BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig85
         (631 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY088311_1573331 Arabidopsis thaliana clone 5504 mRNA, comple...   205   4e-52   
pir|F84823|F84823 probable peroxisomal membrane carrier protein ...   205   4e-52   Arabidopsis thaliana [mouse-ear cress]
gb:AC135205_1742013 Oryza sativa (japonica cultivar-group) chrom...   189   4e-47   
gb:AP004779_1844983 Oryza sativa (japonica cultivar-group) genom...   157   2e-37   
gb:AC116920_1206416 Dictyostelium discoideum chromosome 2 map 44...    88   1e-16   
gb:CR382127_1660321 Yarrowia lipolytica chromosome A of strain C...    83   4e-15   
gb:NCB7N14_1690215 Neurospora crassa DNA linkage group II BAC cl...    74   2e-12   
gb:CR382139_1672605 Debaryomyces hansenii chromosome G of strain...    69   8e-11   
gb:AE017347_1757975 Cryptococcus neoformans var. neoformans JEC2...    65   7e-10   
sp|P21245|P47A_CANBO|P47A_CANBO Peroxisomal membrane protein PMP47A.>pir|A2...    65   9e-10   [Candida] boidinii
gb:AE016819_1748982 Ashbya gossypii (= Eremothecium gossypii) AT...    64   3e-09   
gb:AY084815_1569898 Arabidopsis thaliana clone 118596 mRNA, comp...    63   4e-09   
gb:CBU53145_1645702 Candida boidinii peroxisome membrane protein...    63   5e-09   
sp|Q00319|P47B_CANBO|P47B_CANBO Peroxisomal membrane protein PMP47B.>pir|S5...    63   5e-09   [Candida] boidinii
gb:NC3H10_1688523 Neurospora crassa DNA linkage group V Cosmid c...    60   3e-08   
gb:BT010139_1640205 Arabidopsis thaliana At5g66380 gene, complet...    60   3e-08   
gb:AJ720399_2502586 Gallus gallus mRNA for hypothetical protein,...    58   1e-07   
gb:CR380957_1652615 Candida glabrata strain CBS138 chromosome K ...    58   1e-07   
gb:BC072270_2556522 Xenopus laevis hypothetical protein LOC44357...    57   3e-07   
gb:AE017344_1756366 Cryptococcus neoformans var. neoformans JEC2...    57   3e-07   
gb:AX453492_1468810 Sequence 53 from Patent WO0242455.                 56   4e-07   
gb:AE013599_1130810 Drosophila melanogaster chromosome 2R, compl...    56   4e-07   
gb:AE013599_1130809 Drosophila melanogaster chromosome 2R, compl...    56   4e-07   
gb:AC096689_1736274 Oryza sativa chromosome 3 BAC OSJNBa0027J18 ...    55   1e-06   
gb:AE014296_1134731 Drosophila melanogaster chromosome 3L, compl...    54   2e-06   
pir|T50159|T50159 mitochondrial carrier protein [imported] - fis...    54   2e-06   Schizosaccharomyces pombe
pir|S44092|S44092 probable carrier protein c2 - Caenorhabditis e...    54   2e-06   Caenorhabditis elegans [roundworm]
gb:AE016817_1747335 Ashbya gossypii (= Eremothecium gossypii) AT...    54   3e-06   
gb:BT001624_1356397 Drosophila melanogaster RE36975 full insert ...    54   3e-06   
gb:BC074516_2558011 Xenopus tropicalis MGC69279 protein, mRNA (c...    53   4e-06   
gb:BC059349_2552384 Xenopus laevis hypothetical protein MGC69168...    53   4e-06   
gb:AC107085_1738327 Oryza sativa (japonica cultivar-group) chrom...    53   4e-06   
pir|S54495|S54495 probable carrier protein YPR021c - yeast (Sacc...    53   4e-06   Saccharomyces cerevisiae [brewer's yeast]
sp|P40464|FLX1_YEAST|FLX1_YEAST Mitochondrial FAD carrier protein FLX1.>pir...    53   5e-06   Saccharomyces cerevisiae [brewer's yeast]
gb:CR382132_1665166 Yarrowia lipolytica chromosome F of strain C...    52   6e-06   
gb:CR382130_1663399 Yarrowia lipolytica chromosome D of strain C...    52   6e-06   
gb:CR382125_1657335 Kluyveromyces lactis strain NRRL Y-1140 chro...    52   6e-06   
gb:CQ871238_1454653 Sequence 7 from Patent WO2004078112.               52   6e-06   
pir|T05350|T05350 adenylate translocator brittle-1 homolog F8B4....    52   6e-06   Arabidopsis thaliana [mouse-ear cress]
sp|O70579|PM34_MOUSE|PM34_MOUSE Peroxisomal membrane protein PMP34 (34 kDa ...    52   6e-06   Mus musculus [mouse]
gb:AY560327_1614883 Hordeum vulgare subsp. vulgare plastidial AD...    52   8e-06   
gb:BC087370_2565215 Xenopus laevis hypothetical LOC495984, mRNA ...    52   1e-05   
gb:AE017347_1758054 Cryptococcus neoformans var. neoformans JEC2...    52   1e-05   
gb:AC104272_1737352 Oryza sativa (japonica cultivar-group) chrom...    52   1e-05   
gb:CR382137_1669893 Debaryomyces hansenii chromosome E of strain...    52   1e-05   
gb:AJ720830_2503017 Gallus gallus mRNA for hypothetical protein,...    51   1e-05   
gb:AK002829_1151477 Mus musculus adult male kidney cDNA, RIKEN f...    51   1e-05   
sp|O43808|PM34_HUMAN|PM34_HUMAN Peroxisomal membrane protein PMP34 (34 kDa ...    51   1e-05   Homo sapiens [man]
gb:BC084385_2563765 Xenopus laevis hypothetical LOC495171, mRNA ...    51   2e-05   
gb:BC016571_2092379 Mus musculus solute carrier family 25 (mitoc...    51   2e-05   
gb:AP004045_1836827 Oryza sativa (japonica cultivar-group) genom...    51   2e-05   
gb:AK012670_1157094 Mus musculus 10, 11 days embryo whole body c...    51   2e-05   
pir|T23170|T23170 hypothetical protein K01C8.7 - Caenorhabditis ...    51   2e-05   Caenorhabditis elegans [roundworm]
sp|Q9QXX4|CMC2_MOUSE|CMC2_MOUSE Calcium-binding mitochondrial carrier prote...    51   2e-05   Mus musculus [mouse]
gb:AX880684_1478377 Sequence 15589 from Patent EP1074617.>gb:AK0...    50   2e-05   
gb:AX453448_1468806 Sequence 9 from Patent WO0242455.                  50   2e-05   
gb:AE014296_1135890 Drosophila melanogaster chromosome 3L, compl...    50   2e-05   
gb:AE014134_1127042 Drosophila melanogaster chromosome 2L, compl...    50   2e-05   
sp|Q9H2D1|MFTC_HUMAN|MFTC_HUMAN Mitochondrial folate transporter/carrier.>g...    50   2e-05   Homo sapiens [man]
gb:AF055463_2052650 Mus musculus peroxisomal integral membrane p...    50   3e-05   
gb:BC016932_1975807 Homo sapiens solute carrier family 25 (mitoc...    50   3e-05   
gb:AC002535_1530841 Arabidopsis thaliana chromosome 2 clone T30B...    50   3e-05   
gb:AX879835_1478005 Sequence 14740 from Patent EP1074617.              50   3e-05   
gb:CR858723_1182877 Pongo pygmaeus mRNA; cDNA DKFZp468M1513 (fro...    50   3e-05   
sp|O75746|CMC1_HUMAN|CMC1_HUMAN Calcium-binding mitochondrial carrier prote...    50   3e-05   Homo sapiens [man]
gb:HSA496569_2007650 Homo sapiens mRNA for mitochondrial asparta...    50   4e-05   
gb:HOS17571_1996294 Homo sapiens mRNA for mitochondrial carrier ...    50   4e-05   
gb:AB083329_1871866 Macaca fascicularis slc25a13 mRNA for solute...    50   4e-05   
gb:AB062964_1868955 Macaca fascicularis brain cDNA clone:QmoA-10...    50   4e-05   
gb:AB060253_1868687 Macaca fascicularis brain cDNA clone:QtrA-11...    50   4e-05   
gb:AE016817_1747376 Ashbya gossypii (= Eremothecium gossypii) AT...    50   4e-05   
gb:CR382129_1661560 Yarrowia lipolytica chromosome C of strain C...    50   4e-05   
gb:AY093232_1575186 Arabidopsis thaliana unknown protein (At1g25...    50   4e-05   
sp|Q95J75|MFTC_MACFA|MFTC_MACFA Mitochondrial folate transporter/carrier.>g...    50   4e-05   Macaca fascicularis [crab eating macaque]
sp|Q9UJS0|CMC2_HUMAN|CMC2_HUMAN Calcium-binding mitochondrial carrier prote...    50   4e-05   Homo sapiens [man]
gb:CR382137_1669871 Debaryomyces hansenii chromosome E of strain...    49   5e-05   
sp|Q8BH59|CMC1_MOUSE|CMC1_MOUSE Calcium-binding mitochondrial carrier prote...    49   5e-05   Mus musculus [mouse]
gb:BC076521_2559349 Danio rerio zgc:92447, mRNA (cDNA clone MGC:...    49   7e-05   
gb:AF283645_1894677 Homo sapiens folate transporter/carrier mRNA...    49   7e-05   
gb:AK053646_1170509 Mus musculus 0 day neonate eyeball cDNA, RIK...    49   7e-05   
sp|Q21153|CMC1_CAEEL|CMC1_CAEEL Probable calcium-binding mitochondrial carr...    49   7e-05   Caenorhabditis elegans [roundworm]
gb:AY611603_2086858 Cricetulus griseus mitochondrial folate tran...    49   9e-05   
gb:NCB13O20_1689219 Neurospora crassa DNA linkage group V BAC cl...    48   1e-04   
gb:DMEY18197_1379514 Drosophila melanogaster mRNA for mitochondr...    48   1e-04   
gb:AE014297_1142184 Drosophila melanogaster chromosome 3R, compl...    48   1e-04   
gb:AE014297_1142183 Drosophila melanogaster chromosome 3R, compl...    48   1e-04   
sp|Q9VA73|CMC1_DROME|CMC1_DROME Calcium-binding mitochondrial carrier Arala...    48   1e-04   Drosophila melanogaster
gb:BC031874_2097283 Mus musculus mitochondrial folate transporte...    48   2e-04   
gb:BC014064_1974369 Homo sapiens hypothetical protein FLJ10618, ...    48   2e-04   
gb:CR382125_1658281 Kluyveromyces lactis strain NRRL Y-1140 chro...    48   2e-04   
gb:AX876835_1476714 Sequence 11740 from Patent EP1074617.>gb:AK0...    48   2e-04   
gb:AX453452_1468808 Sequence 13 from Patent WO0242455.                 48   2e-04   
gb:AX453450_1468807 Sequence 11 from Patent WO0242455.                 48   2e-04   
gb:AC115584_1205707 Dictyostelium discoideum chromosome 2 map co...    48   2e-04   
pir|T40033|T40033 probable mitochondrial FAD carrier protein - f...    48   2e-04   Schizosaccharomyces pombe
sp|Q8BMG8|MFTC_MOUSE|MFTC_MOUSE Mitochondrial folate transporter/carrier.>g...    48   2e-04   Mus musculus [mouse]
gb:AE016818_1747896 Ashbya gossypii (= Eremothecium gossypii) AT...    47   2e-04   
gb:CR382135_1668366 Debaryomyces hansenii chromosome C of strain...    47   2e-04   
gb:CR380959_1653875 Candida glabrata strain CBS138 chromosome M ...    47   2e-04   
gb:SPAC688_1718215 S.pombe chromosome I cosmid c688.                   47   3e-04   
gb:AP005003_1847110 Oryza sativa (japonica cultivar-group) genom...    47   3e-04   
gb:AE017343_1755509 Cryptococcus neoformans var. neoformans JEC2...    47   3e-04   
gb:CR382131_1663579 Yarrowia lipolytica chromosome E of strain C...    47   3e-04   
gb:AX453490_1468809 Sequence 51 from Patent WO0242455.>gb:BC0480...    47   3e-04   
sp|P38127|RIM2_YEAST|RIM2_YEAST Mitochondrial carrier protein RIM2.>pir|S36...    47   3e-04   Saccharomyces cerevisiae [brewer's yeast]
gb:BC057495_2552126 Danio rerio solute carrier family 25 (mitoch...    46   5e-04   
gb:BC087106_2109999 Rattus norvegicus cDNA clone MGC:94707 IMAGE...    46   5e-04   
gb:AC087553_1734115 Oryza sativa (japonica cultivar-group) chrom...    46   5e-04   
sp|P29518|BT1_MAIZE|BT1_MAIZE Brittle-1 protein, chloroplast precursor.>pi...    46   5e-04   Zea mays [maize]
gb:AB093647_1872213 Macaca fascicularis brain cDNA clone:QflA-20...    46   6e-04   
gb:CR382125_1657818 Kluyveromyces lactis strain NRRL Y-1140 chro...    46   6e-04   
gb:AP003615_1831435 Oryza sativa (japonica cultivar-group) genom...    45   8e-04   
gb:CR380950_1649856 Candida glabrata strain CBS138 chromosome D ...    45   8e-04   
gb:AX705226_1473542 Sequence 17 from Patent WO03014353.>gb:AE016...    45   8e-04   
pir|T00435|T00435 probable mitochondrial carrier protein [import...    45   8e-04   Arabidopsis thaliana [mouse-ear cress]
gb:XLA289240_2582516 Xenopus laevis mRNA for peroxisomal membran...    45   0.001   
gb:BC068966_2555458 Xenopus laevis peroxisomal membrane protein ...    45   0.001   
gb:AL627107_1931027 Human DNA sequence from clone XXyac-R12DG2 o...    45   0.001   
gb:CR382122_1655295 Kluyveromyces lactis strain NRRL Y-1140 chro...    45   0.001   
gb:AJ720037_2502224 Gallus gallus mRNA for hypothetical protein,...    45   0.001   
gb:AE017341_1754628 Cryptococcus neoformans var. neoformans JEC2...    45   0.001   
gb:CR380956_1652067 Candida glabrata strain CBS138 chromosome J ...    45   0.001   
gb:CR380953_1651003 Candida glabrata strain CBS138 chromosome G ...    45   0.001   
gb:AC079374_1732559 Arabidopsis thaliana chromosome 1 BAC F4F7 g...    44   0.002   
