BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig97
         (697 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|P35016|ENPL_CATRO|ENPL_CATRO Endoplasmin homolog precursor (GRP94 homolo...   312   3e-84   Catharanthus roseus [chatas]
gb:AC091774_1735041 Oryza sativa chromosome 6 BAC OJ1540_H01 gen...   291   6e-78   
gb:AB064527_1522362 Arabidopsis thaliana SHD gene for SHEPHERD, ...   291   6e-78   
pir|T09882|T09882 heat shock protein 90 homolog T22A6.20 - Arabi...   291   6e-78   Arabidopsis thaliana [mouse-ear cress]
gb:AF544993_1810459 Xerophyta viscosa Grp94 mRNA, complete cds.       289   3e-77   
gb:AB037681_1519150 Oryza sativa HSP90 mRNA for heat shock prote...   289   4e-77   
sp|P36183|ENPL_HORVU|ENPL_HORVU Endoplasmin homolog precursor (GRP94 homolo...   284   1e-75   Hordeum vulgare [barley]
gb:AF510108_2498606 Danio rerio chaperone protein GP96 (GP96) mR...   160   2e-38   
gb:AY335768_2144986 Synthetic construct Homo sapiens tumor rejec...   159   4e-38   
gb:BC081917_2108161 Rattus norvegicus tumor rejection antigen gp...   159   4e-38   
gb:BC010445_2090986 Mus musculus tumor rejection antigen gp96, m...   159   4e-38   
gb:BC009195_1971820 Homo sapiens tumor rejection antigen (gp96) ...   159   4e-38   
pir|S51358|S51358 protein kinase ppk98 (EC 2.7.1.-) precursor, b...   159   4e-38   Sus scrofa [pigs]
sp|P08113|ENPL_MOUSE|ENPL_MOUSE Endoplasmin precursor (Endoplasmic reticulu...   159   4e-38   Mus musculus [mouse]
sp|P14625|ENPL_HUMAN|ENPL_HUMAN Endoplasmin precursor (94 kDa glucose-regul...   159   4e-38   Homo sapiens [man]
sp|P41148|ENPL_CANFA|ENPL_CANFA Endoplasmin precursor (94 kDa glucose-regul...   159   4e-38   Canis lupus familiaris [dogs]
sp|Q95M18|ENPL_BOVIN|ENPL_BOVIN Endoplasmin precursor (94 kDa glucose-regul...   159   4e-38   Bos taurus [bovine]
gb:SSPPK_1445525 S.scrofa ppk98 gene.                                 159   6e-38   
sp|Q29092|ENPL_PIG|ENPL_PIG Endoplasmin precursor (94 kDa glucose-regulat...   159   6e-38   Sus scrofa [pigs]
sp|P08110|ENPL_CHICK|ENPL_CHICK Endoplasmin precursor (Heat shock 108 kDa p...   159   6e-38   Gallus gallus [bantam]
gb:BC060352_2552833 Xenopus laevis hypothetical protein MGC68448...   158   8e-38   
gb:SSGP96GRP_1445399 S.scrofa mRNA for gp96/GRP94.                    158   8e-38   
gb:AB040814_1195491 Dictyostelium discoideum Dd-grp94 mRNA for g...   158   8e-38   
gb:AY040226_1934866 Homo sapiens heat shock protein gp96 precurs...   157   1e-37   
gb:GGHSP108_2573211 Hen gene for steroid inducible 108K heat sho...   157   2e-37   
gb:AY187545_2517841 Xenopus laevis heat shock protein gp96 mRNA,...   157   2e-37   
pir|I50255|I50255 108K heat shock protein - chicken>gb:CHKHSPA_2...   157   2e-37   Gallus gallus [bantam]
gb:CR860533_1184598 Pongo pygmaeus mRNA; cDNA DKFZp459I057 (from...   155   5e-37   
gb:AF387865_2491050 Gallus gallus heat shock protein 108 mRNA, c...   155   6e-37   
pir|JC7352|JC7352 glucose-regulated protein 94 - slime mold (Dic...   155   6e-37   Dictyostelium discoideum
gb:AY187546_2517842 Eptatretus stoutii heat shock protein gp96 m...   153   3e-36   
gb:AY187547_1308580 Strongylocentrotus purpuratus heat shock pro...   153   3e-36   
gb:AF038559_1235104 Cryptosporidium parvum heat shock protein 90...   151   9e-36   
gb:AF006554_1231328 Drosophila persimilis strain persimi45 82 kD...   149   5e-35   
gb:AF006537_1231311 Drosophila pseudoobscura strain pseudo9 82 k...   149   5e-35   
pir|S57415|S57415 Hsp83 protein - Leishmania donovani infantum        149   5e-35   
sp|Q25293|HS83_LEIIN|HS83_LEIIN Heat shock protein 83-1 (HSP 83).>gb:LIHSP8...   149   5e-35   Leishmania infantum
gb:AY705371_1623725 Chlamydomonas reinhardtii heat shock protein...   149   6e-35   
gb:DMU57467_1380869 Drosophila melanogaster heat shock protein 8...   149   6e-35   
gb:DMU57459_1380861 Drosophila melanogaster heat shock protein 8...   149   6e-35   
pir|D24827|D24827 heat shock 82K protein - fruit fly (Drosophila...   149   6e-35   Drosophila virilis
pir|B24827|B24827 heat shock 82K protein - fruit fly (Drosophila...   149   6e-35   Drosophila simulans
sp|P04811|HS83_DROVI|HS83_DROVI Heat shock protein 83 (HSP 82) (Fragment).>...   149   6e-35   Drosophila virilis
sp|P04810|HS83_DROSI|HS83_DROSI Heat shock protein 83 (HSP 82) (Fragment).>...   149   6e-35   Drosophila simulans
sp|P02828|HS83_DROME|HS83_DROME Heat shock protein 83 (HSP 82).>pir|A24827|...   149   6e-35   Drosophila melanogaster
sp|O02192|HS83_DROAV|HS83_DROAV Heat shock protein 83 (HSP 82).>gb:DAU75687...   149   6e-35   Drosophila auraria
gb:AF006561_1231335 Drosophila miranda strain miranda23 82 kDa h...   148   8e-35   
gb:AF006552_1231326 Drosophila persimilis strain persimi43 82 kD...   148   8e-35   
gb:AF006551_1231325 Drosophila persimilis strain persimi42 82 kD...   148   8e-35   
gb:AF006545_1231319 Drosophila pseudoobscura bogotana strain bog...   148   8e-35   
gb:AF006543_1231317 Drosophila pseudoobscura bogotana strain bog...   148   8e-35   
gb:AF006542_1231316 Drosophila pseudoobscura bogotana strain bog...   148   8e-35   
gb:AF006539_1231313 Drosophila pseudoobscura strain pseudo11 82 ...   148   8e-35   
gb:AF006536_1231310 Drosophila pseudoobscura strain pseudo8 82 k...   148   8e-35   
gb:AF006535_1231309 Drosophila pseudoobscura strain pseudo7 82 k...   148   8e-35   
gb:AF006534_1231308 Drosophila pseudoobscura strain pseudo6 82 k...   148   8e-35   
gb:AF006532_1231306 Drosophila pseudoobscura strain pseudo4 82 k...   148   8e-35   
pir|C24827|C24827 heat shock 82K protein - fruit fly (Drosophila...   148   8e-35   Drosophila pseudoobscura pseudoobscura
sp|P04809|HS83_DROPS|HS83_DROPS Heat shock protein 83 (HSP 82) (Fragment).>...   148   8e-35   Drosophila pseudoobscura
sp|O16076|HS83_DROPE|HS83_DROPE Heat shock protein 83 (HSP 82) (Fragment).>...   148   8e-35   Drosophila persimilis
sp|O16087|HS83_DROMI|HS83_DROMI Heat shock protein 83 (HSP 82) (Fragment).>...   148   8e-35   Drosophila miranda
gb:AF006550_1231324 Drosophila persimilis strain persimi41 82 kD...   147   2e-34   
gb:AF006562_1231336 Drosophila miranda strain miranda24 82 kDa h...   147   2e-34   
gb:AF006557_1231331 Drosophila persimilis strain persimi48 82 kD...   147   2e-34   
gb:AF006553_1231327 Drosophila persimilis strain persimi44 82 kD...   147   2e-34   
pir|G90082|G90082 heat shock protein 82 [imported] - Guillardia ...   147   2e-34   Guillardia theta
gb:AB095186_1525333 Cyanidioschyzon merolae Hsp90 gene for heat ...   146   3e-34   
gb:AF006555_1231329 Drosophila persimilis strain persimi46 82 kD...   146   4e-34   
gb:AB176669_1202138 Antheraea yamamai hsp90 mRNA for heat shock ...   146   4e-34   
gb:AY423488_1325442 Opistophthalmus carinatus Hsp90 (HSP90) mRNA...   145   5e-34   
gb:AF254880_1256306 Spodoptera frugiperda 90-kDa heat shock prot...   145   5e-34   
gb:AF006530_1231304 Drosophila pseudoobscura strain pseudo2 82 k...   145   5e-34   
gb:AF006529_1231303 Drosophila pseudoobscura strain pseudo1 82 k...   145   5e-34   
gb:AE014188_968021 Plasmodium falciparum 3D7 chromosome 12, comp...   145   5e-34   
gb:AF135117_2476132 Salmo salar heat shock protein hsp90 beta (h...   145   7e-34   
gb:AF006563_1231337 Drosophila miranda strain miranda25 82 kDa h...   145   7e-34   
gb:AB060275_1196993 Bombyx mori hsp90 mRNA for 90-kDa heat shock...   145   7e-34   
gb:AB010709_1193222 Schistosoma japonicum mRNA for heat shock pr...   145   7e-34   
pir|A26125|A26125 heat shock protein 90 homolog - Trypanosoma cruzi   145   7e-34   Trypanosoma cruzi
pir|A44983|A44983 heat shock protein 83 - Trypanosoma brucei          145   7e-34   Trypanosoma brucei
sp|P06660|HS85_TRYCR|HS85_TRYCR Heat shock like 85 kDa protein.>gb:TRBHSC_1...   145   7e-34   Trypanosoma cruzi
sp|P12861|HS83_TRYBB|HS83_TRYBB Heat shock protein 83.>pir|S08119|S08119 he...   145   7e-34   Trypanosoma brucei brucei
gb:BC065359_2553977 Danio rerio heat shock protein 90-beta, mRNA...   145   9e-34   
gb:AJ720864_2503051 Gallus gallus mRNA for hypothetical protein,...   145   9e-34   
gb:AJ719941_2502128 Gallus gallus partial mRNA for hypothetical ...   145   9e-34   
gb:AJ719479_2501666 Gallus gallus partial mRNA for hypothetical ...   145   9e-34   
gb:AF473560_2496878 Coturnix japonica heat shock protein 90 alph...   145   9e-34   
gb:AF068772_2471523 Danio rerio heat shock protein hsp90beta mRN...   145   9e-34   
gb:MSQHSP82G_1390181 Anopheles albimanus heat shock protein gene...   145   9e-34   
pir|A32298|HHCH90 heat shock protein 90 - chicken                     145   9e-34   
sp|O57521|HS9B_BRARE|HS9B_BRARE Heat shock protein HSP 90-beta.>gb:AF042108...   145   9e-34   Danio rerio [leopard danio]
sp|P27741|HS83_LEIAM|HS83_LEIAM Heat shock protein 83 (HSP 83).>pir|A44943|...   145   9e-34   Leishmania amazonensis
gb:AY528900_1333156 Chiromantes haematocheir hsp-90 mRNA, comple...   144   1e-33   
gb:AF006538_1231312 Drosophila pseudoobscura strain pseudo10 82 ...   144   1e-33   
pir|T24521|T24521 hypothetical protein T05E11.3 - Caenorhabditis...   144   1e-33   Caenorhabditis elegans [roundworm]
gb:AY785160_2546337 Xenopus laevis Hsp90beta mRNA, complete cds....   144   1e-33   
gb:S45392_2138468 heat shock protein 90 [rats, brain, mRNA, 2524...   144   1e-33   
gb:AB072369_1408900 Bos taurus hsp90beta mRNA for 90-kDa heat sh...   144   1e-33   
sp|P34058|HS9B_RAT|HS9B_RAT Heat shock protein HSP 90-beta (HSP 84).           144   1e-33   Rattus norvegicus [brown rat]
gb:MUSHSP84B_2126297 Mouse heat-shock protein hsp84 mRNA.             144   2e-33   
gb:MUSHSP84A_2126296 Mouse 84 kD heat shock protein mRNA, comple...   144   2e-33   
gb:BC007327_1970645 Homo sapiens heat shock 90kDa protein 1, bet...   144   2e-33   
gb:AL139392_1920674 Human DNA sequence from clone RP1-302G2 on c...   144   2e-33   
gb:ATAC009176_1542838 Arabidopsis thaliana chromosome III P1 MLP...   144   2e-33   
gb:AY383484_1429970 Equus caballus heat shock protein 90 (Hsp90)...   144   2e-33   
gb:AF006558_1231332 Drosophila persimilis strain persimi49 82 kD...   144   2e-33   
gb:CR860313_1184395 Pongo pygmaeus mRNA; cDNA DKFZp459I055 (from...   144   2e-33   
pir|T46243|T46243 hypothetical protein DKFZp761K0511.1 - human>g...   144   2e-33   Homo sapiens [man]
pir|A35569|HHMS84 heat shock protein 84 - mouse>gb:AF465639_2066...   144   2e-33   
pir|A29461|HHHU84 heat shock protein 90-beta [validated] - human...   144   2e-33   
sp|P11499|HS9B_MOUSE|HS9B_MOUSE Heat shock protein HSP 90-beta (HSP 84) (Tu...   144   2e-33   Mus musculus [mouse]
sp|P08238|HS9B_HUMAN|HS9B_HUMAN Heat shock protein HSP 90-beta (HSP 84) (HS...   144   2e-33   Homo sapiens [man]
sp|Q9GKX8|HS9B_HORSE|HS9B_HORSE Heat shock protein HSP 90-beta (HSP 84) (Fr...   144   2e-33   Equus caballus [domestic horse]
gb:BC072998_2556913 Xenopus laevis MGC82579 protein, mRNA (cDNA ...   143   3e-33   
gb:AY395632_2531749 Dicentrarchus labrax HSP-90 mRNA, complete cds.   143   3e-33   
gb:MUSHSP86B_2126300 Mouse heat-shock protein hsp86 mRNA.             143   3e-33   
gb:AY335224_1320683 Drosophila saltans heat shock protein 83 (Hs...   143   3e-33   
gb:AF006559_1231333 Drosophila persimilis strain persimi50 82 kD...   143   3e-33   
gb:AK088975_1175732 Mus musculus 2 days neonate thymus thymic ce...   143   3e-33   
gb:AK077095_1171659 Mus musculus adult male testis cDNA, RIKEN f...   143   3e-33   
pir|B32848|HHMS86 heat shock protein 86 - mouse>gb:AK004658_1152...   143   3e-33   
sp|P54651|HS9C_DICDI|HS9C_DICDI Heat shock cognate 90 kDa protein.>gb:DDIHS...   143   3e-33   Dictyostelium discoideum
sp|Q04619|HS9B_CHICK|HS9B_CHICK Heat shock cognate protein HSP 90-beta.>pir...   143   3e-33   Gallus gallus [bantam]
sp|P07901|HS9A_MOUSE|HS9A_MOUSE Heat shock protein HSP 90-alpha (HSP 86) (T...   143   3e-33   Mus musculus [mouse]
gb:CR381646_2570126 Zebrafish DNA sequence from clone DKEY-241L7...   143   3e-33   
gb:BC072489_2106509 Rattus norvegicus heat shock protein 1, alph...   143   3e-33   
gb:HSHSP86_2014260 Human mRNA for heat shock protein hsp86.>gb:H...   143   3e-33   
gb:AF402101_1796245 Achlya ambisexualis isolate JS855 heat shock...   143   3e-33   
gb:AF402100_1796244 Achlya ambisexualis isolate JS854 heat shock...   143   3e-33   
gb:AY094422_1575722 Arabidopsis thaliana At2g04030/F3C11.14 mRNA...   143   3e-33   
gb:AAU39048_1508250 Achlya ambisexualis heat shock protein 90-2 ...   143   3e-33   
gb:AAU39047_1508249 Achlya ambisexualis heat shock protein 90-1 ...   143   3e-33   
gb:AX925932_1483737 Sequence 11 from Patent WO03083117.               143   3e-33   
gb:SSU94395_1445879 Sus scrofa 90-kDa heat shock protein (hsp90)...   143   3e-33   
gb:AB072368_1408899 Bos taurus hsp90alpha mRNA for 90-kDa heat s...   143   3e-33   
gb:AF006544_1231318 Drosophila pseudoobscura bogotana strain bog...   143   3e-33   
gb:CR859986_1184082 Pongo pygmaeus mRNA; cDNA DKFZp459N168 (from...   143   3e-33   
pir|H84453|H84453 probable heat shock protein [imported] - Arabi...   143   3e-33   Arabidopsis thaliana [mouse-ear cress]
pir|A32319|HHHU86 heat shock protein 90-alpha - human>gb:AX92592...   143   3e-33   
sp|O02705|HS9A_PIG|HS9A_PIG Heat shock protein HSP 90-alpha (HSP 86).          143   3e-33   Sus scrofa [pigs]
sp|Q9GKX7|HS9A_HORSE|HS9A_HORSE Heat shock protein HSP 90-alpha (HSP 86) (F...   143   3e-33   Equus caballus [domestic horse]
gb:BC082009_2108246 Rattus norvegicus heat shock 90kDa protein 1...   142   4e-33   
gb:AX925930_1483736 Sequence 9 from Patent WO03083117.                142   4e-33   
gb:AX925926_1483734 Sequence 5 from Patent WO03083117.                142   4e-33   
gb:AX925922_1483732 Sequence 1 from Patent WO03083117.                142   4e-33   
gb:PFHESHPR_1394220 P.falciparum (7) mRNA for heat-shock protein.     142   4e-33   
gb:PFAHSP86B_1393806 Plasmodium falciparum (clone HB3) heat shoc...   142   4e-33   
gb:AF217404_1251969 Schistosoma mansoni endoplasmin mRNA, comple...   142   4e-33   
pir|T20019|T20019 hypothetical protein C47E8.5 - Caenorhabditis ...   142   4e-33   Caenorhabditis elegans [roundworm]
pir|T09091|S49155 heat shock protein 86 - malaria parasite (Plas...   142   4e-33   
sp|O43109|HS90_PODAN|HS90_PODAN Heat shock protein 90 homolog (Suppressor o...   142   4e-33   Podospora anserina
gb:AF521007_1807871 Hevea brasiliensis heat shock protein mRNA, ...   142   6e-33   
gb:AE017353_1760078 Cryptococcus neoformans var. neoformans JEC2...   142   6e-33   
gb:ATHHSP81_1553238 Arabidopsis thaliana HSP81-1 gene for 81kDa ...   142   6e-33   
gb:AB025606_1516301 Arabidopsis thaliana genomic DNA, chromosome...   142   6e-33   
gb:AF287229_1259075 Tetrahymena pyriformis heat shock protein 90...   142   6e-33   
gb:AF006556_1231330 Drosophila persimilis strain persimi47 82 kD...   142   6e-33   
pir|A45508|A45508 heat shock protein 83 - Arabidopsis thaliana>g...   142   6e-33   Arabidopsis thaliana [mouse-ear cress]
sp|P27323|HS81_ARATH|HS81_ARATH Heat shock protein 81-1 (HSP81-1) (Heat sho...   142   6e-33   Arabidopsis thaliana [mouse-ear cress]
gb:CRUHSP90A_2112036 Cricetulus griseus (clone 33A) heat shock p...   142   7e-33   
gb:AX047375_1458061 Sequence 3 from Patent WO0068693.>gb:HSHSP90...   142   7e-33   
gb:DKL17848_1377787 Dendronephthya klunzingeri mRNA for heat sho...   142   7e-33   
gb:AF461150_1273175 Heterodera glycines Hsp90 mRNA, complete cds.     142   7e-33   
sp|P07900|HS9A_HUMAN|HS9A_HUMAN Heat shock protein HSP 90-alpha (HSP 86).        142   7e-33   Homo sapiens [man]
sp|P46633|HS9A_CRIGR|HS9A_CRIGR Heat shock protein HSP 90-alpha (HSP 86).        142   7e-33   Cricetulus griseus [Chinese hamsters]
sp|P11501|HS9A_CHICK|HS9A_CHICK Heat shock protein HSP 90-alpha.>gb:GGHSPAA...   142   7e-33   Gallus gallus [bantam]
sp|O16068|HS83_DROPB|HS83_DROPB Heat shock protein 83 (HSP 82) (Fragment).>...   142   7e-33   Drosophila pseudoobscura bogotana
gb:S77849_1704549 HSP81-3=heat-shock Protein [Arabidopsis thalia...   141   1e-32   
gb:NC9G6_1688865 Neurospora crassa DNA linkage group V Cosmid co...   141   1e-32   
gb:BT001095_1635350 Arabidopsis thaliana clone C104855 (D) putat...   141   1e-32   
gb:BT000717_1634990 Arabidopsis thaliana clone RAFL09-76-I24 (R1...   141   1e-32   
gb:AY070031_1566674 Arabidopsis thaliana putative heat shock pro...   141   1e-32   
gb:AY050349_1562128 Arabidopsis thaliana AT5g56010/MDA7_5 mRNA, ...   141   1e-32   
gb:ATHSP90A_1553400 A.thaliana hsp90A gene.                           141   1e-32   
gb:AB011476_1511387 Arabidopsis thaliana genomic DNA, chromosome...   141   1e-32   
sp|P51818|HS83_ARATH|HS83_ARATH Heat shock protein 81-3 (HSP81-3) (HSP81.2)...   141   1e-32   Arabidopsis thaliana [mouse-ear cress]
sp|P55737|HS82_ARATH|HS82_ARATH Heat shock protein 81-2 (HSP81-2).>gb:AB011...   141   1e-32   Arabidopsis thaliana [mouse-ear cress]
gb:OTU89945_2577497 Oncorhynchus tshawytscha heat shock protein ...   141   1e-32   
gb:CR381646_2570125 Zebrafish DNA sequence from clone DKEY-241L7...   141   1e-32   
gb:BC075757_2558721 Danio rerio heat shock protein 90-alpha, mRN...   141   1e-32   
gb:AY222612_2520292 Astyanax mexicanus heat shock protein 90 alp...   141   1e-32   
gb:AF384808_1794539 Cryptococcus neoformans var. grubii heat-sho...   141   1e-32   
gb:AE016819_1748690 Ashbya gossypii (= Eremothecium gossypii) AT...   141   1e-32   
gb:ATHSP881_1553399 A.thaliana hsp88.1 gene.                          140   2e-32   
gb:ATHSP812_1553397 A.thaliana hsp81.2 gene.                          140   2e-32   
gb:AY362761_1322646 Chlamys farreri heat shock protein 90 mRNA, ...   140   2e-32   
gb:AK088148_1175223 Mus musculus 2 days neonate thymus thymic ce...   140   2e-32   
pir|S65776|S49340 heat-shock protein, 82K, precursor - rye>gb:SC...   140   2e-32   
sp|O61998|HS90_BRUPA|HS90_BRUPA Heat shock protein 90.>gb:BPAJ5785_1355850 ...   140   2e-32   Brugia pahangi
sp|P51819|HS83_PHANI|HS83_PHANI Heat shock protein 83.>gb:PHNHSP83A_1700143...   140   2e-32   Ipomoea nil [qian niu]
sp|P02829|HS82_YEAST|HS82_YEAST Heat shock protein HSP82.>pir|A03313|HHBY90...   140   2e-32   Saccharomyces cerevisiae [brewer's yeast]
gb:AY214170_2519611 Paralichthys olivaceus heat shock protein 90...   140   3e-32   
gb:AF384807_1794538 Cryptococcus bacillisporus heat-shock protei...   140   3e-32   
sp|Q90474|HS9A_BRARE|HS9A_BRARE Heat shock protein HSP 90-alpha.>gb:AF06877...   140   3e-32   Danio rerio [leopard danio]
gb:AY292370_1316663 Toxoplasma gondii HSP90 mRNA, complete cds.>...   139   4e-32   
gb:AF006546_1231320 Drosophila pseudoobscura bogotana strain bog...   139   4e-32   
gb:OSJN00065_1694212 Oryza sativa genomic DNA, chromosome 4, BAC...   139   5e-32   
gb:CR382124_1656903 Kluyveromyces lactis strain NRRL Y-1140 chro...   139   5e-32   
gb:AY368905_1602942 Nicotiana benthamiana molecular chaperone Hs...   139   5e-32   
gb:AY368904_1602941 Nicotiana benthamiana molecular chaperone Hs...   139   5e-32   
gb:YSCHSC82_1729344 S. cerevisiae HSC82 gene encoding hsc82, the...   139   6e-32   
gb:AY368906_1602943 Lycopersicon esculentum molecular chaperone ...   139   6e-32   
gb:BPAJ5784_1355849 Brugia pahangi mRNA for heat shock protein 90.    139   6e-32   
gb:AF151114_1245425 Tetrahymena thermophila strain B2086 hsp82 h...   139   6e-32   
pir|S55133|S55133 heat shock protein HSC82 - yeast (Saccharomyce...   139   6e-32   Saccharomyces cerevisiae [brewer's yeast]
sp|P15108|HS83_YEAST|HS83_YEAST Heat shock cognate protein HSC82.                139   6e-32   Saccharomyces cerevisiae [brewer's yeast]
gb:AX250459_1464827 Sequence 65 from Patent WO0168863.                138   8e-32   
gb:AE014297_1141800 Drosophila melanogaster chromosome 3R, compl...   138   8e-32   
sp|P41887|HS90_SCHPO|HS90_SCHPO Heat shock protein 90 homolog.>pir|T39202|T...   138   8e-32   Schizosaccharomyces pombe
gb:AF421541_1798873 Crypthecodinium cohnii Hsp90 mRNA, complete ...   138   1e-31   
gb:AY325266_1599615 Hordeum vulgare cytosolic heat shock protein...   138   1e-31   
gb:AF006547_1231321 Drosophila pseudoobscura bogotana strain bog...   138   1e-31   
gb:HUMHSP86B_2032210 Human heat shock protein 86 mRNA, 5'end.         137   1e-31   
gb:AP004557_1841527 Oryza sativa (japonica cultivar-group) genom...   137   1e-31   
gb:AY519499_1610933 Nicotiana tabacum heat shock protein 90 (OIN...   137   1e-31   
gb:AY459430_1328241 Eimeria acervulina isolate 12 heat shock pro...   137   1e-31   
gb:AY459429_1328240 Eimeria acervulina clone 62 heat shock prote...   137   1e-31   
gb:AY335220_1320679 Drosophila willistoni heat shock protein 83 ...   137   1e-31   
pir|JQ0129|JQ0129 86K heat shock protein IV - human (fragment)        137   1e-31   Homo sapiens [man]
sp|O44001|HS90_EIMTE|HS90_EIMTE Heat shock protein 90.>gb:AF042329_1235807 ...   137   1e-31   Eimeria tenella
sp|P33126|HS82_ORYSA|HS82_ORYSA Heat shock protein 82.>pir|S25541|S25541 he...   137   1e-31   Oryza sativa [red rice]
gb:AP005392_1850979 Oryza sativa (japonica cultivar-group) genom...   137   2e-31   
gb:AP005392_1850976 Oryza sativa (japonica cultivar-group) genom...   137   2e-31   
gb:TAX98582_1724804 T.aestivum mRNA for HSP80-2 protein.              137   2e-31   
gb:HTOHSP82_1682178 Histoplasma capsulatum heat shock protein 82...   137   2e-31   
gb:CR382129_1661636 Yarrowia lipolytica chromosome C of strain C...   137   2e-31   
gb:AB111810_1527129 Oryza sativa (japonica cultivar-group) Hsp90...   137   2e-31   
gb:AY226087_1310851 Leucosolenia sp. 90-kDa heat-shock protein (...   137   2e-31   
sp|P33125|HS82_AJECA|HS82_AJECA Heat shock protein 82.>pir|S21764|S21764 he...   137   2e-31   Histoplasma capsulatum
sp|P36181|HS80_LYCES|HS80_LYCES Heat shock cognate protein 80.>pir|T07037|T...   137   2e-31   Solanum lycopersicum
gb:CR382136_1669062 Debaryomyces hansenii chromosome D of strain...   137   2e-31   
gb:CR380958_1653091 Candida glabrata strain CBS138 chromosome L ...   137   2e-31   
gb:AY226086_1310850 Clypeatula cooperensis 90-kDa heat-shock pro...   137   2e-31   
gb:AY226081_1310845 Monosiga brevicollis 90-kDa heat-shock prote...   137   2e-31   
gb:AB092407_1198780 Giardia intestinalis gene for cytosolic-type...   137   2e-31   
sp|P46598|HS90_CANAL|HS90_CANAL Heat shock protein 90 homolog.>gb:CAHSP90_1...   137   2e-31   Candida albicans
gb:AY226092_1310856 Mnemiopsis leidyi 90-kDa heat-shock protein ...   136   3e-31   
gb:AY226088_1310852 Scypha sp. AR-2003 90-kDa heat-shock protein...   136   3e-31   
gb:AY335221_1320680 Drosophila nebulosa heat shock protein 83 (H...   136   4e-31   
pir|A48426|A48426 heat shock protein HSP82 - maize                    136   4e-31   Zea mays [maize]
gb:AF006548_1231322 Drosophila pseudoobscura bogotana strain bog...   135   5e-31   
sp|Q08277|HS82_MAIZE|HS82_MAIZE Heat shock protein 82.>gb:S59780_1704330 Ze...   135   7e-31   Zea mays [maize]
gb:AF136649_1244024 Babesia bovis heat shock protein 90 (HSP90) ...   135   9e-31   
pir|S51795|S51795 heat shock protein 90 - fission yeast (Schizos...   135   9e-31   Schizosaccharomyces pombe
gb:AY077617_1567843 Oryza sativa HSP90-like protein mRNA, comple...   134   1e-30   
gb:AY226090_1310854 Nematostella vectensis 90-kDa heat-shock pro...   134   1e-30   
gb:AF143855_1244465 Brachionus calyciflorus 82 kD heat shock pro...   134   2e-30   
gb:CNSLT1IB5_1180704 human full-length cDNA 5-PRIME end of clone...   134   2e-30   
gb:AF212996_1777692 Neurospora crassa heat shock protein 80 gene...   134   2e-30   
gb:TAU55859_1724744 Triticum aestivum heat shock protein 80 mRNA...   134   2e-30   
gb:AY394701_1325186 Adineta ricciae 82kD heat-shock protein gene...   134   2e-30   
gb:AY226089_1310853 Aphrocallistes vastus 90-kDa heat-shock prot...   134   2e-30   
sp|P24724|HS90_THEPA|HS90_THEPA Heat shock protein 90 (HSP90).>gb:THEHSP90_...   134   2e-30   Theileria parva
gb:AF250001_1255682 Adineta vaga 82 kDa heat shock protein 3 (hs...   133   3e-30   
gb:AF250000_1255681 Adineta vaga 82 kDa heat shock protein 2 (hs...   133   3e-30   
gb:AF143856_1244466 Brachionus plicatilis 82 kD heat shock prote...   133   3e-30   
gb:AF249999_1255680 Habrotrocha constricta 82 kDa heat shock pro...   133   3e-30   
gb:AF249998_1255679 Habrotrocha constricta 82 kDa heat shock pro...   133   3e-30   
gb:AF143858_1244468 Eosphora ehrenbergi 82 kD heat shock protein...   133   3e-30   
gb:AF143850_1244460 Habrotrocha constricta 82 kD heat shock prot...   133   3e-30   
gb:AF143849_1244459 Adineta vaga 82 kD heat shock protein 1 (hsp...   133   3e-30   
gb:AF249997_1255678 Philodina roseola 82 kDa heat shock protein ...   132   4e-30   
gb:AF143851_1244461 Philodina roseola 82 kD heat shock protein 1...   132   4e-30   
gb:AF143857_1244467 Seison nebaliae 82 kD heat shock protein (hs...   132   6e-30   
gb:AY394438_2531662 Sphoeroides annulatus Hsp90-like protein gen...   132   8e-30   
gb:AY459446_1328257 Eimeria acervulina clone 12-21 heat shock pr...   132   8e-30   
gb:AY459436_1328247 Eimeria acervulina clone 1133-21 heat shock ...   132   8e-30   
gb:AY459431_1328242 Eimeria acervulina clone 1133-1 heat shock p...   132   8e-30   
gb:AF250002_1255683 Philodina roseola 82 kDa heat shock protein ...   132   8e-30   
gb:AY459449_1328260 Eimeria acervulina clone JJ-12 heat shock pr...   131   1e-29   
gb:AY226085_1310849 Suberites fuscus 90-kDa heat-shock protein (...   130   2e-29   
gb:AY226082_1310846 Proterospongia sp. ATCC 50818 90-kDa heat-sh...   130   2e-29   
gb:AF250004_1255685 Philodina roseola 82 kDa heat shock protein ...   130   2e-29   
gb:AF143854_1244464 Sinantherina socialis 82 kD heat shock prote...   130   2e-29   
gb:AY459440_1328251 Eimeria acervulina clone 12-4 heat shock pro...   130   2e-29   
gb:AY226083_1310847 Halichondria sp. AR-2003 90-kDa heat-shock p...   130   2e-29   
sp|O18750|ENPL_RABIT|ENPL_RABIT Endoplasmin (94 kDa glucose-regulated prote...   130   3e-29   Oryctolagus cuniculus [domestic rabbit]
gb:AY394702_1325187 Lepidodermella sp. DMW-2003 82kD heat-shock ...   129   4e-29   
gb:AB092411_1198784 Entamoeba histolytica gene for cytosolic-typ...   129   4e-29   
gb:AB092409_1198782 Trichomonas vaginalis gene for cytosolic-typ...   129   4e-29   
gb:AF375826_1266698 Oncicola sp. WM-2001 82 kDa heat shock prote...   128   8e-29   
gb:AY226091_1310855 Aurelia aurita 90-kDa heat-shock protein (hs...   128   1e-28   
gb:AF375825_1266697 Oligacanthorhynchus tortuosa 82 kDa heat sho...   128   1e-28   
gb:AY335225_1320684 Drosophila sturtevanti heat shock protein 83...   127   2e-28   
gb:AF143853_1244463 Moniliformis moniliformis 82 kD heat shock p...   127   2e-28   
gb:AY335222_1320681 Drosophila capricorni heat shock protein 83 ...   126   3e-28   
gb:AY122631_1301645 Cryptobia helicis clone 9 heat shock protein...   126   3e-28   
gb:AY391254_1604496 Spumella uniguttata heat shock protein 90 ge...   126   4e-28   
gb:AF500588_1806429 Solanum tuberosum heat shock protein 80 mRNA...   125   5e-28   
gb:AB100500_12864 Selenomonas ruminantium regulator gene for deg...   125   5e-28   
gb:AY122625_1301639 Rhynchomonas nasuta strain CBR1 heat shock p...   125   9e-28   
gb:AX885168_1480621 Sequence 1031 from Patent EP1033401.              124   1e-27   
gb:AY390395_1325012 Blepharisma intermedium heat shock protein 9...   124   1e-27   
gb:AY122630_1301644 Cryptobia helicis clone 3 heat shock protein...   124   1e-27   
gb:AE017340_457600 Idiomarina loihiensis L2TR, complete genome.       124   1e-27   
pir|AH0378|AH0378 heat shock protein HtpG [imported] - Yersinia ...   124   1e-27   
sp|P58482|HTPG_YERPE|HTPG_YERPE Chaperone protein htpG (Heat shock protein ...   124   1e-27   
gb:AY391256_1604498 Lessardia elongata heat shock protein 90 gen...   124   2e-27   
sp|Q8D228|HTPG_WIGBR|HTPG_WIGBR Chaperone protein htpG (Heat shock protein ...   124   2e-27   
gb:BC006864_2090433 Mus musculus TNF receptor-associated protein...   124   2e-27   
gb:BC006685_2090309 Mus musculus TNF receptor-associated protein...   124   2e-27   
gb:AY122624_1301638 Dimastigella trypaniformis strain Ulm heat s...   124   2e-27   
gb:CP000020_870968 Vibrio fischeri ES114 chromosome I, complete ...   124   2e-27   
sp|Q9CQN1|TRAL_MOUSE|TRAL_MOUSE Heat shock protein 75 kDa, mitochondrial pr...   124   2e-27   
sp|P54650|HTPG_VIBFI|HTPG_VIBFI Chaperone protein htpG (Heat shock protein ...   124   2e-27   
gb:AY122623_1301637 Diplonema papillatum strain ATCC 50162 heat ...   123   3e-27   
gb:AY335656_2144874 Synthetic construct Homo sapiens heat shock ...   123   4e-27   
gb:BC083909_2108965 Rattus norvegicus tumor necrosis factor type...   123   4e-27   
gb:BC018950_1976670 Homo sapiens TNF receptor-associated protein...   123   4e-27   
gb:BC001455_1967602 Homo sapiens TNF receptor-associated protein...   123   4e-27   
gb:AF043254_1878542 Homo sapiens heat shock protein 75 (hsp75) m...   123   4e-27   
gb:AC005203_1874874 Homo sapiens chromosome 16, cosmid clone RT7...   123   4e-27   
gb:AY122632_1301646 Bodo saltans strain Konstanz heat shock prot...   123   4e-27   
gb:AY122628_1301642 Trypanoplasma borreli strain Tt-JH heat shoc...   123   4e-27   
gb:AF369892_1266362 Leishmania donovani lipophosphoglycan biosyn...   123   4e-27   
gb:AF253053_1256132 Leishmania infantum glucose-regulated protei...   123   4e-27   
gb:CR860536_1184601 Pongo pygmaeus mRNA; cDNA DKFZp459E187 (from...   123   4e-27   
gb:AY389747_1178354 Hyacinthus orientalis heat shock protein 82 ...   123   4e-27   
gb:BX950851_839926 Erwinia carotovora subsp. atroseptica SCRI104...   123   4e-27   
pir|A55877|A55877 tumor necrosis factor type 1 receptor associat...   123   4e-27   
sp|Q12931|TRAL_HUMAN|TRAL_HUMAN Heat shock protein 75 kDa, mitochondrial pr...   123   4e-27   
sp|P22359|HTPG_VIBCH|HTPG_VIBCH Chaperone protein htpG (Heat shock protein ...   123   4e-27   
sp|Q9ZMM2|HTPG_HELPJ|HTPG_HELPJ Chaperone protein htpG (Heat shock protein ...   123   4e-27   
sp|Q89CK8|HTPG_BRAJA|HTPG_BRAJA Chaperone protein htpG (Heat shock protein ...   123   4e-27   
gb:AY683455_2087656 Rattus norvegicus heat shock protein 86 mRNA...   122   5e-27   
gb:AE017345_1756728 Cryptococcus neoformans var. neoformans JEC2...   122   5e-27   
gb:CR555306_108170 Azoarcus sp. EbN1 complete genome.                 122   5e-27   
pir|B85545|B85545 chaperone Hsp90, heat shock protein C 62.5 [im...   122   5e-27   
sp|Q7M8C4|HTPG_WOLSU|HTPG_WOLSU Chaperone protein htpG (Heat shock protein ...   122   5e-27   
sp|Q83SE6|HTPG_SHIFL|HTPG_SHIFL Chaperone protein htpG (Heat shock protein ...   122   5e-27   
sp|P10413|HTPG_ECOLI|HTPG_ECOLI Chaperone protein htpG (Heat shock protein ...   122   5e-27   
gb:AY391259_1325114 Perkinsus marinus heat shock protein 90 gene...   122   6e-27   
gb:AY122629_1301643 Cryptobia salmositica heat shock protein 90 ...   122   6e-27   
gb:CP000026_77005 Salmonella enterica subsp. enterica serovar Pa...   122   6e-27   
sp|Q87RH5|HTPG_VIBPA|HTPG_VIBPA Chaperone protein htpG (Heat shock protein ...   122   6e-27   
sp|Q8RGH4|HTPG_FUSNN|HTPG_FUSNN Chaperone protein htpG (Heat shock protein ...   122   6e-27   
gb:AE008718_242213 Salmonella typhimurium LT2, section 26 of 220...   122   8e-27   
pir|AB0563|AB0563 heat shock protein HtpG [imported] - Salmonell...   122   8e-27   
sp|P58480|HTPG_SALTY|HTPG_SALTY Chaperone protein htpG (Heat shock protein ...   122   8e-27   
sp|P58479|HTPG_SALTI|HTPG_SALTI Chaperone protein htpG (Heat shock protein ...   122   8e-27   
sp|Q883Y9|HTPG_PSESM|HTPG_PSESM Chaperone protein htpG (Heat shock protein ...   122   8e-27   
gb:AY122627_1301641 Bodo saliens strain ATCC 50358 clone 7 heat ...   121   1e-26   
gb:AY122626_1301640 Bodo saliens strain ATCC 50358 clone 5 heat ...   121   1e-26   
sp|P56116|HTPG_HELPY|HTPG_HELPY Chaperone protein htpG (Heat shock protein ...   121   1e-26   
gb:AJ719428_2501615 Gallus gallus mRNA for hypothetical protein,...   121   1e-26   
gb:AK093344_1913955 Homo sapiens cDNA FLJ36025 fis, clone TESTI2...   121   1e-26   
gb:AE017197_402787 Rickettsia typhi str. Wilmington complete gen...   121   1e-26   
sp|Q9ZCB9|HTPG_RICPR|HTPG_RICPR Chaperone protein htpG (Heat shock protein ...   121   1e-26   
sp|Q97E05|HTPG_CLOAB|HTPG_CLOAB Chaperone protein htpG (Heat shock protein ...   121   1e-26   
gb:AF251005_1780930 Candida tropicalis heat shock protein 90 gen...   120   2e-26   
gb:CP000025_878393 Campylobacter jejuni RM1221, complete genome.      120   2e-26   
gb:AP006627_563293 Bacillus clausii KSM-K16 DNA, complete genome.     120   2e-26   
gb:AE015941_320608 Clostridium tetani E88, section 6 of 10 of th...   120   2e-26   
gb:CR925677_117505 Ehrlichia ruminantium str. Gardel, complete g...   120   2e-26   
gb:CR767821_116594 Ehrlichia ruminantium strain Welgevonden, com...   120   2e-26   
sp|Q88FB9|HTPG_PSEPK|HTPG_PSEPK Chaperone protein htpG (Heat shock protein ...   120   2e-26   
sp|Q9I3C5|HTPG_PSEAE|HTPG_PSEAE Chaperone protein htpG (Heat shock protein ...   120   2e-26   
sp|Q894P6|HTPG_CLOTE|HTPG_CLOTE Chaperone protein htpG (Heat shock protein ...   120   2e-26   
sp|Q9PHZ3|HTPG_CAMJE|HTPG_CAMJE Chaperone protein htpG (Heat shock protein ...   120   2e-26   
sp|Q9KE51|HTPG_BACHD|HTPG_BACHD Chaperone protein htpG (Heat shock protein ...   120   2e-26   
gb:AY713393_1623967 Kryptoperidinium foliaceum isolate KfolHSP90...   120   2e-26   
gb:AY122622_1301636 Rhynchopus sp. ATCC50230 heat shock protein ...   120   2e-26   
gb:AJ749949_530813 Francisella tularensis subsp. tularensis comp...   120   3e-26   
sp|P58478|HTPG_RICCN|HTPG_RICCN Chaperone protein htpG (Heat shock protein ...   120   3e-26   
sp|Q83EL0|HTPG_COXBU|HTPG_COXBU Chaperone protein htpG (Heat shock protein ...   120   3e-26   
sp|Q7WC32|HTPG_BORPA|HTPG_BORPA Chaperone protein htpG (Heat shock protein ...   120   3e-26   
sp|Q7WQ31|HTPG_BORBR|HTPG_BORBR Chaperone protein htpG (Heat shock protein ...   120   3e-26   
gb:CP000009_863039 Gluconobacter oxydans 621H, complete genome.       119   4e-26   
gb:AE017333_450031 Bacillus licheniformis DSM 13, complete genom...   119   4e-26   
sp|Q8Y0Q3|HTPG_RALSO|HTPG_RALSO Chaperone protein htpG (Heat shock protein ...   119   4e-26   
sp|Q7W0M8|HTPG_BORPE|HTPG_BORPE Chaperone protein htpG (Heat shock protein ...   119   4e-26   
gb:CR378666_94411 Photobacterium profundum SS9; segment 4/12.         119   5e-26   
sp|Q8PJK3|HTPG_XANAC|HTPG_XANAC Chaperone protein htpG (Heat shock protein ...   119   5e-26   
sp|Q50667|HTPG_MYCTU|HTPG_MYCTU Chaperone protein htpG (Heat shock protein ...   119   5e-26   
gb:AY122633_1301647 Bodo cf. uncinatus strain ATCC 30904 heat sh...   119   7e-26   
sp|Q87EN0|HTPG_XYLFT|HTPG_XYLFT Chaperone protein htpG (Heat shock protein ...   119   7e-26   
gb:BA000037_721826 Vibrio vulnificus YJ016 DNA, chromosome I, co...   118   9e-26   
gb:AE016914_356279 Chromobacterium violaceum ATCC 12472 section ...   118   9e-26   
sp|Q8P855|HTPG_XANCP|HTPG_XANCP Chaperone protein htpG (Heat shock protein ...   118   9e-26   
sp|Q7MMR7|HTPG_VIBVY|HTPG_VIBVY Chaperone protein htpG (Heat shock protein ...   118   9e-26   
sp|Q8DFM0|HTPG_VIBVU|HTPG_VIBVU Chaperone protein htpG (Heat shock protein ...   118   9e-26   
sp|Q8K981|HTPG_BUCAP|HTPG_BUCAP Chaperone protein htpG (Heat shock protein ...   118   9e-26   
gb:AE017354_459737 Legionella pneumophila subsp. pneumophila str...   118   1e-25   
gb:CR628337_114524 Legionella pneumophila str. Lens complete gen...   118   1e-25   
gb:CR628336_111438 Legionella pneumophila str. Paris complete ge...   118   1e-25   
sp|Q9PEQ0|HTPG_XYLFA|HTPG_XYLFA Chaperone protein htpG (Heat shock protein ...   118   1e-25   
sp|P61188|HTPG_TREDE|HTPG_TREDE Chaperone protein htpG (Heat shock protein ...   118   1e-25   
sp|Q8EFF7|HTPG_SHEON|HTPG_SHEON Chaperone protein htpG (Heat shock protein ...   118   1e-25   
sp|P54649|HTPG_ACTAC|HTPG_ACTAC Chaperone protein htpG (Heat shock protein ...   118   1e-25   
gb:BT001316_1356089 Drosophila melanogaster AT15050 full insert ...   117   1e-25   
gb:AF115775_1242499 Drosophila melanogaster Hsp90-related protei...   117   1e-25   
gb:AE013599_1130243 Drosophila melanogaster chromosome 2R, compl...   117   1e-25   
gb:AE016827_343325 Mannheimia succiniciproducens MBEL55E, comple...   117   1e-25   
sp|Q98JB6|HTPG_RHILO|HTPG_RHILO Chaperone protein htpG (Heat shock protein ...   117   1e-25   
sp|Q7N0P4|HTPG_PHOLL|HTPG_PHOLL Chaperone protein htpG (Heat shock protein ...   117   1e-25   
sp|Q82TV8|HTPG_NITEU|HTPG_NITEU Chaperone protein htpG (Heat shock protein ...   117   1e-25   
gb:AX885167_1480620 Sequence 1030 from Patent EP1033401.              117   2e-25   
sp|P57555|HTPG_BUCAI|HTPG_BUCAI Chaperone protein htpG (Heat shock protein ...   116   3e-25   
sp|P46208|HTPG_BACSU|HTPG_BACSU Chaperone protein htpG (Heat shock protein ...   116   3e-25   
gb:AY713394_1623968 Kryptoperidinium foliaceum isolate Kfolhsp90...   116   4e-25   
gb:AE017321_441773 Wolbachia endosymbiont strain TRS of Brugia m...   116   4e-25   
pir|G64048|G64048 heat shock protein htpG - Haemophilus influenz...   116   4e-25   
sp|P61187|HTPG_RHOPA|HTPG_RHOPA Chaperone protein htpG (Heat shock protein ...   116   4e-25   
sp|P61186|HTPG_MYCPA|HTPG_MYCPA Chaperone protein htpG (Heat shock protein ...   116   4e-25   
gb:AE017282_427641 Methylococcus capsulatus str. Bath, complete ...   115   6e-25   
sp|O83949|HTPG_TREPA|HTPG_TREPA Chaperone protein htpG (Heat shock protein ...   115   6e-25   
sp|Q8XNC2|HTPG_CLOPE|HTPG_CLOPE Chaperone protein htpG (Heat shock protein ...   115   6e-25   
gb:AY188864_1308632 Streblomastix strix clone 1 heat shock prote...   115   7e-25   
sp|Q9CM20|HTPG_PASMU|HTPG_PASMU Chaperone protein htpG (Heat shock protein ...   115   7e-25   
gb:AF009711_1231603 Trypanosoma brucei heat shock protein hsp83 ...   115   1e-24   
sp|P61189|HTPG_WOLPM|HTPG_WOLPM Chaperone protein htpG (Heat shock protein ...   115   1e-24   
sp|O33012|HTPG_MYCLE|HTPG_MYCLE Chaperone protein htpG (Heat shock protein ...   115   1e-24   
sp|Q7NYF6|HTPG_CHRVO|HTPG_CHRVO Chaperone protein htpG (Heat shock protein ...   115   1e-24   
gb:AY826920_1629226 Heterocapsa triquetra clone HTHSP1 heat-shoc...   114   1e-24   
gb:AY288511_1594824 Euglena gracilis heat shock protein 90 mRNA,...   114   1e-24   
gb:AY391258_1604499 Oxyrrhis marina heat shock protein 90 gene, ...   114   2e-24   
gb:AP006618_556506 Nocardia farcinica IFM 10152 DNA, complete ge...   114   2e-24   
sp|P58481|HTPG_STRCO|HTPG_STRCO Chaperone protein htpG (Heat shock protein ...   114   2e-24   
sp|Q8CX68|HTPG_OCEIH|HTPG_OCEIH Chaperone protein htpG (Heat shock protein ...   114   2e-24   
sp|P44516|HTPG_HAEIN|HTPG_HAEIN Chaperone protein htpG (Heat shock protein ...   114   2e-24   
gb:CP000030_83376 Anaplasma marginale str. St. Maries, complete ...   114   2e-24   
gb:CR522870_99121 Desulfotalea psychrophila LSv54 chromosome.         113   3e-24   
gb:AY391261_1604501 Uncultured dinoflagellate BSL-2003 heat shoc...   113   4e-24   
gb:U00036_1401420 Caenorhabditis elegans cosmid R151, complete s...   113   4e-24   
gb:U00036_1401419 Caenorhabditis elegans cosmid R151, complete s...   113   4e-24   
gb:CE75HSP1_1359581 Caenorhabditis elegans heat shock protein 75...   113   4e-24   
gb:AY391262_1325115 Monocystis agilis heat shock protein 90 gene...   113   4e-24   
gb:AF287231_1259077 Paramecium tetraurelia heat shock protein 90...   113   4e-24   
gb:AF287230_1259076 Paramecium tetraurelia heat shock protein 90...   113   4e-24   
gb:CR543861_102371 Acinetobacter sp. ADP1 complete genome.            113   4e-24   
pir|T16767|T16767 hypothetical protein R151.7 - Caenorhabditis e...   113   4e-24   
sp|P58477|HTPG_RHIME|HTPG_RHIME Chaperone protein htpG (Heat shock protein ...   113   4e-24   
gb:AY188865_1308633 Streblomastix strix clone 2 heat shock prote...   112   5e-24   
sp|Q8KE61|HTPG_CHLTE|HTPG_CHLTE Chaperone protein htpG (Heat shock protein ...   112   5e-24   
gb:AY423866_1325504 Cryptosporidium parvum heat shock protein 90...   112   8e-24   
gb:BX571965_790869 Burkholderia pseudomallei strain K96243, chro...   112   8e-24   
sp|P61184|HTPG_BDEBA|HTPG_BDEBA Chaperone protein htpG (Heat shock protein ...   112   8e-24   
gb:AY391257_1325113 Tetrahymena bergeri heat shock protein 90 ge...   111   1e-23   
gb:AE014187_938883 Plasmodium falciparum 3D7 chromosome 14 compl...   111   1e-23   
gb:AY391260_1604500 Prorocentrum micans heat shock protein 90 ge...   110   2e-23   
gb:AC117075_1207802 Dictyostelium discoideum chromosome 2 map 52...   110   2e-23   
pir|G70169|G70169 heat shock protein 90 (htpG) homolog - Lyme di...   110   2e-23   
sp|Q7VFD7|HTPG_HELHP|HTPG_HELHP Chaperone protein htpG (Heat shock protein ...   110   2e-23   
gb:CP000013_869787 Borrelia garinii PBi, complete genome.             110   3e-23   
gb:AY288510_1594823 Euglena gracilis heat shock protein 90 mRNA,...   109   4e-23   
sp|P61185|HTPG_GEOSL|HTPG_GEOSL Chaperone protein htpG (Heat shock protein ...   109   4e-23   
sp|P42555|HTPG_BORBU|HTPG_BORBU Chaperone protein htpG (Heat shock protein ...   109   4e-23   
gb:XLU42697_2583383 Xenopus laevis heat shock protein 90 (Hsp90)...   109   5e-23   
pir|JC2344|JC2344 heat shock protein 90 beta - zebra fish             109   5e-23   
gb:AY391253_1325112 Halteria grandinella heat shock protein 90 g...   108   7e-23   
gb:AY335223_1320682 Drosophila sucinea heat shock protein 83 (Hs...   108   7e-23   
gb:AB061695_1197018 Dictyostelium discoideum Dd-trap1 mRNA for T...   108   7e-23   
gb:AY391255_1604497 Heterocapsa triquetra heat shock protein 90 ...   108   9e-23   
gb:AY122634_1301648 Naegleria gruberi strain ATCC 30224 heat sho...   108   9e-23   
gb:AE013598_296211 Xanthomonas oryzae pv. oryzae KACC10331, comp...   107   3e-22   
gb:ZEFHSP90B_2583846 Danio rerio heat shock protein 90 (hsp90) g...   106   3e-22   
pir|JC2343|JC2343 heat shock protein 90 alpha - zebra fish            106   3e-22   
sp|Q89A93|HTPG_BUCBP|HTPG_BUCBP Chaperone protein htpG (Heat shock protein ...   106   3e-22   
gb:AY462240_1329448 Hexamita inflata heat shock protein 90 (hsp9...   106   5e-22   
gb:AY462239_1329447 Hexamita inflata heat shock protein 90 (hsp9...   105   6e-22   
gb:AY458647_620004 Uncultured bacterium 580 clone EBAC000-36A07 ...   105   6e-22   
gb:AY785159_2546336 Xenopus laevis Hsp90alpha mRNA, partial cds.      104   1e-21   
gb:AE017318_440887 Desulfovibrio vulgaris subsp. vulgaris str. H...   104   1e-21   
gb:ZEFHSP90A_2583845 Danio rerio heat shock protein 90 (hsp90) g...   103   2e-21   
gb:CNS07EG9_1372864 chromosome II of strain GB-M1 of Encephalito...   103   2e-21   
gb:AE014186_938151 Plasmodium falciparum 3D7 chromosome 11 compl...   101   1e-20   
gb:AY188868_1308636 Streblomastix strix clone 5 heat shock prote...    95   1e-18   
gb:VIBTOXRA_210005 Vibrio cholerae transcription regulating tran...    95   1e-18   
pir|A39266|A39266 heat shock protein htpG - Vibrio cholerae (fra...    95   1e-18   
gb:AF051230_1764219 Picea mariana heat shock protein (Sb40) mRNA...    94   2e-18   
gb:AY188867_1308635 Streblomastix strix clone 4 heat shock prote...    94   3e-18   
gb:AY188866_1308634 Streblomastix strix clone 3 heat shock prote...    93   4e-18   
gb:AY236714_1592026 Ochromonas sp. Woods Hole heat shock protein...    93   5e-18   
gb:AY236717_1312154 Thaumatomonas sp. (SA) heat shock protein 90...    92   7e-18   
gb:AY236712_1312153 Corallochytrium limacisporum heat shock prot...    92   7e-18   
gb:AY236713_1592025 Goniomonas sp. ATCC 50108 heat shock protein...    90   3e-17   
gb:D17804_1994606 Homo sapiens DNA for heat shock protein beta, ...    89   7e-17   
gb:AY236711_1312152 Amastigomonas marina heat shock protein 90 (...    89   7e-17   
gb:AF273735_1257702 Heterodera glycines hypothetical esophageal ...    89   1e-16   
gb:AF170295_2478264 Cyprinus carpio heat shock protein 90 alpha ...    87   2e-16   
gb:CQ815194_1453518 Sequence 5 from Patent EP1422238.>gb:AX13400...    86   6e-16   
gb:AY528417_1333143 Meloidogyne hapla heat shock protein 90 gene...    83   4e-15   
gb:AY528416_1333142 Meloidogyne hapla heat shock protein 90 gene...    83   4e-15   
gb:AF201338_1250603 Meloidogyne javanica heat shock protein 90 g...    83   4e-15   
gb:AB010001_1466 Synechococcus sp. gene for HtpG, complete cds.>...    83   4e-15   
gb:AF170296_2478265 Cyprinus carpio stress protein HSP90-beta mR...    83   5e-15   
gb:BC009206_1971830 Homo sapiens heat shock 90kDa protein 1, bet...    83   5e-15   
gb:AL139392_1920675 Human DNA sequence from clone RP1-302G2 on c...    82   9e-15   
gb:BX908798_831091 Parachlamydia-related symbiont UWE25, complet...    80   3e-14   
gb:BA000039_726975 Thermosynechococcus elongatus BP-1 DNA, compl...    80   3e-14   
pir|S76909|S76909 hypothetical protein - Synechocystis sp. (stra...    80   5e-14   
gb:ANSSPB_1819571 Aspergillus niger partial sspB gene for heat s...    79   6e-14   
gb:GGHSP905_2573213 Chicken hsp90 gene for 90 kDa-heat shock pro...    79   8e-14   
pir|AD2096|AD2096 heat shock protein [imported] - Nostoc sp. (st...    77   3e-13   
gb:BC023006_1978063 Homo sapiens heat shock 90kDa protein 1, alp...    77   4e-13   
gb:AF275719_1894340 Homo sapiens isolate Liv chaperone protein H...    77   4e-13   
gb:AE011594_274654 Leptospira interrogans serovar lai str. 56601...    75   9e-13   
gb:BA000045_741889 Gloeobacter violaceus PCC 7421 DNA, complete ...    75   1e-12   
gb:BX569692_776180 Synechococcus sp. WH8102 complete genome; seg...    74   2e-12   
gb:AE016929_360265 Bacteroides thetaiotaomicron VPI-5482, sectio...    74   2e-12   


