BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig152
         (587 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AE005172_890286 Arabidopsis thaliana chromosome 1, top arm co...   134   1e-30   
gb:AY086095_1571153 Arabidopsis thaliana clone 21249 mRNA, compl...   132   5e-30   
gb:AY058092_1564231 Arabidopsis thaliana At1g63170/F16M19_7 mRNA...   132   5e-30   
pir|C96657|C96657 hypothetical protein F16M19.7 [imported] - Ara...   132   5e-30   Arabidopsis thaliana [mouse-ear cress]
gb:AY057713_1564125 Arabidopsis thaliana AT4g11680/T5C23_110 mRN...   129   5e-29   
pir|T04215|T04215 hypothetical protein T5C23.110 - Arabidopsis t...   129   5e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AP005885_1859667 Oryza sativa (japonica cultivar-group) genom...   124   1e-27   
gb:AP003916_1835174 Oryza sativa (japonica cultivar-group) genom...   115   7e-25   
gb:AY059830_1564674 Arabidopsis thaliana putative protein (At3g6...   113   2e-24   
pir|T47910|T47910 hypothetical protein T20K12.80 - Arabidopsis t...   113   2e-24   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00203_1696651 Oryza sativa genomic DNA, chromosome 4, BAC...   111   8e-24   
gb:AY084480_1569569 Arabidopsis thaliana clone 109181 mRNA, comp...   104   1e-21   
pir|H96703|H96703 probable RING zinc finger protein T23K23.8 [im...   104   1e-21   Arabidopsis thaliana [mouse-ear cress]
gb:AY168924_1586415 Arabidopsis thaliana RES protein (RES) mRNA,...    86   6e-16   
pir|D84428|D84428 hypothetical protein At2g01730 [imported] - Ar...    86   6e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AP005879_1859549 Oryza sativa (japonica cultivar-group) genom...    47   2e-04   
pir|T08924|T08924 hypothetical protein T15N24.30 - Arabidopsis t...    45   7e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AF144380_1771887 Phacelia tanacetifolia clone Pt8L unknown mRNA.    45   9e-04   
gb:AY085253_1570325 Arabidopsis thaliana clone 141890 mRNA, comp...    45   0.001   
gb:AB011476_1511384 Arabidopsis thaliana genomic DNA, chromosome...    45   0.001   
gb:AP002524_1822387 Oryza sativa (japonica cultivar-group) genom...    42   0.006   
gb:AY074271_1567432 Arabidopsis thaliana unknown protein (At4g32...    41   0.012   
pir|T04466|T04466 hypothetical protein F4D11.200 - Arabidopsis t...    41   0.012   Arabidopsis thaliana [mouse-ear cress]
gb:AC130610_1740872 Oryza sativa (japonica cultivar-group) chrom...    40   0.036   
pir|G96835|G96835 probable RING zinc finger protein, 53384-54880...    39   0.062   Arabidopsis thaliana [mouse-ear cress]
gb:AY224451_1590653 Oryza sativa (japonica cultivar-group) isola...    38   0.14    
pir|H86289|H86289 T16N11.10 protein - Arabidopsis thaliana>gb:AE...    32   5.8     Arabidopsis thaliana [mouse-ear cress]


>gb:AE005172_890286 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC025417_1539511 Genomic sequence
           for Arabidopsis thaliana BAC T12C24 from chromosome I,
           complete sequence.>gb:AY136370_1581871 Arabidopsis
           thaliana unknown protein (At3g13380:At1g12760) mRNA,
           complete cds.>gb:BT000279_1634557 Arabidopsis thaliana
           unknown protein (At3g13380At1g12760) mRNA, complete cds.
          Length = 408

 Score =  134 bits (336), Expect = 1e-30
 Identities = 70/147 (47%), Positives = 91/147 (61%), Gaps = 9/147 (6%)
 Frame = +2