gb:AF310895_1261397 Dictyostelium discoideum RIM (rimA) and RacI...    44   0.002   
gb:AK077111_1171667 Mus musculus adult male testis cDNA, RIKEN f...    44   0.002   
gb:CR382126_1658556 Kluyveromyces lactis strain NRRL Y-1140 chro...    44   0.002   
gb:AB013389_1512041 Arabidopsis thaliana genomic DNA, chromosome...    44   0.002   
gb:AE014134_1127739 Drosophila melanogaster chromosome 2L, compl...    44   0.002   
gb:AE014134_1127738 Drosophila melanogaster chromosome 2L, compl...    44   0.002   
gb:AJ720306_2502493 Gallus gallus mRNA for hypothetical protein,...    44   0.003   
gb:BC022676_2093856 Mus musculus solute carrier family 25, membe...    44   0.003   
gb:AY063892_1565839 Arabidopsis thaliana unknown protein (At5g27...    44   0.003   
gb:AK015679_1158455 Mus musculus adult male testis cDNA, RIKEN f...    44   0.003   
gb:HS20I3_1997479 Human DNA sequence from clone RP1-20I3 on chro...    43   0.004   
gb:AF155811_1886677 Homo sapiens mitochondrial uncoupling protei...    43   0.004   
gb:AF155810_1886676 Homo sapiens mitochondrial uncoupling protei...    43   0.004   
sp|O95258|UCP5_HUMAN|UCP5_HUMAN Brain mitochondrial carrier protein-1 (BMCP...    43   0.004   Homo sapiens [man]
gb:AB028879_2044525 Rattus norvegicus BMCP1 mRNA for brain mitoc...    42   0.007   
gb:AC150162_1745056 Solanum demissum chromosome 5 clone PGEC160O...    42   0.007   
gb:CR382138_1671058 Debaryomyces hansenii chromosome F of strain...    42   0.007   
gb:AY088489_1573508 Arabidopsis thaliana clone 7124 mRNA, comple...    42   0.007   
gb:ATAC009177_1542867 Arabidopsis thaliana chromosome III BAC T1...    42   0.007   
gb:AB042429_1519887 Triticum aestivum WhUCP1b mRNA for uncouplin...    42   0.007   
gb:AB016885_1513123 Arabidopsis thaliana genomic DNA, chromosome...    42   0.007   
pir|T04273|T04273 hypothetical protein F20B18.290 - Arabidopsis ...    42   0.007   Arabidopsis thaliana [mouse-ear cress]
pir|JC7553|JC7553 brain mitochondrial carrier protein-1 - rat>gb...    42   0.007   Rattus norvegicus [brown rat]
gb:BC011293_2091362 Mus musculus RIKEN cDNA 5730438N18 gene, mRN...    42   0.009   
gb:AP002970_1824027 Oryza sativa (japonica cultivar-group) genom...    42   0.009   
gb:AB189674_1529556 Philodendron bipinnatifidum PbUCPa mRNA for ...    42   0.009   
gb:AB088762_1524791 Helicodiceros muscivorus HmUCPa mRNA for mit...    42   0.009   
gb:AB019236_1514251 Arabidopsis thaliana genomic DNA, chromosome...    42   0.009   
gb:AB017063_1513347 Arabidopsis thaliana genomic DNA, chromosome...    42   0.009   
gb:AB042428_1519886 Triticum aestivum WhUCP1a mRNA for uncouplin...    42   0.011   
pir|T21149|T21149 hypothetical protein F20D1.9 - Caenorhabditis ...    42   0.011   Caenorhabditis elegans [roundworm]
gb:AF535151_2067731 Mus musculus brain mitochondrial carrier pro...    41   0.015   
gb:AF535150_2067730 Mus musculus brain mitochondrial carrier pro...    41   0.015   
gb:AF076981_2053591 Mus musculus brain mitochondrial carrier pro...    41   0.015   
gb:AP003334_1828137 Oryza sativa (japonica cultivar-group) genom...    41   0.015   
gb:AP003334_1828136 Oryza sativa (japonica cultivar-group) genom...    41   0.015   
gb:AY644460_1619789 Saccharum officinarum mitochondrial uncoupli...    41   0.015   
gb:AY054689_1563343 Arabidopsis thaliana Unknown protein (AT4g15...    41   0.015   
gb:AC116925_1206488 Dictyostelium discoideum chromosome 2 map 41...    41   0.015   
sp|Q9Z2B2|UCP5_MOUSE|UCP5_MOUSE Brain mitochondrial carrier protein-1 (BMCP...    41   0.015   Mus musculus [mouse]
gb:BC031671_1980220 Homo sapiens hypothetical protein MGC34725, ...    41   0.019   
gb:AK097761_1914975 Homo sapiens cDNA FLJ40442 fis, clone TESTI2...    41   0.019   
gb:AF495714_1905238 Homo sapiens mitochondrial carrier protein m...    41   0.019   
gb:AE016820_1749890 Ashbya gossypii (= Eremothecium gossypii) AT...    41   0.019   
gb:AP004869_1846306 Oryza sativa (japonica cultivar-group) genom...    40   0.025   
gb:AP002483_1822209 Oryza sativa (japonica cultivar-group) genom...    40   0.025   
gb:BC056716_2551909 Danio rerio zgc:65787, mRNA (cDNA clone MGC:...    40   0.032   
gb:CR382131_1663747 Yarrowia lipolytica chromosome E of strain C...    40   0.032   
gb:CR382130_1662581 Yarrowia lipolytica chromosome D of strain C...    40   0.032   
gb:AB024734_1516047 Symplocarpus foetidus mRNA for SfUCPb, compl...    40   0.032   
gb:AB024733_1516046 Symplocarpus foetidus mRNA for SfUCPa, compl...    40   0.032   
gb:AE014296_1136883 Drosophila melanogaster chromosome 3L, compl...    40   0.032   
gb:BC084458_2563832 Xenopus tropicalis cDNA clone MGC:89262 IMAG...    40   0.042   
gb:BC063207_2553479 Xenopus tropicalis hypothetical protein LOC3...    40   0.042   
gb:AP002900_1823705 Oryza sativa (japonica cultivar-group) genom...    40   0.042   
gb:AE017350_1759155 Cryptococcus neoformans var. neoformans JEC2...    40   0.042   
gb:NC20H10_1688473 Neurospora crassa DNA linkage group V Cosmid ...    40   0.042   
gb:AB189672_1529554 Dracunculus vulgaris DvUCPa mRNA for uncoupl...    40   0.042   
gb:AY094704_1297878 Drosophila melanogaster GH11346 full insert ...    40   0.042   
gb:AE014297_1139113 Drosophila melanogaster chromosome 3R, compl...    40   0.042   
gb:AE014296_1134790 Drosophila melanogaster chromosome 3L, compl...    40   0.042   
pir|T49871|T49871 peroxisomal Ca-dependent solute carrier-like p...    40   0.042   Arabidopsis thaliana [mouse-ear cress]
pir|T40968|T40968 probable mitochondrial carrier protein - fissi...    40   0.042   Schizosaccharomyces pombe
gb:CR382127_1660151 Yarrowia lipolytica chromosome A of strain C...    39   0.055   
gb:CR382124_1656764 Kluyveromyces lactis strain NRRL Y-1140 chro...    39   0.055   
pir|T47570|T47570 uncoupling protein [imported] - Arabidopsis th...    39   0.055   Arabidopsis thaliana [mouse-ear cress]
pir|T52024|T52024 uncoupling protein [imported] - Arabidopsis th...    39   0.055   Arabidopsis thaliana [mouse-ear cress]
gb:BC013194_1974008 Homo sapiens hypothetical protein FLJ20551, ...    39   0.072   
gb:AK054901_1911376 Homo sapiens cDNA FLJ30339 fis, clone BRACE2...    39   0.072   
gb:AK000558_1908000 Homo sapiens cDNA FLJ20551 fis, clone KAT11656.    39   0.072   
gb:AJ619962_1907003 Homo sapiens partial mRNA for mitochondrial ...    39   0.072   
gb:AB049997_1520935 Oryza sativa (japonica cultivar-group) OsUCP...    39   0.072   
gb:AX817352_1475896 Sequence 100 from Patent WO02081517.               39   0.072   
gb:CQ782543_1452030 Sequence 2683 from Patent EP1396543.>gb:AK07...    39   0.072   
gb:BC072926_2556850 Xenopus laevis MGC80420 protein, mRNA (cDNA ...    39   0.094   
gb:CR382124_1656951 Kluyveromyces lactis strain NRRL Y-1140 chro...    39   0.094   
gb:AK007934_1154290 Mus musculus 10 day old male pancreas cDNA, ...    39   0.094   
pir|T07793|T07793 uncoupling protein (clone StUCP7), mitochonria...    39   0.094   Solanum tuberosum [potatoes]
gb:BC088076_2565587 Xenopus tropicalis hypothetical LOC496786, m...    38   0.12    
gb:AP004622_1842244 Oryza sativa (japonica cultivar-group) genom...    38   0.12    
gb:AF472619_1803087 Lycopersicon esculentum putative uncoupling ...    38   0.12    
gb:AY062478_1565134 Arabidopsis thaliana putative protein (F5K20...    38   0.12    
gb:AF216971_1251846 Trichomonas vaginalis hydrogenosomal membran...    38   0.12    
pir|T43493|T43493 hypothetical protein DKFZp434C119.1 - human>gb...    38   0.12    Homo sapiens [man]
sp|Q9BZJ4|CG69_HUMAN|CG69_HUMAN Mitochondrial carrier protein CGI-69 (PRO21...    38   0.12    Homo sapiens [man]
gb:BC046767_2099350 Mus musculus solute carrier family 25 (mitoc...    38   0.16    
gb:CR382134_1667348 Debaryomyces hansenii chromosome B of strain...    38   0.16    
gb:CR382131_1664134 Yarrowia lipolytica chromosome E of strain C...    38   0.16    
gb:CR380958_1653156 Candida glabrata strain CBS138 chromosome L ...    38   0.16    
gb:AF043695_1235931 Caenorhabditis elegans cosmid C42C1, complet...    38   0.16    
gb:AK017628_1159245 Mus musculus 8 days embryo whole body cDNA, ...    38   0.16    
sp|P40556|YIA6_YEAST|YIA6_YEAST Putative mitochondrial carrier YIL006W.>pir...    38   0.16    Saccharomyces cerevisiae [brewer's yeast]
sp|Q9DAM5|DNC_MOUSE|DNC_MOUSE Mitochondrial deoxynucleotide carrier.>gb:AK...    38   0.16    Mus musculus [mouse]
gb:BC055369_2102017 Mus musculus solute carrier family 25 (mitoc...    37   0.21    
gb:BC022637_2093833 Mus musculus solute carrier family 25 (mitoc...    37   0.21    
gb:AK032806_1163075 Mus musculus 12 days embryo male wolffian du...    37   0.21    
gb:AE014296_1134789 Drosophila melanogaster chromosome 3L, compl...    37   0.21    
sp|P39953|YEA6_YEAST|YEA6_YEAST Putative mitochondrial carrier YEL006W.>pir...    37   0.21    Saccharomyces cerevisiae [brewer's yeast]
gb:BX649502_2567819 Zebrafish DNA sequence from clone DKEY-204F1...    37   0.27    
gb:AF151827_1886313 Homo sapiens CGI-69 protein mRNA, complete c...    37   0.27    
gb:AP001080_1820751 Oryza sativa (japonica cultivar-group) genom...    37   0.27    
gb:AE017345_1756867 Cryptococcus neoformans var. neoformans JEC2...    37   0.27    
gb:AE016819_1748966 Ashbya gossypii (= Eremothecium gossypii) AT...    37   0.27    
gb:AE016814_1745865 Ashbya gossypii (= Eremothecium gossypii) AT...    37   0.27    
gb:AX453443_1468804 Sequence 4 from Patent WO0242455.                  37   0.27    
gb:AE013599_1131793 Drosophila melanogaster chromosome 2R, compl...    37   0.27    
gb:AE014134_1127737 Drosophila melanogaster chromosome 2L, compl...    37   0.27    
gb:AE005172_890450 Arabidopsis thaliana chromosome 1, top arm co...    37   0.27    
pir|G86383|G86383 probable mitochondrial carrier protein [import...    37   0.27    Arabidopsis thaliana [mouse-ear cress]
gb:BC073249_2557101 Xenopus laevis MGC80594 protein, mRNA (cDNA ...    37   0.36    
gb:BC083723_2108796 Rattus norvegicus cDNA clone MGC:94620 IMAGE...    37   0.36    
gb:BC072660_2106623 Mus musculus RIKEN cDNA 2310067G05 gene, mRN...    37   0.36    
gb:AE017350_1759100 Cryptococcus neoformans var. neoformans JEC2...    37   0.36    
gb:SPBC12D12_1718900 S.pombe chromosome II cosmid c12D12.              37   0.36    
gb:CR382121_1654671 Kluyveromyces lactis strain NRRL Y-1140 chro...    37   0.36    
pir|T39385|T39385 probable mitochondrial carrier protein - fissi...    37   0.36    Schizosaccharomyces pombe
gb:BC045395_2549235 Danio rerio zgc:55596, mRNA (cDNA clone MGC:...    36   0.47    
gb:AK176097_1818085 Arabidopsis thaliana mRNA, complete cds, clo...    36   0.47    
gb:AY088459_1573478 Arabidopsis thaliana clone 6836 mRNA, comple...    36   0.47    
gb:AY085360_1570431 Arabidopsis thaliana clone 147875 mRNA, comp...    36   0.47    
gb:AY058876_1564412 Arabidopsis thaliana AT5g26200/T19G15_50 mRN...    36   0.47    
pir|T01839|T01839 hypothetical protein F9D12.12 - Arabidopsis th...    36   0.47    Arabidopsis thaliana [mouse-ear cress]
pir|B96811|B96811 hypothetical protein T11I11.12 [imported] - Ar...    36   0.47    Arabidopsis thaliana [mouse-ear cress]
pir|T37992|T37992 probable tricarboxylate transport protein - fi...    36   0.47    Schizosaccharomyces pombe
sp|Q03829|YM39_YEAST|YM39_YEAST Putative mitochondrial carrier YMR166C.>pir...    36   0.47    Saccharomyces cerevisiae [brewer's yeast]
gb:AL450998_1928075 Human DNA sequence from clone RP11-169K16 on...    36   0.61    