>sp|P35016|ENPL_CATRO Endoplasmin homolog precursor (GRP94
           homolog).>pir|S39558|S39558 HSP90 homolog - Madagascar
           periwinkle>gb:CTRHSP90A_1674248 Catharanthus roseus heat
           shock protein 90 mRNA, complete cds.
          Length = 817

 Score =  312 bits (800), Expect = 3e-84
 Identities = 164/211 (77%), Positives = 172/211 (81%)
 Frame = +2

Query: 65  MRKWAVPAVXXXXXXXXXXPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV 244
           MRKW VP+V            QGRKIHANAE DSDAPVDPPKVE+KIG VP+GLSTD DV
Sbjct: 1   MRKWTVPSVLFLLCPSLSSSCQGRKIHANAEADSDAPVDPPKVEDKIGAVPNGLSTDSDV 60

Query: 245 AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR 424
           AKREAESMS R LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct: 61  AKREAESMSMRNLRSDAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR 120

Query: 425 FLSLTDKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAF 604
           FL+LTDK+ILGEGDTA                   RGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct: 121 FLALTDKEILGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF 180

Query: 605 VEKMQSSGDLNLIGQFGVGFYSVYLVADYVE 697
           VEKMQ+SGDLNLIGQFGVGFYSVYLV DYVE
Sbjct: 181 VEKMQTSGDLNLIGQFGVGFYSVYLVPDYVE 211



>gb:AC091774_1735041 Oryza sativa chromosome 6 BAC OJ1540_H01
           genomic sequence, complete sequence.>gb:AP003614_1831416
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 6, PAC clone:P0481E08.>gb:AP003769_1833289
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 6, PAC clone:P0541C02.
          Length = 812