Query: 53  VNVNSGGEGNDGVDTTPLL--GDQIFGS-------RRFMRRPPSLXXXXXXXXXXXXXXX 205
           +  +S    +D +D  PLL  GD   G+       RR +RR   L               
Sbjct: 13  IPASSSSSSSDAIDPAPLLFNGDDNEGNNGGGGGERRSVRRQ-GLREAARFLSRASSGRV 71

Query: 206 XXXXXXXXXESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPL 385
                    E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ ++LVMSR E P+MPL
Sbjct: 72  MREPSMLVREAAAEQLEERQSDWAYSKPVVVLDIVWNLAFVSVATAILVMSRKEHPIMPL 131

Query: 386 RLWIVGYDFQCVLHIVCVCLEYRRRNQ 466
           R+W++GY  QCVLH+VCVC+EYRRRN+
Sbjct: 132 RVWLLGYALQCVLHMVCVCVEYRRRNR 158



>gb:AY086095_1571153 Arabidopsis thaliana clone 21249 mRNA, complete
           sequence.
          Length = 381

 Score =  132 bits (331), Expect = 5e-30
 Identities = 63/124 (50%), Positives = 81/124 (65%)
 Frame = +2

Query: 92  DTTPLLGDQIFGSRRFMRRPPSLXXXXXXXXXXXXXXXXXXXXXXXXESAAEQIEERQSD 271
           + TPL+     G RR +RR                            E+AAEQ+EERQSD
Sbjct: 8   EATPLILTDGGGGRRSVRRQGLREAARLLRHASSGRMMMREPSMLVREAAAEQLEERQSD 67

Query: 272 WAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY 451
           WAYSKP+V+LD  WNLAFV+V+ +VLV+S DE+P MPLR+WI+GY  QC++H+VCVC+EY
Sbjct: 68  WAYSKPVVVLDFVWNLAFVVVATAVLVLSSDENPNMPLRVWIIGYGLQCMMHMVCVCVEY 127

Query: 452 RRRN 463
           RRRN
Sbjct: 128 RRRN 131



>gb:AY058092_1564231 Arabidopsis thaliana At1g63170/F16M19_7 mRNA,
           complete cds.
          Length = 381

 Score =  132 bits (331), Expect = 5e-30
 Identities = 63/124 (50%), Positives = 81/124 (65%)
 Frame = +2

Query: 92  DTTPLLGDQIFGSRRFMRRPPSLXXXXXXXXXXXXXXXXXXXXXXXXESAAEQIEERQSD 271
           + TPL+     G RR +RR                            E+AAEQ+EERQSD
Sbjct: 8   EATPLILTDGGGGRRSVRRQGLREAARLLRHASSGRMMMREPSMLVREAAAEQLEERQSD 67

Query: 272 WAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY 451
           WAYSKP+V+LD  WNLAFV+V+ +VLV+S DE+P MPLR+WI+GY  QC++H+VCVC+EY
Sbjct: 68  WAYSKPVVVLDFVWNLAFVVVATAVLVLSSDENPNMPLRVWIIGYGLQCMMHMVCVCVEY 127

Query: 452 RRRN 463
           RRRN
Sbjct: 128 RRRN 131



>pir|C96657|C96657 hypothetical protein F16M19.7 [imported] -
           Arabidopsis thaliana>gb:AE005173_893985 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010795_1537097 Arabidopsis thaliana
           chromosome 1 BAC F16M19 genomic sequence, complete
           sequence.
          Length = 381

 Score =  132 bits (331), Expect = 5e-30
 Identities = 63/124 (50%), Positives = 81/124 (65%)
 Frame = +2

Query: 92  DTTPLLGDQIFGSRRFMRRPPSLXXXXXXXXXXXXXXXXXXXXXXXXESAAEQIEERQSD 271
           + TPL+     G RR +RR                            E+AAEQ+EERQSD
Sbjct: 8   EATPLILTDGGGGRRSVRRQGLREAARLLRHASSGRMMMREPSMLVREAAAEQLEERQSD 67