gb:AF155773_1772990 Gibberella moniliformis fumonisin biosynthet...    36   0.61    
gb:CR382131_1664907 Yarrowia lipolytica chromosome E of strain C...    36   0.61    
gb:CR382130_1662412 Yarrowia lipolytica chromosome D of strain C...    36   0.61    
gb:AY048991_1561800 Cryptococcus neoformans var. neoformans puta...    36   0.61    
gb:AE014297_1139114 Drosophila melanogaster chromosome 3R, compl...    36   0.61    
pir|T32897|T32897 hypothetical protein C42C1.10 - Caenorhabditis...    36   0.61    Caenorhabditis elegans [roundworm]
gb:AY394951_2531694 Danio rerio clone RK050A1F10 solute carrier ...    35   0.80    
gb:BC089627_2110960 Mus musculus cDNA clone MGC:107701 IMAGE:675...    35   0.80    
gb:AE017343_1755942 Cryptococcus neoformans var. neoformans JEC2...    35   0.80    
gb:AE016817_1747420 Ashbya gossypii (= Eremothecium gossypii) AT...    35   0.80    
gb:AC137608_1743479 Oryza sativa (japonica cultivar-group) chrom...    35   0.80    
gb:CR382137_1670429 Debaryomyces hansenii chromosome E of strain...    35   0.80    
gb:CR382128_1661239 Yarrowia lipolytica chromosome B of strain C...    35   0.80    
gb:AY183458_1587909 Yarrowia lipolytica mitochondrial ADP/ATP ca...    35   0.80    
gb:AY078922_1568083 Arabidopsis thaliana At2g46320/F11C10.1 mRNA...    35   0.80    
gb:AB010069_1510860 Arabidopsis thaliana genomic DNA, chromosome...    35   0.80    
pir|T37603|T37603 probable oxaloacetate transport protein, mitoc...    35   0.80    Schizosaccharomyces pombe
gb:AE016816_1746799 Ashbya gossypii (= Eremothecium gossypii) AT...    35   1.0     
gb:D89102_1675220 Schizosaccharomyces pombe mRNA, partial cds, c...    35   1.0     
gb:CR382126_1658489 Kluyveromyces lactis strain NRRL Y-1140 chro...    35   1.0     
gb:BT020813_1436171 Bos taurus hypothetical protein FLJ20551 (FL...    35   1.0     
gb:BT020652_1436010 Bos taurus hypothetical protein FLJ20551 (FL...    35   1.0     
gb:BT020649_1436007 Bos taurus hypothetical protein FLJ20551 (FL...    35   1.0     
gb:AF119864_1150048 Homo sapiens PRO2163 mRNA, complete cds.           35   1.0     
pir|T42011|T42011 ADP,ATP carrier protein - fission yeast (Schiz...    35   1.0     Schizosaccharomyces pombe
sp|Q9W725|UCP2_CYPCA|UCP2_CYPCA Mitochondrial uncoupling protein 2 (UCP 2)....    35   1.0     Cyprinus carpio [carp]
sp|Q09188|ADT_SCHPO|ADT_SCHPO ADP,ATP carrier protein (ADP/ATP translocase...    35   1.0     Schizosaccharomyces pombe
gb:BC070531_2555513 Xenopus laevis hypothetical protein MGC78829...    35   1.4     
gb:AP003246_1826180 Oryza sativa (japonica cultivar-group) genom...    35   1.4     
gb:BT005998_1638920 Arabidopsis thaliana At3g20240 gene, complet...    35   1.4     
gb:AY087444_1572475 Arabidopsis thaliana clone 35499 mRNA, compl...    35   1.4     
gb:AY085067_1570149 Arabidopsis thaliana clone 126140 mRNA, comp...    35   1.4     
gb:U64842_1405725 Caenorhabditis elegans cosmid F25B4, complete ...    35   1.4     
gb:AC115606_1205896 Dictyostelium discoideum chromosome 2 map 15...    35   1.4     
gb:HSM801771_1186436 Homo sapiens mRNA; cDNA DKFZp434M1820 (from...    35   1.4     
gb:AE014298_1126466 Drosophila melanogaster chromosome X, comple...    35   1.4     
pir|T25728|T25728 hypothetical protein F25B4.7 - Caenorhabditis ...    35   1.4     
pir|B96830|B96830 hypothetical protein F19K16.14 [imported] - Ar...    35   1.4     
pir|T01729|T01729 mitochondrial solute carrier protein homolog -...    35   1.4     
gb:BC076734_2559480 Xenopus laevis MGC81365 protein, mRNA (cDNA ...    34   1.8     
gb:BC044682_2548879 Xenopus laevis uncoupling protein 2, mRNA (c...    34   1.8     
gb:AF461732_1801832 Zea mays uncoupling protein mRNA, complete c...    34   1.8     
gb:AY144949_1583740 Saccharomyces castellii clone Contig1620 PET...    34   1.8     
gb:AB049998_1520936 Oryza sativa (japonica cultivar-group) OsUCP...    34   1.8     
gb:CR859581_1183690 Pongo pygmaeus mRNA; cDNA DKFZp459O044 (from...    34   1.8     
pir|T29640|T29640 mitochondrial carrier protein DIF-1 homolog - ...    34   1.8     
pir|H86274|H86274 F7A19.22 protein - Arabidopsis thaliana>gb:AE0...    34   1.8     
sp|Q27257|DIF1_CAEEL|DIF1_CAEEL Protein dif-1.>gb:CECARPRO_1361657 C.elegan...    34   1.8     
gb:BC084172_2563563 Xenopus tropicalis hypothetical LOC496457, m...    34   2.3     
gb:BC055226_2551305 Danio rerio zgc:63736, mRNA (cDNA clone MGC:...    34   2.3     
gb:AY665293_1958598 Macaca fascicularis mitochondrial solute car...    34   2.3     
gb:AC003083_1874481 Homo sapiens BAC clone CTB-60N22 from 7, com...    34   2.3     
gb:AP004689_1843438 Oryza sativa (japonica cultivar-group) genom...    34   2.3     
gb:CR380956_1652159 Candida glabrata strain CBS138 chromosome J ...    34   2.3     
gb:BT005018_1637964 Arabidopsis thaliana clone U50609 putative m...    34   2.3     
gb:AY644461_1619790 Saccharum officinarum mitochondrial uncoupli...    34   2.3     
gb:BT020880_1436238 Bos taurus hypothetical protein FLJ20551 (FL...    34   2.3     
gb:AF127029_1414561 Bos taurus uncoupling protein 2 mRNA, nuclea...    34   2.3     
gb:CEF17E5_1362631 Caenorhabditis elegans cosmid F17E5, complete...    34   2.3     
gb:CR926117_1185621 Pongo pygmaeus mRNA; cDNA DKFZp459H2410 (fro...    34   2.3     
gb:CR857243_1181488 Pongo pygmaeus mRNA; cDNA DKFZp469I0832 (fro...    34   2.3     
pir|G96770|G96770 hypothetical protein F1O17.9 [imported] - Arab...    34   2.3     
sp|Q19529|CMC3_CAEEL|CMC3_CAEEL Probable calcium-binding mitochondrial carr...    34   2.3     
gb:CR382132_1665730 Yarrowia lipolytica chromosome F of strain C...    33   3.0     
gb:AY788859_1351606 Ixodes scapularis fed tick salivary protein ...    33   3.0     
gb:AY691195_1346612 Leishmania major ATP/ADP translocase mRNA, c...    33   3.0     
gb:AY187877_1308617 Leishmania mexicana amazonensis ADP/ATP carr...    33   3.0     
gb:AC125735_1208107 Leishmania major strain Friedlin chromosome ...    33   3.0     
gb:AE014297_1140469 Drosophila melanogaster chromosome 3R, compl...    33   3.0     
gb:AE014297_1140467 Drosophila melanogaster chromosome 3R, compl...    33   3.0     
gb:BA000045_740326 Gloeobacter violaceus PCC 7421 DNA, complete ...    33   3.0     
gb:AE017354_460652 Legionella pneumophila subsp. pneumophila str...    33   3.0     
gb:CR628337_115427 Legionella pneumophila str. Lens complete gen...    33   3.0     
gb:CR628336_112369 Legionella pneumophila str. Paris complete ge...    33   3.0     
pir|T45934|T45934 hypothetical protein F5K20.240 - Arabidopsis t...    33   3.0     
sp|P53320|YG5F_YEAST|YG5F_YEAST Putative mitochondrial carrier YGR257C.>pir...    33   3.0     
sp|Q9Z2Z6|MCAT_MOUSE|MCAT_MOUSE Mitochondrial carnitine/acylcarnitine carri...    33   3.0     
gb:BC081749_2108002 Rattus norvegicus solute carrier family 25 (...    33   3.9     
gb:HSA131612_2000218 Homo sapiens dic gene, exons 1-11.>gb:HSA13...    33   3.9     
gb:AP005830_1858659 Oryza sativa (japonica cultivar-group) genom...    33   3.9     
gb:NCB21O8_1689692 Neurospora crassa DNA linkage group II BAC cl...    33   3.9     
gb:AY224505_1590707 Oryza sativa (japonica cultivar-group) isola...    33   3.9     
gb:AF201377_1415954 Canis familiaris uncoupling protein 2 (UCP2)...    33   3.9     
gb:AE014297_1138356 Drosophila melanogaster chromosome 3R, compl...    33   3.9     
gb:AE013599_1133881 Drosophila melanogaster chromosome 2R, compl...    33   3.9     
pir|T50686|T50686 peroxisomal Ca-dependent solute carrier [impor...    33   3.9     
sp|Q9N2J1|UCP2_CANFA|UCP2_CANFA Mitochondrial uncoupling protein 2 (UCP 2)....    33   3.9     
sp|P97521|MCAT_RAT|MCAT_RAT Mitochondrial carnitine/acylcarnitine carrier...    33   3.9     
gb:BC043993_2548403 Xenopus laevis hypothetical protein LOC39847...    33   5.2     
gb:AY603424_2086789 Rattus norvegicus mitochondrial hepatocellul...    33   5.2     
gb:AY346372_1946852 Homo sapiens solute carrier family 25 member...    33   5.2     
gb:AE017356_1760412 Cryptococcus neoformans var. neoformans JEC2...    33   5.2     
gb:SCACR1PRA_1706453 S.cerevisiae ACR1-protein gene, complete CDS.     33   5.2     
gb:CQ783884_1452675 Sequence 4024 from Patent EP1396543.>gb:AK07...    33   5.2     
gb:AE014297_1141242 Drosophila melanogaster chromosome 3R, compl...    33   5.2     
sp|P33303|SFC1_YEAST|SFC1_YEAST Succinate/fumarate mitochondrial transporte...    33   5.2     
sp|Q9HC21|DNC_HUMAN|DNC_HUMAN Mitochondrial deoxynucleotide carrier (Mitoc...    33   5.2     
sp|Q01356|AR13_NEUCR|AR13_NEUCR Amino acid transporter arg-13.>pir|T47240|T...    33   5.2     
gb:BC062851_2553440 Danio rerio zgc:77760, mRNA (cDNA clone MGC:...    32   6.7     
gb:BC052871_2101323 Mus musculus solute carrier family 25 (mitoc...    32   6.7     
gb:AF515781_2067312 Dicrostonyx groenlandicus uncoupling protein...    32   6.7     
gb:AK117673_1815695 Arabidopsis thaliana At1g14140 mRNA for puta...    32   6.7     
gb:AE017343_1755493 Cryptococcus neoformans var. neoformans JEC2...    32   6.7     
gb:OSJN00035_1693683 Oryza sativa genomic DNA, chromosome 4, BAC...    32   6.7     
gb:CR382133_1666764 Debaryomyces hansenii chromosome A of strain...    32   6.7     
gb:CR382131_1663905 Yarrowia lipolytica chromosome E of strain C...    32   6.7     
gb:CR382131_1663837 Yarrowia lipolytica chromosome E of strain C...    32   6.7     
gb:ATT5E8_1556142 Arabidopsis thaliana DNA chromosome 5, BAC clo...    32   6.7     
gb:AK085913_1174619 Mus musculus 16 days neonate heart cDNA, RIK...    32   6.7     
gb:AK078385_1172297 Mus musculus 10 days neonate cerebellum cDNA...    32   6.7     
gb:AE014297_1140456 Drosophila melanogaster chromosome 3R, compl...    32   6.7     
gb:AE014296_1136882 Drosophila melanogaster chromosome 3L, compl...    32   6.7     
pir|T19322|T19322 hypothetical protein C16C10.1 - Caenorhabditis...    32   6.7     
sp|Q09461|YQ51_CAEEL|YQ51_CAEEL Putative mitochondrial carrier C16C10.1.>gb...    32   6.7     
gb:BX649499_2567815 Zebrafish DNA sequence from clone DKEY-60A16...    32   8.8     
gb:BC076052_2558934 Danio rerio zgc:92520, mRNA (cDNA clone MGC:...    32   8.8     
gb:BC075893_2558783 Danio rerio zgc:92113, mRNA (cDNA clone MGC:...    32   8.8     
gb:AY484518_2085542 Dicrostonyx groenlandicus mitochondrial unco...    32   8.8     
gb:AF271264_2061088 Phodopus sungorus uncoupling protein 2 mRNA,...    32   8.8     
gb:AF111999_2054912 Mus musculus strain CAST/Ei uncoupling prote...    32   8.8     
gb:AB012159_2043688 Mus musculus gene for uncoupling protein-2, ...    32   8.8     
gb:AB010743_2043622 Rattus norvegicus mRNA for UCP2, complete cd...    32   8.8     
gb:AB005143_2043280 Rattus norvegicus mRNA for uncoupling protei...    32   8.8     
gb:AB056388_1868375 Macaca fascicularis brain cDNA, clone:QflA-1...    32   8.8     
gb:SCYMC1_1713579 S.cerevisiae YMC1 gene for mitochondrial carri...    32   8.8     
gb:BMMIF1_1355494 Brugia malayi genomic DNA MIF-1 locus.               32   8.8     
gb:CR857224_1181471 Pongo pygmaeus mRNA; cDNA DKFZp469N0421 (fro...    32   8.8     
gb:AK035298_1164066 Mus musculus adult male urinary bladder cDNA...    32   8.8     
gb:AE014188_968205 Plasmodium falciparum 3D7 chromosome 12, comp...    32   8.8     
sp|P32331|YMC1_YEAST|YMC1_YEAST Carrier protein YMC1, mitochondrial precurs...    32   8.8     
sp|P56500|UCP2_RAT|UCP2_RAT Mitochondrial uncoupling protein 2 (UCP 2).>g...    32   8.8     
sp|P70406|UCP2_MOUSE|UCP2_MOUSE Mitochondrial uncoupling protein 2 (UCP 2) ...    32   8.8     