 Score =  291 bits (746), Expect = 6e-78
 Identities = 152/212 (71%), Positives = 169/212 (79%), Gaps = 1/212 (0%)
 Frame = +2

Query: 65  MRKWAVP-AVXXXXXXXXXXPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPD 241
           MRKWA+  A+          PD  +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +
Sbjct: 1   MRKWALSSALLLLLLLLTTLPDPAKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSE 60

Query: 242 VAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI 421
           V +REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI
Sbjct: 61  VVQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI 120

Query: 422 RFLSLTDKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSA 601
           RFL+LTDK++LGEGDTA                   RGIGMTKEDL+KNLGTIAKSGTSA
Sbjct: 121 RFLALTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSA 180

Query: 602 FVEKMQSSGDLNLIGQFGVGFYSVYLVADYVE 697
           FVEKMQ+ GDLNLIGQFGVGFYSVYLVADYVE
Sbjct: 181 FVEKMQTGGDLNLIGQFGVGFYSVYLVADYVE 212



>gb:AB064527_1522362 Arabidopsis thaliana SHD gene for SHEPHERD,
           complete cds.
          Length = 823

 Score =  291 bits (746), Expect = 6e-78
 Identities = 156/211 (73%), Positives = 166/211 (78%)
 Frame = +2

Query: 65  MRKWAVPAVXXXXXXXXXXPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV 244
           MRK  + +V          PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV
Sbjct: 1   MRKRTLVSVLFLFSLLFLLPDQGRKLHANAEESSDDVTDPPKVEEKIGG-HGGLSTDSDV 59

Query: 245 AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR 424
             RE+ESMSK+TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct: 60  VHRESESMSKKTLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR 119

Query: 425 FLSLTDKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAF 604
           FL+LTDKD+LGEGDTA                   RGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct: 120 FLALTDKDVLGEGDTAKLEIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF 179

Query: 605 VEKMQSSGDLNLIGQFGVGFYSVYLVADYVE 697
           VEKMQSSGDLNLIGQFGVGFYS YLVADY+E
Sbjct: 180 VEKMQSSGDLNLIGQFGVGFYSAYLVADYIE 210



>pir|T09882|T09882 heat shock protein 90 homolog T22A6.20 -
           Arabidopsis thaliana>gb:AB064528_1522363 Arabidopsis
           thaliana SHD mRNA for SHEPHERD, complete
           cds.>gb:ATCHRIV61_1546302 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 61.>gb:ATT22A6_1555168
           Arabidopsis thaliana DNA chromosome 4, BAC clone T22A6
           (ESSA project).>gb:AY039895_1560409 Arabidopsis thaliana
           AT4g24190/T22A6_20 mRNA, complete
           cds.>gb:BT004527_1637561 Arabidopsis thaliana
           At4g24190/T22A6_20 gene, complete cds.
          Length = 823

 Score =  291 bits (746), Expect = 6e-78
 Identities = 156/211 (73%), Positives = 166/211 (78%)
 Frame = +2

Query: 65  MRKWAVPAVXXXXXXXXXXPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV 244
           MRK  + +V          PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV
Sbjct: 1   MRKRTLVSVLFLFSLLFLLPDQGRKLHANAEESSDDVTDPPKVEEKIGG-HGGLSTDSDV 59

Query: 245 AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR 424
             RE+ESMSK+TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct: 60  VHRESESMSKKTLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR 119

Query: 425 FLSLTDKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAF 604
           FL+LTDKD+LGEGDTA                   RGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct: 120 FLALTDKDVLGEGDTAKLEIQIKLDKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF 179

Query: 605 VEKMQSSGDLNLIGQFGVGFYSVYLVADYVE 697
           VEKMQSSGDLNLIGQFGVGFYS YLVADY+E
Sbjct: 180 VEKMQSSGDLNLIGQFGVGFYSAYLVADYIE 210



>gb:AF544993_1810459 Xerophyta viscosa Grp94 mRNA, complete cds.
          Length = 812

 Score =  289 bits (740), Expect = 3e-77
 Identities = 155/215 (72%), Positives = 167/215 (77%), Gaps = 4/215 (1%)
 Frame = +2

Query: 65  MRKWAVPA--VXXXXXXXXXXPDQGRKIHANAEV--DSDAPVDPPKVEEKIGGVPHGLST 232
           MR W++P   V          PD GRK+HANAE   D+D  VDPPKVEEKI GV  GLST
Sbjct: 1   MRNWSIPPALVLLLLISLSAIPDGGRKLHANAEESRDADELVDPPKVEEKIAGVHGGLST 60

Query: 233 DPDVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAL 412
           D DVAKREAESMS++ LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAL
Sbjct: 61  DADVAKREAESMSRKNLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAL 120

Query: 413 DKIRFLSLTDKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSG 592
           DKIRFLSLTDK++LGEGD                     RGIGMTKEDL+KNLGTIAKSG
Sbjct: 121 DKIRFLSLTDKEVLGEGDNTKLEIMIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSG 180

Query: 593 TSAFVEKMQSSGDLNLIGQFGVGFYSVYLVADYVE 697
           TSAFVEKMQ+ GDLNLIGQFGVGFYSVYLV+DYVE
Sbjct: 181 TSAFVEKMQTGGDLNLIGQFGVGFYSVYLVSDYVE 215



>gb:AB037681_1519150 Oryza sativa HSP90 mRNA for heat shock protein
           90, complete cds.
          Length = 810

 Score =  289 bits (739), Expect = 4e-77
 Identities = 150/211 (71%), Positives = 168/211 (79%)
 Frame = +2

Query: 65  MRKWAVPAVXXXXXXXXXXPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV 244
           MRKWA+ +           PD  +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +V
Sbjct: 1   MRKWALSSALLLLLLTTL-PDPAKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSEV 59

Query: 245 AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR 424
            +REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct: 60  VQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR 119

Query: 425 FLSLTDKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAF 604
           FL+LTDK++LGEGDTA                   RGIGMTKEDL+KNLGTIAKSGTSAF
Sbjct: 120 FLALTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAF 179

Query: 605 VEKMQSSGDLNLIGQFGVGFYSVYLVADYVE 697
           VEK+Q+ GDLNLIGQFGVGFYSVYLVADYVE
Sbjct: 180 VEKVQTGGDLNLIGQFGVGFYSVYLVADYVE 210



>sp|P36183|ENPL_HORVU Endoplasmin homolog precursor (GRP94
           homolog).>pir|S33533|S33533 heat shock protein 90
           homolog precursor - barley>gb:HVGRP94HO_1682375
           H.vulgare mRNA for GRP94 homologue.
          Length = 809

 Score =  284 bits (726), Expect = 1e-75
 Identities = 146/211 (69%), Positives = 163/211 (77%)
 Frame = +2

Query: 65  MRKWAVPAVXXXXXXXXXXPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV 244
           MRKWA+             PD  +K+  NAE  SD   D PKVEEK+G VPHGLSTD +V
Sbjct: 1   MRKWALSCALLLVLLLTTLPDPAKKLQVNAEESSDEVGDFPKVEEKLGAVPHGLSTDSEV 60

Query: 245 AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR 424
            +RE+ES+S++TLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct: 61  VQRESESISRKTLRNSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR 120

Query: 425 FLSLTDKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAF 604
           FL+LTDK+++GEGDTA                   RG+GMTKEDL+KNLGTIAKSGTSAF
Sbjct: 121 FLALTDKEVMGEGDTAKLEIQIKLDKENKILSIRDRGVGMTKEDLIKNLGTIAKSGTSAF 180

Query: 605 VEKMQSSGDLNLIGQFGVGFYSVYLVADYVE 697
           VEKMQ+ GDLNLIGQFGVGFYSVYLVADYVE
Sbjct: 181 VEKMQTGGDLNLIGQFGVGFYSVYLVADYVE 211



>gb:AF510108_2498606 Danio rerio chaperone protein GP96 (GP96) mRNA,
           complete cds.>gb:BC063951_2553653 Danio rerio tumor
           rejection antigen (gp96) 1, mRNA (cDNA clone MGC:77624
           IMAGE:6996698), complete cds.
          Length = 793

 Score =  160 bits (405), Expect = 2e-38
 Identities = 99/196 (50%), Positives = 119/196 (60%), Gaps = 13/196 (6%)
 Frame = +2

Query: 146 ANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEK 301
           A+ + D D  +D   VEE +G    G  TD +V +RE E++          + +R  AEK
Sbjct: 17  ASVKADDDVDIDGT-VEEDLGKSRDGSRTDDEVVQREEEAIQLDGLNTSQLKEIRDKAEK 75

Query: 302 FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAXXX 481
             FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR LSLT++D L   +     
Sbjct: 76  HAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLLSLTNEDALAGNEELTIK 135

Query: 482 XXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-----QSSGDLNLIG 646
                            GIGMTKE+LVKNLGTIAKSGTS F+ KM      S     LIG
Sbjct: 136 IKSDKEKNMLHITDT--GIGMTKEELVKNLGTIAKSGTSEFLNKMTEVQDDSQSTSELIG 193

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS +LVAD V
Sbjct: 194 QFGVGFYSAFLVADKV 209



>gb:AY335768_2144986 Synthetic construct Homo sapiens tumor
           rejection antigen 1gp96 (TRA1) mRNA, partial cds.
          Length = 803

 Score =  159 bits (402), Expect = 4e-38
 Identities = 98/198 (49%), Positives = 121/198 (61%), Gaps = 13/198 (6%)
 Frame = +2

Query: 140 IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA 295
           + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct: 19  VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS 73

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct: 74  EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT 133

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD-----LNL 640
                              G+GMT+E+LVKNLGTIAKSGTS F+ KM  + +       L
Sbjct: 134 VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSEL 191

Query: 641 IGQFGVGFYSVYLVADYV 694
           IGQFGVGFYS +LVAD V
Sbjct: 192 IGQFGVGFYSAFLVADKV 209



>gb:BC081917_2108161 Rattus norvegicus tumor rejection antigen gp96
           (predicted), mRNA (cDNA clone MGC:93881 IMAGE:7112411),
           complete cds.
          Length = 643

 Score =  159 bits (402), Expect = 4e-38
 Identities = 98/198 (49%), Positives = 121/198 (61%), Gaps = 13/198 (6%)
 Frame = +2

Query: 140 IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA 295
           + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct: 19  VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS 73

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct: 74  EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT 133

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD-----LNL 640
                              G+GMT+E+LVKNLGTIAKSGTS F+ KM  + +       L
Sbjct: 134 VKIKCDREKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSEL 191

Query: 641 IGQFGVGFYSVYLVADYV 694
           IGQFGVGFYS +LVAD V
Sbjct: 192 IGQFGVGFYSAFLVADKV 209



>gb:BC010445_2090986 Mus musculus tumor rejection antigen gp96, mRNA
           (cDNA clone MGC:6208 IMAGE:3587178), complete
           cds.>gb:BC011439_2091427 Mus musculus tumor rejection
           antigen gp96, mRNA (cDNA clone MGC:12053 IMAGE:3707817),
           complete cds.
          Length = 802

 Score =  159 bits (402), Expect = 4e-38
 Identities = 98/198 (49%), Positives = 121/198 (61%), Gaps = 13/198 (6%)
 Frame = +2

Query: 140 IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA 295
           + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct: 19  VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS 73

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct: 74  EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT 133

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD-----LNL 640
                              G+GMT+E+LVKNLGTIAKSGTS F+ KM  + +       L
Sbjct: 134 VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSEL 191

Query: 641 IGQFGVGFYSVYLVADYV 694
           IGQFGVGFYS +LVAD V
Sbjct: 192 IGQFGVGFYSAFLVADKV 209



>gb:BC009195_1971820 Homo sapiens tumor rejection antigen (gp96) 1,
           mRNA (cDNA clone IMAGE:3938823), complete cds.
          Length = 315

 Score =  159 bits (402), Expect = 4e-38
 Identities = 98/198 (49%), Positives = 121/198 (61%), Gaps = 13/198 (6%)
 Frame = +2

Query: 140 IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA 295
           + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct: 19  VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS 73

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct: 74  EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT 133

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD-----LNL 640
                              G+GMT+E+LVKNLGTIAKSGTS F+ KM  + +       L
Sbjct: 134 VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSEL 191

Query: 641 IGQFGVGFYSVYLVADYV 694
           IGQFGVGFYS +LVAD V
Sbjct: 192 IGQFGVGFYSAFLVADKV 209



>pir|S51358|S51358 protein kinase ppk98 (EC 2.7.1.-) precursor,
           brain - pig
          Length = 804

 Score =  159 bits (402), Expect = 4e-38
 Identities = 98/198 (49%), Positives = 121/198 (61%), Gaps = 13/198 (6%)
 Frame = +2

Query: 140 IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA 295
           + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct: 19  VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS 73

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct: 74  EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT 133

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD-----LNL 640
                              G+GMT+E+LVKNLGTIAKSGTS F+ KM  + +       L
Sbjct: 134 VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMAEAQEDGQSTSEL 191

Query: 641 IGQFGVGFYSVYLVADYV 694
           IGQFGVGFYS +LVAD V
Sbjct: 192 IGQFGVGFYSAFLVADKV 209



>sp|P08113|ENPL_MOUSE Endoplasmin precursor (Endoplasmic reticulum
           protein 99) (94 kDa glucose-regulated protein) (GRP94)
           (ERP99) (Polymorphic tumor rejection antigen 1) (Tumor
           rejection antigen gp96).>pir|A29317|A29317 endoplasmic
           reticulum protein 99 precursor -
           mouse>gb:MUSERPX_2125777 Mouse ERp99 mRNA encoding an
           endoplasmic reticulum transmembrane protein.
          Length = 802

 Score =  159 bits (402), Expect = 4e-38
 Identities = 98/198 (49%), Positives = 121/198 (61%), Gaps = 13/198 (6%)
 Frame = +2

Query: 140 IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA 295
           + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct: 19  VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS 73

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct: 74  EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT 133

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD-----LNL 640
                              G+GMT+E+LVKNLGTIAKSGTS F+ KM  + +       L
Sbjct: 134 VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSEL 191

Query: 641 IGQFGVGFYSVYLVADYV 694
           IGQFGVGFYS +LVAD V
Sbjct: 192 IGQFGVGFYSAFLVADKV 209



>sp|P14625|ENPL_HUMAN Endoplasmin precursor (94 kDa
           glucose-regulated protein) (GRP94) (gp96 homolog) (Tumor
           rejection antigen 1).>pir|A35954|A35954 endoplasmin
           precursor - human>gb:BC066656_1987115 Homo sapiens tumor
           rejection antigen (gp96) 1, mRNA (cDNA clone MGC:75130
           IMAGE:6165138), complete cds.>gb:HSTRA1_2021210 Homo
           sapiens tra1 mRNA for human homologue of murine tumor
           rejection antigen gp96.
          Length = 803

 Score =  159 bits (402), Expect = 4e-38
 Identities = 98/198 (49%), Positives = 121/198 (61%), Gaps = 13/198 (6%)
 Frame = +2

Query: 140 IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA 295
           + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct: 19  VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS 73

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct: 74  EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT 133

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD-----LNL 640
                              G+GMT+E+LVKNLGTIAKSGTS F+ KM  + +       L
Sbjct: 134 VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSEL 191

Query: 641 IGQFGVGFYSVYLVADYV 694
           IGQFGVGFYS +LVAD V
Sbjct: 192 IGQFGVGFYSAFLVADKV 209



>sp|P41148|ENPL_CANFA Endoplasmin precursor (94 kDa
           glucose-regulated protein) (GRP94).>pir|A53211|A53211
           glucose-regulated protein GRP94 - dog>gb:U01153_1446202
           Canis familiaris GRP94 mRNA, complete cds.
          Length = 804

 Score =  159 bits (402), Expect = 4e-38
 Identities = 98/198 (49%), Positives = 121/198 (61%), Gaps = 13/198 (6%)
 Frame = +2

Query: 140 IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA 295
           + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct: 19  VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS 73

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct: 74  EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT 133

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD-----LNL 640
                              G+GMT+E+LVKNLGTIAKSGTS F+ KM  + +       L
Sbjct: 134 VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSEL 191

Query: 641 IGQFGVGFYSVYLVADYV 694
           IGQFGVGFYS +LVAD V
Sbjct: 192 IGQFGVGFYSAFLVADKV 209



>sp|Q95M18|ENPL_BOVIN Endoplasmin precursor (94 kDa
           glucose-regulated protein) (GRP94).>gb:AB025193_1408017
           Bos taurus mRNA for glucose-regulated protein GRP94
           precursor, complete cds.
          Length = 804

 Score =  159 bits (402), Expect = 4e-38
 Identities = 98/198 (49%), Positives = 121/198 (61%), Gaps = 13/198 (6%)
 Frame = +2

Query: 140 IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA 295
           + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct: 19  VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS 73

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct: 74  EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT 133

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD-----LNL 640
                              G+GMT+E+LVKNLGTIAKSGTS F+ KM  + +       L
Sbjct: 134 VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSEL 191

Query: 641 IGQFGVGFYSVYLVADYV 694
           IGQFGVGFYS +LVAD V
Sbjct: 192 IGQFGVGFYSAFLVADKV 209



>gb:SSPPK_1445525 S.scrofa ppk98 gene.
          Length = 808

 Score =  159 bits (401), Expect = 6e-38
 Identities = 98/198 (49%), Positives = 120/198 (60%), Gaps = 13/198 (6%)
 Frame = +2

Query: 140 IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA 295
           + A  EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct: 19  VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS 73

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct: 74  EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT 133

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD-----LNL 640
                              G+GMT+E+LVKNLGTIAKSGTS F+ KM  + +       L
Sbjct: 134 VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMAEAQEDGQSTSEL 191

Query: 641 IGQFGVGFYSVYLVADYV 694
           IGQFGVGFYS +LVAD V
Sbjct: 192 IGQFGVGFYSAFLVADKV 209



>sp|Q29092|ENPL_PIG Endoplasmin precursor (94 kDa glucose-regulated
           protein) (GRP94) (GP96 homolog) (98 kDa protein kinase)
           (PPK 98) (ppk98).>gb:SSPPK98_1445526 S.scrofa ppk 98
           mRNA.
          Length = 804

 Score =  159 bits (401), Expect = 6e-38
 Identities = 98/198 (49%), Positives = 120/198 (60%), Gaps = 13/198 (6%)
 Frame = +2

Query: 140 IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA 295
           + A  EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct: 19  VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS 73

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct: 74  EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT 133

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD-----LNL 640
                              G+GMT+E+LVKNLGTIAKSGTS F+ KM  + +       L
Sbjct: 134 VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMAEAQEDGQSTSEL 191

Query: 641 IGQFGVGFYSVYLVADYV 694
           IGQFGVGFYS +LVAD V
Sbjct: 192 IGQFGVGFYSAFLVADKV 209



>sp|P08110|ENPL_CHICK Endoplasmin precursor (Heat shock 108 kDa
           protein) (HSP108) (HSP 108) (Transferrin-binding
           protein).>pir|A24461|HHCH08 heat shock protein 108
           precursor - chicken>gb:CHKHSP108_2569125 Chicken heat
           shock protein 108 mRNA, complete cds.
          Length = 795

 Score =  159 bits (401), Expect = 6e-38
 Identities = 98/193 (50%), Positives = 118/193 (61%), Gaps = 13/193 (6%)
 Frame = +2

Query: 155 EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF 310
           EVD DA V     EE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct: 23  EVDVDATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF 77

Query: 311 QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAXXXXXX 490
           QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +        
Sbjct: 78  QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKC 137

Query: 491 XXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-----QSSGDLNLIGQFG 655
                         GIGMTKE+L+KNLGTIAKSGTS F+ KM      S     LIGQFG
Sbjct: 138 DKEKNMLHVTDT--GIGMTKEELIKNLGTIAKSGTSEFLNKMTEMQDDSQSTSELIGQFG 195

Query: 656 VGFYSVYLVADYV 694
           VGFYS +LVAD V
Sbjct: 196 VGFYSAFLVADRV 208



>gb:BC060352_2552833 Xenopus laevis hypothetical protein MGC68448,
           mRNA (cDNA clone MGC:68448 IMAGE:3396928), complete cds.
          Length = 805

 Score =  158 bits (400), Expect = 8e-38
 Identities = 98/198 (49%), Positives = 120/198 (60%), Gaps = 13/198 (6%)
 Frame = +2

Query: 140 IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA 295
           + A  EV+ DA V     E+ IG    G  TD +V  RE E++          + +R  +
Sbjct: 19  VQAEDEVEVDATV-----EDDIGKSREGSRTDDEVVSREEEAIQLDGLNAAQIKEIREKS 73

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct: 74  EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLMSLTDENALAANEELT 133

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD-----LNL 640
                              GIGMTKE+LVKNLGTIAKSGTS F+ K+  + D       L
Sbjct: 134 IKIKCDKEKNMLQITDT--GIGMTKEELVKNLGTIAKSGTSEFLSKLTEAQDDGQSTSEL 191

Query: 641 IGQFGVGFYSVYLVADYV 694
           IGQFGVGFYS +LVAD V
Sbjct: 192 IGQFGVGFYSAFLVADRV 209



>gb:SSGP96GRP_1445399 S.scrofa mRNA for gp96/GRP94.
          Length = 804

 Score =  158 bits (400), Expect = 8e-38
 Identities = 97/198 (48%), Positives = 120/198 (60%), Gaps = 13/198 (6%)
 Frame = +2

Query: 140 IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA 295
           + A  EVD D  V     EE +G    G  TD ++ +RE E++          R LR  +
Sbjct: 19  VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEIVQREEEAIQLDGLNASQIRELREKS 73

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct: 74  EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT 133

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD-----LNL 640
                              G+GMT+E+LVKNLGTIAKSGTS F+ KM  + +       L
Sbjct: 134 VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSEL 191

Query: 641 IGQFGVGFYSVYLVADYV 694
           IGQFGVGFYS +LVAD V
Sbjct: 192 IGQFGVGFYSAFLVADKV 209



>gb:AB040814_1195491 Dictyostelium discoideum Dd-grp94 mRNA for
           glucose-regulated protein 94, complete cds.
          Length = 768

 Score =  158 bits (400), Expect = 8e-38
 Identities = 85/148 (57%), Positives = 108/148 (72%), Gaps = 1/148 (0%)
 Frame = +2

Query: 254 EAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLS 433
           EAE+   + +    EKF FQ EV++LM+IIINSLYS K+IFLRELISNASDALDKIRFL+
Sbjct: 39  EAEA---KLIEEKGEKFTFQTEVNKLMNIIINSLYSKKEIFLRELISNASDALDKIRFLA 95

Query: 434 LTDKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEK 613
           LT+ D+LGEG+ +                   RG+GMTK++LV+NLGTIA+SGT  F++K
Sbjct: 96  LTNADLLGEGEQSNLDIHIKIDKANNVLHITDRGVGMTKDELVRNLGTIAQSGTKEFIKK 155

Query: 614 MQSSGD-LNLIGQFGVGFYSVYLVADYV 694
           +  S +  NLIGQFGVGFYS++LVAD V
Sbjct: 156 VSDSAESSNLIGQFGVGFYSLFLVADSV 183



>gb:AY040226_1934866 Homo sapiens heat shock protein gp96 precursor,
           mRNA, partial cds.
          Length = 782

 Score =  157 bits (398), Expect = 1e-37
 Identities = 99/193 (51%), Positives = 120/193 (62%), Gaps = 15/193 (7%)
 Frame = +2

Query: 161 DSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEFQA 316
           D +  VD   VEE +G    G  TD +V +RE E++          R LR  +EKF FQA
Sbjct: 1   DDEVDVDGT-VEEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEKFAFQA 59

Query: 317 EVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAXXXXXXXX 496
           EV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +          
Sbjct: 60  EVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIKCDK 119

Query: 497 XXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-------QSSGDLNLIGQFG 655
                       G+GMT+E+LVKNLGTIAKSGTS F+ KM       QSS +  LIGQFG
Sbjct: 120 EKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSSSE--LIGQFG 175

Query: 656 VGFYSVYLVADYV 694
           VGFYS +LVAD V
Sbjct: 176 VGFYSAFLVADKV 188



>gb:GGHSP108_2573211 Hen gene for steroid inducible 108K heat shock
           protein.
          Length = 792

 Score =  157 bits (397), Expect = 2e-37
 Identities = 97/193 (50%), Positives = 118/193 (61%), Gaps = 13/193 (6%)
 Frame = +2

Query: 155 EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF 310
           EVD DA V     EE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct: 23  EVDVDATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF 77

Query: 311 QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAXXXXXX 490
           QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +        
Sbjct: 78  QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKC 137

Query: 491 XXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-----QSSGDLNLIGQFG 655
                         GIGMTKE+L+KNLGTIAKSGTS F+ KM      S     LIGQFG
Sbjct: 138 DKEKNMLHVTDT--GIGMTKEELIKNLGTIAKSGTSEFLNKMTEMQDDSQSTSELIGQFG 195

Query: 656 VGFYSVYLVADYV 694
           VGFYS +LVA+ V
Sbjct: 196 VGFYSAFLVAERV 208



>gb:AY187545_2517841 Xenopus laevis heat shock protein gp96 mRNA,
           complete cds.
          Length = 804

 Score =  157 bits (397), Expect = 2e-37
 Identities = 97/198 (48%), Positives = 119/198 (60%), Gaps = 13/198 (6%)
 Frame = +2

Query: 140 IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA 295
           +HA  +V+ DA V     E+ IG    G  TD +V  RE E++          + +R  +
Sbjct: 19  VHAEDDVEVDATV-----EDDIGKSRDGSRTDDEVVSREEEAIQLDGLNAAQIKEIREKS 73

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD   L   +   
Sbjct: 74  EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLMSLTDDQALAANEELT 133

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD-----LNL 640
                              GIGMTKE+LVKNLGTIAKSGTS F+ K+  + +       L
Sbjct: 134 IKIKCDKEKNMLHITDT--GIGMTKEELVKNLGTIAKSGTSEFLSKLTEAQEDGQSTSEL 191

Query: 641 IGQFGVGFYSVYLVADYV 694
           IGQFGVGFYS +LVAD V
Sbjct: 192 IGQFGVGFYSAFLVADRV 209



>pir|I50255|I50255 108K heat shock protein -
           chicken>gb:CHKHSPA_2569126 Chicken 108K heat shock
           protein gene, complete cds.
          Length = 795

 Score =  157 bits (397), Expect = 2e-37
 Identities = 97/193 (50%), Positives = 118/193 (61%), Gaps = 13/193 (6%)
 Frame = +2

Query: 155 EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF 310
           EVD DA V     EE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct: 23  EVDVDATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF 77

Query: 311 QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAXXXXXX 490
           QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +        
Sbjct: 78  QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKC 137

Query: 491 XXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-----QSSGDLNLIGQFG 655
                         GIGMTKE+L+KNLGTIAKSGTS F+ KM      S     LIGQFG
Sbjct: 138 DKEKNMLHVTDT--GIGMTKEELIKNLGTIAKSGTSEFLNKMTEMQDDSQSTSELIGQFG 195

Query: 656 VGFYSVYLVADYV 694
           VGFYS +LVA+ V
Sbjct: 196 VGFYSAFLVAERV 208



>gb:CR860533_1184598 Pongo pygmaeus mRNA; cDNA DKFZp459I057 (from
           clone DKFZp459I057).
          Length = 804

 Score =  155 bits (393), Expect = 5e-37
 Identities = 97/198 (48%), Positives = 120/198 (60%), Gaps = 13/198 (6%)
 Frame = +2

Query: 140 IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA 295
           + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct: 19  VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS 73

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +   
Sbjct: 74  EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELT 133

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD-----LNL 640
                              G+GMT+E+LVKNLGTIAKSGTS F+ KM  + +       L
Sbjct: 134 VKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSEL 191

Query: 641 IGQFGVGFYSVYLVADYV 694
           IGQFGVGF S +LVAD V
Sbjct: 192 IGQFGVGFCSAFLVADKV 209



>gb:AF387865_2491050 Gallus gallus heat shock protein 108 mRNA,
           complete cds.
          Length = 795

 Score =  155 bits (392), Expect = 6e-37
 Identities = 96/193 (49%), Positives = 117/193 (60%), Gaps = 13/193 (6%)
 Frame = +2

Query: 155 EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF 310
           EVD DA V     EE +G    G  TD +V +RE E++          + +R  +E+F F
Sbjct: 23  EVDVDATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSERFAF 77

Query: 311 QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAXXXXXX 490
           QAEV+R+  +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +        
Sbjct: 78  QAEVNRMTKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKC 137

Query: 491 XXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-----QSSGDLNLIGQFG 655
                         GIGMTKE+L+KNLGTIAKSGTS F+ KM      S     LIGQFG
Sbjct: 138 DKEKNMLHVTDT--GIGMTKEELIKNLGTIAKSGTSEFLNKMTEMQDDSQSTSELIGQFG 195

Query: 656 VGFYSVYLVADYV 694
           VGFYS +LVAD V
Sbjct: 196 VGFYSAFLVADRV 208



>pir|JC7352|JC7352 glucose-regulated protein 94 - slime mold
           (Dictyostelium discoideum)
          Length = 768

 Score =  155 bits (392), Expect = 6e-37
 Identities = 84/148 (56%), Positives = 107/148 (72%), Gaps = 1/148 (0%)
 Frame = +2

Query: 254 EAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLS 433
           EAE+   + +    EKF FQ EV++LM+IIINSL S K+IFLRELISNASDALDKIRFL+
Sbjct: 39  EAEA---KLIEEKGEKFTFQTEVNKLMNIIINSLVSKKEIFLRELISNASDALDKIRFLA 95

Query: 434 LTDKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEK 613
           LT+ D+LGEG+ +                   RG+GMTK++LV+NLGTIA+SGT  F++K
Sbjct: 96  LTNADLLGEGEQSNLDIHIKIDKANNVLHITDRGVGMTKDELVRNLGTIAQSGTKEFIKK 155

Query: 614 MQSSGD-LNLIGQFGVGFYSVYLVADYV 694
           +  S +  NLIGQFGVGFYS++LVAD V
Sbjct: 156 VSDSAESSNLIGQFGVGFYSLFLVADSV 183



>gb:AY187546_2517842 Eptatretus stoutii heat shock protein gp96
           mRNA, complete cds.
          Length = 795

 Score =  153 bits (386), Expect = 3e-36
 Identities = 97/186 (52%), Positives = 116/186 (62%), Gaps = 14/186 (7%)
 Frame = +2

