BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig161
         (935 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:OSJN00132_1695418 Oryza sativa genomic DNA, chromosome 4, BAC...   187   2e-46   
gb:BT005618_1638558 Arabidopsis thaliana clone U51252 unknown pr...   185   1e-45   
sp|Q55720|Y49L_SYNY3|Y49L_SYNY3 Ycf49-like protein.>pir|S76515|S76515 hypot...   133   4e-30   Synechocystis sp.
pir|AD2369|AD2369 hypothetical protein all4508 [imported] - Nost...   122   1e-26   Nostoc sp. PCC 7120
gb:BA000045_741951 Gloeobacter violaceus PCC 7421 DNA, complete ...   115   9e-25   
gb:AP008231_582209 Synechococcus elongatus PCC 6301 DNA, complet...   104   3e-21   
gb:AP006175_1861389 Oryza sativa (japonica cultivar-group) genom...   102   8e-21   
gb:BA000039_727221 Thermosynechococcus elongatus BP-1 DNA, compl...   101   2e-20   
gb:BX572092_796530 Prochlorococcus marinus MED4 complete genome;...    86   1e-15   
gb:BX569692_776190 Synechococcus sp. WH8102 complete genome; seg...    84   3e-15   
gb:BX572097_798031 Prochlorococcus marinus MIT9313 complete geno...    84   5e-15   
gb:AE017163_395387 Prochlorococcus marinus subsp. marinus str. C...    71   3e-11   
sp|P15811|YC49_CYAPA|YC49_CYAPA Hypothetical 12.3 kDa protein ycf49 (ORF102...    55   2e-06   Cyanophora paradoxa
sp|Q9TM18|YC49_CYACA|YC49_CYACA Hypothetical 11.6 kDa protein ycf49.>gb:AF0...    54   3e-06   Cyanidium caldarium
gb:AB002583_1508919 Cyanidioschyzon merolae chloroplast DNA, com...    47   4e-04   
pir|T04578|T04578 hypothetical protein T12H17.220 - Arabidopsis ...    47   4e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AE012970_287714 Chlorobium tepidum TLS section 191 of 194 of ...    47   7e-04   
pir|A38346|A38346 ultra-high-sulfur keratin 1 - mouse>gb:MUSSER1...    25   0.85    Mus musculus [mouse]
gb:AC006722_1203873 Caenorhabditis elegans cosmid Y19D10A, compl...    35   1.6     
gb:AY360461_1948029 Homo sapiens UHS KERB-like protein mRNA, com...    21   1.7     
gb:BX538351_1358877 Cryptosporidium parvum chromosome 6, complet...    35   2.8     
gb:AY596297_632730 Haloarcula marismortui ATCC 43049 chromosome ...    34   4.7     
gb:AY366465_2084127 Rattus norvegicus Drosophila-type eyes absen...    33   8.0     
gb:CR382126_1658791 Kluyveromyces lactis strain NRRL Y-1140 chro...    33   8.0     
pir|A38660|B38346 ultra-high-sulfur keratin 2 - mouse>gb:MUSSER2...    22   8.7     


>gb:OSJN00132_1695418 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0089B03, complete
           sequence.>gb:OSJN00263_1697626 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0083D01, complete
           sequence.
          Length = 363

 Score =  187 bits (476), Expect = 2e-46
 Identities = 89/124 (71%), Positives = 96/124 (77%)
 Frame = +1

Query: 295 AEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACT 474
           AEPANALSLPTW +HVSSV EWV AMALVW YGE++G + WKGLSWGMVPLLGGA CACT
Sbjct: 58  AEPANALSLPTWAVHVSSVAEWVTAMALVWDYGERTGLKGWKGLSWGMVPLLGGAMCACT 117

Query: 475 WHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQEXXXXXXXXXXXXXXTGNSR 654
           WHFFYNSESLEVLVALQ ALTVIGN TMCIAAFRI+K+SQE              TG   
Sbjct: 118 WHFFYNSESLEVLVALQGALTVIGNITMCIAAFRIFKASQESSKMVMVNQVHESWTGQPV 177