>gb:AY088311_1573331 Arabidopsis thaliana clone 5504 mRNA, complete
           sequence.
          Length = 331

 Score =  205 bits (522), Expect = 4e-52
 Identities = 106/173 (61%), Positives = 126/173 (72%), Gaps = 3/173 (1%)
 Frame = +1

Query: 121 MSDXXXXXXXXXXXXXXXXXXTYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEG 300
           MSD                  TYPLQTVNTRQQT+R+ K  KRK L TIEHMCQV +QEG
Sbjct: 1   MSDALINGLAGAGGGIIAQLLTYPLQTVNTRQQTERDLKREKRK-LGTIEHMCQVVKQEG 59

Query: 301 WDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAA 480
           W+RLYGGLAPSL GTAASQGVYYYFYQ+FR +AE  AL RK++G+GDGSVGM +SL+VAA
Sbjct: 60  WERLYGGLAPSLAGTAASQGVYYYFYQVFRNRAEATALARKKKGLGDGSVGMFASLLVAA 119

Query: 481 LSGCVNVLLTNPIWVGVTRMQTHSKKAKN---SPTGAMTAXDAILAXVEPPPF 630
            +G VNVL+TNPIWV VTRMQTH K  K+   +P    +  +A++A VEP P+
Sbjct: 120 FAGSVNVLMTNPIWVIVTRMQTHRKMTKDQTAAPESPSSNAEALVA-VEPRPY 171



>pir|F84823|F84823 probable peroxisomal membrane carrier protein
           [imported] - Arabidopsis thaliana>gb:AB047148_1520588
           Arabidopsis thaliana mRNA for 36kDa-peroxisomal membrane
           protein (PMP36), complete cds.>gb:AY039858_1560372
           Arabidopsis thaliana At2g39970/T28M21.13 mRNA, complete
           cds.>gb:BT003020_1636602 Arabidopsis thaliana
           At2g39970/T28M21.13 gene, complete
           cds.>gb:AF002109_1760572 Arabidopsis thaliana chromosome
           2 clone T28M21 map CIC10A06, complete sequence.
          Length = 331

 Score =  205 bits (522), Expect = 4e-52
 Identities = 106/173 (61%), Positives = 126/173 (72%), Gaps = 3/173 (1%)
 Frame = +1

Query: 121 MSDXXXXXXXXXXXXXXXXXXTYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEG 300
           MSD                  TYPLQTVNTRQQT+R+ K  KRK L TIEHMCQV +QEG
Sbjct: 1   MSDALINGLAGAGGGIIAQLLTYPLQTVNTRQQTERDLKREKRK-LGTIEHMCQVVKQEG 59

Query: 301 WDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAA 480
           W+RLYGGLAPSL GTAASQGVYYYFYQ+FR +AE  AL RK++G+GDGSVGM +SL+VAA
Sbjct: 60  WERLYGGLAPSLAGTAASQGVYYYFYQVFRNRAEATALARKKKGLGDGSVGMFASLLVAA 119

Query: 481 LSGCVNVLLTNPIWVGVTRMQTHSKKAKN---SPTGAMTAXDAILAXVEPPPF 630
            +G VNVL+TNPIWV VTRMQTH K  K+   +P    +  +A++A VEP P+
Sbjct: 120 FAGSVNVLMTNPIWVIVTRMQTHRKMTKDQTAAPESPSSNAEALVA-VEPRPY 171



>gb:AC135205_1742013 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1012B02, complete sequence.
          Length = 344

 Score =  189 bits (479), Expect = 4e-47
 Identities = 101/163 (61%), Positives = 109/163 (66%), Gaps = 1/163 (0%)
 Frame = +1

Query: 121 MSDXXXXXXXXXXXXXXXXXXTYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEG 300
           MSD                  TYPLQTVN RQQT+R+  +   K    +  MC V + EG
Sbjct: 1   MSDALINGVAGAGGGIIAQLLTYPLQTVNARQQTERDPSKPAFKD-GAVRQMCLVVKHEG 59

Query: 301 WDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAA 480
           W+RLYGGL PSLVGTAASQGVYYYFYQIFR++AE AAL R RRGIGDGSVGML SL VAA
Sbjct: 60  WERLYGGLMPSLVGTAASQGVYYYFYQIFRSRAEAAALQRSRRGIGDGSVGMLQSLTVAA 119

Query: 481 LSGCVNVLLTNPIWVGVTRMQTHSKKAK-NSPTGAMTAXDAIL 606
           LSGCVNVLLTNPIWV VTRMQTH K  K  SP       D  L
Sbjct: 120 LSGCVNVLLTNPIWVIVTRMQTHRKANKQQSPLDLTCVLDKAL 162



>gb:AP004779_1844983 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0470A03.>gb:AP005003_1847098 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0495C02.
          Length = 273

 Score =  157 bits (396), Expect = 2e-37
 Identities = 78/132 (59%), Positives = 98/132 (74%), Gaps = 5/132 (3%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRK-----QLSTIEHMCQVARQEGWDRLYGGLAPSLVGTA 348
           TYPLQTVNTRQQT+R +K+ K         ST+  M Q+ + EGW  LY GL PSL+GTA
Sbjct: 29  TYPLQTVNTRQQTERSAKKKKANGAAIANTSTLFQMLQLFQTEGWGGLYSGLKPSLIGTA 88

Query: 349 ASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVG 528
           ASQG+YYYFYQI + K E  A+ R ++G+GDG+VGM S L +AA++G +NVLLTNPIWV 
Sbjct: 89  ASQGIYYYFYQILKNKVEDLAVARGKKGLGDGTVGMFSWLGIAAVAGSINVLLTNPIWVL 148

Query: 529 VTRMQTHSKKAK 564
           VTRMQTH++  K
Sbjct: 149 VTRMQTHTQAEK 160



>gb:AC116920_1206416 Dictyostelium discoideum chromosome 2 map
           4415041-4520361 strain AX4, complete sequence.
          Length = 329

 Score = 88.2 bits (217), Expect = 1e-16
 Identities = 48/132 (36%), Positives = 79/132 (59%), Gaps = 7/132 (5%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQ-RESKEGKRKQLSTIEH------MCQVARQEGWDRLYGGLAPSLVG 342
           TYP  TV+TR Q Q ++ ++G++ +++T+ +        ++ ++E W  LY GL  +L+G
Sbjct: 38  TYPFSTVSTRLQVQQKKQQQGQQSEITTVPYKNSIDAFKRIIKEENWRTLYSGLKSALIG 97

Query: 343 TAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIW 522
             AS  VYYY+Y + ++     +L  K +      +G + +L +AAL+GC NVL T PIW
Sbjct: 98  IGASSFVYYYWYTLLKS----ISLKLKNK----QELGTIENLAIAALAGCANVLTTLPIW 149

Query: 523 VGVTRMQTHSKK 558
           V  TR+Q +S K
Sbjct: 150 VVNTRLQINSDK 161



 Score = 38.1 bits (87), Expect = 0.12
 Identities = 31/128 (24%), Positives = 55/128 (42%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           T P+  VNTR Q   +           +     + + EG+  LY GL P+L+   ++  V
Sbjct: 145 TLPIWVVNTRLQINSDK--------GIVGQFKYIIKNEGFGGLYKGLIPALI-LVSNPSV 195