Query: 179 DPPKVEEKIGGVPHGLS-TDPDVAKREAESMSK--------RTLRAGAEKFEFQAEVSRL 331
           DP  VE+ IG      S TD +V +RE E++          + LR  A+KF FQAEV+R+
Sbjct: 28  DPSVVEQDIGKSRDASSRTDDEVVEREEEAIQLEGLSPAQVKELRERADKFAFQAEVNRM 87

Query: 332 MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAXXXXXXXXXXXXX 511
           M +IINSLY NK+IFLRELISNASDALDKIR +SLTD+  L   D               
Sbjct: 88  MKLIINSLYKNKEIFLRELISNASDALDKIRLMSLTDETALAATDELTIKIKADQEHNML 147

Query: 512 XXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEK---MQSSGD--LNLIGQFGVGFYSVY 676
                  GIGMT+E+L+KNLGTIAKSGTS F+ K   MQ+ G     LIGQFGVGFYS +
Sbjct: 148 HITDT--GIGMTREELIKNLGTIAKSGTSEFLGKITEMQAEGQSTSELIGQFGVGFYSSF 205

Query: 677 LVADYV 694
           LVAD V
Sbjct: 206 LVADRV 211



>gb:AY187547_1308580 Strongylocentrotus purpuratus heat shock
           protein gp96 mRNA, complete cds.
          Length = 806

 Score =  153 bits (386), Expect = 3e-36
 Identities = 95/179 (53%), Positives = 109/179 (60%), Gaps = 11/179 (6%)
 Frame = +2

Query: 191 VEEKIGGVPHGLSTDPDVAKREAESMS--------KRTLRAGAEKFEFQAEVSRLMDIII 346
           VE+ IG    G  TD +V  RE E++          + LR  AEK  FQAEV+R+M +II
Sbjct: 32  VEDDIGKSRDGSKTDDEVVAREEEAIKLDGLNVSQMKELRDSAEKHVFQAEVNRMMKLII 91

Query: 347 NSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAXXXXXXXXXXXXXXXXXX 526
           NSLY NK+IFLRELISNASDALDKIR  SLTDK  L    T                   
Sbjct: 92  NSLYRNKEIFLRELISNASDALDKIRLTSLTDKAALDA--TEELSIKIKADKDNHMLHIT 149

Query: 527 XRGIGMTKEDLVKNLGTIAKSGTSAFVEK---MQSSGDLNLIGQFGVGFYSVYLVADYV 694
             G+GMTK DL+ NLGTIAKSGTS F EK   M SS   +LIGQFGVGFYS +LVA+ V
Sbjct: 150 DTGVGMTKNDLINNLGTIAKSGTSEFFEKLSDMDSSEATDLIGQFGVGFYSSFLVAERV 208



>gb:AF038559_1235104 Cryptosporidium parvum heat shock protein 90
           (HSP90) gene, complete cds.
          Length = 787

 Score =  151 bits (382), Expect = 9e-36
 Identities = 79/147 (53%), Positives = 99/147 (67%)
 Frame = +2

Query: 254 EAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLS 433
           E  +  +  ++  +E +EFQ EVSRLMDIIINSLYS KD+FLREL+SN++DAL+K RF+S
Sbjct: 73  ELSNDDEAAIQKTSESYEFQTEVSRLMDIIINSLYSQKDVFLRELLSNSADALEKARFIS 132

Query: 434 LTDKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEK 613
           +TD   LGE                        GIGMT+ DLV NLGT+AKSGT+ F+E 
Sbjct: 133 VTDDSFLGEQQELEIRVSFNNDKRTITISDT--GIGMTRHDLVTNLGTVAKSGTANFLES 190

Query: 614 MQSSGDLNLIGQFGVGFYSVYLVADYV 694
           +   GDLNLIGQFGVGFY+ YLV+D V
Sbjct: 191 LAKGGDLNLIGQFGVGFYASYLVSDRV 217



>gb:AF006554_1231328 Drosophila persimilis strain persimi45 82 kDa
           heat shock protein (Hsp82) gene, partial cds.
          Length = 269

 Score =  149 bits (376), Expect = 5e-35
 Identities = 79/134 (58%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSXLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>gb:AF006537_1231311 Drosophila pseudoobscura strain pseudo9 82 kDa
           heat shock protein (Hsp82) gene, partial cds.
          Length = 269

 Score =  149 bits (376), Expect = 5e-35
 Identities = 79/134 (58%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYXSLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>pir|S57415|S57415 Hsp83 protein - Leishmania donovani infantum
          Length = 700

 Score =  149 bits (376), Expect = 5e-35
 Identities = 78/133 (58%), Positives = 95/133 (71%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISNASDA DKIR+ SLTD  +LGE  +  
Sbjct: 3   ETFAFQAEINQLMSLIINTFYSNKEIFLRELISNASDACDKIRYQSLTDPSVLGE--SPR 60

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DLV NLGTIA+SGT AF+E +++ GD+++IGQFG
Sbjct: 61  LCIRVVPDKENKTLTVEDNGIGMTKADLVNNLGTIARSGTKAFMEALEAGGDMSMIGQFG 120

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVAD V
Sbjct: 121 VGFYSAYLVADRV 133



>sp|Q25293|HS83_LEIIN Heat shock protein 83-1 (HSP
           83).>gb:LIHSP83GN_1387527 Leishmania infantum hsp83-1
           gene for heat shock protein 83-1 and hsp83-2 gene for
           heat shock protein 83-2.
          Length = 701

 Score =  149 bits (376), Expect = 5e-35
 Identities = 78/133 (58%), Positives = 95/133 (71%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISNASDA DKIR+ SLTD  +LGE  +  
Sbjct: 3   ETFAFQAEINQLMSLIINTFYSNKEIFLRELISNASDACDKIRYQSLTDPSVLGE--SPR 60

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DLV NLGTIA+SGT AF+E +++ GD+++IGQFG
Sbjct: 61  LCIRVVPDKENKTLTVEDNGIGMTKADLVNNLGTIARSGTKAFMEALEAGGDMSMIGQFG 120

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVAD V
Sbjct: 121 VGFYSAYLVADRV 133



>gb:AY705371_1623725 Chlamydomonas reinhardtii heat shock protein
           90C (HSP90C) mRNA, complete cds.
          Length = 810

 Score =  149 bits (375), Expect = 6e-35
 Identities = 78/136 (57%), Positives = 95/136 (69%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           +G+E F +QAEV RLMD+I+NSLYSN+++FLRELISNASDALDK RFLSLTD  +L   +
Sbjct: 78  SGSETFTYQAEVDRLMDMIVNSLYSNREVFLRELISNASDALDKARFLSLTDPSVLAGRE 137

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGM++E L+ NLGTIA+SGT  F+E M + GD NLIG
Sbjct: 138 ELDIRISADKEKGTLVIEDS--GIGMSREQLLSNLGTIARSGTRKFMEAMAAKGDTNLIG 195

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS +LVAD V
Sbjct: 196 QFGVGFYSAFLVADRV 211



>gb:DMU57467_1380869 Drosophila melanogaster heat shock protein 83
           (Hsp83) gene, partial cds.>gb:DMU57468_1380870
           Drosophila melanogaster heat shock protein 83 (Hsp83)
           gene, partial cds.>gb:DMU57469_1380871 Drosophila
           melanogaster heat shock protein 83 (Hsp83) gene, partial
           cds.>gb:DMU57470_1380872 Drosophila melanogaster heat
           shock protein 83 (Hsp83) gene, partial
           cds.>gb:DMU57471_1380873 Drosophila melanogaster heat
           shock protein 83 (Hsp83) gene, partial
           cds.>gb:DMU57472_1380874 Drosophila melanogaster heat
           shock protein 83 (Hsp83) gene, partial
           cds.>gb:DMU57473_1380875 Drosophila melanogaster heat
           shock protein 83 (Hsp83) gene, partial cds.
          Length = 370

 Score =  149 bits (375), Expect = 6e-35
 Identities = 80/134 (59%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YLVAD V
Sbjct: 123 GVGFYSAYLVADKV 136



>gb:DMU57459_1380861 Drosophila melanogaster heat shock protein 83
           (Hsp83) gene, partial cds.>gb:DMU57460_1380862
           Drosophila melanogaster heat shock protein 83 (Hsp83)
           gene, partial cds.>gb:DMU57461_1380863 Drosophila
           melanogaster heat shock protein 83 (Hsp83) gene, partial
           cds.>gb:DMU57462_1380864 Drosophila melanogaster heat
           shock protein 83 (Hsp83) gene, partial
           cds.>gb:DMU57463_1380865 Drosophila melanogaster heat
           shock protein 83 (Hsp83) gene, partial
           cds.>gb:DMU57464_1380866 Drosophila melanogaster heat
           shock protein 83 (Hsp83) gene, partial
           cds.>gb:DMU57465_1380867 Drosophila melanogaster heat
           shock protein 83 (Hsp83) gene, partial
           cds.>gb:DMU57466_1380868 Drosophila melanogaster heat
           shock protein 83 (Hsp83) gene, partial cds.
          Length = 371

 Score =  149 bits (375), Expect = 6e-35
 Identities = 80/134 (59%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YLVAD V
Sbjct: 123 GVGFYSAYLVADKV 136



>pir|D24827|D24827 heat shock 82K protein - fruit fly (Drosophila
           virilis)  (fragment)
          Length = 374

 Score =  149 bits (375), Expect = 6e-35
 Identities = 80/134 (59%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YLVAD V
Sbjct: 123 GVGFYSAYLVADKV 136



>pir|B24827|B24827 heat shock 82K protein - fruit fly (Drosophila
           simulans)  (fragment)
          Length = 375

 Score =  149 bits (375), Expect = 6e-35
 Identities = 80/134 (59%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YLVAD V
Sbjct: 123 GVGFYSAYLVADKV 136



>sp|P04811|HS83_DROVI Heat shock protein 83 (HSP 82)
           (Fragment).>gb:DVHSP82_1383901 Drosophila virilis gene
           fragment for heat shock protein hsp 82.
          Length = 374

 Score =  149 bits (375), Expect = 6e-35
 Identities = 80/134 (59%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YLVAD V
Sbjct: 123 GVGFYSAYLVADKV 136



>sp|P04810|HS83_DROSI Heat shock protein 83 (HSP 82)
           (Fragment).>gb:DMHS83_1379621 Drosophila melanogaster
           5'end of heat shock gene hsp83.>gb:DSHSP82_1383256
           Drosophila simulans gene fragment for heat shock protein
           hsp 82.
          Length = 375

 Score =  149 bits (375), Expect = 6e-35
 Identities = 80/134 (59%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YLVAD V
Sbjct: 123 GVGFYSAYLVADKV 136



>sp|P02828|HS83_DROME Heat shock protein 83 (HSP
           82).>pir|A24827|HHFF83 heat shock protein 83 - fruit fly
           (Drosophila melanogaster)>gb:AE014296_1134498 Drosophila
           melanogaster chromosome 3L, complete
           sequence.>gb:AE003477_1211797 Drosophila melanogaster
           chromosome 3L, section 11 of 83 of the complete
           sequence.>gb:AY122080_1301442 Drosophila melanogaster
           AT20544 full insert cDNA.>gb:DMHSP82_1379632 Drosophila
           melanogaster gene for heat shock protein hsp
           82.>gb:AX047373_1458060 Sequence 1 from Patent
           WO0068693.
          Length = 717

 Score =  149 bits (375), Expect = 6e-35
 Identities = 80/134 (59%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YLVAD V
Sbjct: 123 GVGFYSAYLVADKV 136



>sp|O02192|HS83_DROAV Heat shock protein 83 (HSP
           82).>gb:DAU75687_1376677 Drosophila auraria heat shock
           protein 83 (hsp83) gene, complete cds.
          Length = 716

 Score =  149 bits (375), Expect = 6e-35
 Identities = 80/134 (59%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YLVAD V
Sbjct: 123 GVGFYSAYLVADKV 136



>gb:AF006561_1231335 Drosophila miranda strain miranda23 82 kDa heat
           shock protein (Hsp82) gene, partial cds.
          Length = 269

 Score =  148 bits (374), Expect = 8e-35
 Identities = 79/134 (58%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>gb:AF006552_1231326 Drosophila persimilis strain persimi43 82 kDa
           heat shock protein (Hsp82) gene, partial cds.
          Length = 269

 Score =  148 bits (374), Expect = 8e-35
 Identities = 79/134 (58%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>gb:AF006551_1231325 Drosophila persimilis strain persimi42 82 kDa
           heat shock protein (Hsp82) gene, partial cds.
          Length = 269

 Score =  148 bits (374), Expect = 8e-35
 Identities = 79/134 (58%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>gb:AF006545_1231319 Drosophila pseudoobscura bogotana strain
           bogota70 82 kDa heat shock protein (Hsp82) gene, partial
           cds.
          Length = 269

 Score =  148 bits (374), Expect = 8e-35
 Identities = 80/134 (59%), Positives = 94/134 (70%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YXKLIPNKTAGTLTVIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>gb:AF006543_1231317 Drosophila pseudoobscura bogotana strain
           bogota63 82 kDa heat shock protein (Hsp82) gene, partial
           cds.
          Length = 269

 Score =  148 bits (374), Expect = 8e-35
 Identities = 79/134 (58%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>gb:AF006542_1231316 Drosophila pseudoobscura bogotana strain
           bogota62 82 kDa heat shock protein (Hsp82) gene, partial
           cds.
          Length = 269

 Score =  148 bits (374), Expect = 8e-35
 Identities = 79/134 (58%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>gb:AF006539_1231313 Drosophila pseudoobscura strain pseudo11 82 kDa
           heat shock protein (Hsp82) gene, partial cds.
          Length = 269

 Score =  148 bits (374), Expect = 8e-35
 Identities = 79/134 (58%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>gb:AF006536_1231310 Drosophila pseudoobscura strain pseudo8 82 kDa
           heat shock protein (Hsp82) gene, partial cds.
          Length = 269

 Score =  148 bits (374), Expect = 8e-35
 Identities = 79/134 (58%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>gb:AF006535_1231309 Drosophila pseudoobscura strain pseudo7 82 kDa
           heat shock protein (Hsp82) gene, partial cds.
          Length = 268

 Score =  148 bits (374), Expect = 8e-35
 Identities = 79/134 (58%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLXSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>gb:AF006534_1231308 Drosophila pseudoobscura strain pseudo6 82 kDa
           heat shock protein (Hsp82) gene, partial cds.
          Length = 269

 Score =  148 bits (374), Expect = 8e-35
 Identities = 79/134 (58%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>gb:AF006532_1231306 Drosophila pseudoobscura strain pseudo4 82 kDa
           heat shock protein (Hsp82) gene, partial cds.
          Length = 269

 Score =  148 bits (374), Expect = 8e-35
 Identities = 79/134 (58%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>pir|C24827|C24827 heat shock 82K protein - fruit fly (Drosophila
           pseudoobscura) (fragment)
          Length = 375

 Score =  148 bits (374), Expect = 8e-35
 Identities = 79/134 (58%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>sp|P04809|HS83_DROPS Heat shock protein 83 (HSP 82)
           (Fragment).>gb:DPHSP82_1381404 Drosophila pseudoobscura
           gene for heat shock protein hsp 82.
          Length = 375

 Score =  148 bits (374), Expect = 8e-35
 Identities = 79/134 (58%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>sp|O16076|HS83_DROPE Heat shock protein 83 (HSP 82)
           (Fragment).>gb:AF006549_1231323 Drosophila persimilis
           strain persimi40 82 kDa heat shock protein (Hsp82) gene,
           partial cds.
          Length = 269

 Score =  148 bits (374), Expect = 8e-35
 Identities = 79/134 (58%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>sp|O16087|HS83_DROMI Heat shock protein 83 (HSP 82)
           (Fragment).>gb:AF006531_1231305 Drosophila pseudoobscura
           strain pseudo3 82 kDa heat shock protein (Hsp82) gene,
           partial cds.>gb:AF006533_1231307 Drosophila
           pseudoobscura strain pseudo5 82 kDa heat shock protein
           (Hsp82) gene, partial cds.>gb:AF006541_1231315
           Drosophila pseudoobscura bogotana strain bogota61 82 kDa
           heat shock protein (Hsp82) gene, partial
           cds.>gb:AF006560_1231334 Drosophila miranda strain
           miranda22 82 kDa heat shock protein (Hsp82) gene,
           partial cds.
          Length = 269

 Score =  148 bits (374), Expect = 8e-35
 Identities = 79/134 (58%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>gb:AF006550_1231324 Drosophila persimilis strain persimi41 82 kDa
           heat shock protein (Hsp82) gene, partial cds.
          Length = 269

 Score =  147 bits (371), Expect = 2e-34
 Identities = 78/134 (58%), Positives = 92/134 (68%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD      G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYXSLTDPSKXDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>gb:AF006562_1231336 Drosophila miranda strain miranda24 82 kDa heat
           shock protein (Hsp82) gene, partial cds.
          Length = 269

 Score =  147 bits (370), Expect = 2e-34
 Identities = 78/134 (58%), Positives = 92/134 (68%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEXLQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+ D V
Sbjct: 123 GVGFYSAYLIXDRV 136



>gb:AF006557_1231331 Drosophila persimilis strain persimi48 82 kDa
           heat shock protein (Hsp82) gene, partial cds.
          Length = 269

 Score =  147 bits (370), Expect = 2e-34
 Identities = 78/134 (58%), Positives = 92/134 (68%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGXEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+ D V
Sbjct: 123 GVGFYSAYLIXDRV 136



>gb:AF006553_1231327 Drosophila persimilis strain persimi44 82 kDa
           heat shock protein (Hsp82) gene, partial cds.
          Length = 269

 Score =  147 bits (370), Expect = 2e-34
 Identities = 78/134 (58%), Positives = 92/134 (68%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISN SDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNXSDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>pir|G90082|G90082 heat shock protein 82 [imported] - Guillardia
           theta nucleomorph>gb:AF165818_1773744 Guillardia theta
           nucleomorph chromosome 1, complete sequence.
          Length = 684

 Score =  147 bits (370), Expect = 2e-34
 Identities = 75/133 (56%), Positives = 96/133 (72%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E ++FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD  +L   +   
Sbjct: 3   ETYQFQAEINQLMSLIINTFYSNKEIFLRELISNASDALDKIRYQSLTDSSVLD--NEPK 60

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK+DL++NLGTIAKSGT +F+E +Q+  D+++IGQFG
Sbjct: 61  LEIRILTDKNNKSLTLIDTGIGMTKDDLIQNLGTIAKSGTKSFMEALQAGADVSMIGQFG 120

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVAD V
Sbjct: 121 VGFYSAYLVADRV 133



>gb:AB095186_1525333 Cyanidioschyzon merolae Hsp90 gene for heat
           shock 90kD protein, partial cds.
          Length = 706

 Score =  146 bits (369), Expect = 3e-34
 Identities = 74/136 (54%), Positives = 97/136 (71%)
 Frame = +2

Query: 290 GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDT 469
           G E +EFQAE+++LM +I+N+LYS++D+ LRELISNASDALDK+R+LSL+DK +L   + 
Sbjct: 6   GQETYEFQAEINQLMSLIVNALYSSRDVALRELISNASDALDKLRYLSLSDKSVLDADEK 65

Query: 470 AXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQ 649
                                GIGMTK DLV NLGTIAKSGT +F+E +Q+  D++LIGQ
Sbjct: 66  MEIYIKADKEAKTLEVRDT--GIGMTKSDLVTNLGTIAKSGTKSFIEALQAGADVSLIGQ 123

Query: 650 FGVGFYSVYLVADYVE 697
           FGVGF S +L+AD VE
Sbjct: 124 FGVGFLSAFLIADVVE 139



>gb:AF006555_1231329 Drosophila persimilis strain persimi46 82 kDa
           heat shock protein (Hsp82) gene, partial cds.
          Length = 269

 Score =  146 bits (368), Expect = 4e-34
 Identities = 78/134 (58%), Positives = 92/134 (68%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+  +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMXXLQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>gb:AB176669_1202138 Antheraea yamamai hsp90 mRNA for heat shock
           protein, complete cds.
          Length = 717

 Score =  146 bits (368), Expect = 4e-34
 Identities = 80/139 (57%), Positives = 94/139 (67%)
 Frame = +2

Query: 278 TLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG 457
           T  A  E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L 
Sbjct: 8   TPSAEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLD 67

Query: 458 EGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLN 637
            G                       GIGMTK DLV NLGTIAKSGT AF+E +Q+  D++
Sbjct: 68  SGKELYIKIIPNKSEGTLTIIDT--GIGMTKADLVNNLGTIAKSGTKAFMEALQAGADIS 125

Query: 638 LIGQFGVGFYSVYLVADYV 694
           +IGQFGVGFYS YLVAD V
Sbjct: 126 MIGQFGVGFYSCYLVADRV 144



>gb:AY423488_1325442 Opistophthalmus carinatus Hsp90 (HSP90) mRNA,
           complete cds.
          Length = 718

 Score =  145 bits (367), Expect = 5e-34
 Identities = 78/134 (58%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L  G   
Sbjct: 13  AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLESGKDL 72

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               G+GMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 73  FIKIIPNKDDRTLTIVDT--GVGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 130

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YLVAD V
Sbjct: 131 GVGFYSAYLVADKV 144



>gb:AF254880_1256306 Spodoptera frugiperda 90-kDa heat shock protein
           HSP83 (hsp83) mRNA, complete cds.
          Length = 717

 Score =  145 bits (367), Expect = 5e-34
 Identities = 79/136 (58%), Positives = 93/136 (68%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A  E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L  G 
Sbjct: 10  AEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGK 69

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IG
Sbjct: 70  ELYIKIIPNKSEGTLTIIDT--GIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIG 127

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVAD V
Sbjct: 128 QFGVGFYSCYLVADRV 143



>gb:AF006530_1231304 Drosophila pseudoobscura strain pseudo2 82 kDa
           heat shock protein (Hsp82) gene, partial cds.
          Length = 269

 Score =  145 bits (367), Expect = 5e-34
 Identities = 78/134 (58%), Positives = 92/134 (68%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GI MTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIXMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>gb:AF006529_1231303 Drosophila pseudoobscura strain pseudo1 82 kDa
           heat shock protein (Hsp82) gene, partial cds.
          Length = 269

 Score =  145 bits (367), Expect = 5e-34
 Identities = 78/134 (58%), Positives = 92/134 (68%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GI MTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIXMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>gb:AE014188_968021 Plasmodium falciparum 3D7 chromosome 12,
           complete sequence.>gb:AE014847_1229413 Plasmodium
           falciparum 3D7 chromosome 12, section 4 of 9 of the
           complete sequence.
          Length = 821

 Score =  145 bits (367), Expect = 5e-34
 Identities = 78/134 (58%), Positives = 97/134 (72%), Gaps = 1/134 (0%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E  ++Q EV+RLMDII+NSLY+ K++FLRELISNA+DAL+KIRFLSL+D+ +LGE     
Sbjct: 73  ESHQYQTEVTRLMDIIVNSLYTQKEVFLRELISNAADALEKIRFLSLSDESVLGE--EKK 130

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKM-QSSGDLNLIGQF 652
                              GIGMTK DL+ NLGTIAKSGTS F+E + +S GD++LIGQF
Sbjct: 131 LEIRISANKEKNILSITDTGIGMTKVDLINNLGTIAKSGTSNFLEAISKSGGDMSLIGQF 190

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS +LVAD V
Sbjct: 191 GVGFYSAFLVADKV 204



>gb:AF135117_2476132 Salmo salar heat shock protein hsp90 beta
           (hsp90 beta) mRNA, complete cds.
          Length = 722

 Score =  145 bits (366), Expect = 7e-34
 Identities = 78/134 (58%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 11  AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPTKLDNGKEL 70

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 71  KIDVIPNVEERTLTLIDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQF 128

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YLVA+ V
Sbjct: 129 GVGFYSAYLVAERV 142



>gb:AF006563_1231337 Drosophila miranda strain miranda25 82 kDa heat
           shock protein (Hsp82) gene, partial cds.
          Length = 269

 Score =  145 bits (366), Expect = 7e-34
 Identities = 77/134 (57%), Positives = 91/134 (67%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD      G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYXSLTDPXKXDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+ D V
Sbjct: 123 GVGFYSAYLIXDRV 136



>gb:AB060275_1196993 Bombyx mori hsp90 mRNA for 90-kDa heat shock
           protein, complete cds.
          Length = 716

 Score =  145 bits (366), Expect = 7e-34
 Identities = 80/139 (57%), Positives = 94/139 (67%)
 Frame = +2

Query: 278 TLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG 457
           T  A  E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L 
Sbjct: 7   TQPAEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLD 66

Query: 458 EGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLN 637
            G                       GIGMTK DLV NLGTIAKSGT AF+E +Q+  D++
Sbjct: 67  SGKELYIKIIPNKNEGTLTIIDT--GIGMTKADLVNNLGTIAKSGTKAFMEALQAGADIS 124

Query: 638 LIGQFGVGFYSVYLVADYV 694
           +IGQFGVGFYS YLVAD V
Sbjct: 125 MIGQFGVGFYSSYLVADRV 143



>gb:AB010709_1193222 Schistosoma japonicum mRNA for heat shock
           protein 90, partial cds.
          Length = 244

 Score =  145 bits (366), Expect = 7e-34
 Identities = 75/134 (55%), Positives = 92/134 (68%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDK R++SLT+  +   GD   
Sbjct: 11  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKARYMSLTNSSVFDTGDDLY 70

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIA SGT AF+E +Q   D+++IGQFG
Sbjct: 71  IKLIPNKEAGTLTVLDT--GIGMTKADLINNLGTIASSGTKAFMEALQVGADISMIGQFG 128

Query: 656 VGFYSVYLVADYVE 697
           VGFYS YLVAD V+
Sbjct: 129 VGFYSAYLVADRVQ 142



>pir|A26125|A26125 heat shock protein 90 homolog - Trypanosoma cruzi
          Length = 704

 Score =  145 bits (366), Expect = 7e-34
 Identities = 75/133 (56%), Positives = 96/133 (72%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDA DKIR+ SLT++ +LG  D + 
Sbjct: 3   ETFAFQAEINQLMSLIINTFYSNKEIFLRELISNSSDACDKIRYQSLTNQAVLG--DESH 60

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK +LV NLGTIA+SGT AF+E +++ GD+++IGQFG
Sbjct: 61  LRIRVVPDKANKTLTVEDTGIGMTKAELVNNLGTIARSGTKAFMEALEAGGDMSMIGQFG 120

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVAD V
Sbjct: 121 VGFYSAYLVADRV 133



>pir|A44983|A44983 heat shock protein 83 - Trypanosoma brucei
          Length = 703

 Score =  145 bits (366), Expect = 7e-34
 Identities = 75/133 (56%), Positives = 95/133 (71%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDA DKIR+ SLT++ +LG  D   
Sbjct: 3   ETFAFQAEINQLMSLIINTFYSNKEIFLRELISNSSDACDKIRYQSLTNQSVLG--DEPH 60

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DLV NLGTIA+SGT +F+E +++ GD+++IGQFG
Sbjct: 61  LRIRVIPDRVNKTLTVEDSGIGMTKADLVNNLGTIARSGTKSFMEALEAGGDMSMIGQFG 120

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVAD V
Sbjct: 121 VGFYSAYLVADRV 133



>sp|P06660|HS85_TRYCR Heat shock like 85 kDa
           protein.>gb:TRBHSC_1400688 T.cruzi tandemly repeated
           gene encoding an 85 kDa antigen with homology to heat
           shock proteins.
          Length = 704

 Score =  145 bits (366), Expect = 7e-34
 Identities = 75/133 (56%), Positives = 96/133 (72%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDA DKIR+ SLT++ +LG  D + 
Sbjct: 3   ETFAFQAEINQLMSLIINTFYSNKEIFLRELISNSSDACDKIRYQSLTNQAVLG--DESH 60

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK +LV NLGTIA+SGT AF+E +++ GD+++IGQFG
Sbjct: 61  LRIRVVPDKANKTLTVEDTGIGMTKAELVNNLGTIARSGTKAFMEALEAGGDMSMIGQFG 120

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVAD V
Sbjct: 121 VGFYSAYLVADRV 133



>sp|P12861|HS83_TRYBB Heat shock protein 83.>pir|S08119|S08119 heat
           shock protein 83 - Trypanosoma brucei
           brucei>gb:TBHSP83_1399089 Trypanosoma brucei HSP83 gene.
          Length = 703

 Score =  145 bits (366), Expect = 7e-34
 Identities = 75/133 (56%), Positives = 95/133 (71%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDA DKIR+ SLT++ +LG  D   
Sbjct: 3   ETFAFQAEINQLMSLIINTFYSNKEIFLRELISNSSDACDKIRYQSLTNQSVLG--DEPH 60

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DLV NLGTIA+SGT +F+E +++ GD+++IGQFG
Sbjct: 61  LRIRVIPDRVNKTLTVEDSGIGMTKADLVNNLGTIARSGTKSFMEALEAGGDMSMIGQFG 120

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVAD V
Sbjct: 121 VGFYSAYLVADRV 133



>gb:BC065359_2553977 Danio rerio heat shock protein 90-beta, mRNA
           (cDNA clone MGC:77433 IMAGE:6970738), complete cds.
          Length = 725

 Score =  145 bits (365), Expect = 9e-34
 Identities = 77/134 (57%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLREL+SNASDALDKIR+ SLTD   L  G   
Sbjct: 11  AETFAFQAEIAQLMSLIINTFYSNKEIFLRELVSNASDALDKIRYESLTDPTKLDSGKDL 70

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 71  KIDIIPNVQERTLTLIDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQF 128

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YLVA+ V
Sbjct: 129 GVGFYSAYLVAEKV 142



>gb:AJ720864_2503051 Gallus gallus mRNA for hypothetical protein,
           clone 28d6.
          Length = 217

 Score =  145 bits (365), Expect = 9e-34
 Identities = 79/147 (53%), Positives = 96/147 (65%)
 Frame = +2

Query: 254 EAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLS 433
           EA     + +    E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ S
Sbjct: 3   EAVQTQDQPMEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYES 62

Query: 434 LTDKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEK 613
           LTD   L  G                       GIGMTK DLV NLGTIAKSGT AF+E 
Sbjct: 63  LTDPSKLDSGKDLKINLIPNKHDRTLTIVDT--GIGMTKADLVNNLGTIAKSGTKAFMEA 120