Query: 272 WAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY 451
           WAYSKP+V+LD  WNLAFV+V+ +VLV+S DE+P MPLR+WI+GY  QC++H+VCVC+EY
Sbjct: 68  WAYSKPVVVLDFVWNLAFVVVATAVLVLSSDENPNMPLRVWIIGYGLQCMMHMVCVCVEY 127

Query: 452 RRRN 463
           RRRN
Sbjct: 128 RRRN 131



>gb:AY057713_1564125 Arabidopsis thaliana AT4g11680/T5C23_110 mRNA,
           complete cds.>gb:BT010750_1640696 Arabidopsis thaliana
           At4g11680/T5C23_110 gene, complete cds.
          Length = 390

 Score =  129 bits (323), Expect = 5e-29
 Identities = 61/114 (53%), Positives = 75/114 (65%)
 Frame = +2

Query: 125 GSRRFMRRPPSLXXXXXXXXXXXXXXXXXXXXXXXXESAAEQIEERQSDWAYSKPIVLLD 304
           GSRR MR P  L                        E+AAEQ+EERQSDWAYSKP+V LD
Sbjct: 76  GSRRMMREPSMLVR----------------------ETAAEQLEERQSDWAYSKPVVFLD 113

Query: 305 LFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEYRRRNQ 466
           + WNLAFV + ++VL++SRDE P MPLR+W+VGY  QC LH+ CVC+EYRRR +
Sbjct: 114 ILWNLAFVAIGVAVLILSRDEKPNMPLRVWVVGYGIQCWLHMACVCVEYRRRRR 167



>pir|T04215|T04215 hypothetical protein T5C23.110 - Arabidopsis
           thaliana>gb:ATCHRIV32_1544933 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 32.>gb:ATT5C23_1556104
           Arabidopsis thaliana DNA chromosome 4, BAC clone T5C23
           (ESSA project).
          Length = 419

 Score =  129 bits (323), Expect = 5e-29
 Identities = 61/114 (53%), Positives = 75/114 (65%)
 Frame = +2

Query: 125 GSRRFMRRPPSLXXXXXXXXXXXXXXXXXXXXXXXXESAAEQIEERQSDWAYSKPIVLLD 304
           GSRR MR P  L                        E+AAEQ+EERQSDWAYSKP+V LD
Sbjct: 76  GSRRMMREPSMLVR----------------------ETAAEQLEERQSDWAYSKPVVFLD 113

Query: 305 LFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEYRRRNQ 466
           + WNLAFV + ++VL++SRDE P MPLR+W+VGY  QC LH+ CVC+EYRRR +
Sbjct: 114 ILWNLAFVAIGVAVLILSRDEKPNMPLRVWVVGYGIQCWLHMACVCVEYRRRRR 167



>gb:AP005885_1859667 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0657H12.
          Length = 399

 Score =  124 bits (311), Expect = 1e-27
 Identities = 57/84 (67%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = +2

Query: 233 ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF 412
           E+AA+Q+EERQ+DWAYS+P+V LDL WNLAF+LV+ +VL +SR+ESP MPLRLWIVGY  
Sbjct: 65  EAAADQLEERQADWAYSRPVVALDLLWNLAFILVAAAVLALSREESPSMPLRLWIVGYAV 124

Query: 413 QCVLHIVCVCLEYR-RRNQLPSSP 481
           QCVLH+ CV +EYR RR Q   SP
Sbjct: 125 QCVLHMACVAIEYRMRRGQSGESP 148



>gb:AP003916_1835174 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1634_H04.
          Length = 361

 Score =  115 bits (287), Expect = 7e-25
 Identities = 63/144 (43%), Positives = 81/144 (56%), Gaps = 4/144 (2%)
 Frame = +2