Query: 655 DLCK 666
            + K
Sbjct: 178 SMTK 181



>gb:BT005618_1638558 Arabidopsis thaliana clone U51252 unknown
           protein (At4g22830) mRNA, complete
           cds.>gb:AK118821_1816780 Arabidopsis thaliana At4g22830
           mRNA for unknown protein, complete cds, clone:
           RAFL21-15-H12.
          Length = 193

 Score =  185 bits (470), Expect = 1e-45
 Identities = 83/104 (79%), Positives = 93/104 (89%)
 Frame = +1

Query: 286 VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC 465
           +Q +EP+NALSLPTW +HVSSV+EW+ AMALVW+YGE+ GYESWKGLSWGMVPLLGGA C
Sbjct: 83  LQLSEPSNALSLPTWAVHVSSVVEWITAMALVWKYGERKGYESWKGLSWGMVPLLGGALC 142

Query: 466 ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE 597
           ACTWHFFYN ESLEVLVALQAALTV GN T+CIAAFRI K S +
Sbjct: 143 ACTWHFFYNDESLEVLVALQAALTVFGNITLCIAAFRINKLSSK 186



>sp|Q55720|Y49L_SYNY3 Ycf49-like protein.>pir|S76515|S76515
           hypothetical protein - Synechocystis sp. (strain PCC
           6803)>gb:BA000022_689750 Synechocystis sp. PCC 6803 DNA,
           complete genome.
          Length = 104

 Score =  133 bits (335), Expect = 4e-30
 Identities = 59/97 (60%), Positives = 75/97 (77%)
 Frame = +1

Query: 307 NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF 486
           NALS+PTW +HVSSVIEW++A+ALV +Y  K+GY  W+ L+WGMVP L  A CACTWHFF
Sbjct: 2   NALSIPTWMVHVSSVIEWIVAIALVSRYATKAGYGHWRALAWGMVPALVSATCACTWHFF 61

Query: 487 YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE 597
            N+  L+ LV LQA  TVIGN T+C+AA+ IY+ S +
Sbjct: 62  DNASQLDWLVTLQALTTVIGNITLCLAAWWIYRQSAQ 98



>pir|AD2369|AD2369 hypothetical protein all4508 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_685497 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 102

 Score =  122 bits (305), Expect = 1e-26
 Identities = 55/96 (57%), Positives = 72/96 (75%)
 Frame = +1

Query: 307 NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF 486
           N LS+PTW IHVSSVIEW+ A+ L+W YGE +   SW GLS  M+P L  A CACTWH+F
Sbjct: 2   NVLSIPTWIIHVSSVIEWIAAIWLIWTYGELTANRSWWGLSLAMLPALISAMCACTWHYF 61

Query: 487 YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ 594
            NSESLE +V LQA +T++GN T+  AA+ I++S++
Sbjct: 62  DNSESLEWIVTLQATMTLVGNFTLLAAAWLIWRSAK 97



>gb:BA000045_741951 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 104

 Score =  115 bits (289), Expect = 9e-25
 Identities = 50/95 (52%), Positives = 70/95 (73%)
 Frame = +1

Query: 310 ALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFFY 489
           ALSLPTW IH++SV+EW +A+ALVW+Y E++G  S++ L WGM+P L GA     WH+F 
Sbjct: 3   ALSLPTWIIHIASVVEWTLAIALVWRYAERTGERSFRALCWGMLPALVGAMAVLVWHYFD 62

Query: 490 NSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ 594
           N   L  L  LQAA+T++GNAT+  AA+ IY+S++
Sbjct: 63  NRPELAYLGQLQAAMTLLGNATLAFAAYLIYRSAR 97



>gb:AP008231_582209 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 109

 Score =  104 bits (259), Expect = 3e-21
 Identities = 46/97 (47%), Positives = 70/97 (72%)
 Frame = +1

Query: 307 NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF 486
           +ALSLPTW IH+SSV+EW++A+  +W+ GE+ G   W GL+  M+P L  A CACTWH++
Sbjct: 2   HALSLPTWVIHISSVLEWLLAILYLWRLGEQ-GDRRWFGLAVAMLPALISALCACTWHYY 60