Query: 614 MQSSGDLNLIGQFGVGFYSVYLVADYV 694
           +Q+  D+++IGQFGVGFYS YLVA+ V
Sbjct: 121 LQAGADISMIGQFGVGFYSAYLVAEKV 147



>gb:AJ719941_2502128 Gallus gallus partial mRNA for hypothetical
           protein, clone 8j21.
          Length = 236

 Score =  145 bits (365), Expect = 9e-34
 Identities = 79/147 (53%), Positives = 96/147 (65%)
 Frame = +2

Query: 254 EAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLS 433
           EA     + +    E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ S
Sbjct: 3   EAVQTQDQPMEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYES 62

Query: 434 LTDKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEK 613
           LTD   L  G                       GIGMTK DLV NLGTIAKSGT AF+E 
Sbjct: 63  LTDPSKLDSGKDLKINLIPNKHDRTLTIVDT--GIGMTKADLVNNLGTIAKSGTKAFMEA 120

Query: 614 MQSSGDLNLIGQFGVGFYSVYLVADYV 694
           +Q+  D+++IGQFGVGFYS YLVA+ V
Sbjct: 121 LQAGADISMIGQFGVGFYSAYLVAEKV 147



>gb:AJ719479_2501666 Gallus gallus partial mRNA for hypothetical
           protein, clone 2l3.
          Length = 242

 Score =  145 bits (365), Expect = 9e-34
 Identities = 79/147 (53%), Positives = 96/147 (65%)
 Frame = +2

Query: 254 EAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLS 433
           EA     + +    E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ S
Sbjct: 3   EAVQTQDQPMEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYES 62

Query: 434 LTDKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEK 613
           LTD   L  G                       GIGMTK DLV NLGTIAKSGT AF+E 
Sbjct: 63  LTDPSKLDSGKDLKINLIPNKHDRTLTIVDT--GIGMTKADLVNNLGTIAKSGTKAFMEA 120

Query: 614 MQSSGDLNLIGQFGVGFYSVYLVADYV 694
           +Q+  D+++IGQFGVGFYS YLVA+ V
Sbjct: 121 LQAGADISMIGQFGVGFYSAYLVAEKV 147



>gb:AF473560_2496878 Coturnix japonica heat shock protein 90 alpha
           mRNA, partial cds.
          Length = 230

 Score =  145 bits (365), Expect = 9e-34
 Identities = 79/147 (53%), Positives = 96/147 (65%)
 Frame = +2

Query: 254 EAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLS 433
           EA     + +    E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ S
Sbjct: 3   EAVQTQDQPMEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYES 62

Query: 434 LTDKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEK 613
           LTD   L  G                       GIGMTK DLV NLGTIAKSGT AF+E 
Sbjct: 63  LTDPSKLDSGKDLKINLIPNKHDRTLTIVDT--GIGMTKADLVNNLGTIAKSGTKAFMEA 120

Query: 614 MQSSGDLNLIGQFGVGFYSVYLVADYV 694
           +Q+  D+++IGQFGVGFYS YLVA+ V
Sbjct: 121 LQAGADISMIGQFGVGFYSAYLVAEKV 147



>gb:AF068772_2471523 Danio rerio heat shock protein hsp90beta mRNA,
           complete cds.
          Length = 724

 Score =  145 bits (365), Expect = 9e-34
 Identities = 77/134 (57%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLREL+SNASDALDKIR+ SLTD   L  G   
Sbjct: 11  AETFAFQAEIAQLMSLIINTFYSNKEIFLRELVSNASDALDKIRYESLTDPTKLDSGKDL 70

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 71  KIDIIPNVQERTLTLIDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQF 128

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YLVA+ V
Sbjct: 129 GVGFYSAYLVAEKV 142



>gb:MSQHSP82G_1390181 Anopheles albimanus heat shock protein gene
           (hsp82) genes, complete cds.>gb:MSQHSP82G_1390182
           Anopheles albimanus heat shock protein gene (hsp82)
           genes, complete cds.
          Length = 721

 Score =  145 bits (365), Expect = 9e-34
 Identities = 78/133 (58%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L  G    
Sbjct: 8   ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPTKLDSGKELF 67

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 68  IKIIPNKEAGTLTLIDT--GIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFG 125

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVAD V
Sbjct: 126 VGFYSAYLVADKV 138



>pir|A32298|HHCH90 heat shock protein 90 - chicken
          Length = 728

 Score =  145 bits (365), Expect = 9e-34
 Identities = 79/147 (53%), Positives = 96/147 (65%)
 Frame = +2

Query: 254 EAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLS 433
           EA     + +    E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ S
Sbjct: 3   EAVQTQDQPMEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYES 62

Query: 434 LTDKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEK 613
           LTD   L  G                       GIGMTK DLV NLGTIAKSGT AF+E 
Sbjct: 63  LTDPSKLDSGKDLKINLIPNKHDRTLTIVDT--GIGMTKADLVNNLGTIAKSGTKAFMEA 120

Query: 614 MQSSGDLNLIGQFGVGFYSVYLVADYV 694
           +Q+  D+++IGQFGVGFYS YLVA+ V
Sbjct: 121 LQAGADISMIGQFGVGFYSAYLVAEKV 147



>sp|O57521|HS9B_BRARE Heat shock protein HSP
           90-beta.>gb:AF042108_2470344 Danio rerio heat shock
           protein 90-beta (hsp90beta) mRNA, complete cds.
          Length = 725

 Score =  145 bits (365), Expect = 9e-34
 Identities = 77/134 (57%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLREL+SNASDALDKIR+ SLTD   L  G   
Sbjct: 11  AETFAFQAEIAQLMSLIINTFYSNKEIFLRELVSNASDALDKIRYESLTDPTKLDSGKDL 70

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 71  KIDIIPNVQERTLTLIDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQF 128

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YLVA+ V
Sbjct: 129 GVGFYSAYLVAEKV 142



>sp|P27741|HS83_LEIAM Heat shock protein 83 (HSP
           83).>pir|A44943|A44943 heat shock protein 83 -
           Leishmania mexicana amazonensis>gb:LEIHSP01_1387392
           Leishmania amazonensis heat shock protein 83 gene,
           complete cds.
          Length = 701

 Score =  145 bits (365), Expect = 9e-34
 Identities = 75/133 (56%), Positives = 93/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLR++ISNASDA DKIR+ SLTD  +LG  D   
Sbjct: 3   ETFAFQAEINQLMSLIINTFYSNKEIFLRDVISNASDACDKIRYQSLTDPSVLG--DATR 60

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DLV NLGTIA+SGT AF+E +++  D+++IGQFG
Sbjct: 61  LCVRVVPDKENKTLTVEDNGIGMTKADLVNNLGTIARSGTKAFMEALEAGADMSMIGQFG 120

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVAD V
Sbjct: 121 VGFYSAYLVADRV 133



>gb:AY528900_1333156 Chiromantes haematocheir hsp-90 mRNA, complete
           cds.
          Length = 717

 Score =  144 bits (364), Expect = 1e-33
 Identities = 78/143 (54%), Positives = 94/143 (65%)
 Frame = +2

Query: 266 MSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK 445
           M +       E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD 
Sbjct: 1   MPEEATMEDVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDP 60

Query: 446 DILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSS 625
             L  G                       G+GMTK DLV NLGTIAKSGT AF+E +Q+ 
Sbjct: 61  SKLESGKELFIKLVPNKNDRTLTIIDS--GVGMTKADLVNNLGTIAKSGTKAFMEALQAG 118

Query: 626 GDLNLIGQFGVGFYSVYLVADYV 694
            D+++IGQFGVGFYS YLVAD V
Sbjct: 119 ADISMIGQFGVGFYSAYLVADKV 141



>gb:AF006538_1231312 Drosophila pseudoobscura strain pseudo10 82 kDa
           heat shock protein (Hsp82) gene, partial cds.
          Length = 269

 Score =  144 bits (364), Expect = 1e-33
 Identities = 77/134 (57%), Positives = 91/134 (67%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++ M +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD      G   
Sbjct: 5   AETFAFQAEIAQXMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKXDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>pir|T24521|T24521 hypothetical protein T05E11.3 - Caenorhabditis
           elegans>gb:CET05E11_1367247 Caenorhabditis elegans
           cosmid T05E11, complete sequence.
          Length = 760

 Score =  144 bits (364), Expect = 1e-33
 Identities = 85/160 (53%), Positives = 106/160 (66%), Gaps = 6/160 (3%)
 Frame = +2

Query: 233 DPDVAKREAESMSK-RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDA 409
           + D  K +  S+S+ + LR+ AEK EFQAEV+R+M +IINSLY NK+IFLRELISNASDA
Sbjct: 40  EEDSIKLDGLSVSQIKELRSKAEKHEFQAEVNRMMKLIINSLYRNKEIFLRELISNASDA 99

Query: 410 LDKIRFLSLTDKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKS 589
           LDKIR LSLTD + L E  T                     G+GMT++DL+ NLGTIA+S
Sbjct: 100 LDKIRLLSLTDPEQLRE--TEEMSVKIKADRENRLLHITDTGVGMTRQDLINNLGTIARS 157

Query: 590 GTSAFVEKM-----QSSGDLNLIGQFGVGFYSVYLVADYV 694
           GTS F+ K+      S    +LIGQFGVGFY+ +LVAD V
Sbjct: 158 GTSEFLSKLMDTATSSDQQQDLIGQFGVGFYAAFLVADRV 197



>gb:AY785160_2546337 Xenopus laevis Hsp90beta mRNA, complete
           cds.>gb:BC077195_2559913 Xenopus laevis heat shock 90kDa
           protein 1, alpha-like 3, mRNA (cDNA clone MGC:78910
           IMAGE:4175543), complete cds.
          Length = 722

 Score =  144 bits (363), Expect = 1e-33
 Identities = 77/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G    
Sbjct: 13  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKDLK 72

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 73  IDIIPNRLERTLTMIDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 130

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 131 VGFYSAYLVAEKV 143



>gb:S45392_2138468 heat shock protein 90 [rats, brain, mRNA, 2524
           nt].
          Length = 724

 Score =  144 bits (363), Expect = 1e-33
 Identities = 77/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G    
Sbjct: 13  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELK 72

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 73  IDIIPNPQEATLTLVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 130

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 131 VGFYSAYLVAEKV 143



>gb:AB072369_1408900 Bos taurus hsp90beta mRNA for 90-kDa heat shock
           protein beta, complete cds.
          Length = 724

 Score =  144 bits (363), Expect = 1e-33
 Identities = 78/133 (58%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G    
Sbjct: 13  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELK 72

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 73  IDIIPNPQERTLTLVDT--GIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFG 130

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 131 VGFYSAYLVAEKV 143



>sp|P34058|HS9B_RAT Heat shock protein HSP 90-beta (HSP 84).
          Length = 723

 Score =  144 bits (363), Expect = 1e-33
 Identities = 77/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G    
Sbjct: 12  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELK 71

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 72  IDIIPNPQEATLTLVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 129

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 130 VGFYSAYLVAEKV 142



>gb:MUSHSP84B_2126297 Mouse heat-shock protein hsp84 mRNA.
          Length = 724

 Score =  144 bits (362), Expect = 2e-33
 Identities = 77/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G    
Sbjct: 13  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELK 72

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 73  IDIIPNPQERTLTLVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 130

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 131 VGFYSAYLVAEKV 143



>gb:MUSHSP84A_2126296 Mouse 84 kD heat shock protein mRNA, complete
           cds.
          Length = 724

 Score =  144 bits (362), Expect = 2e-33
 Identities = 77/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G    
Sbjct: 13  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELK 72

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 73  IDILPNPQERTLTLVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 130

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 131 VGFYSAYLVAEKV 143



>gb:BC007327_1970645 Homo sapiens heat shock 90kDa protein 1, beta,
           mRNA (cDNA clone IMAGE:3641489), partial cds.
          Length = 351

 Score =  144 bits (362), Expect = 2e-33
 Identities = 77/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G    
Sbjct: 13  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELK 72

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 73  IDIIPNPQERTLTLVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 130

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 131 VGFYSAYLVAEKV 143



>gb:AL139392_1920674 Human DNA sequence from clone RP1-302G2 on
           chromosome 6p11.2-21.1 Contains the SLC29A1 gene for
           equilibrative nucleoside transporter 1, the HSPCB gene
           for heat-shock 90 kDa protein 1 beta, a novel gene
           similar to D. melanogaster slalom (sll), the NFKBIE gene
           for nuclear factor of kappa light polypeptide gene
           enhancer in B-cells inhibitor epsilon, a novel gene
           similar to C. elegans ZK1067.4 and seven CpG islands,
           complete sequence.>gb:AY359878_1948016 Homo sapiens heat
           shock 90kDa protein 1 beta (HSPCB) mRNA, complete
           cds.>gb:BC004928_1969450 Homo sapiens heat shock 90kDa
           protein 1, beta, mRNA (cDNA clone MGC:10493
           IMAGE:3621040), complete cds.>gb:BC012807_1973778 Homo
           sapiens heat shock 90kDa protein 1, beta, mRNA (cDNA
           clone MGC:3483 IMAGE:3530042), complete
           cds.>gb:BC014485_1974641 Homo sapiens heat shock 90kDa
           protein 1, beta, mRNA (cDNA clone MGC:23206
           IMAGE:4870198), complete cds.>gb:BC016753_1975700 Homo
           sapiens heat shock 90kDa protein 1, beta, mRNA (cDNA
           clone MGC:1138 IMAGE:2987963), complete
           cds.>gb:BC068474_1987631 Homo sapiens heat shock 90kDa
           protein 1, beta, mRNA (cDNA clone MGC:87106
           IMAGE:4824686), complete cds.>gb:HUMHSP90B_2032213 Human
           90 kD heat shock protein gene, complete cds.
          Length = 724

 Score =  144 bits (362), Expect = 2e-33
 Identities = 77/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G    
Sbjct: 13  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELK 72

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 73  IDIIPNPQERTLTLVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 130

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 131 VGFYSAYLVAEKV 143



>gb:ATAC009176_1542838 Arabidopsis thaliana chromosome III P1 MLP3
           genomic sequence, complete
           sequence.>gb:ATAC013483_1543539 Arabidopsis thaliana
           chromosome III BAC F17A17 genomic sequence, complete
           sequence.
          Length = 803

 Score =  144 bits (362), Expect = 2e-33
 Identities = 78/138 (56%), Positives = 99/138 (71%), Gaps = 4/138 (2%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AEKFE+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+R+LS+T+ ++    D  
Sbjct: 94  AEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSVTNPEL--SKDAP 151

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSS----GDLNL 640
                               GIGMT+++LV  LGTIA+SGT+ F++ ++ S    GD NL
Sbjct: 152 DLDIRIYADKENGIITLTDSGIGMTRQELVDCLGTIAQSGTAKFMKALKDSKDAGGDNNL 211

Query: 641 IGQFGVGFYSVYLVADYV 694
           IGQFGVGFYS +LVAD V
Sbjct: 212 IGQFGVGFYSAFLVADRV 229



>gb:AY383484_1429970 Equus caballus heat shock protein 90 (Hsp90)
           mRNA, complete cds.
          Length = 724

 Score =  144 bits (362), Expect = 2e-33
 Identities = 77/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G    
Sbjct: 13  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELK 72

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 73  IDIIPNPQERTLTLVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 130

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 131 VGFYSAYLVAEKV 143



>gb:AF006558_1231332 Drosophila persimilis strain persimi49 82 kDa
           heat shock protein (Hsp82) gene, partial cds.
          Length = 269

 Score =  144 bits (362), Expect = 2e-33
 Identities = 78/135 (57%), Positives = 93/135 (68%), Gaps = 1/135 (0%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD     + D  
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPS---KXDXX 61

Query: 473 XXXXXXXX-XXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQ 649
                                GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQ
Sbjct: 62  KELYIKLIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQ 121

Query: 650 FGVGFYSVYLVADYV 694
           FGVGFYS YL+AD V
Sbjct: 122 FGVGFYSAYLIADRV 136



>gb:CR860313_1184395 Pongo pygmaeus mRNA; cDNA DKFZp459I055 (from
           clone DKFZp459I055).
          Length = 724

 Score =  144 bits (362), Expect = 2e-33
 Identities = 77/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G    
Sbjct: 13  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELK 72

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 73  IDIIPNPQERTLTLVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 130

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 131 VGFYSAYLVAEKV 143



>pir|T46243|T46243 hypothetical protein DKFZp761K0511.1 -
           human>gb:HSM801517_2017330 Homo sapiens mRNA; cDNA
           DKFZp761K0511 (from clone DKFZp761K0511); partial cds.
          Length = 737

 Score =  144 bits (362), Expect = 2e-33
 Identities = 77/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G    
Sbjct: 13  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELK 72

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 73  IDIIPNPQERTLTLVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 130

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 131 VGFYSAYLVAEKV 143



>pir|A35569|HHMS84 heat shock protein 84 - mouse>gb:AF465639_2066610
           Mus musculus strain C57BL/6 heat shock protein 84b
           (Hsp84b) mRNA, complete cds.>gb:AY695392_2087998 Rattus
           norvegicus strain BN/NHsdMcwi heat shock protein 90
           (Hsp90) mRNA, complete cds.>gb:AY695393_2087999 Rattus
           norvegicus strain SS/JrHsdMcwi heat shock protein 90
           (Hsp90) mRNA, complete cds.>gb:BC088985_2110651 Mus
           musculus heat shock protein 1, beta, mRNA (cDNA clone
           MGC:115780 IMAGE:6808699), complete
           cds.>gb:BC087184_2565041 Xenopus laevis hypothetical
           LOC495860, mRNA (cDNA clone MGC:98019 IMAGE:7198812),
           complete cds.
          Length = 724

 Score =  144 bits (362), Expect = 2e-33
 Identities = 77/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G    
Sbjct: 13  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELK 72

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 73  IDIIPNPQERTLTLVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 130

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 131 VGFYSAYLVAEKV 143



>pir|A29461|HHHU84 heat shock protein 90-beta [validated] -
           human>gb:AX047377_1458062 Sequence 5 from Patent
           WO0068693.>gb:HUMHSP90_2032212 Human 90-kDa heat-shock
           protein gene, cDNA, complete cds.
          Length = 724

 Score =  144 bits (362), Expect = 2e-33
 Identities = 77/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G    
Sbjct: 13  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELK 72

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 73  IDIIPNPQERTLTLVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 130

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 131 VGFYSAYLVAEKV 143



>sp|P11499|HS9B_MOUSE Heat shock protein HSP 90-beta (HSP 84) (Tumor
           specific transplantation 84 kDa antigen) (TSTA).
          Length = 723

 Score =  144 bits (362), Expect = 2e-33
 Identities = 77/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G    
Sbjct: 12  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELK 71

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 72  IDILPNPQERTLTLVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 129

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 130 VGFYSAYLVAEKV 142



>sp|P08238|HS9B_HUMAN Heat shock protein HSP 90-beta (HSP 84) (HSP
           90).
          Length = 723

 Score =  144 bits (362), Expect = 2e-33
 Identities = 77/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G    
Sbjct: 12  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELK 71

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 72  IDIIPNPQERTLTLVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 129

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 130 VGFYSAYLVAEKV 142



>sp|Q9GKX8|HS9B_HORSE Heat shock protein HSP 90-beta (HSP 84)
           (Fragment).>gb:AB043676_1408390 Equus caballus Hsp90beta
           mRNA for heat shock protein 90 beta, partial cds.
          Length = 713

 Score =  144 bits (362), Expect = 2e-33
 Identities = 77/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G    
Sbjct: 5   ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELK 64

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 65  IDIIPNPQERTLTLVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 122

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 123 VGFYSAYLVAEKV 135



>gb:BC072998_2556913 Xenopus laevis MGC82579 protein, mRNA (cDNA
           clone MGC:82579 IMAGE:4970292), complete cds.
          Length = 729

 Score =  143 bits (361), Expect = 3e-33
 Identities = 76/141 (53%), Positives = 95/141 (67%)
 Frame = +2

Query: 272 KRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDI 451
           ++ +    E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   
Sbjct: 11  EQQMEEDVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSK 70

Query: 452 LGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD 631
           L  G                       GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D
Sbjct: 71  LDSGKELKIELIPNKQDRSLTIIDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGAD 128

Query: 632 LNLIGQFGVGFYSVYLVADYV 694
           +++IGQFGVGFYS YLVA+ V
Sbjct: 129 ISMIGQFGVGFYSAYLVAEKV 149



>gb:AY395632_2531749 Dicentrarchus labrax HSP-90 mRNA, complete cds.
          Length = 725

 Score =  143 bits (361), Expect = 3e-33
 Identities = 76/134 (56%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLT+   +  G   
Sbjct: 11  AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTEPTKMDSGKEL 70

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 71  KIDIIPNKADRTLTLIDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQF 128

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YLVA+ V
Sbjct: 129 GVGFYSAYLVAEKV 142



>gb:MUSHSP86B_2126300 Mouse heat-shock protein hsp86 mRNA.
          Length = 347

 Score =  143 bits (361), Expect = 3e-33
 Identities = 76/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L  G    
Sbjct: 13  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELH 72

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 73  INLIPSKQDRTLTIVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 130

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 131 VGFYSAYLVAEKV 143



>gb:AY335224_1320683 Drosophila saltans heat shock protein 83
           (Hsp83) gene, partial cds.
          Length = 355

 Score =  143 bits (361), Expect = 3e-33
 Identities = 77/129 (59%), Positives = 90/129 (69%)
 Frame = +2

Query: 308 FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAXXXXX 487
           FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G        
Sbjct: 2   FQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDSTKLESGKELYIKLI 61

Query: 488 XXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFY 667
                          GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQFGVGFY
Sbjct: 62  PNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFY 119

Query: 668 SVYLVADYV 694
           S YLVAD V
Sbjct: 120 SAYLVADKV 128



>gb:AF006559_1231333 Drosophila persimilis strain persimi50 82 kDa
           heat shock protein (Hsp82) gene, partial cds.
          Length = 269

 Score =  143 bits (361), Expect = 3e-33
 Identities = 77/134 (57%), Positives = 91/134 (67%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L      
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSXXXL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GI MTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIXMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>gb:AK088975_1175732 Mus musculus 2 days neonate thymus thymic cells
           cDNA, RIKEN full-length enriched library,
           clone:E430034E15 product:heat shock protein, 86 kDa 1,
           full insert sequence.
          Length = 274

 Score =  143 bits (361), Expect = 3e-33
 Identities = 76/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L  G    
Sbjct: 18  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELH 77

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 78  INLIPSKQDRTLTIVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 135

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 136 VGFYSAYLVAEKV 148



>gb:AK077095_1171659 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4933404E03
           product:heat shock protein, 86 kDa 1, full insert
           sequence.
          Length = 557

 Score =  143 bits (361), Expect = 3e-33
 Identities = 76/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L  G    
Sbjct: 18  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELH 77

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 78  INLIPSKQDRTLTIVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 135

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 136 VGFYSAYLVAEKV 148



>pir|B32848|HHMS86 heat shock protein 86 - mouse>gb:AK004658_1152488
           Mus musculus adult male lung cDNA, RIKEN full-length
           enriched library, clone:1200009A10 product:heat shock
           protein, 86 kDa 1, full insert
           sequence.>gb:BC046614_2099315 Mus musculus heat shock
           protein 1, alpha, mRNA (cDNA clone MGC:54660
           IMAGE:6491307), complete cds.>gb:BC049124_2099938 Mus
           musculus heat shock protein 1, alpha, mRNA (cDNA clone
           MGC:61211 IMAGE:6816250), complete
           cds.>gb:MUSHSP86A_2126299 Mouse heat shock protein 86
           mRNA, complete cds, and 28S ribosomal RNA, partial
           sequence.
          Length = 733

 Score =  143 bits (361), Expect = 3e-33
 Identities = 76/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L  G    
Sbjct: 18  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELH 77

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 78  INLIPSKQDRTLTIVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 135

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 136 VGFYSAYLVAEKV 148



>sp|P54651|HS9C_DICDI Heat shock cognate 90 kDa
           protein.>gb:DDIHSC90R_1377107 Dictyostelium discoideum
           (clone C 6.1.1) heat shock cognate protein (hsc90) mRNA,
           complete cds.
          Length = 700

 Score =  143 bits (361), Expect = 3e-33
 Identities = 78/134 (58%), Positives = 97/134 (72%), Gaps = 1/134 (0%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E+F FQAE+++LM +IIN+ YSNK++FLRELISNASDALDKIR+ SLTD  +L E  T  
Sbjct: 7   ERFTFQAEINQLMSLIINTFYSNKEVFLRELISNASDALDKIRYQSLTDASVL-ESKTEL 65

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQS-SGDLNLIGQF 652
                              GIGMTK D+VKNLGTIA+SGT  F+E++QS + D+++IGQF
Sbjct: 66  EIKIIPDKTAKTLTLIDS-GIGMTKTDMVKNLGTIARSGTKNFMEQLQSGAADISMIGQF 124

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YLVAD V
Sbjct: 125 GVGFYSAYLVADTV 138



>sp|Q04619|HS9B_CHICK Heat shock cognate protein HSP
           90-beta.>pir|JC1468|JC1468 heat shock protein 90 beta -
           chicken>gb:GGHSP90B_2573214 G.gallus hsp 90 beta mRNA
           for heat shock protein 90 beta.
          Length = 725

 Score =  143 bits (361), Expect = 3e-33
 Identities = 78/133 (58%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G    
Sbjct: 13  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDTGKDLK 72

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 73  IDIVPNPRDPTLTLLDT--GIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFG 130

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 131 VGFYSAYLVAEKV 143



>sp|P07901|HS9A_MOUSE Heat shock protein HSP 90-alpha (HSP 86)
           (Tumor specific transplantation 86 kDa antigen) (TSTA).
          Length = 732

 Score =  143 bits (361), Expect = 3e-33
 Identities = 76/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L  G    
Sbjct: 17  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELH 76

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 77  INLIPSKQDRTLTIVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 134

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 135 VGFYSAYLVAEKV 147



>gb:CR381646_2570126 Zebrafish DNA sequence from clone DKEY-241L7 in
           linkage group 20 Contains the hsp90a gene for heat shock
           protein 90-alpha, the gene for a novel protein similar
           to heat shock protein 90-alpha, the gene for a novel
           protein similar to vertebrate protein phosphatase 2
           regulatory subunit B (B56) gamma isoform (PPP2R5C),
           seven novel genes and five CpG islands, complete
           sequence.
          Length = 734

 Score =  143 bits (360), Expect = 3e-33
 Identities = 76/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L  G    
Sbjct: 16  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKDLK 75

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 76  IEIIPNKEERTLTIIDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 133

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 134 VGFYSAYLVAEKV 146



>gb:BC072489_2106509 Rattus norvegicus heat shock protein 1, alpha,
           mRNA (cDNA clone MGC:91423 IMAGE:7105514), complete
           cds.>gb:BC085120_2109072 Rattus norvegicus heat shock
           protein 1, alpha, mRNA (cDNA clone MGC:105293
           IMAGE:7114546), complete cds.>gb:RNO297736_2135836
           Rattus norvegicus hsp86 gene for heat shock protein 86,
           exons 1-11 and promoter region.>gb:RNO428213_2135957
           Rattus norvegicus hsp86 gene for heat shock protein 86.
          Length = 733

 Score =  143 bits (360), Expect = 3e-33
 Identities = 76/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L  G    
Sbjct: 18  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELH 77

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 78  INLIPNKQDRTLTIVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 135

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 136 VGFYSAYLVAEKV 148



>gb:HSHSP86_2014260 Human mRNA for heat shock protein
           hsp86.>gb:HUMHSP86A_2032209 Human heat shock protein 86
           (HSP86) gene, exons 2-6.
          Length = 312

 Score =  143 bits (360), Expect = 3e-33
 Identities = 76/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L  G    
Sbjct: 18  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELH 77

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 78  INLIPNKQDRTLTIVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 135

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 136 VGFYSAYLVAEKV 148



>gb:AF402101_1796245 Achlya ambisexualis isolate JS855 heat shock
           protein Hsp90 mRNA, complete cds.
          Length = 703

 Score =  143 bits (360), Expect = 3e-33
 Identities = 74/134 (55%), Positives = 92/134 (68%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           +E F F A++++L+ +IIN+ YSNKD+FLRELISNASDALDKIR+ SLTD  +L      
Sbjct: 5   SETFAFSADINQLLSLIINTFYSNKDVFLRELISNASDALDKIRYQSLTDPSVLDSDKDL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               G+GMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  EIKVIPDKANGTLTLQDS--GLGMTKTDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YLVAD V
Sbjct: 123 GVGFYSAYLVADRV 136



>gb:AF402100_1796244 Achlya ambisexualis isolate JS854 heat shock
           protein Hsp90 mRNA, complete cds.
          Length = 703

 Score =  143 bits (360), Expect = 3e-33
 Identities = 74/134 (55%), Positives = 92/134 (68%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           +E F F A++++L+ +IIN+ YSNKD+FLRELISNASDALDKIR+ SLTD  +L      
Sbjct: 5   SETFAFSADINQLLSLIINTFYSNKDVFLRELISNASDALDKIRYQSLTDPSVLDSDKDL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               G+GMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  EIKVIPDKANGTLTLQDS--GLGMTKTDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YLVAD V
Sbjct: 123 GVGFYSAYLVADRV 136



>gb:AY094422_1575722 Arabidopsis thaliana At2g04030/F3C11.14 mRNA,
           complete cds.
          Length = 780

 Score =  143 bits (360), Expect = 3e-33
 Identities = 80/154 (51%), Positives = 106/154 (68%), Gaps = 5/154 (3%)
 Frame = +2

Query: 248 KREAESMSKRTLRAGA-EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR 424
           K +A    K T   G+ EKFE+QAEVSRL+D+I++SLYS+K++FLREL+SNASDALDK+R
Sbjct: 60  KCDAAVAEKETTEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLR 119

Query: 425 FLSLTDKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAF 604
           FLS+T+  +LG+G                       GIGMTKE+L+  LGTIA+SGTS F
Sbjct: 120 FLSVTEPSLLGDG--GDLEIRIKPDPDNGTITITDTGIGMTKEELIDCLGTIAQSGTSKF 177

Query: 605 VEKMQSSGDL----NLIGQFGVGFYSVYLVADYV 694
           ++ ++ + DL     LIGQFGVGFYS +LVA+ V
Sbjct: 178 LKALKENKDLGADNGLIGQFGVGFYSAFLVAEKV 211