Query: 47  TNVNVNSGGEGNDGVDTTPLLGDQIF----GSRRFMRRPPSLXXXXXXXXXXXXXXXXXX 214
           T+ +  SGG G  G     L G   F    GSRR MR P                     
Sbjct: 24  TSPDRRSGGGGGGGRLLPGLRGAARFLGRTGSRRLMREP--------------------- 62

Query: 215 XXXXXXESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLW 394
                 E+AAE +EERQ+DWAYSKP+V+LD+ WNLAFV V+ +VL  S  ESP +PLR+W
Sbjct: 63  -SVAVRETAAEHLEERQTDWAYSKPVVVLDVLWNLAFVAVAAAVLAASLPESPSVPLRVW 121

Query: 395 IVGYDFQCVLHIVCVCLEYRRRNQ 466
           + GY  QC+ H++CV +EYRRR +
Sbjct: 122 LAGYVLQCLFHVLCVTVEYRRRRE 145



>gb:AY059830_1564674 Arabidopsis thaliana putative protein
           (At3g61180; T20K12.80) mRNA, complete
           cds.>gb:AY064638_1566089 Arabidopsis thaliana putative
           protein (At3g61180; T20K12.80) mRNA, complete cds.
          Length = 379

 Score =  113 bits (283), Expect = 2e-24
 Identities = 50/83 (60%), Positives = 63/83 (75%)
 Frame = +2

Query: 233 ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF 412
           E AAEQ+EERQS WAYSKPI++LD+ WN  FV+VSI++L  S DE P +PLRLWI+GY+ 
Sbjct: 65  EVAAEQLEERQSQWAYSKPIIVLDILWNFLFVIVSIAILGFSSDEDPDVPLRLWIIGYNV 124

Query: 413 QCVLHIVCVCLEYRRRNQLPSSP 481
           QC+ H+ CV  EY+RR    S P
Sbjct: 125 QCLFHVGCVIAEYKRRRVANSPP 147



>pir|T47910|T47910 hypothetical protein T20K12.80 - Arabidopsis
           thaliana>gb:ATT20K12_1554957 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T20K12.
          Length = 362

 Score =  113 bits (283), Expect = 2e-24
 Identities = 50/83 (60%), Positives = 63/83 (75%)
 Frame = +2

Query: 233 ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF 412
           E AAEQ+EERQS WAYSKPI++LD+ WN  FV+VSI++L  S DE P +PLRLWI+GY+ 
Sbjct: 48  EVAAEQLEERQSQWAYSKPIIVLDILWNFLFVIVSIAILGFSSDEDPDVPLRLWIIGYNV 107

Query: 413 QCVLHIVCVCLEYRRRNQLPSSP 481
           QC+ H+ CV  EY+RR    S P
Sbjct: 108 QCLFHVGCVIAEYKRRRVANSPP 130



>gb:OSJN00203_1696651 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0032E06, complete sequence.
          Length = 324

 Score =  111 bits (278), Expect = 8e-24
 Identities = 51/84 (60%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = +2

Query: 233 ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF 412
           E+AAE +EERQ+DWAYS+P+V LDL WNLAF+ V+  VLV+SR E   MPLR W+ GY  
Sbjct: 10  EAAAEHLEERQADWAYSRPVVALDLLWNLAFITVAAVVLVLSRGEDSPMPLRTWVAGYAL 69

Query: 413 QCVLHIVCVCLEYR-RRNQLPSSP 481
           QCV+H+VCV +EYR RR Q   +P
Sbjct: 70  QCVVHMVCVAIEYRMRRGQRDRAP 93



>gb:AY084480_1569569 Arabidopsis thaliana clone 109181 mRNA,
           complete sequence.
          Length = 343

 Score =  104 bits (259), Expect = 1e-21
 Identities = 42/77 (54%), Positives = 64/77 (83%)
 Frame = +2

Query: 233 ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF 412
           E+AA+++EER++DW YSKP+V LD+ WN AFVLV+I +L++ ++E P +P+R+WI GY  
Sbjct: 49  ETAAQELEERRADWGYSKPVVALDMLWNTAFVLVAIVMLLVFKEEKPNVPIRIWICGYAI 108