Query: 487 YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE 597
            N+  LE LV LQA+ T++GN T+ +AA+  ++ + +
Sbjct: 61  DNTPKLEWLVTLQASTTLVGNFTLMLAAYWFWRPASK 97



>gb:AP006175_1861389 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0669G04.
          Length = 175

 Score =  102 bits (255), Expect = 8e-21
 Identities = 48/54 (88%), Positives = 50/54 (92%)
 Frame = +1

Query: 436 MVPLLGGAFCACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE 597
           MVPLLGGA CACTWHFFYNSESLEVLVALQ  LTVIGN TMCIAAFRI+K+SQE
Sbjct: 117 MVPLLGGAMCACTWHFFYNSESLEVLVALQGVLTVIGNITMCIAAFRIFKASQE 170



>gb:BA000039_727221 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 100

 Score =  101 bits (251), Expect = 2e-20
 Identities = 46/96 (47%), Positives = 65/96 (67%)
 Frame = +1

Query: 307 NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF 486
           +ALS+PTW +H+SSV+EW+ A+  V Q   +   + W+ L+W M+P L  A CACTWH+F
Sbjct: 2   HALSIPTWMVHISSVLEWMAAIWFVAQLDRRRPGQGWRWLAWAMLPALVSAMCACTWHYF 61

Query: 487 YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ 594
            N+ +L  LV LQA LT +GN T+C AA  ++  SQ
Sbjct: 62  DNAVTLAWLVDLQALLTFLGNCTLCGAAAWLWWRSQ 97



>gb:BX572092_796530 Prochlorococcus marinus MED4 complete genome;
           segment 3/5.
          Length = 100

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 43/94 (45%), Positives = 55/94 (58%)
 Frame = +1

Query: 313 LSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFFYN 492
           LS  TW IH+SSVIEW+ A+ ++ +       E +  LS  M+P L GA CA TWH F N
Sbjct: 4   LSFGTWLIHISSVIEWIYAIFIINKISSYKKLELYYWLSLAMIPNLIGAMCAITWHIFDN 63

Query: 493 SESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ 594
              L  LV LQ   T IGN+T+ IA   IYK ++
Sbjct: 64  QPELYGLVTLQGIFTFIGNSTLAIATIAIYKRTE 97



>gb:BX569692_776190 Synechococcus sp. WH8102 complete genome;
           segment 4/7.
          Length = 92

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 46/91 (50%), Positives = 58/91 (63%)
 Frame = +1

Query: 307 NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF 486
           +ALSL TW IHV+SVIEW +A+ L+ +          K L+  MVP L  A  ACTWH F
Sbjct: 2   HALSLGTWWIHVTSVIEWSLAIVLIQR-------RDLKWLALAMVPALISAMAACTWHLF 54

Query: 487 YNSESLEVLVALQAALTVIGNATMCIAAFRI 579
            NSE+L  LV LQAALT+IGN  +  AA+ +
Sbjct: 55  DNSEALRPLVTLQAALTLIGNMVLAWAAWSL 85



>gb:BX572097_798031 Prochlorococcus marinus MIT9313 complete genome;
           segment 3/7.
          Length = 100

 Score = 83.6 bits (205), Expect = 5e-15
 Identities = 40/97 (41%), Positives = 64/97 (65%)
 Frame = +1

Query: 307 NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF 486
           +ALSL TW IH++S+ EW++A+ LV Q+G+++   +   L+  M+P L  A  A TWH F
Sbjct: 2   HALSLGTWWIHLASLFEWMLAIVLVAQWGKRNQNRAMSWLALAMLPNLVSAMTAITWHIF 61

Query: 487 YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE 597
            NS++L  +V LQA LT+IGN  +  A + + +S ++
Sbjct: 62  DNSKALSGIVVLQAWLTLIGNCCLAAATWNLMRSERQ 98