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
            +  Y+  R           RR  G   +G L   ++ A++  +  ++T P  +  +R+Q
Sbjct: 196 QFVSYEKLRA--------LWRRQSGRTKLGGLEVFILGAIAKLIAGIVTYPYLLVKSRLQ 247

Query: 544 THSKKAKN 567
           + S  A N
Sbjct: 248 SQSGNASN 255



>gb:CR382127_1660321 Yarrowia lipolytica chromosome A of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 299

 Score = 82.8 bits (203), Expect = 4e-15
 Identities = 48/127 (37%), Positives = 71/127 (55%), Gaps = 2/127 (1%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQ--RESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQ 357
           TYPL T++TR QT+  R  K+ K + LS +    ++ ++EG   LY GL  +L G + + 
Sbjct: 24  TYPLITLSTRAQTESMRTKKDSKAETLSALAAARKIVKREGIAGLYSGLDSALFGISVTN 83

Query: 358 GVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTR 537
            VYYYFY+  RT   +  L +   G    ++    S++  A++G   V+LTNPIWV  TR
Sbjct: 84  FVYYYFYESSRT---IFQLSKAAAGAASMNLTTGESMLAGAVAGSATVVLTNPIWVVNTR 140

Query: 538 MQTHSKK 558
           M    KK
Sbjct: 141 MTVSEKK 147



 Score = 33.1 bits (74), Expect = 3.9
 Identities = 34/124 (27%), Positives = 56/124 (45%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           T P+  VNTR  T  E K+G    L+TI+   ++A ++G    + G+AP+LV    +  +
Sbjct: 131 TNPIWVVNTRM-TVSEKKQGT---LATIK---EIASKDGLKTFFSGIAPALV-LVINPIL 182

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
            Y  ++  + + E      KRR         + + +  AL   V   +T P     +RMQ
Sbjct: 183 QYTIFEQLKNRVE------KRR-----KFTSIDAFLYGALGKLVATTVTYPYITLKSRMQ 231

Query: 544 THSK 555
              K
Sbjct: 232 VKQK 235



>gb:NCB7N14_1690215 Neurospora crassa DNA linkage group II BAC clone
           B7N14.
          Length = 340

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 49/137 (35%), Positives = 70/137 (51%), Gaps = 1/137 (0%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQ-VARQEGWDRLYGGLAPSLVGTAASQG 360
           TYPL T++TR Q      E KR   +T     Q +  +EG   LY GL+ +L G + +  
Sbjct: 31  TYPLITLSTRAQV-----ESKRSADTTFLAAVQKIVAREGISGLYSGLSSALFGISVTNF 85

Query: 361 VYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           VYYY+Y+  R   E AA+   + G     +  + S++  A++G   V+LTNPIWV  TRM
Sbjct: 86  VYYYWYEWTRAFFEAAAV---KAGRASKKLTTVESMIAGAIAGSATVILTNPIWVVNTRM 142

Query: 541 QTHSKKAKNSPTGAMTA 591
            T    A +      TA
Sbjct: 143 TTRKAAAADDDDEKNTA 159



>gb:CR382139_1672605 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 342

 Score = 68.6 bits (166), Expect = 8e-11
 Identities = 45/147 (30%), Positives = 72/147 (48%), Gaps = 22/147 (14%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQL-------------------STIEHMCQVARQEGWD 306
           TYPL T++T  QT ++ KE K+ ++                   S+ +   ++ R+ G  
Sbjct: 24  TYPLVTLSTLAQTTQKKKEEKKVEVKEFEAKEYHYRIVNKIVTSSSYQAAREIIRKNGVL 83

Query: 307 RLYGGLAPSLVGTAASQGVYYYFYQIFRT---KAEVAALDRKRRGIGDGSVGMLSSLVVA 477
            LY GL  +L G   +  +YYYFY++      KA V     KR+G   G + M+ S++  
Sbjct: 84  GLYSGLESALYGITLTNFIYYYFYELTSNVFLKANVG----KRQG---GGLSMVQSIITG 136

Query: 478 ALSGCVNVLLTNPIWVGVTRMQTHSKK 558
           A++G V  + +NP WV  TRM T   +
Sbjct: 137 AIAGAVTCVGSNPFWVANTRMMTDKNR 163



 Score = 37.4 bits (85), Expect = 0.21
 Identities = 18/69 (26%), Positives = 37/69 (53%), Gaps = 5/69 (7%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRES-----KEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTA 348
           TYP  T+ +R   +++       + +  +LS I+ + ++ ++EG + LYGGL   L+ + 
Sbjct: 248 TYPYITLKSRMHVKKKKLSKQVSDDEEIKLSMIQEIKKIIKEEGIEGLYGGLTVKLIQSI 307

Query: 349 ASQGVYYYF 375
            +    +YF
Sbjct: 308 TTAAFLFYF 316



>gb:AE017347_1757975 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 323

 Score = 65.5 bits (158), Expect = 7e-10
 Identities = 45/151 (29%), Positives = 70/151 (46%), Gaps = 6/151 (3%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           TYPL T++TR   Q      K++ ++  E + +   +EG   LY GL  SL G A + GV
Sbjct: 22  TYPLVTLSTRAAVQT-----KKEHITAKEALSKAYGEEGIAGLYSGLGSSLFGIALTNGV 76

Query: 364 YYYFYQIFRTKAEVAALDRKR--RGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTR 537
           YY FY+  R     +AL R+R      +G +  +  +    ++G +  + TNP+W   T 
Sbjct: 77  YYAFYEEMR-----SALIRRRSKTPASNGGLTTIEGIFAGLVAGSITTIATNPVWTIQTA 131

Query: 538 MQTH----SKKAKNSPTGAMTAXDAILAXVE 618
             T+    S KA   P    +A       +E
Sbjct: 132 QATYTADPSSKADGKPDIKPSAAQVAKGIIE 162



>sp|P21245|P47A_CANBO Peroxisomal membrane protein
           PMP47A.>pir|A23667|A23667 47K peroxisomal membrane
           protein - yeast (Candida boidinii)>gb:YSAPMP47_1728144
           Candida boidinii peroxisomal membrane protein (PMP47)
           gene, complete cds.
          Length = 423

 Score = 65.1 bits (157), Expect = 9e-10
 Identities = 49/170 (28%), Positives = 77/170 (45%), Gaps = 29/170 (17%)
 Frame = +1

Query: 184 TYPLQTVNTRQQT-------QRESKEGK-----------------RKQLSTIEHMCQVAR 291
           TYPL T+ T  QT       Q + KE                   +K++S  E + ++ +
Sbjct: 26  TYPLVTLTTHAQTMVKLKKDQEKEKENSNEDGSLSPKSSNTSDVSQKKISQFEILKKILK 85

Query: 292 QEGWDRLYGGLAPSLVGTAASQGVYYYFYQIF-----RTKAEVAALDRKRRGIGDGSVGM 456
            +G   LY GL  +L G A +  VYYYFY++      R      A + K+  +  G + +
Sbjct: 86  DQGAKGLYNGLESALFGIAVTNFVYYYFYELTGKTLNRRSNPQTASNSKKVALKKG-LSV 144

Query: 457 LSSLVVAALSGCVNVLLTNPIWVGVTRMQTHSKKAKNSPTGAMTAXDAIL 606
             S+   A++G ++ + TNPIWV  TRM   SK       G +   +AI+
Sbjct: 145 WQSMAAGAVAGTISRVATNPIWVANTRMTILSK--NQGKLGKLNTIEAII 192



 Score = 41.2 bits (95), Expect = 0.015
 Identities = 30/123 (24%), Positives = 57/123 (46%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           T P+   NTR  T     +GK  +L+TIE +  + + EGW +L+ G+ P+L         
Sbjct: 162 TNPIWVANTRM-TILSKNQGKLGKLNTIEAIIYILKNEGWQKLFTGIVPALFLVLNPIIQ 220

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
           Y  F Q+   K+ +  + ++       ++  + +L++ A    +  ++T P     +RM 
Sbjct: 221 YTIFEQL---KSFIVKIKKR-------NITPVDALLLGAFGKLIATIITYPYITLRSRMH 270

Query: 544 THS 552
             S
Sbjct: 271 VKS 273



>gb:AE016819_1748982 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 315

 Score = 63.5 bits (153), Expect = 3e-09
 Identities = 38/119 (31%), Positives = 61/119 (51%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           T PL T+ TR Q   + KE   +  S +E + ++ R+EG    Y GL  ++ G AA+   
Sbjct: 34  TMPLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYGMAANSLN 93

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           YYYFY++        A     R  G   +    +++ +A++G +  + +NPIWV  TRM
Sbjct: 94  YYYFYEL--------AARATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNTRM 144



 Score = 32.3 bits (72), Expect = 6.7
 Identities = 20/68 (29%), Positives = 30/68 (44%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           TYP  T+ TR    +  KE    Q S    M  + ++EG   LY G+   L  +  +   
Sbjct: 226 TYPYITLKTRMHLAK-GKEDADTQQSMWSLMVDIVKKEGIQGLYHGIGVKLTQSILTAAF 284

Query: 364 YYYFYQIF 387
            +YF + F
Sbjct: 285 LFYFKEGF 292



>gb:AY084815_1569898 Arabidopsis thaliana clone 118596 mRNA,
           complete sequence.
          Length = 308

 Score = 63.2 bits (152), Expect = 4e-09
 Identities = 44/146 (30%), Positives = 65/146 (44%), Gaps = 1/146 (0%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +PL  V TR Q             +T   +  +AR EG   LY G  P+++G+  S G+Y
Sbjct: 25  HPLDVVRTRFQVNDGRGSSLPTYKNTAHAVFTIARLEGLRGLYAGFFPAVIGSTVSWGLY 84

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
           ++FY          A  R  RG  D  +     L  AA +G +  L TNPIW+  TR+Q 
Sbjct: 85  FFFYG--------RAKQRYARGRDDEKLSPALHLASAAEAGALVCLCTNPIWLVKTRLQL 136

Query: 547 HSKKAKNSP-TGAMTAXDAILAXVEP 621
            +   +  P +G + A   I+    P
Sbjct: 137 QTPLHQTQPYSGLLDAFRTIVKEEGP 162



>gb:CBU53145_1645702 Candida boidinii peroxisome membrane protein 47
           (Pmp47) gene, complete cds.
          Length = 419

 Score = 62.8 bits (151), Expect = 5e-09
 Identities = 45/169 (26%), Positives = 74/169 (43%), Gaps = 28/169 (16%)
 Frame = +1

Query: 184 TYPLQTVNTRQQT-------QRESKEGK-----------------RKQLSTIEHMCQVAR 291
           TYPL T+ T  QT       + E KE                   +K++S  E + ++ +
Sbjct: 26  TYPLVTLTTHAQTMVRLKKNEEEEKENSNEDGSLSPKSSNTSNISQKKISQFEILKKILK 85

Query: 292 QEGWDRLYGGLAPSLVGTAASQGVYYYFYQI----FRTKAEVAALDRKRRGIGDGSVGML 459
            +G   LY GL  +L G A +  VYYYFY++       ++        ++      + + 
Sbjct: 86  DQGAKGLYNGLESALFGIAVTNFVYYYFYELTGKTLSRRSNPQTTSGSKKVTLKKGLSVW 145

Query: 460 SSLVVAALSGCVNVLLTNPIWVGVTRMQTHSKKAKNSPTGAMTAXDAIL 606
            S+   A++G ++ + TNPIWV  TRM   SK       G +   +AI+
Sbjct: 146 QSMAAGAVAGTISRVATNPIWVANTRMTILSK--NQGKLGKLNTIEAII 192



 Score = 42.7 bits (99), Expect = 0.005
 Identities = 32/128 (25%), Positives = 58/128 (45%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           T P+   NTR  T     +GK  +L+TIE +  + + EGW +L+ G+ P+L         
Sbjct: 162 TNPIWVANTRM-TILSKNQGKLGKLNTIEAIIYILKNEGWQKLFTGIVPALFLVLNPIIQ 220

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
           Y  F Q+   K+ +  + ++       +V  + +L++ A    +  ++T P     +RM 
Sbjct: 221 YTIFEQL---KSFIVKIKKR-------NVTPVDALLLGAFGKLIATIITYPYITLRSRMH 270

Query: 544 THSKKAKN 567
             S    N
Sbjct: 271 VKSMTENN 278



>sp|Q00319|P47B_CANBO Peroxisomal membrane protein
           PMP47B.>pir|S50283|S50283 PMP47B protein - yeast
           (Candida boidinii)>gb:YSAPMP47B_1728145 Candida boidinii
           peroxisomal membrane protein (PMP47B) gene, complete
           cds.
          Length = 419