>gb:AAU39048_1508250 Achlya ambisexualis heat shock protein 90-2
           (JS852) gene, upstream regulatory region and partial
           cds.
          Length = 309

 Score =  143 bits (360), Expect = 3e-33
 Identities = 74/134 (55%), Positives = 92/134 (68%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           +E F F A++++L+ +IIN+ YSNKD+FLRELISNASDALDKIR+ SLTD  +L      
Sbjct: 5   SETFAFSADINQLLSLIINTFYSNKDVFLRELISNASDALDKIRYQSLTDPSVLDSDKDL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               G+GMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  EIKVIPDKANGTLTLQDS--GLGMTKTDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YLVAD V
Sbjct: 123 GVGFYSAYLVADRV 136



>gb:AAU39047_1508249 Achlya ambisexualis heat shock protein 90-1
           (JS851) gene, upstream regulatory region and partial
           cds.
          Length = 309

 Score =  143 bits (360), Expect = 3e-33
 Identities = 74/134 (55%), Positives = 92/134 (68%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           +E F F A++++L+ +IIN+ YSNKD+FLRELISNASDALDKIR+ SLTD  +L      
Sbjct: 5   SETFAFSADINQLLSLIINTFYSNKDVFLRELISNASDALDKIRYQSLTDPSVLDSDKDL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               G+GMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  EIKVIPDKANGTLTLQDS--GLGMTKTDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YLVAD V
Sbjct: 123 GVGFYSAYLVADRV 136



>gb:AX925932_1483737 Sequence 11 from Patent WO03083117.
          Length = 854

 Score =  143 bits (360), Expect = 3e-33
 Identities = 76/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L  G    
Sbjct: 140 ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELH 199

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 200 INLIPNKQDRTLTIVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 257

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 258 VGFYSAYLVAEKV 270



>gb:SSU94395_1445879 Sus scrofa 90-kDa heat shock protein (hsp90)
           mRNA, complete cds.
          Length = 733

 Score =  143 bits (360), Expect = 3e-33
 Identities = 76/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L  G    
Sbjct: 18  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELH 77

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 78  INLIPNKQDRTLTIVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 135

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 136 VGFYSAYLVAEKV 148



>gb:AB072368_1408899 Bos taurus hsp90alpha mRNA for 90-kDa heat
           shock protein alpha, complete cds.
          Length = 733

 Score =  143 bits (360), Expect = 3e-33
 Identities = 76/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L  G    
Sbjct: 18  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELH 77

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 78  INLIPNKQDRTLTIVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 135

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 136 VGFYSAYLVAEKV 148



>gb:AF006544_1231318 Drosophila pseudoobscura bogotana strain
           bogota67 82 kDa heat shock protein (Hsp82) gene, partial
           cds.
          Length = 269

 Score =  143 bits (360), Expect = 3e-33
 Identities = 77/134 (57%), Positives = 91/134 (67%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                                I MTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--XIXMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>gb:CR859986_1184082 Pongo pygmaeus mRNA; cDNA DKFZp459N168 (from
           clone DKFZp459N168).
          Length = 732

 Score =  143 bits (360), Expect = 3e-33
 Identities = 76/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L  G    
Sbjct: 17  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELH 76

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 77  INLIPNKQDRTLTIVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 134

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 135 VGFYSAYLVAEKV 147



>pir|H84453|H84453 probable heat shock protein [imported] -
           Arabidopsis thaliana>gb:AX765864_1474621 Sequence 73
           from Patent WO03008440.>gb:AC007167_1535417 Arabidopsis
           thaliana chromosome 2 clone F3C11 map mi310, complete
           sequence.>gb:AY053403_1562916 Arabidopsis thaliana
           At2g04030/F3C11.14 mRNA, complete
           cds.>gb:BT002234_1635837 Arabidopsis thaliana
           At2g04030/F3C11.14 mRNA, complete
           cds.>gb:AF436826_1799878 Arabidopsis thaliana
           At2g04030/F3C11.14 mRNA, complete cds.
          Length = 780

 Score =  143 bits (360), Expect = 3e-33
 Identities = 80/154 (51%), Positives = 106/154 (68%), Gaps = 5/154 (3%)
 Frame = +2

Query: 248 KREAESMSKRTLRAGA-EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR 424
           K +A    K T   G+ EKFE+QAEVSRL+D+I++SLYS+K++FLREL+SNASDALDK+R
Sbjct: 60  KCDAAVAEKETTEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLR 119

Query: 425 FLSLTDKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAF 604
           FLS+T+  +LG+G                       GIGMTKE+L+  LGTIA+SGTS F
Sbjct: 120 FLSVTEPSLLGDG--GDLEIRIKPDPDNGTITITDTGIGMTKEELIDCLGTIAQSGTSKF 177

Query: 605 VEKMQSSGDL----NLIGQFGVGFYSVYLVADYV 694
           ++ ++ + DL     LIGQFGVGFYS +LVA+ V
Sbjct: 178 LKALKENKDLGADNGLIGQFGVGFYSAFLVAEKV 211



>pir|A32319|HHHU86 heat shock protein 90-alpha -
           human>gb:AX925928_1483735 Sequence 7 from Patent
           WO03083117.>gb:HUMHSP89KD_2032211 Homo sapiens heat
           shock protein (HSP89-alpha) gene, complete cds.
          Length = 732

 Score =  143 bits (360), Expect = 3e-33
 Identities = 76/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L  G    
Sbjct: 18  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELH 77

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 78  INLIPNKQDRTLTIVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 135

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 136 VGFYSAYLVAEKV 148



>sp|O02705|HS9A_PIG Heat shock protein HSP 90-alpha (HSP 86).
          Length = 732

 Score =  143 bits (360), Expect = 3e-33
 Identities = 76/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L  G    
Sbjct: 17  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELH 76

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 77  INLIPNKQDRTLTIVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 134

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 135 VGFYSAYLVAEKV 147



>sp|Q9GKX7|HS9A_HORSE Heat shock protein HSP 90-alpha (HSP 86)
           (Fragment).>gb:AB043677_1408391 Equus caballus Hsp90
           alpha mRNA for heat shock protein 90 alpha, partial cds.
          Length = 719

 Score =  143 bits (360), Expect = 3e-33
 Identities = 76/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L  G    
Sbjct: 7   ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELH 66

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 67  INLIPNKQDRTLTIVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 124

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 125 VGFYSAYLVAEKV 137



>gb:BC082009_2108246 Rattus norvegicus heat shock 90kDa protein 1,
           beta, mRNA (cDNA clone MGC:94263 IMAGE:7131767),
           complete cds.
          Length = 724

 Score =  142 bits (359), Expect = 4e-33
 Identities = 77/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G    
Sbjct: 13  ETFAFQAEIAQLMFLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELK 72

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 73  IDIIPNPQERTLTLVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 130

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 131 VGFYSAYLVAEKV 143



>gb:AX925930_1483736 Sequence 9 from Patent WO03083117.
          Length = 854

 Score =  142 bits (359), Expect = 4e-33
 Identities = 75/133 (56%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDK+R+ SLTD   L  G    
Sbjct: 140 ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKVRYESLTDPSKLDSGKELH 199

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 200 INLIPNKQDRTLTIVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 257

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 258 VGFYSAYLVAEKV 270



>gb:AX925926_1483734 Sequence 5 from Patent WO03083117.
          Length = 732

 Score =  142 bits (359), Expect = 4e-33
 Identities = 75/133 (56%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDK+R+ SLTD   L  G    
Sbjct: 18  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKVRYESLTDPSKLDSGKELH 77

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 78  INLIPNKQDRTLTIVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 135

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 136 VGFYSAYLVAEKV 148



>gb:AX925922_1483732 Sequence 1 from Patent WO03083117.
          Length = 315

 Score =  142 bits (359), Expect = 4e-33
 Identities = 75/133 (56%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDK+R+ SLTD   L  G    
Sbjct: 18  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKVRYESLTDPSKLDSGKELH 77

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 78  INLIPNKQDRTLTIVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 135

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 136 VGFYSAYLVAEKV 148



>gb:PFHESHPR_1394220 P.falciparum (7) mRNA for heat-shock protein.
          Length = 745

 Score =  142 bits (359), Expect = 4e-33
 Identities = 75/133 (56%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F F A++ +LM +IIN+ YSNK+IFLRELISNASDALDKIR+ S+TD   L       
Sbjct: 4   ETFAFNADIRQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESITDTQKLSA--EPE 61

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIA+SGT AF+E +Q+SGD+++IGQFG
Sbjct: 62  FFIRIIPDKTNNTLTIEDSGIGMTKNDLINNLGTIARSGTKAFMEAIQASGDISMIGQFG 121

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVAD+V
Sbjct: 122 VGFYSAYLVADHV 134



>gb:PFAHSP86B_1393806 Plasmodium falciparum (clone HB3) heat shock
           protein 86 gene, complete cds.
          Length = 747

 Score =  142 bits (359), Expect = 4e-33
 Identities = 75/133 (56%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F F A++ +LM +IIN+ YSNK+IFLRELISNASDALDKIR+ S+TD   L       
Sbjct: 4   ETFAFNADIRQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESITDTQKLSA--EPE 61

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIA+SGT AF+E +Q+SGD+++IGQFG
Sbjct: 62  FFIRIIPDKTNNTLTIEDSGIGMTKNDLINNLGTIARSGTKAFMEAIQASGDISMIGQFG 121

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVAD+V
Sbjct: 122 VGFYSAYLVADHV 134



>gb:AF217404_1251969 Schistosoma mansoni endoplasmin mRNA, complete
           cds.
          Length = 796

 Score =  142 bits (359), Expect = 4e-33
 Identities = 91/189 (48%), Positives = 111/189 (58%), Gaps = 12/189 (6%)
 Frame = +2

Query: 164 SDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTL--------RAGAEKFEFQAE 319
           SD PV  P           GLST  D   +E E++S   L        R  AEK +F+AE
Sbjct: 31  SDIPVSRPN---------EGLSTASDTLTKEGEAISLDGLSVEQLKQAREHAEKRQFEAE 81

Query: 320 VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAXXXXXXXXX 499
           V R+M II+NSLY NK+IFLRELISNASDALDK+R LSLT+ ++L E D           
Sbjct: 82  VDRMMKIIVNSLYKNKEIFLRELISNASDALDKVRVLSLTNNEMLNESDEMSIRIKANKD 141

Query: 500 XXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKM----QSSGDLNLIGQFGVGFY 667
                      GIGMT+ +L  NLGTIAKSGTS F+ K+     +S   +LIGQFGVGFY
Sbjct: 142 ARTLHIIDT--GIGMTEAELTSNLGTIAKSGTSEFLTKIAQTNTASEKSDLIGQFGVGFY 199

Query: 668 SVYLVADYV 694
           S +LVA+ V
Sbjct: 200 SSFLVANKV 208



>pir|T20019|T20019 hypothetical protein C47E8.5 - Caenorhabditis
           elegans>gb:CEC47E8_1361355 Caenorhabditis elegans cosmid
           C47E8, complete sequence.
          Length = 702

 Score =  142 bits (359), Expect = 4e-33
 Identities = 76/134 (56%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+I+LRELISNASDALDKIR+ +LT+   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIYLRELISNASDALDKIRYQALTEPSELDTGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  FIKITPNKEEKTLTIMDT--GIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS +LVAD V
Sbjct: 123 GVGFYSAFLVADKV 136



>pir|T09091|S49155 heat shock protein 86 - malaria parasite
           (Plasmodium falciparum)>gb:PFMAL7P1_1191801 Plasmodium
           falciparum 3D7 chromosome 7, *** SEQUENCING IN PROGRESS
           ***, 12 ordered pieces.>gb:AF030694_1234459 Plasmodium
           falciparum strain Dd2 heat shock protein 86 (HSP86), O1
           (o1), O3 (o3), O2 (o2), CG8 (cg8), CG4 (cg4), CG3 (cg3),
           putative chloroquine resistance transporter (crt), CG9
           (cg9), CG1 (cg1), CG6 (cg6), CG2 (cg2), and CG7 (cg7)
           genes, complete cds.>gb:PFAHSP86A_1393805 Plasmodium
           falciparum (clone Dd2) heat shock protein 86 gene,
           complete cds.
          Length = 745

 Score =  142 bits (359), Expect = 4e-33
 Identities = 75/133 (56%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F F A++ +LM +IIN+ YSNK+IFLRELISNASDALDKIR+ S+TD   L       
Sbjct: 4   ETFAFNADIRQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESITDTQKLSA--EPE 61

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIA+SGT AF+E +Q+SGD+++IGQFG
Sbjct: 62  FFIRIIPDKTNNTLTIEDSGIGMTKNDLINNLGTIARSGTKAFMEAIQASGDISMIGQFG 121

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVAD+V
Sbjct: 122 VGFYSAYLVADHV 134



>sp|O43109|HS90_PODAN Heat shock protein 90 homolog (Suppressor of
           vegetative incompatibility MOD-E).>gb:PAU81165_1698931
           Podospora anserina suppressor of vegetative
           incompatibility MOD-E (mod-E) gene, complete cds.
          Length = 701

 Score =  142 bits (359), Expect = 4e-33
 Identities = 76/134 (56%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE FEFQAE+S+L+ +IIN++YSNK+IFLREL+SNASDALDKIR+ SL+D   L  G   
Sbjct: 2   AETFEFQAEISQLLSLIINTVYSNKEIFLRELVSNASDALDKIRYESLSDPSKLDTGKDL 61

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIA+SGT  F+E + +  D+++IGQF
Sbjct: 62  RIDIIPDKENKTLTIQDT--GIGMTKADLVNNLGTIARSGTKQFMEALTAGADISMIGQF 119

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YLVAD V
Sbjct: 120 GVGFYSAYLVADRV 133



>gb:AF521007_1807871 Hevea brasiliensis heat shock protein mRNA,
           complete cds.
          Length = 698

 Score =  142 bits (358), Expect = 6e-33
 Identities = 77/136 (56%), Positives = 93/136 (68%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A AE F FQAE+++L+ +IIN+ YSNK+IFLRE+ISNASDALDKIRF SLTDK  L    
Sbjct: 2   ADAETFAFQAEINQLLSLIINTFYSNKEIFLREIISNASDALDKIRFESLTDKSKLDA-- 59

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGMTK DLV NLGTIA+SGT  F+E +Q+  D+++IG
Sbjct: 60  QPELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIG 119

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVA+ V
Sbjct: 120 QFGVGFYSAYLVAEKV 135



>gb:AE017353_1760078 Cryptococcus neoformans var. neoformans JEC21
           chromosome 13, complete sequence.
          Length = 700

 Score =  142 bits (358), Expect = 6e-33
 Identities = 79/135 (58%), Positives = 94/135 (69%), Gaps = 1/135 (0%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL-GEGDTA 472
           E F FQAE+S+L+D+IIN+ YSNK+IFLRELISN+SDALDKIR+ +LTD   L  E D  
Sbjct: 4   ETFGFQAEISQLLDLIINTFYSNKEIFLRELISNSSDALDKIRYAALTDPSQLESEKDLY 63

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E + S  D+++IGQF
Sbjct: 64  IRIIPNKEEGTLTIRDT---GIGMTKADLVNNLGTIAKSGTKAFMEALSSGADISMIGQF 120

Query: 653 GVGFYSVYLVADYVE 697
           GVGFYS YLVA+ VE
Sbjct: 121 GVGFYSSYLVAEKVE 135



>gb:ATHHSP81_1553238 Arabidopsis thaliana HSP81-1 gene for 81kDa
           heat-shock protein, complete cds.
          Length = 700

 Score =  142 bits (358), Expect = 6e-33
 Identities = 78/136 (57%), Positives = 95/136 (69%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A AE F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF SLTDK  L +G 
Sbjct: 2   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKL-DGQ 60

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGMTK DLV NLGTIA+SGT  F+E +Q+  D+++IG
Sbjct: 61  PELFIRLVPDKSNKTLSIIDS-GIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIG 119

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVA+ V
Sbjct: 120 QFGVGFYSAYLVAEKV 135



>gb:AB025606_1516301 Arabidopsis thaliana genomic DNA, chromosome 5,
           BAC clone:F6N7.>gb:AY128296_1580597 Arabidopsis thaliana
           AT5g52640/F6N7_13 mRNA, complete
           cds.>gb:BT001091_1635346 Arabidopsis thaliana
           At5g52640/F6N7_13 mRNA, complete cds.
          Length = 705

 Score =  142 bits (358), Expect = 6e-33
 Identities = 78/136 (57%), Positives = 95/136 (69%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A AE F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF SLTDK  L +G 
Sbjct: 7   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKL-DGQ 65

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGMTK DLV NLGTIA+SGT  F+E +Q+  D+++IG
Sbjct: 66  PELFIRLVPDKSNKTLSIIDS-GIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIG 124

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVA+ V
Sbjct: 125 QFGVGFYSAYLVAEKV 140



>gb:AF287229_1259075 Tetrahymena pyriformis heat shock protein 90
           (HSP81) gene, partial cds.
          Length = 699

 Score =  142 bits (358), Expect = 6e-33
 Identities = 73/135 (54%), Positives = 93/135 (68%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F F+A++ +LM +IIN+ YSNK+IFLRELISNASDALDKIR++S+TD +        
Sbjct: 1   AEHFAFEADIQQLMGLIINTFYSNKEIFLRELISNASDALDKIRYISITDSERAKLETEP 60

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK++L+ NLGTIAKSGT AF+E + S  D+++IGQF
Sbjct: 61  NFRIRIIPNKNDNTLTLWDTGIGMTKKELINNLGTIAKSGTKAFMEALSSGADISMIGQF 120

Query: 653 GVGFYSVYLVADYVE 697
           GVGFYS YLVA+ VE
Sbjct: 121 GVGFYSAYLVAEKVE 135



>gb:AF006556_1231330 Drosophila persimilis strain persimi47 82 kDa
           heat shock protein (Hsp82) gene, partial cds.
          Length = 269

 Score =  142 bits (358), Expect = 6e-33
 Identities = 75/134 (55%), Positives = 89/134 (66%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+  L D      G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYEXLXDPSXXDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+ D V
Sbjct: 123 GVGFYSAYLIXDRV 136



>pir|A45508|A45508 heat shock protein 83 - Arabidopsis
           thaliana>gb:ATHHSP83_1553239 A.thaliana heat shock
           protein 83 mRNA, complete cds.
          Length = 705

 Score =  142 bits (358), Expect = 6e-33
 Identities = 78/136 (57%), Positives = 95/136 (69%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A AE F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF SLTDK  L +G 
Sbjct: 7   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKL-DGQ 65

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGMTK DLV NLGTIA+SGT  F+E +Q+  D+++IG
Sbjct: 66  PELFIRLVPDKANKTLSIIDS-GIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIG 124

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVA+ V
Sbjct: 125 QFGVGFYSAYLVAEKV 140



>sp|P27323|HS81_ARATH Heat shock protein 81-1 (HSP81-1) (Heat shock
           protein 83).
          Length = 700

 Score =  142 bits (358), Expect = 6e-33
 Identities = 78/136 (57%), Positives = 95/136 (69%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A AE F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF SLTDK  L +G 
Sbjct: 2   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKL-DGQ 60

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGMTK DLV NLGTIA+SGT  F+E +Q+  D+++IG
Sbjct: 61  PELFIRLVPDKSNKTLSIIDS-GIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIG 119

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVA+ V
Sbjct: 120 QFGVGFYSAYLVAEKV 135



>gb:CRUHSP90A_2112036 Cricetulus griseus (clone 33A) heat shock
           protein 90A (HSP90) mRNA, complete cds.
          Length = 733

 Score =  142 bits (357), Expect = 7e-33
 Identities = 75/133 (56%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L  G    
Sbjct: 18  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELH 77

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 78  INIIPNKQDRTLTIVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 135

Query: 656 VGFYSVYLVADYV 694
           VGFY+ YLVA+ V
Sbjct: 136 VGFYTAYLVAEKV 148



>gb:AX047375_1458061 Sequence 3 from Patent
           WO0068693.>gb:HSHSP90R_2014261 Human mRNA for 90-kDa
           heat-shock protein.
          Length = 732

 Score =  142 bits (357), Expect = 7e-33
 Identities = 75/133 (56%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ +LTD   L  G    
Sbjct: 18  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYETLTDPSKLDSGKELH 77

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 78  INLIPNKQDRTLTIVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 135

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 136 VGFYSAYLVAEKV 148



>gb:DKL17848_1377787 Dendronephthya klunzingeri mRNA for heat shock
           protein HSP90.
          Length = 733

 Score =  142 bits (357), Expect = 7e-33
 Identities = 77/133 (57%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L   +   
Sbjct: 16  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYQSLTDPTKLD--NCKD 73

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DLV NLGTIAKSGT AF+E +QS  D+++IGQFG
Sbjct: 74  MKMEIIPNKDDNTLTIIDTGIGMTKADLVNNLGTIAKSGTKAFMEALQSGADISMIGQFG 133

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 134 VGFYSAYLVAERV 146



>gb:AF461150_1273175 Heterodera glycines Hsp90 mRNA, complete cds.
          Length = 721

 Score =  142 bits (357), Expect = 7e-33
 Identities = 75/133 (56%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ +LTD   +  G    
Sbjct: 7   ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYQALTDPSQMESGKELF 66

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 67  IKIVPNKADKTLTIIDT--GIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFG 124

Query: 656 VGFYSVYLVADYV 694
           VGFYS +LVAD V
Sbjct: 125 VGFYSAFLVADRV 137



>sp|P07900|HS9A_HUMAN Heat shock protein HSP 90-alpha (HSP 86).
          Length = 731

 Score =  142 bits (357), Expect = 7e-33
 Identities = 75/133 (56%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ +LTD   L  G    
Sbjct: 17  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYETLTDPSKLDSGKELH 76

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 77  INLIPNKQDRTLTIVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 134

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 135 VGFYSAYLVAEKV 147



>sp|P46633|HS9A_CRIGR Heat shock protein HSP 90-alpha (HSP 86).
          Length = 732

 Score =  142 bits (357), Expect = 7e-33
 Identities = 75/133 (56%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L  G    
Sbjct: 17  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELH 76

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 77  INIIPNKQDRTLTIVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 134

Query: 656 VGFYSVYLVADYV 694
           VGFY+ YLVA+ V
Sbjct: 135 VGFYTAYLVAEKV 147



>sp|P11501|HS9A_CHICK Heat shock protein HSP
           90-alpha.>gb:GGHSPAA_2573215 Chicken mRNA for 90kDa heat
           shock protein.
          Length = 728

 Score =  142 bits (357), Expect = 7e-33
 Identities = 78/147 (53%), Positives = 95/147 (64%)
 Frame = +2

Query: 254 EAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLS 433
           EA     + +    E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ S
Sbjct: 3   EAVQTQDQPMEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYES 62

Query: 434 LTDKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEK 613
           LTD   L  G                       GIGMTK DLV NLGTIAKSGT AF+E 
Sbjct: 63  LTDPSKLDSGKDLKINLIPNKHDRTLTIVDT--GIGMTKADLVNNLGTIAKSGTKAFMEA 120

Query: 614 MQSSGDLNLIGQFGVGFYSVYLVADYV 694
           +Q+  D+++IGQFGVG YS YLVA+ V
Sbjct: 121 LQAGADISMIGQFGVGSYSAYLVAEKV 147



>sp|O16068|HS83_DROPB Heat shock protein 83 (HSP 82)
           (Fragment).>gb:AF006540_1231314 Drosophila pseudoobscura
           bogotana strain bogota60 82 kDa heat shock protein
           (Hsp82) gene, partial cds.
          Length = 269

 Score =  142 bits (357), Expect = 7e-33
 Identities = 80/134 (59%), Positives = 94/134 (70%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ S TD   L      
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYXSXTDPXKLXXXXXX 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GI MTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  XXXXIPNKTAGTLTIIDT--GIXMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>gb:S77849_1704549 HSP81-3=heat-shock Protein [Arabidopsis
           thaliana=thale-cress, Genomic, 3094 nt].
          Length = 699

 Score =  141 bits (356), Expect = 1e-32
 Identities = 78/136 (57%), Positives = 94/136 (69%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A AE F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF SLTDK  L +G 
Sbjct: 2   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKL-DGQ 60

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGMTK DLV NLGTIA+SGT  F+E + +  D+++IG
Sbjct: 61  PELFIHIIPDKTNNTLTIIDS-GIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIG 119

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVAD V
Sbjct: 120 QFGVGFYSAYLVADKV 135



>gb:NC9G6_1688865 Neurospora crassa DNA linkage group V Cosmid
           contig 9G6.
          Length = 705

 Score =  141 bits (356), Expect = 1e-32
 Identities = 77/136 (56%), Positives = 93/136 (68%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A AE FEFQAE+S+L+ +IIN++YSNK+IFLRELISNASDALDKIR+ SL+D   L    
Sbjct: 2   ATAETFEFQAEISQLLSLIINTVYSNKEIFLRELISNASDALDKIRYESLSDPSKL--DS 59

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGMTK DLV NLGTIA+SGT  F+E + +  D+++IG
Sbjct: 60  CKDLRIDIIPDKANKTLTIRDTGIGMTKADLVNNLGTIARSGTKQFMEALTAGADISMIG 119

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVAD V
Sbjct: 120 QFGVGFYSAYLVADRV 135



>gb:BT001095_1635350 Arabidopsis thaliana clone C104855 (D) putative
           heat shock protein 90 (At5g56010) mRNA, complete
           cds.>gb:BT001104_1635359 Arabidopsis thaliana clone
           C104855 (D) putative heat shock protein 90 (At5g56010)
           mRNA, complete cds.
          Length = 526

 Score =  141 bits (356), Expect = 1e-32
 Identities = 78/136 (57%), Positives = 94/136 (69%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A AE F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF SLTDK  L +G 
Sbjct: 2   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKL-DGQ 60

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGMTK DLV NLGTIA+SGT  F+E + +  D+++IG
Sbjct: 61  PELFIHIIPDKTNNTLTIIDS-GIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIG 119

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVAD V
Sbjct: 120 QFGVGFYSAYLVADKV 135



>gb:BT000717_1634990 Arabidopsis thaliana clone RAFL09-76-I24
           (R19621) putative heat shock protein 81-2 (HSP81-2)
           (At5g56030) mRNA, complete cds.
          Length = 699

 Score =  141 bits (356), Expect = 1e-32
 Identities = 78/136 (57%), Positives = 94/136 (69%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A AE F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF SLTDK  L +G 
Sbjct: 2   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKL-DGQ 60

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGMTK DLV NLGTIA+SGT  F+E + +  D+++IG
Sbjct: 61  PELFIHIIPDKTNNTLTIIDS-GIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIG 119

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVAD V
Sbjct: 120 QFGVGFYSAYLVADKV 135



>gb:AY070031_1566674 Arabidopsis thaliana putative heat shock
           protein 90 (At5g56010) mRNA, complete cds.
          Length = 699

 Score =  141 bits (356), Expect = 1e-32
 Identities = 78/136 (57%), Positives = 94/136 (69%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A AE F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF SLTDK  L +G 
Sbjct: 2   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKL-DGQ 60

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGMTK DLV NLGTIA+SGT  F+E + +  D+++IG
Sbjct: 61  PELFIHIIPDKTNNTLTIIDS-GIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIG 119

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVAD V
Sbjct: 120 QFGVGFYSAYLVADKV 135



>gb:AY050349_1562128 Arabidopsis thaliana AT5g56010/MDA7_5 mRNA,
           partial cds.
          Length = 527

 Score =  141 bits (356), Expect = 1e-32
 Identities = 78/136 (57%), Positives = 94/136 (69%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A AE F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF SLTDK  L +G 
Sbjct: 2   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKL-DGQ 60

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGMTK DLV NLGTIA+SGT  F+E + +  D+++IG
Sbjct: 61  PELFIHIIPDKTNNTLTIIDS-GIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIG 119

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVAD V
Sbjct: 120 QFGVGFYSAYLVADKV 135



>gb:ATHSP90A_1553400 A.thaliana hsp90A gene.
          Length = 704

 Score =  141 bits (356), Expect = 1e-32
 Identities = 78/136 (57%), Positives = 95/136 (69%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A AE F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF SLTDK  L +G 
Sbjct: 7   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKL-DGQ 65

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGMTK DLV NLGTIA+SGT  F+E +Q+  D+++IG
Sbjct: 66  PELFIRLVPDKPNKTLSIIDS-GIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIG 124

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVA+ V
Sbjct: 125 QFGVGFYSAYLVAEKV 140



>gb:AB011476_1511387 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MDA7.>gb:ATHSP814_1553398 A.thaliana hsp81.4
           gene.
          Length = 699

 Score =  141 bits (356), Expect = 1e-32
 Identities = 78/136 (57%), Positives = 94/136 (69%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A AE F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF SLTDK  L +G 
Sbjct: 2   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKL-DGQ 60

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGMTK DLV NLGTIA+SGT  F+E + +  D+++IG
Sbjct: 61  PELFIHIIPDKTNNTLTIIDS-GIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIG 119

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVAD V
Sbjct: 120 QFGVGFYSAYLVADKV 135



>sp|P51818|HS83_ARATH Heat shock protein 81-3 (HSP81-3)
           (HSP81.2).>gb:AB011476_1511388 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1
           clone:MDA7.>gb:AY062832_1565488 Arabidopsis thaliana
           heat shock protein 90 (At5g56010; MDA7.5) mRNA, complete
           cds.>gb:AY081302_1568648 Arabidopsis thaliana heat shock
           protein 90 (At5g56010) mRNA, complete cds.
          Length = 699

 Score =  141 bits (356), Expect = 1e-32
 Identities = 78/136 (57%), Positives = 94/136 (69%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A AE F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF SLTDK  L +G 
Sbjct: 2   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKL-DGQ 60

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGMTK DLV NLGTIA+SGT  F+E + +  D+++IG
Sbjct: 61  PELFIHIIPDKTNNTLTIIDS-GIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIG 119

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVAD V
Sbjct: 120 QFGVGFYSAYLVADKV 135



>sp|P55737|HS82_ARATH Heat shock protein 81-2
           (HSP81-2).>gb:AB011476_1511390 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1
           clone:MDA7.>gb:AY062750_1565406 Arabidopsis thaliana
           HEAT SHOCK PROTEIN 81-2 (HSP81-2) (MDA7.7) mRNA,
           complete cds.>gb:AY128805_1580885 Arabidopsis thaliana
           heat shock protein 81-2 (At5g56030) mRNA, complete
           cds.>gb:BT001944_1635547 Arabidopsis thaliana clone
           C105057 putative heat-shock protein HSP81-2 (At5g56030)
           mRNA, complete cds.>gb:BT002535_1636138 Arabidopsis
           thaliana Unknown protein mRNA, complete cds.
          Length = 699