>gb:AE017163_395387 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 3 of 6 of the complete
           genome.>gb:AE017126_1031056 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 104

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 36/100 (36%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
 Frame = +1

Query: 307 NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSW---GMVPLLGGAFCACTW 477
           ++LS  TW IH+ ++ EW++A+ ++ +   ++   S + L W    M+P L  A  A TW
Sbjct: 2   HSLSTATWFIHILTLFEWILAIIIIAKLSTQNN--STRKLIWLAFAMLPNLASAMAAITW 59

Query: 478 HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE 597
           H F N   L  LV +QA LT +GN+ +  AA+RI+ S ++
Sbjct: 60  HIFDNDSGLYGLVYIQALLTFLGNSALAFAAWRIFISEKQ 99



>sp|P15811|YC49_CYAPA Hypothetical 12.3 kDa protein ycf49
           (ORF102).>pir|S12809|S12809 hypothetical protein (rpl3
           5' region) - Cyanophora paradoxa
           cyanelle>gb:CHCPRPO_1646585 Cyanophora paradoxa rps18,
           rps19, rpl2, rpl3, rpl33 genes and rpl22 (partial) and
           ORF102.>gb:CPU30821_1648800 Cyanophora paradoxa
           cyanelle, complete genome.
          Length = 102

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 33/93 (35%), Positives = 45/93 (48%)
 Frame = +1

Query: 307 NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF 486
           N LS  TW +H+SSV+EW+  +     Y +     S K   +        A CACT HFF
Sbjct: 2   NVLSYFTWFVHLSSVLEWLNIIYFFLLYTKLKKNLSLKTFIFSFFISFCSALCACTLHFF 61

Query: 487 YNSESLEVLVALQAALTVIGNATMCIAAFRIYK 585
            N      L+ LQ+ LT+  N T+  +   IYK
Sbjct: 62  NNQSFYYFLINLQSFLTLFANITLYFSIL-IYK 93



>sp|Q9TM18|YC49_CYACA Hypothetical 11.6 kDa protein
           ycf49.>gb:AF022186_1761813 Cyanidium caldarium strain
           RK1 chloroplast, complete genome.
          Length = 97

 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 5/85 (5%)
 Frame = +1

Query: 310 ALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPL-----LGGAFCACT 474
           +LSLPTW IH+ +++EW I + L++ +     Y+  +  ++ ++ L     L G F AC 
Sbjct: 3   SLSLPTWNIHIVTLVEWSIVIRLIYLF--TYFYDIPRSFNFLIIILMIFFFLSGLF-ACC 59

Query: 475 WHFFYNSESLEVLVALQAALTVIGN 549
           WHFF N+  L  +   QAALT   N
Sbjct: 60  WHFFNNNSILLWISVAQAALTAFSN 84



>gb:AB002583_1508919 Cyanidioschyzon merolae chloroplast DNA,
           complete genome, strain:10D.
          Length = 97

 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 26/79 (32%), Positives = 42/79 (53%)
 Frame = +1

Query: 313 LSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFFYN 492
           LS  TW IH  S++EW++ M L+ +Y         K + W ++     A+ A +WH  +N
Sbjct: 15  LSWSTWLIHHCSIVEWLMIMPLLKRYR--------KAMDWNLI----SAWAAISWHMTHN 62

Query: 493 SESLEVLVALQAALTVIGN 549
              +E LV +QA  T++ N
Sbjct: 63  --RVEWLVIIQATSTILAN 79



>pir|T04578|T04578 hypothetical protein T12H17.220 - Arabidopsis
           thaliana>gb:ATCHRIV58_1546120 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           58.>gb:ATT12H17_1554368 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T12H17 (ESSAII project).
          Length = 121

 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 18/25 (72%), Positives = 23/25 (92%)
 Frame = +1

Query: 286 VQFAEPANALSLPTWTIHVSSVIEW 360
           +Q +EP+NALSLPTW +HVSSV+EW
Sbjct: 83  LQLSEPSNALSLPTWAVHVSSVVEW 107



>gb:AE012970_287714 Chlorobium tepidum TLS section 191 of 194 of the
           complete genome.>gb:AE006470_934882 Chlorobium tepidum
           TLS complete genome.
          Length = 232