 Score = 62.8 bits (151), Expect = 5e-09
 Identities = 45/169 (26%), Positives = 74/169 (43%), Gaps = 28/169 (16%)
 Frame = +1

Query: 184 TYPLQTVNTRQQT-------QRESKEGK-----------------RKQLSTIEHMCQVAR 291
           TYPL T+ T  QT       + E KE                   +K++S  E + ++ +
Sbjct: 26  TYPLVTLTTHAQTMVRLKKNEEEEKENSNEDGSLSPKSSNTSNISQKKISQFEILKKILK 85

Query: 292 QEGWDRLYGGLAPSLVGTAASQGVYYYFYQI----FRTKAEVAALDRKRRGIGDGSVGML 459
            +G   LY GL  +L G A +  VYYYFY++       ++        ++      + + 
Sbjct: 86  DQGAKGLYNGLESALFGIAVTNFVYYYFYELTGKTLSRRSNPQTTSGSKKVTLKKGLSVW 145

Query: 460 SSLVVAALSGCVNVLLTNPIWVGVTRMQTHSKKAKNSPTGAMTAXDAIL 606
            S+   A++G ++ + TNPIWV  TRM   SK       G +   +AI+
Sbjct: 146 QSMAAGAVAGTISRVATNPIWVANTRMTILSK--NQGKLGKLNTIEAII 192



 Score = 42.7 bits (99), Expect = 0.005
 Identities = 32/128 (25%), Positives = 58/128 (45%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           T P+   NTR  T     +GK  +L+TIE +  + + EGW +L+ G+ P+L         
Sbjct: 162 TNPIWVANTRM-TILSKNQGKLGKLNTIEAIIYILKNEGWQKLFTGIVPALFLVLNPIIQ 220

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
           Y  F Q+   K+ +  + ++       +V  + +L++ A    +  ++T P     +RM 
Sbjct: 221 YTIFEQL---KSFIVKIKKR-------NVTPVDALLLGAFGKLIATIITYPYITLRSRMH 270

Query: 544 THSKKAKN 567
             S    N
Sbjct: 271 VKSMTENN 278



>gb:NC3H10_1688523 Neurospora crassa DNA linkage group V Cosmid
           contig 3H10.
          Length = 706

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 37/127 (29%), Positives = 60/127 (47%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YP+  V TR Q QR +  G R   ++I+   +V R EG+  LY G+ P LVG A  + + 
Sbjct: 368 YPIDLVKTRMQNQRGASPGSRLYDNSIDCFRKVIRNEGFRGLYSGVLPQLVGVAPEKAI- 426

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
                    K  V  L R       G++ ++  ++    +G   V+ TNP+ +   R+Q 
Sbjct: 427 ---------KLTVNDLVRGAFTDKQGNISVIHEIIAGGTAGGCQVVFTNPLEIVKIRLQV 477

Query: 547 HSKKAKN 567
             + AK+
Sbjct: 478 QGEVAKS 484



 Score = 38.5 bits (88), Expect = 0.094
 Identities = 38/143 (26%), Positives = 58/143 (40%), Gaps = 3/143 (2%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRE---SKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAAS 354
           T PL+ V  R Q Q E   S EG  K+ +       + R  G   LY G +  L+     
Sbjct: 465 TNPLEIVKIRLQVQGEVAKSVEGAPKRSAM-----WIVRNLGLVGLYKGASACLLRDVPF 519

Query: 355 QGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVT 534
             +Y+  Y     K ++    + ++      +G+L  L   A++G     LT P  V  T
Sbjct: 520 SAIYFPTYS--HLKKDLFGESKTKK------LGVLQLLTAGAIAGMPAAYLTTPCDVIKT 571

Query: 535 RMQTHSKKAKNSPTGAMTAXDAI 603
           R+Q  ++K     TG   A   I
Sbjct: 572 RLQVEARKGDTQYTGLRHAAKTI 594



>gb:BT010139_1640205 Arabidopsis thaliana At5g66380 gene, complete
           cds.
          Length = 308

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 43/146 (29%), Positives = 64/146 (43%), Gaps = 1/146 (0%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           + L  V TR Q             +T   +  +AR EG   LY G  P+++G+  S G+Y
Sbjct: 25  HSLDVVRTRFQVNDGRGSSLPTYKNTAHAVFTIARLEGLRGLYAGFFPAVIGSTVSWGLY 84

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
           ++FY          A  R  RG  D  +     L  AA +G +  L TNPIW+  TR+Q 
Sbjct: 85  FFFYG--------RAKQRYARGRDDEKLSPALHLASAAEAGALVCLCTNPIWLVKTRLQL 136

Query: 547 HSKKAKNSP-TGAMTAXDAILAXVEP 621
            +   +  P +G + A   I+    P
Sbjct: 137 QTPLHQTQPYSGLLDAFRTIVKEEGP 162



>gb:AJ720399_2502586 Gallus gallus mRNA for hypothetical protein,
           clone 16o11.
          Length = 322

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 37/118 (31%), Positives = 58/118 (49%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +PL  V  R     +  E + K    +  M  V ++EG   LY G+ P++VG  AS G+Y
Sbjct: 48  HPLDLVKIRFAVS-DGLELRPKYNGILHCMTTVWKREGLRGLYQGVTPNMVGAGASWGLY 106

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           ++FY   +   +   L+         S+     LV AA +G + + +TNPIWV  TR+
Sbjct: 107 FFFYNAIKAYKKEGKLE---------SLTATEHLVSAAEAGAMTLCITNPIWVTKTRL 155



>gb:CR380957_1652615 Candida glabrata strain CBS138 chromosome K
           complete sequence.
          Length = 919

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 39/140 (27%), Positives = 67/140 (47%), Gaps = 1/140 (0%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YP+  V TR Q QR   + K    ++I+   ++  +EG   +Y GL P L+G A  + + 
Sbjct: 562 YPIDFVKTRMQAQRSLSQYK----NSIDCFLKILSREGIRGVYSGLGPQLIGVAPEKAIK 617

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
                  R K +    D+      +G +G+LS ++  A +G   V+ TNP+ +   R+Q 
Sbjct: 618 LTVNDYMRNKLK----DK------NGKLGLLSEIISGASAGACQVIFTNPLEIVKIRLQV 667

Query: 547 HSK-KAKNSPTGAMTAXDAI 603
             +  A+N+    +TA   I
Sbjct: 668 KGEYVAENAENAKLTALQII 687



 Score = 35.0 bits (79), Expect = 1.0
 Identities = 37/144 (25%), Positives = 59/144 (40%), Gaps = 3/144 (2%)
 Frame = +1

Query: 184  TYPLQTVNTRQQTQRE--SKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQ 357
            T PL+ V  R Q + E  ++  +  +L+ +    Q+ ++ G   LY G A  L+      
Sbjct: 655  TNPLEIVKIRLQVKGEYVAENAENAKLTAL----QIIKRLGLPGLYKGAAACLLRDVPFS 710

Query: 358  GVYYYFY-QIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVT 534
             +Y+  Y  + R        D+ +R      +     L   AL+G     LT P  V  T
Sbjct: 711  AIYFPTYAHLKRDLFNFDPNDKNKRS----RLNTWELLSAGALAGMPAAYLTTPFDVIKT 766

Query: 535  RMQTHSKKAKNSPTGAMTAXDAIL 606
            R+Q   KK +    G + A   IL
Sbjct: 767  RLQIDPKKGETIYKGIIHAARTIL 790



>gb:BC072270_2556522 Xenopus laevis hypothetical protein LOC443574,
           mRNA (cDNA clone IMAGE:4408521), partial cds.
          Length = 676

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 38/134 (28%), Positives = 60/134 (44%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YP+  V TR Q QR S  G+    ++ +   +V R EG+  LY GL P LVG A  + + 
Sbjct: 350 YPIDLVKTRMQNQRSSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLVGVAPEKAI- 408

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
                    K  V    R +    DGS+ + + ++    +G   V+ TNP+ +   R+Q 
Sbjct: 409 ---------KLTVNDFVRDKFTQKDGSIPLFAEIMAGGCAGGSQVIFTNPLEIVKIRLQV 459

Query: 547 HSKKAKNSPTGAMT 588
             +        A+T
Sbjct: 460 AGEITTGPKVRALT 473



>gb:AE017344_1756366 Cryptococcus neoformans var. neoformans JEC21
           chromosome 4, complete sequence.
          Length = 410

 Score = 56.6 bits (135), Expect = 3e-07
 Identities = 39/116 (33%), Positives = 63/116 (54%), Gaps = 4/116 (3%)
 Frame = +1

Query: 256 LSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVYYYFY---QIFRTKA-EVAALDRK 423
           + T+  + ++A +EGW  LY GL PSLVG   ++ + +YFY   +++  K    A  ++ 
Sbjct: 105 VDTVYLIKRIAVEEGWRALYKGLGPSLVGIIPARAINFYFYPTSKVYLAKQFPNAPTEKP 164

Query: 424 RRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQTHSKKAKNSPTGAMTA 591
            +   D  V  L + VVA   G +    TNPIWV  TR+Q  ++K +   TG ++A
Sbjct: 165 GQTAEDSPVIHLGAAVVA---GIMTSTGTNPIWVVKTRLQLSARKKE---TGVVSA 214



>gb:AX453492_1468810 Sequence 53 from Patent WO0242455.
          Length = 322

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 31/86 (36%), Positives = 49/86 (56%)
 Frame = +1

Query: 283 VARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLS 462
           + RQEG+  LY G+ P++ G+ +S G+Y+ FY   +T  +         G     +G   
Sbjct: 73  IFRQEGFRGLYKGVTPNVWGSGSSWGLYFMFYNTIKTFIQ--------GGNTTMPLGPTM 124

Query: 463 SLVVAALSGCVNVLLTNPIWVGVTRM 540
           +++ AA SG + +LLTNPIWV  TR+
Sbjct: 125 NMLAAAESGILTLLLTNPIWVVKTRL 150



>gb:AE013599_1130810 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003834_1226914 Drosophila melanogaster
           chromosome 2R, section 16 of 74 of the complete
           sequence.>gb:AY060332_1292244 Drosophila melanogaster
           GH22139 full length cDNA.>gb:AX453446_1468805 Sequence 7
           from Patent WO0242455.
          Length = 304

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 31/86 (36%), Positives = 49/86 (56%)
 Frame = +1

Query: 283 VARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLS 462
           + RQEG+  LY G+ P++ G+ +S G+Y+ FY   +T  +         G     +G   
Sbjct: 73  IFRQEGFRGLYKGVTPNVWGSGSSWGLYFMFYNTIKTFIQ--------GGNTTMPLGPTM 124

Query: 463 SLVVAALSGCVNVLLTNPIWVGVTRM 540
           +++ AA SG + +LLTNPIWV  TR+
Sbjct: 125 NMLAAAESGILTLLLTNPIWVVKTRL 150



>gb:AE013599_1130809 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003834_1226913 Drosophila melanogaster
           chromosome 2R, section 16 of 74 of the complete
           sequence.
          Length = 360

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 31/86 (36%), Positives = 49/86 (56%)
 Frame = +1

Query: 283 VARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLS 462
           + RQEG+  LY G+ P++ G+ +S G+Y+ FY   +T  +         G     +G   
Sbjct: 73  IFRQEGFRGLYKGVTPNVWGSGSSWGLYFMFYNTIKTFIQ--------GGNTTMPLGPTM 124

Query: 463 SLVVAALSGCVNVLLTNPIWVGVTRM 540
           +++ AA SG + +LLTNPIWV  TR+
Sbjct: 125 NMLAAAESGILTLLLTNPIWVVKTRL 150



>gb:AC096689_1736274 Oryza sativa chromosome 3 BAC OSJNBa0027J18
           genomic sequence, complete sequence.
          Length = 318

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 39/120 (32%), Positives = 58/120 (48%), Gaps = 1/120 (0%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQR-ESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           +PL  V TR Q              +T   +  +AR EG   LY G  P+++G+  S G+
Sbjct: 34  HPLDVVRTRFQVSGGRGCYDLPPYRNTAHAVYTIARSEGLRGLYAGFYPAVLGSTVSWGL 93

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
           Y++FY     +A+   L  K     D  +  +  LV AA +G +  L TNPIW+  TR+Q
Sbjct: 94  YFFFY----NRAKQRYLQGK-----DDQLRPVHHLVSAAEAGALVCLFTNPIWLVKTRLQ 144



>gb:AE014296_1134731 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003481_1212030 Drosophila melanogaster
           chromosome 3L, section 15 of 83 of the complete
           sequence.
          Length = 314

