: 397 EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLKNYG 576
           + +DWRE+GAVT +K+Q  CG CWAFSAV A+EG    + G L+ LS Q+L+DC  ++YG
Sbjct: 114 DAIDWREEGAVTPVKDQANCGSCWAFSAVGAIEGQFFKKNGTLVSLSAQELVDCATEDYG 173



>gb:AF271385_1257585 Fasciola hepatica cathepsin L mRNA, complete
           cds.
          Length = 326

 Score =  112 bits (279), Expect = 6e-24
 Identities = 69/184 (37%), Positives = 96/184 (52%), Gaps = 5/184 (2%)
 Frame = +1

Query: 43  QLILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKF 222
           +L++  +L++G FAS            +   +W   + + Y N A+   R  I+EQNVK 
Sbjct: 2   RLVILTLLIVGVFASND----------DLWHQWKRIYNKEY-NGADDDHRRNIWEQNVKH 50

Query: 223 IESFN---KAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEV 393
           I+  N     G  +YKLG+ +F+D+T EEFKA  L E                N+    V
Sbjct: 51  IQEHNLRHDLGLVTYKLGLNQFTDMTFEEFKAKYLTEMPRASELLSHGIPYKANKRA--V 108

Query: 394 PEYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDC--NLK 567
           P+ +DWRE G VT++K+QG CG CWAFS   AMEG         +  SEQQL+DC  +  
Sbjct: 109 PDRIDWRESGYVTEVKDQGGCGSCWAFSTTGAMEGQYMKNQRTSISFSEQQLVDCSRDFG 168

Query: 568 NYGC 579
           NYGC
Sbjct: 169 NYGC 172



>gb:AY212286_2519529 Fundulus heteroclitus cathepsin L precursor,
           mRNA, complete cds.
          Length = 337

 Score =  111 bits (278), Expect = 7e-24
 Identities = 66/183 (36%), Positives = 95/183 (51%), Gaps = 5/183 (2%)
 Frame = +1

Query: 46  LILAAVLLLGAFASQATALDEEPSMLERHEKWMVHHGRSYKNDAEKAKRFKIFEQNVKFI 225
           ++  AVL L   ++  +A   +P + +    W   H ++Y    E  +R  ++E+N+K I
Sbjct: 1   MLPVAVLTLCLSSAVLSAPSLDPQLDQHWNLWKSWHSKNYHQREEGWRRL-VWEKNLKKI 59

Query: 226 ESFN---KAGNQSYKLGVKKFSDLTNEEFKATMLNEGXXXXXXXXXXXXXXXNESLAEVP 396
           E  N     G  SY+LG+  F D+T+EEFK  M   G                 +  E P
Sbjct: 60  ELHNLEHSMGKHSYRLGMNHFGDMTHEEFKQIM--NGYKHKAERKFKGSLFLEPNFLEAP 117

Query: 397 EYLDWREKGAVTDIKNQGYCGCCWAFSAVAAMEGITQIRTGQLMRLSEQQLLDCNLK--N 570
             +DWREKG VT +K+QG CG CWAFS   A+EG    RTG+L+ LS Q L++C+    N
Sbjct: 118 RSVDWREKGYVTPVKDQGECGSCWAFSTTGALEGQEFTRTGKLVSLSGQNLVECSRPEGN 177

Query: 571 YGC 579
            GC
Sbjct: 178 EGC 180


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 617,437,203
Number of Sequences: 1806583
Number of extensions: 12093726
Number of successful extensions: 35696
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 33675
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34668
length of database: 581,917,975
effective HSP length: 118
effective length of database: 368,741,181
effective search space used: 27655588575
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)