 Score = 46.6 bits (109), Expect = 7e-04
 Identities = 22/95 (23%), Positives = 52/95 (54%)
 Frame = +1

Query: 313 LSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFFYN 492
           LS   W IH+SS +EW +A+ ++++YG+  G +  +  +  M+P   G++    +H   +
Sbjct: 3   LSPLNWLIHLSSSLEWGVALVMLYRYGQFIGRKDVRRFALFMLPHWIGSWFVLLYHL--S 60

Query: 493 SESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE 597
            +++   + +  A+ ++G+  +  A  +I K  ++
Sbjct: 61  GDAIMRFLEISEAINLVGSIALLYATLKILKGDEK 95



>pir|A38346|A38346 ultra-high-sulfur keratin 1 -
           mouse>gb:MUSSER1_2129994 Mouse serine 1 ultra high
           sulfur protein gene, complete cds.
          Length = 230

 Score = 25.4 bits (54), Expect(5) = 0.85
 Identities = 17/49 (34%), Positives = 21/49 (42%)
 Frame = +2

Query: 752 SIGRLGSLLVGVCQYVLCCLMEQIFSLFGGWRVVSTKGIDLHLSCCKPC 898
           S G  GS     C+ V CC+     S  GG +    +      SCCKPC
Sbjct: 80  SCGGCGS---SCCKPVCCCVPVCSCSSCGGCKPCCCQS-----SCCKPC 120



 Score = 21.2 bits (43), Expect(5) = 0.85
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = +2

Query: 881 SCCKPC 898
           SCCKPC
Sbjct: 211 SCCKPC 216



 Score = 21.2 bits (43), Expect(5) = 0.85
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = +2

Query: 881 SCCKPC 898
           SCCKPC
Sbjct: 201 SCCKPC 206



 Score = 21.2 bits (43), Expect(5) = 0.85
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = +2

Query: 881 SCCKPC 898
           SCCKPC
Sbjct: 191 SCCKPC 196



 Score = 21.2 bits (43), Expect(5) = 0.85
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = +2

Query: 881 SCCKPC 898
           SCCKPC
Sbjct: 153 SCCKPC 158



>gb:AC006722_1203873 Caenorhabditis elegans cosmid Y19D10A, complete
           sequence.
          Length = 383

 Score = 35.4 bits (80), Expect = 1.6
 Identities = 20/69 (28%), Positives = 34/69 (49%)
 Frame = +1

Query: 292 FAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCAC 471
           ++ P+  LS+P +  H  S   W I +   ++      ++SWK + W M+PLL G    C
Sbjct: 119 YSGPSFYLSIPQY--HKVSSNIWSIKVYQCFRSNLLKTFDSWKIVPWFMIPLLNGITFMC 176

Query: 472 TWHFFYNSE 498
           T  F   ++
Sbjct: 177 TAGFLMRAD 185



>gb:AY360461_1948029 Homo sapiens UHS KERB-like protein mRNA,
           complete cds.
          Length = 187

 Score = 21.2 bits (43), Expect(6) = 1.7
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = +2

Query: 881 SCCKPC 898
           SCCKPC
Sbjct: 166 SCCKPC 171



 Score = 21.2 bits (43), Expect(6) = 1.7
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = +2

Query: 881 SCCKPC 898
           SCCKPC
Sbjct: 147 SCCKPC 152



 Score = 21.2 bits (43), Expect(6) = 1.7
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = +2

Query: 881 SCCKPC 898
           SCCKPC
Sbjct: 137 SCCKPC 142



 Score = 21.2 bits (43), Expect(6) = 1.7
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = +2

Query: 881 SCCKPC 898
           SCCKPC
Sbjct: 118 SCCKPC 123



 Score = 21.2 bits (43), Expect(6) = 1.7
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = +2

Query: 881 SCCKPC 898
           SCCKPC
Sbjct: 108 SCCKPC 113



 Score = 21.2 bits (43), Expect(6) = 1.7
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = +2