 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 34/119 (28%), Positives = 53/119 (44%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YPL TV +R Q +        +Q+     + ++   EG+  LY GL P L     S  VY
Sbjct: 34  YPLDTVRSRLQLEEAGDVRSTRQV-----IKEIVLGEGFQSLYRGLGPVLQSLCISNFVY 88

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
           +Y +   +  A          G        L  L++ +++G +NVL T P WV  TR++
Sbjct: 89  FYTFHALKAVAS---------GGSPSQHSALKDLLLGSIAGIINVLTTTPFWVVNTRLR 138



 Score = 40.8 bits (94), Expect = 0.019
 Identities = 33/134 (24%), Positives = 61/134 (45%), Gaps = 3/134 (2%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQR---ESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAAS 354
           T P   VNTR + +     S E  +   + +E +  VA +EG   L+ G  PSL+   ++
Sbjct: 127 TTPFWVVNTRLRMRNVAGTSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLM-LVSN 185

Query: 355 QGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVT 534
             + +  Y++         L R       G +G LS   + A++     +LT P+ +  T
Sbjct: 186 PALQFMMYEM---------LKRNIMRFTGGEMGSLSFFFIGAIAKAFATVLTYPLQLVQT 236

Query: 535 RMQTHSKKAKNSPT 576
           + +  SK++ + P+
Sbjct: 237 KQRHRSKESDSKPS 250



 Score = 33.5 bits (75), Expect = 3.0
 Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 8/74 (10%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGK--------RKQLSTIEHMCQVARQEGWDRLYGGLAPSLV 339
           TYPLQ V T+Q+ + +  + K         +  ST+E M  + + +G   L+ GL   ++
Sbjct: 228 TYPLQLVQTKQRHRSKESDSKPSTSAGSTPRTESTLELMISILQHQGIRGLFRGLEAKIL 287

Query: 340 GTAASQGVYYYFYQ 381
            T  +  + +  Y+
Sbjct: 288 QTVLTAALMFMAYE 301



>pir|T50159|T50159 mitochondrial carrier protein [imported] -
           fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC227_1717127 S.pombe chromosome I cosmid
           c227.
          Length = 371

 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 43/158 (27%), Positives = 65/158 (41%), Gaps = 20/158 (12%)
 Frame = +1

Query: 190 PLQTVNTRQQTQR---ESKEGKRKQL--STIEHMCQVARQEGWDRLYGGLAPSLVGTAAS 354
           PL  V TR+Q Q+    +  GK   +   T+  M  +   EG   LY G+ P ++G   S
Sbjct: 25  PLDVVKTRKQAQKAFYSTGGGKNTMVLGGTLSSMRTIFHNEGIAGLYRGVGPMMLGYLPS 84

Query: 355 QGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSL---------------VVAALSG 489
             +Y+  Y+  +    V         I    VG+ +SL                 A ++G
Sbjct: 85  WSIYFVVYEKCKVLFGVNKKYTSLHEIDSSKVGIKASLDSSDKQFYRYWGGQIFSAVIAG 144

Query: 490 CVNVLLTNPIWVGVTRMQTHSKKAKNSPTGAMTAXDAI 603
             +V LTNPIWV  TR+ T S    +S    + A   +
Sbjct: 145 AASVTLTNPIWVVKTRLVTQSHPRASSFVDKIAAATTV 182



 Score = 32.7 bits (73), Expect = 5.2
 Identities = 18/69 (26%), Positives = 31/69 (44%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           TYP + + TR Q+           L     +  + R EGW + Y G+A + + T  +  V
Sbjct: 304 TYPHEVLRTRLQSLDAPTHNSATLL-----IRDIWRSEGWRKYYSGMATNFIRTIPASSV 358

Query: 364 YYYFYQIFR 390
            +  ++I R
Sbjct: 359 TFLSFEIVR 367



>pir|S44092|S44092 probable carrier protein c2 - Caenorhabditis
           elegans>gb:CECAPO_1361656 C.elegans mRNA for unknown
           ORF, 1921bp.>gb:CET09F3_1367531 Caenorhabditis elegans
           cosmid T09F3, complete sequence.
          Length = 384

 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 38/124 (30%), Positives = 59/124 (47%), Gaps = 3/124 (2%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           Y ++ ++T   T  +     R+    I+++ QV + EG   LY GL P+LVG A S+ VY
Sbjct: 124 YCVRNLST-SSTPPQPPTAARRGTIVIKYITQVIKTEGIGALYKGLIPNLVGVAPSKAVY 182

Query: 367 YYFYQI---FRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTR 537
           +Y Y     F  ++EV   +             +  +V A  +G V     NPIW+  TR
Sbjct: 183 FYTYSTSKRFWNESEVLIPN-----------SAIVHMVSAGSAGFVAASAVNPIWLVKTR 231

Query: 538 MQTH 549
           +Q H
Sbjct: 232 LQLH 235



>gb:AE016817_1747335 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 912

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 35/141 (24%), Positives = 64/141 (45%), Gaps = 2/141 (1%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YP+  V TR Q QR+  + K    ++I+ + ++  +EG   LY GL P L+G A  + + 
Sbjct: 543 YPIDMVKTRMQAQRDFSKYK----NSIDCLLKILSKEGVRGLYSGLGPQLIGVAPEKAI- 597

Query: 367 YYFYQIFRTKAEVAALDRKRRGIG--DGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
                      ++   D  R  +   DG + +   ++  A +G   V+ TNP+ +   R+
Sbjct: 598 -----------KLTVNDHMRATLAGRDGKLSLPCEIISGATAGACQVVFTNPLEIVKIRL 646

Query: 541 QTHSKKAKNSPTGAMTAXDAI 603
           Q  S    ++   ++ A   I
Sbjct: 647 QVKSDYVADAARNSVNAISVI 667



>gb:BT001624_1356397 Drosophila melanogaster RE36975 full insert
           cDNA.
          Length = 314

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 34/119 (28%), Positives = 54/119 (45%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YPL TV +R Q +           ST++ + ++   +G+  LY GL P L     S  VY
Sbjct: 34  YPLDTVRSRLQLEEAGDVR-----STMQVIKEIVLGDGFQSLYRGLGPVLQSLCISNFVY 88

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
           +Y +   +  A          G        L  L++ +++G +NVL T P WV  TR++
Sbjct: 89  FYTFHALKAVAS---------GGSPSQHSALKDLLLGSIAGIINVLTTTPFWVVNTRLR 138



 Score = 40.8 bits (94), Expect = 0.019
 Identities = 33/134 (24%), Positives = 61/134 (45%), Gaps = 3/134 (2%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQR---ESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAAS 354
           T P   VNTR + +     S E  +   + +E +  VA +EG   L+ G  PSL+   ++
Sbjct: 127 TTPFWVVNTRLRMRNVAGTSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLM-LVSN 185

Query: 355 QGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVT 534
             + +  Y++         L R       G +G LS   + A++     +LT P+ +  T
Sbjct: 186 PALQFMMYEM---------LKRNIMRFTGGEMGSLSFFFIGAIAKAFATVLTYPLQLVQT 236

Query: 535 RMQTHSKKAKNSPT 576
           + +  SK++ + P+
Sbjct: 237 KQRHRSKESDSKPS 250



 Score = 33.5 bits (75), Expect = 3.0
 Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 8/74 (10%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGK--------RKQLSTIEHMCQVARQEGWDRLYGGLAPSLV 339
           TYPLQ V T+Q+ + +  + K         +  ST+E M  + + +G   L+ GL   ++
Sbjct: 228 TYPLQLVQTKQRHRSKESDSKPSTSAGSTPRTESTLELMISILQHQGIRGLFRGLEAKIL 287

Query: 340 GTAASQGVYYYFYQ 381
            T  +  + +  Y+
Sbjct: 288 QTVLTAALMFMAYE 301



>gb:BC074516_2558011 Xenopus tropicalis MGC69279 protein, mRNA (cDNA
           clone MGC:69279 IMAGE:5308404), complete cds.
          Length = 310

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 46/147 (31%), Positives = 63/147 (42%), Gaps = 7/147 (4%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YPL T   R Q      +  RK  ST   + ++ R+EG    Y G  P +     S  VY
Sbjct: 35  YPLDTARLRLQV-----DDNRKSRSTPAVLLEIMREEGVLAPYRGWFPVISSLCCSNFVY 89

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSS-LVVAALSGCVNVLLTNPIWVGVTRMQ 543
           +Y      T + + AL  K      GSV      L +  ++G VNVL+T P+WV  TR++
Sbjct: 90  FY------TFSSLKALSVK------GSVPTTGKDLTIGFIAGVVNVLITTPLWVVNTRLK 137

Query: 544 THSKKAKNSP------TGAMTAXDAIL 606
               K +N        TG   A   IL
Sbjct: 138 LQGAKFRNDDIVPTTYTGIFDAFQRIL 164



>gb:BC059349_2552384 Xenopus laevis hypothetical protein MGC69168,
           mRNA (cDNA clone MGC:69168 IMAGE:5048990), complete cds.
          Length = 676

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 37/136 (27%), Positives = 61/136 (44%), Gaps = 2/136 (1%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKE--GKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
           YP+  V TR Q QR +    G+    ++ +   +V R EG+  LY GL P L+G A  + 
Sbjct: 347 YPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKA 406

Query: 361 VYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           +          K  V    R +    +GS+ +LS ++    +G   V+ TNP+ +   R+
Sbjct: 407 I----------KLTVNDFVRDKFTTKEGSIPLLSEILAGGCAGGSQVIFTNPLEIVKIRL 456

Query: 541 QTHSKKAKNSPTGAMT 588
           Q   +        A+T
Sbjct: 457 QVAGEITTGPRVSALT 472



>gb:AC107085_1738327 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1764_D01, complete sequence.
          Length = 330

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 35/120 (29%), Positives = 60/120 (50%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YPL T  T+ Q + +++ G  K  +  +   +  ++     LY GL    + +  SQ VY
Sbjct: 29  YPLDTCKTKFQAELQTQPGAHKYRNLSDVFWEAVQKRQILSLYQGLKTKNIQSFISQFVY 88

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
           +Y Y  F+       L++     G  S+G  ++L+VAA +G   V++T P+    +RMQT
Sbjct: 89  FYGYSYFKR----LYLEKS----GAKSIGTKANLLVAAAAGACTVVVTQPLDTASSRMQT 140



>pir|S54495|S54495 probable carrier protein YPR021c - yeast
           (Saccharomyces cerevisiae)>gb:SC9367_1705853
           S.cerevisiae chromosome XVI cosmid
           9367.>gb:SCCHRXVI_1707094 S.cerevisiae chromosome XVI
           165536 bp sequence, cen rightwards.
          Length = 902

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 33/122 (27%), Positives = 56/122 (45%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YP+  + TR Q QR   + K    ++I+ + ++  +EG   LY GL P L+G A  + + 
Sbjct: 549 YPIDFIKTRMQAQRSLAQYK----NSIDCLLKIISREGIKGLYSGLGPQLIGVAPEKAI- 603

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
                    K  V    R R    +G + +   ++  A +G   V+ TNP+ +   R+Q 
Sbjct: 604 ---------KLTVNDFMRNRLTDKNGKLSLFPEIISGASAGACQVIFTNPLEIVKIRLQV 654

Query: 547 HS 552
            S
Sbjct: 655 QS 656



 Score = 35.8 bits (81), Expect = 0.61
 Identities = 35/142 (24%), Positives = 57/142 (40%), Gaps = 1/142 (0%)
 Frame = +1

Query: 184  TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
            T PL+ V  R Q Q +      +Q +  E   Q+ ++ G   LY G+A  L+       +
Sbjct: 642  TNPLEIVKIRLQVQSDYVGENIQQAN--ETATQIVKKLGLRGLYNGVAACLMRDVPFSAI 699

Query: 364  YYYFY-QIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
            Y+  Y  + +   +    D+ +R      +     L   A++G     LT P  V  TR+
Sbjct: 700  YFPTYAHLKKDLFDFDPNDKTKRN----RLKTWELLTAGAIAGMPAAFLTTPFDVIKTRL 755

Query: 541  QTHSKKAKNSPTGAMTAXDAIL 606
            Q   +K +    G   A   IL
Sbjct: 756  QIDPRKGETKYNGIFHAIRTIL 777



>sp|P40464|FLX1_YEAST Mitochondrial FAD carrier protein
           FLX1.>pir|S48400|S48400 carrier protein FLX1, inner
           membrane - yeast (Saccharomyces
           cerevisiae)>gb:AY692757_1622804 Saccharomyces cerevisiae
           clone FLH111117.01X YIL134W gene, complete
           cds.>gb:SC4357_1705277 S.cerevisiae chromosome IX lambda
           clones 4357-3717.>gb:YSCFLX1A_1728901 Saccharomyces
           cerevisiae mitochondrial inner membrane carrier protein
           for FAD (FLX1) gene, complete cds.
          Length = 311