Query: 413 QCVLHIVCVCLEYRRRN 463
           QC++H+V V LE+R+RN
Sbjct: 109 QCLVHVVLVWLEFRKRN 125



>pir|H96703|H96703 probable RING zinc finger protein T23K23.8
           [imported] - Arabidopsis thaliana>gb:AE005173_894429
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC012563_1537747 Arabidopsis thaliana
           chromosome 1 BAC T23K23 genomic sequence, complete
           sequence.
          Length = 343

 Score =  104 bits (259), Expect = 1e-21
 Identities = 42/77 (54%), Positives = 64/77 (83%)
 Frame = +2

Query: 233 ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF 412
           E+AA+++EER++DW YSKP+V LD+ WN AFVLV+I +L++ ++E P +P+R+WI GY  
Sbjct: 49  ETAAQELEERRADWGYSKPVVALDMLWNTAFVLVAIVMLLVFKEEKPNVPIRIWICGYAI 108

Query: 413 QCVLHIVCVCLEYRRRN 463
           QC++H+V V LE+R+RN
Sbjct: 109 QCLVHVVLVWLEFRKRN 125



>gb:AY168924_1586415 Arabidopsis thaliana RES protein (RES) mRNA,
           complete cds.
          Length = 359

 Score = 85.5 bits (210), Expect = 6e-16
 Identities = 39/77 (50%), Positives = 51/77 (66%)
 Frame = +2

Query: 233 ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF 412
           E+AA  +EER+ DW YSKP+V  D+ WN A VL S  +LV + +E P  P+R+WI  Y  
Sbjct: 58  ETAARALEERRIDWGYSKPVVAADILWNAALVLASAVMLVGTVEERPNEPIRVWICVYGL 117

Query: 413 QCVLHIVCVCLEYRRRN 463
           QC+ H+V V  EY RRN
Sbjct: 118 QCLFHVVLVWSEYWRRN 134



>pir|D84428|D84428 hypothetical protein At2g01730 [imported] -
           Arabidopsis thaliana>gb:AC006069_1533381 Arabidopsis
           thaliana chromosome 2 clone T8O11 map rga, complete
           sequence.
          Length = 837

 Score = 85.5 bits (210), Expect = 6e-16
 Identities = 39/77 (50%), Positives = 51/77 (66%)
 Frame = +2

Query: 233 ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF 412
           E+AA  +EER+ DW YSKP+V  D+ WN A VL S  +LV + +E P  P+R+WI  Y  
Sbjct: 633 ETAARALEERRIDWGYSKPVVAADILWNAALVLASAVMLVGTVEERPNEPIRVWICVYGL 692

Query: 413 QCVLHIVCVCLEYRRRN 463
           QC+ H+V V  EY RRN
Sbjct: 693 QCLFHVVLVWSEYWRRN 709



>gb:AP005879_1859549 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OSJNBb0024J13.
          Length = 414

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 23/53 (43%), Positives = 30/53 (56%)
 Frame = +2

Query: 326 VLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEYRRRNQLPSSPE 484
           ++ +I VLV SRDE P  PL  WI+GY   C+  I  +C     RN+ PS  E
Sbjct: 102 IVAAIFVLVFSRDEHPHAPLFAWIIGYTIGCIASIPLICWRCAHRNR-PSEQE 153



>pir|T08924|T08924 hypothetical protein T15N24.30 - Arabidopsis
           thaliana>gb:ATCHRIV65_1546539 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           65.>gb:ATT15N24_1554546 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T15N24 (ESSA project).
          Length = 464

 Score = 45.4 bits (106), Expect = 7e-04
 Identities = 27/72 (37%), Positives = 40/72 (55%)
 Frame = +2