 Score =  141 bits (356), Expect = 1e-32
 Identities = 78/136 (57%), Positives = 94/136 (69%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A AE F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF SLTDK  L +G 
Sbjct: 2   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKL-DGQ 60

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGMTK DLV NLGTIA+SGT  F+E + +  D+++IG
Sbjct: 61  PELFIHIIPDKTNNTLTIIDS-GIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIG 119

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVAD V
Sbjct: 120 QFGVGFYSAYLVADKV 135



>gb:OTU89945_2577497 Oncorhynchus tshawytscha heat shock protein
           hsp90 mRNA, complete cds.
          Length = 726

 Score =  141 bits (355), Expect = 1e-32
 Identities = 76/139 (54%), Positives = 93/139 (66%)
 Frame = +2

Query: 278 TLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG 457
           T+    E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L 
Sbjct: 8   TMDEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPTKLD 67

Query: 458 EGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLN 637
                                    GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D++
Sbjct: 68  S--CKELKIEVTPDLRTRTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADIS 125

Query: 638 LIGQFGVGFYSVYLVADYV 694
           +IGQFGVGFYS YLVA+ V
Sbjct: 126 MIGQFGVGFYSAYLVAERV 144



>gb:CR381646_2570125 Zebrafish DNA sequence from clone DKEY-241L7 in
           linkage group 20 Contains the hsp90a gene for heat shock
           protein 90-alpha, the gene for a novel protein similar
           to heat shock protein 90-alpha, the gene for a novel
           protein similar to vertebrate protein phosphatase 2
           regulatory subunit B (B56) gamma isoform (PPP2R5C),
           seven novel genes and five CpG islands, complete
           sequence.
          Length = 725

 Score =  141 bits (355), Expect = 1e-32
 Identities = 76/145 (52%), Positives = 95/145 (65%)
 Frame = +2

Query: 260 ESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLT 439
           E  ++  +    E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLT
Sbjct: 3   EKSAQPVMEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLT 62

Query: 440 DKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ 619
           D   L                          GIGMTK DL+ NLGTIAKSGT AF+E +Q
Sbjct: 63  DPSKLDS--CKDLKIELIPDQKERTLTIIDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 120

Query: 620 SSGDLNLIGQFGVGFYSVYLVADYV 694
           +  D+++IGQFGVGFYS YLVA+ V
Sbjct: 121 AGADISMIGQFGVGFYSAYLVAEKV 145



>gb:BC075757_2558721 Danio rerio heat shock protein 90-alpha, mRNA
           (cDNA clone MGC:86652 IMAGE:6894022), complete cds.
          Length = 725

 Score =  141 bits (355), Expect = 1e-32
 Identities = 76/145 (52%), Positives = 95/145 (65%)
 Frame = +2

Query: 260 ESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLT 439
           E  ++  +    E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLT
Sbjct: 3   EKSAQPVMEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLT 62

Query: 440 DKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ 619
           D   L                          GIGMTK DL+ NLGTIAKSGT AF+E +Q
Sbjct: 63  DPSKLDS--CKDLKIELIPDQKERTLTIIDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 120

Query: 620 SSGDLNLIGQFGVGFYSVYLVADYV 694
           +  D+++IGQFGVGFYS YLVA+ V
Sbjct: 121 AGADISMIGQFGVGFYSAYLVAEKV 145



>gb:AY222612_2520292 Astyanax mexicanus heat shock protein 90 alpha
           (HSP90a) mRNA, complete cds.
          Length = 723

 Score =  141 bits (355), Expect = 1e-32
 Identities = 76/145 (52%), Positives = 95/145 (65%)
 Frame = +2

Query: 260 ESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLT 439
           E  ++  +    E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLT
Sbjct: 3   EKAAQPVMEEDVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLT 62

Query: 440 DKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQ 619
           D   L                          GIGMTK DL+ NLGTIAKSGT AF+E +Q
Sbjct: 63  DPSKLES--CKDLKIELIPDLKNRTLTIIDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 120

Query: 620 SSGDLNLIGQFGVGFYSVYLVADYV 694
           +  D+++IGQFGVGFYS YLVA+ V
Sbjct: 121 AGADISMIGQFGVGFYSAYLVAERV 145



>gb:AF384808_1794539 Cryptococcus neoformans var. grubii heat-shock
           protein 90 gene, partial cds.
          Length = 691

 Score =  141 bits (355), Expect = 1e-32
 Identities = 76/134 (56%), Positives = 92/134 (68%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+S+L+D+IIN+ YSNK+IFLRELISN+SDALDKIR+ +LTD   L       
Sbjct: 1   ETFGFQAEISQLLDLIINTFYSNKEIFLRELISNSSDALDKIRYAALTDPSQLDSEKDLY 60

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DLV NLGTIAKSGT AF+E + S  D+++IGQFG
Sbjct: 61  IRIIPNKEEGTLTIRDT--GIGMTKADLVNNLGTIAKSGTKAFMEALSSGADISMIGQFG 118

Query: 656 VGFYSVYLVADYVE 697
           VGFYS YLVA+ V+
Sbjct: 119 VGFYSSYLVAEKVQ 132



>gb:AE016819_1748690 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete
           sequence.>gb:AF431814_1799462 Eremothecium gossypii heat
           shock protein (HSP82) gene, complete cds; CIN2 gene,
           partial sequence; and IQGAP-like protein (CYK1) gene,
           complete cds.
          Length = 704

 Score =  141 bits (355), Expect = 1e-32
 Identities = 75/134 (55%), Positives = 97/134 (72%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E +EFQAE+++LM +IIN++YSNK+IFLRELISNASDALDKIR+ SL+D  +L E D   
Sbjct: 5   ETYEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQSLSDPKVL-ESDPEL 63

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK +L+ NLGTIAKSGT AF+E + +  D+++IGQFG
Sbjct: 64  FIRLTPKPEEKVLEIRDS-GIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMIGQFG 122

Query: 656 VGFYSVYLVADYVE 697
           VGFYS++LVAD V+
Sbjct: 123 VGFYSLFLVADRVQ 136



>gb:ATHSP881_1553399 A.thaliana hsp88.1 gene.
          Length = 768

 Score =  140 bits (354), Expect = 2e-32
 Identities = 78/152 (51%), Positives = 105/152 (69%), Gaps = 5/152 (3%)
 Frame = +2

Query: 254 EAESMSKRTLRAGA-EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL 430
           +A    K T   G+ EKFE+QAEVSRL+D+I++SLYS+K++FLREL+SNASDALDK+RFL
Sbjct: 46  DAAVAEKETTEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFL 105

Query: 431 SLTDKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVE 610
           S+T+  +LG+G                       GIGMTKE+L+  LGTIA+SGTS F++
Sbjct: 106 SVTEPSLLGDG--GDLEIRIKPDPDNGTITITDTGIGMTKEELIDCLGTIAQSGTSKFLK 163

Query: 611 KMQSSGDL----NLIGQFGVGFYSVYLVADYV 694
            ++ + DL     LIGQFGVGF+S +LVA+ V
Sbjct: 164 ALKENKDLGADNGLIGQFGVGFFSAFLVAEKV 195



>gb:ATHSP812_1553397 A.thaliana hsp81.2 gene.
          Length = 699

 Score =  140 bits (354), Expect = 2e-32
 Identities = 78/136 (57%), Positives = 94/136 (69%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A AE F FQAE+++L+ +IIN+ YSN +IFLRELISN+SDALDKIRF SLTDK  L +G 
Sbjct: 2   ADAETFAFQAEINQLLSLIINTFYSNLEIFLRELISNSSDALDKIRFESLTDKSKL-DGQ 60

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGMTK DLVKNLGTIA+SGT  F+E + +  D+++IG
Sbjct: 61  PELFIHIIPDKTNNTLTIIDS-GIGMTKADLVKNLGTIARSGTKEFMEALAAGADVSMIG 119

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVAD V
Sbjct: 120 QFGVGFYSAYLVADKV 135



>gb:AY362761_1322646 Chlamys farreri heat shock protein 90 mRNA,
           complete cds.
          Length = 726

 Score =  140 bits (354), Expect = 2e-32
 Identities = 76/133 (57%), Positives = 90/133 (67%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQA +++LM +IIN+ YSNK+IFLRELISN SDALDKIR+ SLTD   L  G    
Sbjct: 15  ETFAFQAGIAQLMSLIINTFYSNKEIFLRELISNCSDALDKIRYESLTDPSKLDSGKELE 74

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DLV NLGTIA+SGT AF+E +Q+  D+++IGQFG
Sbjct: 75  IKIVPNKDDNTLSIMDT--GIGMTKADLVNNLGTIARSGTKAFMEALQAGADISMIGQFG 132

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVAD V
Sbjct: 133 VGFYSAYLVADRV 145



>gb:AK088148_1175223 Mus musculus 2 days neonate thymus thymic cells
           cDNA, RIKEN full-length enriched library,
           clone:E430005B07 product:tumor rejection antigen gp96,
           full insert sequence.
          Length = 277

 Score =  140 bits (354), Expect = 2e-32
 Identities = 79/139 (56%), Positives = 95/139 (68%), Gaps = 5/139 (3%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           +EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L   +  
Sbjct: 3   SEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEEL 62

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD-----LN 637
                               G+GMT+E+LVKNLGTIAKSGTS F+ KM  + +       
Sbjct: 63  TVKIKCDKEKNLLHVTDT--GVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSE 120

Query: 638 LIGQFGVGFYSVYLVADYV 694
           LIGQFGVGFYS +LVAD V
Sbjct: 121 LIGQFGVGFYSAFLVADKV 139



>pir|S65776|S49340 heat-shock protein, 82K, precursor -
           rye>gb:SCCLHSP_1707346 S.cereale (Halo) chloroplast mRNA
           for heat-shock protein.
          Length = 781

 Score =  140 bits (353), Expect = 2e-32
 Identities = 78/154 (50%), Positives = 102/154 (66%), Gaps = 4/154 (2%)
 Frame = +2

Query: 245 AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR 424
           A   AE  +     A  EKFE+QAEVSRLMD+I++SLYS+K++FLREL+SNASDALDK+R
Sbjct: 58  ASAVAEKTAGEEEEAAGEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNASDALDKLR 117

Query: 425 FLSLTDKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAF 604
           FLS+TD  +L +G                       GIGMTK++L   LGTIA+SGTS F
Sbjct: 118 FLSVTDSSVLADG--GELEIRIKPDPDAGTITITDSGIGMTKDELKDCLGTIAQSGTSKF 175

Query: 605 VEKMQSSGDL----NLIGQFGVGFYSVYLVADYV 694
           ++ ++ + +L     LIGQFGVGFYS +LVA+ V
Sbjct: 176 LKALKENKELGADNGLIGQFGVGFYSAFLVAEKV 209



>sp|O61998|HS90_BRUPA Heat shock protein 90.>gb:BPAJ5785_1355850
           Brugia pahangi hsp90 gene and 5' region.
          Length = 717

 Score =  140 bits (353), Expect = 2e-32
 Identities = 75/133 (56%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ +LT+   L  G    
Sbjct: 8   ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYQALTEPAELETGKELY 67

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 68  IKITPNKADKTLTIMDT--GIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFG 125

Query: 656 VGFYSVYLVADYV 694
           VGFYS +LVAD V
Sbjct: 126 VGFYSAFLVADKV 138



>sp|P51819|HS83_PHANI Heat shock protein 83.>gb:PHNHSP83A_1700143
           Pharbitis nil heat shock protein 83 (Hsp83) gene,
           complete cds.
          Length = 703

 Score =  140 bits (353), Expect = 2e-32
 Identities = 76/136 (55%), Positives = 92/136 (67%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A AE F FQAE+++L+ +IIN+ YSNK+IFLRELISNASDALDKIRF SLTDK  L    
Sbjct: 7   AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDA-- 64

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 G+GM K DLV NLGTIA+SGT  F+E +Q+  D+++IG
Sbjct: 65  QPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIG 124

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVA+ V
Sbjct: 125 QFGVGFYSAYLVAEKV 140



>sp|P02829|HS82_YEAST Heat shock protein HSP82.>pir|A03313|HHBY90
           heat shock protein 90 - yeast (Saccharomyces
           cerevisiae)>gb:SC38KCXVI_1705201 S.cerevisiae DNA
           (chromosome XVI; 38 kb).>gb:SCYPL240C_1714761
           S.cerevisiae chromosome XVI reading frame ORF
           YPL240c.>gb:YSCHSP82A_1729355 Yeast (S.cerevisiae) HSP82
           (heat shock-inducible) gene, complete coding sequence
           and flanks.
          Length = 709

 Score =  140 bits (353), Expect = 2e-32
 Identities = 76/136 (55%), Positives = 98/136 (72%), Gaps = 1/136 (0%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTD-KDILGEGDT 469
           +E FEFQAE+++LM +IIN++YSNK+IFLRELISNASDALDKIR+ SL+D K +  E D 
Sbjct: 3   SETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYKSLSDPKQLETEPDL 62

Query: 470 AXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQ 649
                                GIGMTK +L+ NLGTIAKSGT AF+E + +  D+++IGQ
Sbjct: 63  FIRITPKPEQKVLEIRDS---GIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMIGQ 119

Query: 650 FGVGFYSVYLVADYVE 697
           FGVGFYS++LVAD V+
Sbjct: 120 FGVGFYSLFLVADRVQ 135



>gb:AY214170_2519611 Paralichthys olivaceus heat shock protein 90
           beta mRNA, complete cds.
          Length = 726

 Score =  140 bits (352), Expect = 3e-32
 Identities = 76/134 (56%), Positives = 91/134 (67%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ Y NKDIFLR LISNASDALDKIR+ SLT+   +  G   
Sbjct: 11  AETFAFQAEIAQLMSLIINTFYFNKDIFLRVLISNASDALDKIRYESLTEPTKMDSGKDL 70

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 71  KIDIIPNKEDRTLTLIDT--GIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 128

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YLVA+ V
Sbjct: 129 GVGFYSAYLVAEKV 142



>gb:AF384807_1794538 Cryptococcus bacillisporus heat-shock protein
           90 gene, complete cds.
          Length = 699

 Score =  140 bits (352), Expect = 3e-32
 Identities = 77/135 (57%), Positives = 94/135 (69%), Gaps = 1/135 (0%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+S+L+D+IIN+ YSNK+IFLRELISN+SDALDKIR+ +LTD   L   DT  
Sbjct: 4   ETFGFQAEISQLLDLIINTFYSNKEIFLRELISNSSDALDKIRYAALTDPSQL---DTEK 60

Query: 476 XXXXXXX-XXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK +LV NLGTIAKSGT AF+E + S  D+++IGQF
Sbjct: 61  DLYIRIIPNKEEGTLTIRDTGIGMTKAELVNNLGTIAKSGTKAFMEALSSGADISMIGQF 120

Query: 653 GVGFYSVYLVADYVE 697
           GVGFYS YLVA+ V+
Sbjct: 121 GVGFYSSYLVAEKVQ 135



>sp|Q90474|HS9A_BRARE Heat shock protein HSP
           90-alpha.>gb:AF068773_2471524 Danio rerio heat shock
           protein hsp90alpha mRNA, complete cds.
          Length = 726

 Score =  140 bits (352), Expect = 3e-32
 Identities = 75/133 (56%), Positives = 91/133 (68%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L       
Sbjct: 16  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDS--CKD 73

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 74  LKIELIPDQKERTLTIIDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 133

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 134 VGFYSAYLVAEKV 146



>gb:AY292370_1316663 Toxoplasma gondii HSP90 mRNA, complete
           cds.>gb:AY344115_1321313 Toxoplasma gondii heat shock
           protein 90 mRNA, complete cds.
          Length = 708

 Score =  139 bits (351), Expect = 4e-32
 Identities = 74/136 (54%), Positives = 93/136 (68%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A  E F F A++ +LM +IIN+ YSNK+IFLRELISNASDALDKIR+ ++TD + L   +
Sbjct: 2   ADTETFAFNADIQQLMSLIINTFYSNKEIFLRELISNASDALDKIRYEAITDPEKLKGAE 61

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGMTK +LV NLGTIA+SGT AF+E +Q+ GD+++IG
Sbjct: 62  RLFIRIVPNKQNNTLTIEDD--GIGMTKAELVNNLGTIARSGTKAFMEALQAGGDISMIG 119

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVAD V
Sbjct: 120 QFGVGFYSAYLVADKV 135



>gb:AF006546_1231320 Drosophila pseudoobscura bogotana strain
           bogota73 82 kDa heat shock protein (Hsp82) gene, partial
           cds.
          Length = 269

 Score =  139 bits (351), Expect = 4e-32
 Identities = 75/134 (55%), Positives = 89/134 (66%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GI MTK D V N GT AKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIXMTKXDXVNNXGTXAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>gb:OSJN00065_1694212 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0085F13, complete
           sequence.>gb:OSJN00073_1694329 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0027H06, complete
           sequence.
          Length = 703

 Score =  139 bits (350), Expect = 5e-32
 Identities = 75/136 (55%), Positives = 92/136 (67%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A  E F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF SLTDK  L    
Sbjct: 10  AEKETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP 69

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 G+GMTK DLV NLGTIA+SGT  F+E +Q+  D+++IG
Sbjct: 70  ELFIRLVPYKPSKTLSIIDS--GVGMTKSDLVNNLGTIARSGTKEFMEALQAGADVSMIG 127

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVA+ V
Sbjct: 128 QFGVGFYSAYLVAEKV 143



>gb:CR382124_1656903 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 713

 Score =  139 bits (350), Expect = 5e-32
 Identities = 73/134 (54%), Positives = 95/134 (70%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E +EFQAE+++LM +IIN++YSNK+IFLRELISNASDALDKIR+ SL+D  +L       
Sbjct: 5   ETYEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQSLSDPKVL--ETEPE 62

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK +L+ NLGTIAKSGT AF+E + +  D+++IGQFG
Sbjct: 63  LFIRITPRPEEKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMIGQFG 122

Query: 656 VGFYSVYLVADYVE 697
           VGFYS++LVAD V+
Sbjct: 123 VGFYSLFLVADRVQ 136



>gb:AY368905_1602942 Nicotiana benthamiana molecular chaperone
           Hsp90-2 mRNA, complete cds.
          Length = 699

 Score =  139 bits (350), Expect = 5e-32
 Identities = 76/136 (55%), Positives = 92/136 (67%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A AE F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF SLTDK  L    
Sbjct: 2   AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA-- 59

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGMTK DLV NLGTIA+SGT  F+E + +  D+++IG
Sbjct: 60  QPELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIG 119

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVA+ V
Sbjct: 120 QFGVGFYSAYLVAERV 135



>gb:AY368904_1602941 Nicotiana benthamiana molecular chaperone
           Hsp90-1 mRNA, complete cds.
          Length = 699

 Score =  139 bits (350), Expect = 5e-32
 Identities = 76/136 (55%), Positives = 92/136 (67%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A AE F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF SLTDK  L    
Sbjct: 2   AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA-- 59

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGMTK DLV NLGTIA+SGT  F+E + +  D+++IG
Sbjct: 60  QPELFIHIIPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIG 119

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVA+ V
Sbjct: 120 QFGVGFYSAYLVAEKV 135



>gb:YSCHSC82_1729344 S. cerevisiae HSC82 gene encoding hsc82, the
           constitutive homolog of the hsp82 heat shock protein,
           complete cds.
          Length = 705

 Score =  139 bits (349), Expect = 6e-32
 Identities = 75/135 (55%), Positives = 97/135 (71%), Gaps = 1/135 (0%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTD-KDILGEGDTA 472
           E FEFQAE+++LM +IIN++YSNK+IFLRELISNASDALDKIR+ +L+D K +  E D  
Sbjct: 4   ETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQALSDPKQLETEPDLF 63

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK +L+ NLGTIAKSGT AF+E + +  D+++IGQF
Sbjct: 64  IRITPKPEEKVLEIRDS---GIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMIGQF 120

Query: 653 GVGFYSVYLVADYVE 697
           GVGFYS++LVAD V+
Sbjct: 121 GVGFYSLFLVADRVQ 135



>gb:AY368906_1602943 Lycopersicon esculentum molecular chaperone
           Hsp90-1 mRNA, complete cds.
          Length = 699

 Score =  139 bits (349), Expect = 6e-32
 Identities = 75/136 (55%), Positives = 92/136 (67%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A AE F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF SLTDK  L    
Sbjct: 2   AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFQSLTDKSKLDA-- 59

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 G+GMTK DLV NLGTIA+SGT  F+E + +  D+++IG
Sbjct: 60  QPELFIHIVPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEAIAAGADVSMIG 119

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVA+ V
Sbjct: 120 QFGVGFYSAYLVAERV 135



>gb:BPAJ5784_1355849 Brugia pahangi mRNA for heat shock protein 90.
          Length = 717

 Score =  139 bits (349), Expect = 6e-32
 Identities = 74/133 (55%), Positives = 91/133 (68%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ +LT+   L  G    
Sbjct: 8   ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYQALTEPAELETGKELY 67

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 68  IKITPNKADKTLTIMDT--GIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFG 125

Query: 656 VGFYSVYLVADYV 694
            GFYS +LVAD V
Sbjct: 126 AGFYSAFLVADKV 138



>gb:AF151114_1245425 Tetrahymena thermophila strain B2086 hsp82 heat
           shock protein (HSP82) mRNA, partial cds.
          Length = 699

 Score =  139 bits (349), Expect = 6e-32
 Identities = 71/132 (53%), Positives = 91/132 (68%)
 Frame = +2

Query: 302 FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAXXX 481
           F F+A++ +LM +IIN+ YSNK+IFLRELISNASDALDKIR++S+TD +           
Sbjct: 1   FAFEADIQQLMGLIINTFYSNKEIFLRELISNASDALDKIRYISITDSEKAKLEVEPNFR 60

Query: 482 XXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVG 661
                            GIGMTK++L+ NLGTIAKSGT AF+E + S  D+++IGQFGVG
Sbjct: 61  IRIIPDKANNTLTLWDTGIGMTKKELINNLGTIAKSGTKAFMEALSSGADISMIGQFGVG 120

Query: 662 FYSVYLVADYVE 697
           FYS YLVA+ VE
Sbjct: 121 FYSAYLVAEKVE 132



>pir|S55133|S55133 heat shock protein HSC82 - yeast (Saccharomyces
           cerevisiae)>gb:SC8010_1705407 S.cerevisiae chromosome
           XIII cosmid 8010.
          Length = 705

 Score =  139 bits (349), Expect = 6e-32
 Identities = 75/135 (55%), Positives = 97/135 (71%), Gaps = 1/135 (0%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTD-KDILGEGDTA 472
           E FEFQAE+++LM +IIN++YSNK+IFLRELISNASDALDKIR+ +L+D K +  E D  
Sbjct: 4   ETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQALSDPKQLETEPDLF 63

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK +L+ NLGTIAKSGT AF+E + +  D+++IGQF
Sbjct: 64  IRITPKPEEKVLEIRDS---GIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMIGQF 120

Query: 653 GVGFYSVYLVADYVE 697
           GVGFYS++LVAD V+
Sbjct: 121 GVGFYSLFLVADRVQ 135



>sp|P15108|HS83_YEAST Heat shock cognate protein HSC82.
          Length = 704

 Score =  139 bits (349), Expect = 6e-32
 Identities = 75/135 (55%), Positives = 97/135 (71%), Gaps = 1/135 (0%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTD-KDILGEGDTA 472
           E FEFQAE+++LM +IIN++YSNK+IFLRELISNASDALDKIR+ +L+D K +  E D  
Sbjct: 3   ETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQALSDPKQLETEPDLF 62

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK +L+ NLGTIAKSGT AF+E + +  D+++IGQF
Sbjct: 63  IRITPKPEEKVLEIRDS---GIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMIGQF 119

Query: 653 GVGFYSVYLVADYVE 697
           GVGFYS++LVAD V+
Sbjct: 120 GVGFYSLFLVADRVQ 134



>gb:AX250459_1464827 Sequence 65 from Patent WO0168863.
          Length = 234

 Score =  138 bits (348), Expect = 8e-32
 Identities = 75/139 (53%), Positives = 93/139 (66%)
 Frame = +2

Query: 278 TLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG 457
           T  A AE F FQAE+++L+ +IIN+ YSNK+IFLR+LISN+SDALDKIRF SLTDK  L 
Sbjct: 4   TKMAEAETFAFQAEINQLLSLIINTFYSNKEIFLRQLISNSSDALDKIRFQSLTDKSKLD 63

Query: 458 EGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLN 637
                                    G+GMTK DLV NLGTIA+SGT  F+E + +  D++
Sbjct: 64  A--QPELFIHIVPDKANNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEAIAAGADVS 121

Query: 638 LIGQFGVGFYSVYLVADYV 694
           +IGQFGVGFYS YLVA+ V
Sbjct: 122 MIGQFGVGFYSAYLVAERV 140



>gb:AE014297_1141800 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003763_1223793 Drosophila melanogaster
           chromosome 3R, section 101 of 118 of the complete
           sequence.>gb:AY075384_1296204 Drosophila melanogaster
           LD23641 full length cDNA.
          Length = 787

 Score =  138 bits (348), Expect = 8e-32
 Identities = 84/182 (46%), Positives = 108/182 (59%), Gaps = 14/182 (7%)
 Frame = +2

Query: 191 VEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEFQAEVSRLMDIII 346
           ++  +G    G  TD +  KRE E++          + +R  A+KF FQ EV+R+M +II
Sbjct: 30  IDLDLGSFKEGSRTDAETLKREEEAIQLDGLNVAQLKEIREKAKKFTFQTEVNRMMKLII 89

Query: 347 NSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAXXXXXXXXXXXXXXXXXX 526
           NSLY NK+IFLRELISNASDA+DKIR L+L++   L                        
Sbjct: 90  NSLYRNKEIFLRELISNASDAIDKIRLLALSNSKELETNPELHIRIKADKENKALHIMDS 149

Query: 527 XRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSG-----DLN-LIGQFGVGFYSVYLVAD 688
             GIGMT +DL+ NLGTIAKSGT+ F+ KMQ        D+N +IGQFGVGFYS +LVAD
Sbjct: 150 --GIGMTHQDLINNLGTIAKSGTADFLAKMQDPSKSEGLDMNDMIGQFGVGFYSAFLVAD 207

Query: 689 YV 694
            V
Sbjct: 208 RV 209



>sp|P41887|HS90_SCHPO Heat shock protein 90
           homolog.>pir|T39202|T39202 heat shock protein 90 homolog
           - fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC926_1718474 S.pombe chromosome I cosmid
           c926.
          Length = 704

 Score =  138 bits (348), Expect = 8e-32
 Identities = 76/138 (55%), Positives = 93/138 (67%), Gaps = 1/138 (0%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL-GEG 463
           +  E F+F+AE+S+LM +IIN++YSNK+IFLRELISNASDALDKIR+ SL+D   L  E 
Sbjct: 2   SNTETFKFEAEISQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQSLSDPHALDAEK 61

Query: 464 DTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLI 643
           D                      GIGMTK DL+ NLG IAKSGT  F+E   S  D+++I
Sbjct: 62  DLFIRITPDKENKILSIRDT---GIGMTKNDLINNLGVIAKSGTKQFMEAAASGADISMI 118

Query: 644 GQFGVGFYSVYLVADYVE 697
           GQFGVGFYS YLVAD V+
Sbjct: 119 GQFGVGFYSAYLVADKVQ 136



>gb:AF421541_1798873 Crypthecodinium cohnii Hsp90 mRNA, complete
           cds.
          Length = 711

 Score =  138 bits (347), Expect = 1e-31
 Identities = 73/134 (54%), Positives = 91/134 (67%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F F A++ +LM +IIN+ YSNK+IFLRELISNASDALDKIR+ S+TD + +      
Sbjct: 2   AETFAFNADIQQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESITDPEKIEAQPNF 61

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK +L+ NLGTIAKSGT AF+E M + GD+++IGQF
Sbjct: 62  FIKIIPDKTNNTLTIEDS--GIGMTKNELINNLGTIAKSGTKAFMEAMAAGGDISMIGQF 119

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YLVAD +
Sbjct: 120 GVGFYSGYLVADKI 133



>gb:AY325266_1599615 Hordeum vulgare cytosolic heat shock protein 90
           (HSP90) mRNA, complete cds.
          Length = 700

 Score =  138 bits (347), Expect = 1e-31
 Identities = 74/133 (55%), Positives = 90/133 (67%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF SLTDK  L       
Sbjct: 6   ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELF 65

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DLV NLGTIA+SGT  F+E + +  D+++IGQFG
Sbjct: 66  IHIIPDKATSTLTIVDS--GIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFG 123

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 124 VGFYSAYLVAERV 136



>gb:AF006547_1231321 Drosophila pseudoobscura bogotana strain
           bogota74 82 kDa heat shock protein (Hsp82) gene, partial
           cds.
          Length = 269

 Score =  138 bits (347), Expect = 1e-31
 Identities = 75/134 (55%), Positives = 88/134 (65%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE   FQAE++    +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETXAFQAEIAXXXSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GI MTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIXMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>gb:HUMHSP86B_2032210 Human heat shock protein 86 mRNA, 5'end.
          Length = 312

 Score =  137 bits (346), Expect = 1e-31
 Identities = 74/133 (55%), Positives = 90/133 (67%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKI + SLTD   L  G    
Sbjct: 18  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIWYESLTDPSKLDSGKELH 77

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 78  INLIPNKQDQTLTIVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 135

Query: 656 VGFYSVYLVADYV 694
           V FYS YLVA+ V
Sbjct: 136 VSFYSAYLVAEKV 148



>gb:AP004557_1841527 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0028A08.
          Length = 785

 Score =  137 bits (346), Expect = 1e-31
 Identities = 77/151 (50%), Positives = 100/151 (66%), Gaps = 4/151 (2%)
 Frame = +2

Query: 254 EAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLS 433
           +A    K    A  EKFE+QAEVSRLMD+I++SLYS+K++FLREL+SNASDALDK+RFL 
Sbjct: 62  DAAVAEKAEETAEEEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNASDALDKLRFLG 121

Query: 434 LTDKDILGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEK 613
           +TD  +L +G                       GIGMTK++L   LGTIA+SGTS F++ 
Sbjct: 122 VTDSSLLADG--GELEIRIKPDPDAGTITITDTGIGMTKDELKDCLGTIAQSGTSKFLKA 179