Query: 881 SCCKPC 898
           SCCKPC
Sbjct: 89  SCCKPC 94



>gb:BX538351_1358877 Cryptosporidium parvum chromosome 6, complete
           sequence; segment 2/4.
          Length = 738

 Score = 34.7 bits (78), Expect = 2.8
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 1/54 (1%)
 Frame = +2

Query: 749 FSIGRLGSLLVGVCQ-YVLCCLMEQIFSLFGGWRVVSTKGIDLHLSCCKPCKFL 907
           FS+  +G+L   + Q Y+   + E+I +LF   R  S K I + +SCCK  +FL
Sbjct: 273 FSLDNIGALPKNLQQLYIKVAIHEKIDTLFNFLRTHSNKKIIVFVSCCKQVRFL 326



>gb:AY596297_632730 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 136

 Score = 33.9 bits (76), Expect = 4.7
 Identities = 23/71 (32%), Positives = 33/71 (46%)
 Frame = +1

Query: 361 VIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFFYNSESLEVLVALQAALTV 540
           V A+AL W  G + GYES     + + P + G      W F     +L+ L+AL  A  V
Sbjct: 28  VAALALFWAQGFRLGYES----LYRVNPSVAGGGIGADWVFGNTIPALDFLIALIHAADV 83

Query: 541 IGNATMCIAAF 573
           I  A + +  F
Sbjct: 84  ILGAFILVMVF 94



>gb:AY366465_2084127 Rattus norvegicus Drosophila-type eyes absent
           2-like protein (Eya2) mRNA, complete cds.
          Length = 531

 Score = 33.1 bits (74), Expect = 8.0
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +2

Query: 95  PNKPNFPQSQNPQLFFLLFSTQYPPLISITKKP 193
           P+ PNFPQ+Q PQ F   ++  Y P  S+   P
Sbjct: 158 PSYPNFPQNQYPQYFSPSYNPPYVPASSLCSSP 190



>gb:CR382126_1658791 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 259

 Score = 33.1 bits (74), Expect = 8.0
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 5/74 (6%)
 Frame = -2

Query: 223 QDQQPPKP*RGFFGY*NQWGV---LGGKQQKEKLGIL*LRKVGFVWA*GKVGTLKEIIRL 53
           Q QQ P+  RG FG  N+ G     GG++ +E+ G + + K+G +   GK+ +++EI   
Sbjct: 7   QGQQAPR--RGGFGGANRGGRGGRRGGRRDQEEKGWVPVTKLGRLVKAGKISSIEEIFLH 64

Query: 52  ELP--SFDILKALL 17
            LP   F I+  LL
Sbjct: 65  SLPVKEFQIIDQLL 78



>pir|A38660|B38346 ultra-high-sulfur keratin 2 -
           mouse>gb:MUSSER2_2129995 Mouse serine 2 ultra high
           sulfur protein gene, complete cds.
          Length = 223

 Score = 21.6 bits (44), Expect(5) = 8.7
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = +2

Query: 860 KGIDLHLSCCKPC 898
           KG     SCCKPC
Sbjct: 71  KGGCCQSSCCKPC 83



 Score = 21.2 bits (43), Expect(5) = 8.7
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = +2

Query: 881 SCCKPC 898
           SCCKPC
Sbjct: 202 SCCKPC 207



 Score = 21.2 bits (43), Expect(5) = 8.7
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = +2

Query: 881 SCCKPC 898
           SCCKPC
Sbjct: 192 SCCKPC 197



 Score = 21.2 bits (43), Expect(5) = 8.7
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = +2

Query: 881 SCCKPC 898
           SCCKPC
Sbjct: 154 SCCKPC 159



 Score = 21.2 bits (43), Expect(5) = 8.7
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = +2

Query: 881 SCCKPC 898
           SCCKPC
Sbjct: 116 SCCKPC 121


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,042,349,980
Number of Sequences: 1806583
Number of extensions: 23600236
Number of successful extensions: 67370
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 64409
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 67342
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 66927614721
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)