Query: 272 WAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY 451
           W  S+ I LL        + V  S L +S++E P+ P+RLWI GY+  C+L+++   L Y
Sbjct: 216 WMVSELIALL------LQITVITSTLALSKNERPVWPMRLWITGYNVGCLLNLM---LLY 266

Query: 452 RRRNQLPSSPEN 487
            R  Q  +S EN
Sbjct: 267 GRYRQQDTSHEN 278



>gb:AF144380_1771887 Phacelia tanacetifolia clone Pt8L unknown mRNA.
          Length = 74

 Score = 45.1 bits (105), Expect = 9e-04
 Identities = 21/58 (36%), Positives = 35/58 (60%)
 Frame = +2

Query: 293 VLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEYRRRNQ 466
           + ++L   ++ ++ +I VL +SR+E+P  PL  W+VGY   CV  +  +   YR RNQ
Sbjct: 10  ISVELVLTVSQIVAAIVVLSLSRNENPRAPLFAWVVGYASGCVAILPLLYWRYRHRNQ 67



>gb:AY085253_1570325 Arabidopsis thaliana clone 141890 mRNA,
           complete sequence.
          Length = 343

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 23/64 (35%), Positives = 36/64 (56%)
 Frame = +2

Query: 266 SDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCL 445
           S W  S+ I LL     + F L       +S++E P+ P+RLWI GYD  C+L+++ +  
Sbjct: 89  STWMMSELIALLVQLTVITFTLA------ISKEERPIWPVRLWITGYDVGCLLNLMLLYG 142

Query: 446 EYRR 457
            YR+
Sbjct: 143 RYRQ 146



>gb:AB011476_1511384 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MDA7.
          Length = 320

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 23/64 (35%), Positives = 36/64 (56%)
 Frame = +2

Query: 266 SDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCL 445
           S W  S+ I LL     + F L       +S++E P+ P+RLWI GYD  C+L+++ +  
Sbjct: 89  STWMMSELIALLVQLTVITFTLA------ISKEERPIWPVRLWITGYDVGCLLNLMLLYG 142

Query: 446 EYRR 457
            YR+
Sbjct: 143 RYRQ 146



>gb:AP002524_1822387 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0406H10.>gb:AP002903_1823791 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0509B06.
          Length = 405

 Score = 42.4 bits (98), Expect = 0.006
 Identities = 19/65 (29%), Positives = 38/65 (58%)
 Frame = +2

Query: 293 VLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEYRRRNQLP 472
           + ++L  +L+ ++ +I+VL +SR+E P  PL  W++GY   CV  +  +   +  RN+  
Sbjct: 88  ISIELIVSLSQIIAAITVLSVSRNEHPHAPLAQWLIGYTIGCVATLPHLYWRFLHRNRQN 147

Query: 473 SSPEN 487
           +  E+
Sbjct: 148 TEQES 152



>gb:AY074271_1567432 Arabidopsis thaliana unknown protein
           (At4g32600) mRNA, complete cds.>gb:AY081300_1568646
           Arabidopsis thaliana putative protein (At4g32600) mRNA,
           complete cds.>gb:AY096655_1576191 Arabidopsis thaliana
           unknown protein (At4g32600) mRNA, complete cds.
          Length = 453

 Score = 41.2 bits (95), Expect = 0.012
 Identities = 20/58 (34%), Positives = 31/58 (53%)
 Frame = +2

Query: 293 VLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEYRRRNQ 466
           + ++LF  +  ++ +I VL +S+ E P  PL  WIVGY   CV  +  +   Y   NQ
Sbjct: 113 ISIELFLTVGQIIAAIVVLSLSKHEHPRAPLFTWIVGYACGCVATLPLLYWRYYHSNQ 170



>pir|T04466|T04466 hypothetical protein F4D11.200 - Arabidopsis
           thaliana>gb:ATCHRIV77_1547180 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 77.>gb:ATF4D11_1550652
           Arabidopsis thaliana DNA chromosome 4, BAC clone F4D11
           (ESSAII project).
          Length = 495