Query: 614 MQSSGDL----NLIGQFGVGFYSVYLVADYV 694
           ++ + DL     LIGQFGVGFYS +LVA+ V
Sbjct: 180 LKENKDLGADNGLIGQFGVGFYSAFLVAEKV 210



>gb:AY519499_1610933 Nicotiana tabacum heat shock protein 90
           (OINtHsp90) mRNA, complete cds.
          Length = 699

 Score =  137 bits (346), Expect = 1e-31
 Identities = 74/136 (54%), Positives = 91/136 (66%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A  E F FQAE+++L+ +IIN+ YSNK++FLRELISN+SDALDKIRF SLTDK  L    
Sbjct: 2   ADTETFAFQAEINQLLSLIINTFYSNKEVFLRELISNSSDALDKIRFESLTDKSKLDA-- 59

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGMTK DLV NLGTIA+SGT  F+E + +  D+++IG
Sbjct: 60  QPELFIHIIPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIG 119

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVA+ V
Sbjct: 120 QFGVGFYSAYLVAEKV 135



>gb:AY459430_1328241 Eimeria acervulina isolate 12 heat shock
           protein 90 (Hsp90) gene, complete cds.
          Length = 712

 Score =  137 bits (346), Expect = 1e-31
 Identities = 73/133 (54%), Positives = 91/133 (68%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F F A++ +LM +IIN+ YSNK+IFLRELISNASDALDKIR+ ++TD + L       
Sbjct: 5   ETFAFNADIQQLMSLIINTFYSNKEIFLRELISNASDALDKIRYEAITDPEKLKTKPELF 64

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK +LV NLGTIA+SGT AF+E +Q+ GD+++IGQFG
Sbjct: 65  IRLIPDKANNTLTIEDS--GIGMTKAELVNNLGTIARSGTKAFMEALQAGGDISMIGQFG 122

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVAD V
Sbjct: 123 VGFYSAYLVADSV 135



>gb:AY459429_1328240 Eimeria acervulina clone 62 heat shock protein
           90 (Hsp90) mRNA, complete cds.
          Length = 712

 Score =  137 bits (346), Expect = 1e-31
 Identities = 73/133 (54%), Positives = 91/133 (68%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F F A++ +LM +IIN+ YSNK+IFLRELISNASDALDKIR+ ++TD + L       
Sbjct: 5   ETFAFNADIQQLMSLIINTFYSNKEIFLRELISNASDALDKIRYEAITDPEKLKTKPELF 64

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK +LV NLGTIA+SGT AF+E +Q+ GD+++IGQFG
Sbjct: 65  IRLIPDKANNTLTIEDS--GIGMTKAELVNNLGTIARSGTKAFMEALQAGGDISMIGQFG 122

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVAD V
Sbjct: 123 VGFYSAYLVADSV 135



>gb:AY335220_1320679 Drosophila willistoni heat shock protein 83
           (Hsp83) gene, partial cds.
          Length = 336

 Score =  137 bits (346), Expect = 1e-31
 Identities = 74/126 (58%), Positives = 87/126 (69%)
 Frame = +2

Query: 317 EVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAXXXXXXXX 496
           E+++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G           
Sbjct: 1   EIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDSTKLESGKELYIKLIPNK 60

Query: 497 XXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFYSVY 676
                       GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQFGVGFYS Y
Sbjct: 61  TAGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAY 118

Query: 677 LVADYV 694
           LVAD V
Sbjct: 119 LVADKV 124



>pir|JQ0129|JQ0129 86K heat shock protein IV - human (fragment)
          Length = 311

 Score =  137 bits (346), Expect = 1e-31
 Identities = 74/133 (55%), Positives = 90/133 (67%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKI + SLTD   L  G    
Sbjct: 18  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIWYESLTDPSKLDSGKELH 77

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 78  INLIPNKQDQTLTIVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 135

Query: 656 VGFYSVYLVADYV 694
           V FYS YLVA+ V
Sbjct: 136 VSFYSAYLVAEKV 148



>sp|O44001|HS90_EIMTE Heat shock protein 90.>gb:AF042329_1235807
           Eimeria tenella heat shock protein 90 (hsp90) mRNA,
           complete cds.
          Length = 713

 Score =  137 bits (346), Expect = 1e-31
 Identities = 73/133 (54%), Positives = 91/133 (68%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F F A++ +LM +IIN+ YSNK+IFLRELISNASDALDKIR+ ++T+ + L       
Sbjct: 5   ETFAFNADIQQLMSLIINTFYSNKEIFLRELISNASDALDKIRYEAITEPEKLKTKPELF 64

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DLV NLGTIA+SGT AF+E +Q+ GD+++IGQFG
Sbjct: 65  IRLIPDKANNTLTIENS--GIGMTKADLVNNLGTIARSGTKAFMEALQAGGDISMIGQFG 122

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVAD V
Sbjct: 123 VGFYSAYLVADSV 135



>sp|P33126|HS82_ORYSA Heat shock protein 82.>pir|S25541|S25541 heat
           shock protein 82 - rice (strain Taichung Native
           One)>gb:OSHSP82A_1693039 O.sativa gene for heat shock
           protein 82 HSP82.>gb:AP003873_1834630 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1118_A06.>gb:AP003892_1834893 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1345_D02.
          Length = 699

 Score =  137 bits (346), Expect = 1e-31
 Identities = 74/133 (55%), Positives = 90/133 (67%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF SLTDK  L       
Sbjct: 6   ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELF 65

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DLV NLGTIA+SGT  F+E + +  D+++IGQFG
Sbjct: 66  IHIVPDKASNTLSIIDS--GIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFG 123

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 124 VGFYSAYLVAERV 136



>gb:AP005392_1850979 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0463D04.
          Length = 699

 Score =  137 bits (345), Expect = 2e-31
 Identities = 73/133 (54%), Positives = 90/133 (67%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF SLTDK  L       
Sbjct: 6   ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA--QPE 63

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              G+GMTK DLV NLGTIA+SGT  F+E + +  D+++IGQFG
Sbjct: 64  LFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFG 123

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 124 VGFYSAYLVAERV 136



>gb:AP005392_1850976 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0463D04.
          Length = 699

 Score =  137 bits (345), Expect = 2e-31
 Identities = 73/133 (54%), Positives = 90/133 (67%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF SLTDK  L       
Sbjct: 6   ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA--QPE 63

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              G+GMTK DLV NLGTIA+SGT  F+E + +  D+++IGQFG
Sbjct: 64  LFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFG 123

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 124 VGFYSAYLVAERV 136



>gb:TAX98582_1724804 T.aestivum mRNA for HSP80-2 protein.
          Length = 700

 Score =  137 bits (345), Expect = 2e-31
 Identities = 74/133 (55%), Positives = 90/133 (67%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF SLTDK  L       
Sbjct: 6   ETFAFQAEINQLLSLIINTSYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELF 65

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DLV NLGTIA+SGT  F+E + +  D+++IGQFG
Sbjct: 66  IHIIPDKATSTLTIVDS--GIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFG 123

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 124 VGFYSAYLVAERV 136



>gb:HTOHSP82_1682178 Histoplasma capsulatum heat shock protein 82
           (hsp82) gene, complete cds.
          Length = 677

 Score =  137 bits (345), Expect = 2e-31
 Identities = 75/134 (55%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           +E FEFQAE+S+L+ +IIN++YSNK+IFLRELISN SDALDKIR+ +L+D   L E D  
Sbjct: 3   SETFEFQAEISQLLSLIINTVYSNKEIFLRELISNFSDALDKIRYKALSDPSKL-ESDKD 61

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIA+SGT  F+E + +  D+++IGQF
Sbjct: 62  LRIDITPDKENKTLTIRDT-GIGMTKADLVNNLGTIARSGTKQFMEALTAGADISMIGQF 120

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YLVAD V
Sbjct: 121 GVGFYSAYLVADKV 134



>gb:CR382129_1661636 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 704

 Score =  137 bits (345), Expect = 2e-31
 Identities = 74/136 (54%), Positives = 97/136 (71%), Gaps = 1/136 (0%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTD-KDILGEGDT 469
           +E +EF AE+S+LM +IIN++YSNK+IFLRELISNASDALDKIR+ +L+D K +  E + 
Sbjct: 8   SESYEFTAEISQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQALSDPKQLETEPEL 67

Query: 470 AXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQ 649
                                GIGMTK DLV NLGTIAKSGT +F+E + +  D+++IGQ
Sbjct: 68  FIRLTPNKGLKTFEIRDT---GIGMTKADLVNNLGTIAKSGTKSFMEALSAGADVSMIGQ 124

Query: 650 FGVGFYSVYLVADYVE 697
           FGVGFYS++LVAD V+
Sbjct: 125 FGVGFYSLFLVADRVQ 140



>gb:AB111810_1527129 Oryza sativa (japonica cultivar-group) Hsp90
           mRNA for heat shock protein 90, complete cds.
          Length = 699

 Score =  137 bits (345), Expect = 2e-31
 Identities = 73/133 (54%), Positives = 90/133 (67%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF SLTDK  L       
Sbjct: 6   ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA--QPE 63

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              G+GMTK DLV NLGTIA+SGT  F+E + +  D+++IGQFG
Sbjct: 64  LFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFG 123

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 124 VGFYSAYLVAERV 136



>gb:AY226087_1310851 Leucosolenia sp. 90-kDa heat-shock protein
           (hsp90) mRNA, partial cds.
          Length = 572

 Score =  137 bits (345), Expect = 2e-31
 Identities = 74/126 (58%), Positives = 87/126 (69%)
 Frame = +2

Query: 317 EVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAXXXXXXXX 496
           E+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L  G           
Sbjct: 1   EIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSRLDSGKELKIEIIPDR 60

Query: 497 XXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFYSVY 676
                       GIGMTK DLV NLGTIAKSGT AF+E +QS  D+++IGQFGVGFYS Y
Sbjct: 61  ENNTLTLIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQSGADISMIGQFGVGFYSAY 118

Query: 677 LVADYV 694
           LVAD V
Sbjct: 119 LVADRV 124



>sp|P33125|HS82_AJECA Heat shock protein 82.>pir|S21764|S21764 heat
           shock protein 82 - Ajellomyces capsulata
          Length = 679

 Score =  137 bits (345), Expect = 2e-31
 Identities = 75/134 (55%), Positives = 93/134 (69%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           +E FEFQAE+S+L+ +IIN++YSNK+IFLRELISN SDALDKIR+ +L+D   L E D  
Sbjct: 3   SETFEFQAEISQLLSLIINTVYSNKEIFLRELISNFSDALDKIRYKALSDPSKL-ESDKD 61

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GIGMTK DLV NLGTIA+SGT  F+E + +  D+++IGQF
Sbjct: 62  LRIDITPDKENKTLTIRDT-GIGMTKADLVNNLGTIARSGTKQFMEALTAGADISMIGQF 120

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YLVAD V
Sbjct: 121 GVGFYSAYLVADKV 134



>sp|P36181|HS80_LYCES Heat shock cognate protein
           80.>pir|T07037|T07037 heat shock protein 80 -
           tomato>gb:AY368907_1602944 Lycopersicon esculentum
           molecular chaperone Hsp90-2 mRNA, complete
           cds.>gb:TOMHSC80P_1725660 Tomato heat shock cognate
           protein 80 gene, 3' end.
          Length = 699

 Score =  137 bits (345), Expect = 2e-31
 Identities = 75/133 (56%), Positives = 92/133 (69%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF SLTDK  L +G    
Sbjct: 5   ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKL-DGQPEL 63

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DLV NLGTIA+SGT  F+E + +  D+++IGQFG
Sbjct: 64  FIHIIPDKANNTLTIIDS-GIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQFG 122

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 123 VGFYSAYLVAEKV 135



>gb:CR382136_1669062 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 705

 Score =  137 bits (344), Expect = 2e-31
 Identities = 75/137 (54%), Positives = 93/137 (67%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A  E  EF AE+S+LM +IIN++YSNK+IFLRELISNASDALDKIR+ +L D   L    
Sbjct: 4   AKVETHEFTAEISQLMSLIINTVYSNKEIFLRELISNASDALDKIRYEALADPSKLETEP 63

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGMTK DLV NLGTIAKSGT AF+E + +  D+++IG
Sbjct: 64  ELFIRLTPRPEEKVLEIRDT--GIGMTKADLVNNLGTIAKSGTKAFMEALSAGADVSMIG 121

Query: 647 QFGVGFYSVYLVADYVE 697
           QFGVGFYS++LVAD+V+
Sbjct: 122 QFGVGFYSLFLVADHVQ 138



>gb:CR380958_1653091 Candida glabrata strain CBS138 chromosome L
           complete sequence.
          Length = 705

 Score =  137 bits (344), Expect = 2e-31
 Identities = 73/136 (53%), Positives = 98/136 (72%), Gaps = 1/136 (0%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTD-KDILGEGDT 469
           +E FEFQAE+++LM +IIN++YSNK+IFLRELISNASDA+DKIR+ +L+D K +  E + 
Sbjct: 2   SETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDAIDKIRYQALSDPKQLETEPE- 60

Query: 470 AXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQ 649
                                GIGMTK +L+ NLGTIAKSGT AF+E + +  D+++IGQ
Sbjct: 61  --LFIRITPRPEEKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMIGQ 118

Query: 650 FGVGFYSVYLVADYVE 697
           FGVGFYS++LVAD V+
Sbjct: 119 FGVGFYSLFLVADRVQ 134



>gb:AY226086_1310850 Clypeatula cooperensis 90-kDa heat-shock
           protein (hsp90) mRNA, partial cds.
          Length = 297

 Score =  137 bits (344), Expect = 2e-31
 Identities = 73/128 (57%), Positives = 90/128 (70%), Gaps = 1/128 (0%)
 Frame = +2

Query: 317 EVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAXXXXXXXX 496
           E+++LM +IIN+ YSNK++FLRELISNASDALDKIR++SLTD  +L   DT         
Sbjct: 1   EIAQLMSLIINTFYSNKEVFLRELISNASDALDKIRYMSLTDPSVL---DTQKELKITII 57

Query: 497 -XXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFYSV 673
                        GIGMTK DLV NLGTIAKSGT  F+E +Q+  D+++IGQFGVGFYS 
Sbjct: 58  PNKDDNTITIIDTGIGMTKADLVNNLGTIAKSGTRQFMEALQAGADISMIGQFGVGFYSA 117

Query: 674 YLVADYVE 697
           YLVAD V+
Sbjct: 118 YLVADSVQ 125



>gb:AY226081_1310845 Monosiga brevicollis 90-kDa heat-shock protein
           (hsp90) mRNA, partial cds.
          Length = 697

 Score =  137 bits (344), Expect = 2e-31
 Identities = 73/127 (57%), Positives = 90/127 (70%)
 Frame = +2

Query: 317 EVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAXXXXXXXX 496
           E+++LM +IIN+ YSNK+IFLRE+ISNASDALDKIR+ SLTD  +L E +          
Sbjct: 1   EIAQLMSLIINTFYSNKEIFLREIISNASDALDKIRYQSLTDPSVL-EAEKELKIDLIPN 59

Query: 497 XXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFYSVY 676
                       GIGMTK DLV NLGTIAKSGT +F+E +Q+  D+++IGQFGVGFYS Y
Sbjct: 60  KEAKTLTISDT-GIGMTKADLVNNLGTIAKSGTKSFMEALQAGADISMIGQFGVGFYSAY 118

Query: 677 LVADYVE 697
           LVAD VE
Sbjct: 119 LVADTVE 125



>gb:AB092407_1198780 Giardia intestinalis gene for cytosolic-type
           hsp90, partial cds, N-terminal region.
          Length = 347

 Score =  137 bits (344), Expect = 2e-31
 Identities = 74/135 (54%), Positives = 91/135 (67%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE FEFQAE+S+LM++IIN+ YS+K+IFLRELISNASDALDK+ F SLT   +LG+    
Sbjct: 3   AEVFEFQAEISQLMNLIINTFYSSKEIFLRELISNASDALDKLHFTSLTRPSVLGK--QK 60

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               G+GMTK DL+  LGTIAKSG   F+E +    D++LIGQF
Sbjct: 61  DLKVDVIPREKDNILVIRDTGVGMTKADLINCLGTIAKSGAKQFMEMISEGADVSLIGQF 120

Query: 653 GVGFYSVYLVADYVE 697
           GVGFYS YLVA+ VE
Sbjct: 121 GVGFYSAYLVAEKVE 135



>sp|P46598|HS90_CANAL Heat shock protein 90
           homolog.>gb:CAHSP90_1644916 C.albicans hsp90 gene.
          Length = 707

 Score =  137 bits (344), Expect = 2e-31
 Identities = 74/137 (54%), Positives = 94/137 (68%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A  E  EF AE+S+LM +IIN++YSNK+IFLRELISNASDALDKIR+ +L+D   L    
Sbjct: 4   AKVETHEFTAEISQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQALSDPSQLESEP 63

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGMTK DLV NLGTIAKSGT +F+E + +  D+++IG
Sbjct: 64  ELFIRIIPQKDQKVLEIRDS--GIGMTKADLVNNLGTIAKSGTKSFMEALSAGADVSMIG 121

Query: 647 QFGVGFYSVYLVADYVE 697
           QFGVGFYS++LVAD+V+
Sbjct: 122 QFGVGFYSLFLVADHVQ 138



>gb:AY226092_1310856 Mnemiopsis leidyi 90-kDa heat-shock protein
           (hsp90) mRNA, partial cds.
          Length = 279

 Score =  136 bits (343), Expect = 3e-31
 Identities = 73/128 (57%), Positives = 90/128 (70%), Gaps = 1/128 (0%)
 Frame = +2

Query: 317 EVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL-GEGDTAXXXXXXX 493
           E+++LM +IIN+ YSNK+IF+RELISNASDALDKIR+ SLTD  +L GE D         
Sbjct: 1   EIAQLMSLIINTFYSNKEIFVRELISNASDALDKIRYQSLTDPSVLEGEKDLEIKIIPNK 60

Query: 494 XXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFYSV 673
                        G+GMTK DLV NLGTIAKSGT +F+E + +  D+++IGQFGVGFYS 
Sbjct: 61  DDNTLSFYDT---GVGMTKADLVNNLGTIAKSGTKSFMEALSAGADISMIGQFGVGFYSA 117

Query: 674 YLVADYVE 697
           YLVAD VE
Sbjct: 118 YLVADKVE 125



>gb:AY226088_1310852 Scypha sp. AR-2003 90-kDa heat-shock protein
           (hsp90) mRNA, partial cds.
          Length = 572

 Score =  136 bits (343), Expect = 3e-31
 Identities = 73/126 (57%), Positives = 87/126 (69%)
 Frame = +2

Query: 317 EVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAXXXXXXXX 496
           E+++LM +IIN+ YSNK+IFLREL+SN+SDALDKIR+ SLTD   L  G           
Sbjct: 1   EIAQLMSLIINTFYSNKEIFLRELVSNSSDALDKIRYESLTDPSRLDSGKDLKIDIVPDR 60

Query: 497 XXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFYSVY 676
                       GIGMTK DLV NLGTIAKSGT AF+E +QS  D+++IGQFGVGFYS Y
Sbjct: 61  ESNTLTIWDT--GIGMTKADLVNNLGTIAKSGTKAFMEALQSGADISMIGQFGVGFYSAY 118

Query: 677 LVADYV 694
           LVAD V
Sbjct: 119 LVADRV 124



>gb:AY335221_1320680 Drosophila nebulosa heat shock protein 83
           (Hsp83) gene, partial cds.
          Length = 345

 Score =  136 bits (342), Expect = 4e-31
 Identities = 73/125 (58%), Positives = 86/125 (68%)
 Frame = +2

Query: 320 VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAXXXXXXXXX 499
           +++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G            
Sbjct: 1   IAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDSSKLESGKELYIKLIPNKT 60

Query: 500 XXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFYSVYL 679
                      GIGMTK DLV NLGTIAKSGT AF+E +Q+  D+++IGQFGVGFYS YL
Sbjct: 61  AGTLTIIDT--GIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYL 118

Query: 680 VADYV 694
           VAD V
Sbjct: 119 VADKV 123



>pir|A48426|A48426 heat shock protein HSP82 - maize
          Length = 715

 Score =  136 bits (342), Expect = 4e-31
 Identities = 76/137 (55%), Positives = 91/137 (66%), Gaps = 1/137 (0%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A  E F FQAE+++L+ +IIN+ YSNK+IFLRELISNASDALDKIRF SLTDK  L    
Sbjct: 12  AETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDA-- 69

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSG-DLNLI 643
                                 G+GMTK DLV NLGTIA+SGT  F+E + +   D+++I
Sbjct: 70  QPELFIRLVPDKASKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGATDVSMI 129

Query: 644 GQFGVGFYSVYLVADYV 694
           GQFGVGFYS YLVAD V
Sbjct: 130 GQFGVGFYSAYLVADRV 146



>gb:AF006548_1231322 Drosophila pseudoobscura bogotana strain
           bogota77 82 kDa heat shock protein (Hsp82) gene, partial
           cds.
          Length = 269

 Score =  135 bits (341), Expect = 5e-31
 Identities = 74/134 (55%), Positives = 87/134 (64%)
 Frame = +2

Query: 293 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTA 472
           AE F FQAE++  M +IIN+ YSN +IFLRELISNASDALDKIR+ SLTD   L  G   
Sbjct: 5   AETFAFQAEIAXXMSLIINTFYSNXEIFLRELISNASDALDKIRYESLTDPSKLDSGKEL 64

Query: 473 XXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQF 652
                               GI MT  DLV  LGTIAKSGT AF+E +Q+  D+++IGQF
Sbjct: 65  YIKLIPNKTAGTLTIIDT--GIXMTXSDLVNXLGTIAKSGTKAFMEALQAGADISMIGQF 122

Query: 653 GVGFYSVYLVADYV 694
           GVGFYS YL+AD V
Sbjct: 123 GVGFYSAYLIADRV 136



>sp|Q08277|HS82_MAIZE Heat shock protein 82.>gb:S59780_1704330 Zea
           mays heat shock protein HSP82 (hsp82) gene, complete
           cds.
          Length = 715

 Score =  135 bits (340), Expect = 7e-31
 Identities = 75/137 (54%), Positives = 91/137 (66%), Gaps = 1/137 (0%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A  E F FQAE+++L+ +IIN+ YSNK+IFLRELISNASDALDKIRF SLTDK  +    
Sbjct: 12  AETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSNVNA-- 69

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSG-DLNLI 643
                                 G+GMTK DLV NLGTIA+SGT  F+E + +   D+++I
Sbjct: 70  QPELFIRLVPDKASKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGATDVSMI 129

Query: 644 GQFGVGFYSVYLVADYV 694
           GQFGVGFYS YLVAD V
Sbjct: 130 GQFGVGFYSAYLVADRV 146



>gb:AF136649_1244024 Babesia bovis heat shock protein 90 (HSP90)
           mRNA, complete cds.
          Length = 712

 Score =  135 bits (339), Expect = 9e-31
 Identities = 72/136 (52%), Positives = 91/136 (66%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD 466
           A  E + F A++S+L+ +IIN+ YSNK+IFLRELISNASDAL+KIR+ ++  KD     D
Sbjct: 4   AQQETYAFNADISQLLSLIINAFYSNKEIFLRELISNASDALEKIRYEAI--KDPKQVED 61

Query: 467 TAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIG 646
                                 GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IG
Sbjct: 62  FPEYQISLSADKTNKTLTIEDTGIGMTKTDLINNLGTIAKSGTKAFMEAIQAGADMSMIG 121

Query: 647 QFGVGFYSVYLVADYV 694
           QFGVGFYS YLVAD V
Sbjct: 122 QFGVGFYSAYLVADKV 137



>pir|S51795|S51795 heat shock protein 90 - fission yeast
           (Schizosaccharomyces pombe)>gb:YSPHSP90X_1731130
           Schizosaccharomyces pombe heat shock protein 90 (Hsp90)
           gene, complete cds.
          Length = 704

 Score =  135 bits (339), Expect = 9e-31
 Identities = 75/138 (54%), Positives = 91/138 (65%), Gaps = 1/138 (0%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL-GEG 463
           +  E F+F  E+S+LM +IIN++YSNK+IFLRELISNASDALDKIR+ SL+D   L  E 
Sbjct: 2   SNTETFKFDWEISQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQSLSDPHALDAEK 61

Query: 464 DTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLI 643
           D                      GIGMTK DL+ NLG IAKSGT  F+E   S  D+++I
Sbjct: 62  DLFIRITPDKENKILTIRDT---GIGMTKNDLINNLGVIAKSGTKQFMEAAASGADISMI 118

Query: 644 GQFGVGFYSVYLVADYVE 697
           GQFGVGFYS YLVAD V+
Sbjct: 119 GQFGVGFYSAYLVADKVQ 136



>gb:AY077617_1567843 Oryza sativa HSP90-like protein mRNA, complete
           cds.
          Length = 266

 Score =  134 bits (338), Expect = 1e-30
 Identities = 73/138 (52%), Positives = 91/138 (65%)
 Frame = +2

Query: 272 KRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDI 451
           +R + +  E F FQAE+++L+ +IIN+ YSNK+IFLRELISN+S ALDKIRF SLTDK  
Sbjct: 91  ERIMASETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSYALDKIRFESLTDKSK 150

Query: 452 LGEGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGD 631
           L                          GIGMTK DLV NLGTIA+SGT  F+E + +  D
Sbjct: 151 LDAQPELFIHIVPDKASNTLSIIDS--GIGMTKSDLVNNLGTIARSGTKEFMEALAAGAD 208

Query: 632 LNLIGQFGVGFYSVYLVA 685
           +++IGQFGVGFYS YLVA
Sbjct: 209 VSMIGQFGVGFYSAYLVA 226



>gb:AY226090_1310854 Nematostella vectensis 90-kDa heat-shock
           protein (hsp90) mRNA, partial cds.
          Length = 574

 Score =  134 bits (338), Expect = 1e-30
 Identities = 70/126 (55%), Positives = 87/126 (69%)
 Frame = +2

Query: 317 EVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAXXXXXXXX 496
           E+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+LSLTD  +L              
Sbjct: 1   EIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYLSLTDPSVLDS--CKDLKITLIP 58

Query: 497 XXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFYSVY 676
                       G+GMTK DLV NLGTIAKSGT  F+E +Q+  D+++IGQFGVGFYS Y
Sbjct: 59  NKEENSLTIQDSGVGMTKADLVNNLGTIAKSGTKTFMEALQAGADISMIGQFGVGFYSAY 118

Query: 677 LVADYV 694
           LVA+ V
Sbjct: 119 LVAEKV 124



>gb:AF143855_1244465 Brachionus calyciflorus 82 kD heat shock
           protein (hsp82) gene, partial cds.
          Length = 281

 Score =  134 bits (337), Expect = 2e-30
 Identities = 72/125 (57%), Positives = 86/125 (68%)
 Frame = +2

Query: 320 VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAXXXXXXXXX 499
           +++LM +IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD   L  G            
Sbjct: 1   IAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPHKLDSGKELYIKIIPDKA 60

Query: 500 XXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFYSVYL 679
                      GIGMTK DLV NLGTIA+SGT AF+E +Q+  D+++IGQFGVGFYS YL
Sbjct: 61  TNTLTLIDT--GIGMTKADLVNNLGTIARSGTKAFMEALQAGADISMIGQFGVGFYSAYL 118

Query: 680 VADYV 694
           VAD V
Sbjct: 119 VADKV 123



>gb:CNSLT1IB5_1180704 human full-length cDNA 5-PRIME end of clone
           CS0DN005YI08 of Adult brain of Homo sapiens (human).
          Length = 262

 Score =  134 bits (337), Expect = 2e-30
 Identities = 71/125 (56%), Positives = 86/125 (68%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++LM +IIN+ YSNK+IFLRELISN+SDALDKIR+ SLTD   L  G    
Sbjct: 140 ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELH 199

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DL+ NLGTIAKSGT AF+E +Q+  D+++IGQFG
Sbjct: 200 INLIPNKQDRTLTIVDT--GIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFG 257

Query: 656 VGFYS 670
           VGFYS
Sbjct: 258 VGFYS 262



>gb:AF212996_1777692 Neurospora crassa heat shock protein 80 gene,
           complete cds.
          Length = 695

 Score =  134 bits (336), Expect = 2e-30
 Identities = 76/139 (54%), Positives = 94/139 (67%), Gaps = 3/139 (2%)
 Frame = +2

Query: 287 AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRF---LSLTDKDILG 457
           A AE FEFQAE+S+L+ +IIN++YSNK+IFLRELISNASDALDKIR+    S   K  L 
Sbjct: 2   ATAETFEFQAEISQLLSLIINTVYSNKEIFLRELISNASDALDKIRYEVPCSDPSKPGLL 61

Query: 458 EGDTAXXXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLN 637
           +  ++                    GIGMTK DLV NLGTIA+SGT  F+E + +  D++
Sbjct: 62  QDHSSIDIIPDKANKTLTIRDT---GIGMTKADLVNNLGTIARSGTKQFMEALTAGADIS 118

Query: 638 LIGQFGVGFYSVYLVADYV 694
           +IGQFGVGFYS YLVAD V
Sbjct: 119 MIGQFGVGFYSAYLVADRV 137



>gb:TAU55859_1724744 Triticum aestivum heat shock protein 80 mRNA,
           complete cds.
          Length = 700

 Score =  134 bits (336), Expect = 2e-30
 Identities = 73/133 (54%), Positives = 88/133 (66%)
 Frame = +2

Query: 296 EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAX 475
           E F FQAE+++L+ +IIN+ YSNK+IFLRELISNASDALDKIRF SLTDK  L       
Sbjct: 6   ETFAFQAEINQLLSLIINTSYSNKEIFLRELISNASDALDKIRFESLTDKSKLDA--QPE 63

Query: 476 XXXXXXXXXXXXXXXXXXRGIGMTKEDLVKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFG 655
                              GIGMTK DLV NL TI +SGT  F+E + +  D+++IGQFG
Sbjct: 64  LFIRIIPDKATNTLTLIDSGIGMTKSDLVNNLATIGRSGTKDFMEALAAGADVSMIGQFG 123

Query: 656 VGFYSVYLVADYV 694
           VGFYS YLVA+ V
Sbjct: 124 VGFYSAYLVAERV 136


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 711,756,968
Number of Sequences: 1806583
Number of extensions: 14474248
Number of successful extensions: 44091
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 42432
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 43406
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 40529209665
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)