 Score = 41.2 bits (95), Expect = 0.012
 Identities = 20/58 (34%), Positives = 31/58 (53%)
 Frame = +2

Query: 293 VLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEYRRRNQ 466
           + ++LF  +  ++ +I VL +S+ E P  PL  WIVGY   CV  +  +   Y   NQ
Sbjct: 113 ISIELFLTVGQIIAAIVVLSLSKHEHPRAPLFTWIVGYACGCVATLPLLYWRYYHSNQ 170



>gb:AC130610_1740872 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0478F09, complete sequence.
          Length = 407

 Score = 39.7 bits (91), Expect = 0.036
 Identities = 20/62 (32%), Positives = 36/62 (58%)
 Frame = +2

Query: 293 VLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEYRRRNQLP 472
           + ++L  N++ ++ +I VL +SR+E P  PL  W++GY   C   +  +   Y  RN LP
Sbjct: 99  ISVELVVNVSQIIAAICVLSVSRNEHPHSPLFEWVIGYTVGCTATLPHLYWRYLHRN-LP 157

Query: 473 SS 478
           ++
Sbjct: 158 TT 159



>pir|G96835|G96835 probable RING zinc finger protein, 53384-54880
           [imported] - Arabidopsis thaliana>gb:AE005173_895553
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC018848_1538410 Arabidopsis thaliana
           chromosome 1 BAC F5I6 genomic sequence, complete
           sequence.>gb:AY062845_1565501 Arabidopsis thaliana
           putative RING zinc finger protein (At1g80400; F5I6.15)
           mRNA, complete cds.>gb:BT000070_1634348 Arabidopsis
           thaliana putative RING zinc finger protein (At1g80400)
           mRNA, complete cds.
          Length = 407

 Score = 38.9 bits (89), Expect = 0.062
 Identities = 16/58 (27%), Positives = 34/58 (58%)
 Frame = +2

Query: 293 VLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEYRRRNQ 466
           + ++L   +A ++ +I V+V+++DE P  PL  W++GY   C+  +  +   +R  N+
Sbjct: 106 ISVELVVTVAQIVAAIVVMVLAKDEHPEAPLFTWVIGYTCGCLATLPILYWRFRTYNR 163



>gb:AY224451_1590653 Oryza sativa (japonica cultivar-group) isolate
           23264 putative ATP synthetase alpha chain mRNA, complete
           cds.
          Length = 198

 Score = 37.7 bits (86), Expect = 0.14
 Identities = 17/57 (29%), Positives = 31/57 (54%)
 Frame = +2

Query: 293 VLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEYRRRN 463
           + +++  N++ ++ +I VL +SR E P  PL  W++GY   C   +  +   Y  RN
Sbjct: 90  ISIEVLVNVSQIVAAIVVLSLSRKEHPQAPLFEWVIGYTVGCFATLPHLYWRYIHRN 146



>pir|H86289|H86289 T16N11.10 protein - Arabidopsis
           thaliana>gb:AE005172_890548 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC013453_1537943 Arabidopsis thaliana
           chromosome I BAC T16N11 genomic sequence, complete
           sequence.
          Length = 220

 Score = 32.3 bits (72), Expect = 5.8
 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 1/46 (2%)
 Frame = +2

Query: 317 LAFVLVSISVLVMSRDES-PMMPLRLWIVGYDFQCVLHIVCVCLEY 451
           L  +   I VL+  RDE  P   L +WI+GY   C+  +  +C  +
Sbjct: 54  LVLIAAVIIVLIEPRDEEHPQTMLSIWIIGYTCGCIATLPILCWRF 99


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 458,482,426
Number of Sequences: 1806583
Number of extensions: 7832134
Number of successful extensions: 26797
Number of sequences better than 10.0: 27
Number of HSP's better than 10.0 without gapping: 26311
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26794
length of database: 581,917,975
effective HSP length: 118
effective length of database: 368,741,181
effective search space used: 28393070937
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)