 Score = 52.8 bits (125), Expect = 5e-06
 Identities = 34/105 (32%), Positives = 54/105 (51%), Gaps = 4/105 (3%)
 Frame = +1

Query: 304 DRLYGGLAPSLVGTAASQGVYYYFYQIFRT---KAEVAALDRKRRGIG-DGSVGMLSSLV 471
           + LY GL+ +L G A + GVY+  Y + +    K+     + + +G+G D  +  L  L 
Sbjct: 71  NELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIYLS 130

Query: 472 VAALSGCVNVLLTNPIWVGVTRMQTHSKKAKNSPTGAMTAXDAIL 606
             A SG +  +LTNPIWV  TR+ + SK A+ + T        +L
Sbjct: 131 AGASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLL 175



>gb:CR382132_1665166 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 361

 Score = 52.4 bits (124), Expect = 6e-06
 Identities = 35/103 (33%), Positives = 52/103 (50%), Gaps = 7/103 (6%)
 Frame = +1

Query: 283 VARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLS 462
           + RQEG+  L+ GL P+LVG   S+ + ++ Y +   K  +A      +   DG      
Sbjct: 109 IYRQEGYRALFKGLGPNLVGVIPSRSINFFTYGV--GKEFIA------KEFNDGKEASWV 160

Query: 463 SLVVAALSGCVNVLLTNPIWVGVTRMQ-------THSKKAKNS 570
            L+ AA +G V    TNPIW+  TR+Q       TH ++ KNS
Sbjct: 161 HLLAAANAGIVTSTCTNPIWLIKTRLQLDKASPETHLRQYKNS 203



 Score = 38.5 bits (88), Expect = 0.094
 Identities = 19/67 (28%), Positives = 34/67 (50%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           TYP + V TR +       G+ K    ++    V ++EG+  LYGGL P L+ T  +  +
Sbjct: 288 TYPHEVVRTRLRQAPSETGGRLKYTGLVQCFKLVVKEEGFLALYGGLTPHLLRTVPNSII 347

Query: 364 YYYFYQI 384
            +  +++
Sbjct: 348 MFGTFEL 354



>gb:CR382130_1663399 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 660

 Score = 52.4 bits (124), Expect = 6e-06
 Identities = 36/129 (27%), Positives = 61/129 (47%), Gaps = 1/129 (0%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQL-STIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           YP+  V TR Q QR S  G++    ++ +   +V  +EG   LY GL P LVG A  + +
Sbjct: 331 YPIDMVKTRMQNQRASTPGQQLLYKNSWDCFKKVIAREGPRGLYSGLGPQLVGVAPEKAI 390

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
                     K  V  L R +    +G++ +   ++    +G   V+ TNP+ +   R+Q
Sbjct: 391 ----------KLTVNDLVRGKAADKNGNITLPWEIIAGGTAGACQVVFTNPLEIVKIRLQ 440

Query: 544 THSKKAKNS 570
              + AK++
Sbjct: 441 IQGEVAKHT 449



 Score = 37.0 bits (84), Expect = 0.27
 Identities = 42/151 (27%), Positives = 59/151 (39%), Gaps = 2/151 (1%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRE-SKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
           T PL+ V  R Q Q E +K     + S I     + R  G   LY G +  L+       
Sbjct: 429 TNPLEIVKIRLQIQGEVAKHTDAPKRSAI----WIVRNLGLVGLYKGASACLLRDVPFSA 484

Query: 361 VYYYFYQIFRTKAEVAALDRKRRGIGDG-SVGMLSSLVVAALSGCVNVLLTNPIWVGVTR 537
           +Y+  Y         A L +   G G    + +   LV  A++G     LT P  V  TR
Sbjct: 485 IYFPTY---------AHLKKDYFGEGPNHKLPIWQLLVAGAVAGMPAAYLTTPCDVIKTR 535

Query: 538 MQTHSKKAKNSPTGAMTAXDAILAXVEPPPF 630
           +Q  ++  + S TG   A   IL    P  F
Sbjct: 536 LQVEARSGETSYTGLRHAFSTILREEGPAAF 566



>gb:CR382125_1657335 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 304

 Score = 52.4 bits (124), Expect = 6e-06
 Identities = 38/140 (27%), Positives = 64/140 (45%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           TYPL T+ T  QT+       R +L TI+   ++  + G    + GL  ++ G A +  V
Sbjct: 29  TYPLVTITTNLQTKENEA---RPKLETIK---EIYNKNGIIGYFLGLESAVYGMATTNFV 82

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
           YYYFY+     A      +         +    S++ + ++G +  + +NPIWV  TRM 
Sbjct: 83  YYYFYEWCAKTARTLTTKQY--------LSTWESILASTIAGSMTAVASNPIWVANTRMT 134

Query: 544 THSKKAKNSPTGAMTAXDAI 603
                AK++ +   T  D +
Sbjct: 135 V----AKSNHSTLRTVIDIV 150



>gb:CQ871238_1454653 Sequence 7 from Patent WO2004078112.
          Length = 284

 Score = 52.4 bits (124), Expect = 6e-06
 Identities = 43/141 (30%), Positives = 59/141 (41%), Gaps = 3/141 (2%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +PL T   R Q        KRK  +T   + ++ ++EG    Y G  P +     S  VY
Sbjct: 5   FPLDTARLRLQVDE-----KRKSKTTHAVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVY 59

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
           +Y +     KA      R   G           LVV  ++G VNVLLT P+WV  TR++ 
Sbjct: 60  FYTFNSL--KAVWVKGQRSSTG---------KDLVVGFVAGVVNVLLTTPLWVVNTRLKL 108

Query: 547 HSKKAKNS---PTGAMTAXDA 600
              K +N    PT      DA
Sbjct: 109 QGAKFRNEDIIPTNYKGIIDA 129



>pir|T05350|T05350 adenylate translocator brittle-1 homolog F8B4.100
           - Arabidopsis thaliana>gb:ATCHRIV77_1547160 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           77.>gb:ATF8B4_1551096 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F8B4 (ESSA
           project).>gb:AY074831_1567684 Arabidopsis thaliana
           AT4g32400/F8B4_100 mRNA, complete
           cds.>gb:AY084938_1570020 Arabidopsis thaliana clone
           12232 mRNA, complete sequence.>gb:AF372944_1792659
           Arabidopsis thaliana AT4g32400/F8B4_100 mRNA, complete
           cds.
          Length = 392

 Score = 52.4 bits (124), Expect = 6e-06
 Identities = 35/120 (29%), Positives = 54/120 (45%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           TYPL+ V TR   QR   +G        +   ++ R+EG   LY GLAPSL+G       
Sbjct: 222 TYPLELVKTRLTIQRGVYKG------IFDAFLKIIREEGPTELYRGLAPSLIGVVPYAAT 275

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
            Y+ Y   R      +   K        +G + +L++ +L+G ++   T P+ V    MQ
Sbjct: 276 NYFAYDSLRKAYRSFSKQEK--------IGNIETLLIGSLAGALSSTATFPLEVARKHMQ 327



>sp|O70579|PM34_MOUSE Peroxisomal membrane protein PMP34 (34 kDa
           peroxisomal membrane protein) (Solute carrier family 25,
           member 17).>gb:AK002388_1151166 Mus musculus adult male
           kidney cDNA, RIKEN full-length enriched library,
           clone:0610009F07 product:solute carrier family 25
           (mitochondrial carrier; peroxisomal membrane protein, 34
           kDa), member 17, full insert
           sequence.>gb:CQ871240_1454654 Sequence 9 from Patent
           WO2004078112.>gb:BC008571_2090741 Mus musculus cDNA
           clone MGC:6724 IMAGE:3587806, complete
           cds.>gb:BC011292_2091361 Mus musculus solute carrier
           family 25 (mitochondrial carrier, peroxisomal membrane
           protein), member 17, mRNA (cDNA clone MGC:18353
           IMAGE:3962111), complete cds.>gb:MMU6341_2122856 Mus
           musculus mRNA for peroxisomal integral membrane protein
           PMP34.
          Length = 307

 Score = 52.4 bits (124), Expect = 6e-06
 Identities = 43/141 (30%), Positives = 59/141 (41%), Gaps = 3/141 (2%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +PL T   R Q        KRK  +T   + ++ ++EG    Y G  P +     S  VY
Sbjct: 28  FPLDTARLRLQVDE-----KRKSKTTHAVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVY 82

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
           +Y +     KA      R   G           LVV  ++G VNVLLT P+WV  TR++ 
Sbjct: 83  FYTFNSL--KAVWVKGQRSSTG---------KDLVVGFVAGVVNVLLTTPLWVVNTRLKL 131

Query: 547 HSKKAKNS---PTGAMTAXDA 600
              K +N    PT      DA
Sbjct: 132 QGAKFRNEDIIPTNYKGIIDA 152



>gb:AY560327_1614883 Hordeum vulgare subsp. vulgare plastidial
           ADP-glucose transporter mRNA, complete cds; nuclear gene
           for plastid product.
          Length = 396

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 33/120 (27%), Positives = 55/120 (45%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           TYP++ V TR   +++  +      + +    ++ R EG   LY GLAPSL+G       
Sbjct: 226 TYPMELVKTRLTIEKDVYD------NLLHAFVKIVRDEGPGELYRGLAPSLIGVVPYAAA 279

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
            +Y Y+  R           RR  G   VG + +L++ + +G +    T P+ V   +MQ
Sbjct: 280 NFYAYETLR--------GAYRRASGKEEVGNVPTLLIGSAAGAIASTATFPLEVARKQMQ 331



>gb:BC087370_2565215 Xenopus laevis hypothetical LOC495984, mRNA
           (cDNA clone MGC:99132 IMAGE:7205791), complete cds.
          Length = 318

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 35/118 (29%), Positives = 57/118 (48%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +PL  V  R     +  E + K    +  +  V ++EG   LY G+ P++ G  AS G+Y
Sbjct: 44  HPLDLVKIRFAVS-DGLELRPKYRGIVHCLATVWQREGLRGLYQGVTPNMWGAGASWGLY 102

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           ++FY         A    K+ G  +  +  +  L+ AA +G + +  TNPIWV  TR+
Sbjct: 103 FFFYN--------AVKAYKKEGRAE-DLSAVEHLLSAAGAGALTLCFTNPIWVTKTRL 151



 Score = 33.9 bits (76), Expect = 2.3
 Identities = 33/122 (27%), Positives = 52/122 (42%), Gaps = 2/122 (1%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRES--KEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQ 357
           T P+    TR   Q ++     KR+       + ++ R EG   LY G  P L+GT+   
Sbjct: 141 TNPIWVTKTRLVLQYDAGIDSSKRQYRGMFHALGKIYRNEGIPGLYKGFVPGLLGTSHG- 199

Query: 358 GVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTR 537
            + +  Y+  + +     L+R      D  +G L  + +AALS    V  T P  V   R
Sbjct: 200 ALQFMAYEELKMEYN-KYLNRP----SDTKLGTLEYITMAALSKIFAVSTTYPYQVVRAR 254

Query: 538 MQ 543
           +Q
Sbjct: 255 LQ 256



>gb:AE017347_1758054 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 340

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 33/85 (38%), Positives = 46/85 (54%), Gaps = 3/85 (3%)
 Frame = +1

Query: 295 EGWDRLYGGLAPSLVGTAASQGVYYYF-YQIFRTKAEVAALDRKRRGIGDGSVGMLSS-- 465
           +GW  LY GL P+LVG A+S G+Y+ F Y +           +K+   GD S    S   
Sbjct: 81  DGWKGLYRGLVPNLVGGASSWGLYFLFSYNMI----------KKQMQGGDPSYRTSSGQH 130

Query: 466 LVVAALSGCVNVLLTNPIWVGVTRM 540
           L+ AA +  +  +LTNPIWV  TR+
Sbjct: 131 LLAAAEASAITAMLTNPIWVVKTRV 155



>gb:AC104272_1737352 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1045_C06, complete
           sequence.>gb:AC121363_1740158 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBa0036C12,
           complete sequence.
          Length = 336

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 34/126 (26%), Positives = 64/126 (50%), Gaps = 2/126 (1%)
 Frame = +1

Query: 190 PLQTVNTRQQTQRESK--EGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           PL  + TR Q     K   G       I  + Q+A++EG+  +Y GL+P+++    +  V
Sbjct: 50  PLDVIKTRFQVHGWPKLATGTIGGSVIIGSLQQIAQREGFRGMYRGLSPTILALLPNWAV 109

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
           Y+  Y+  + K+ +++ DR         + + ++++ A+ +G    + TNP+WV  TR Q
Sbjct: 110 YFTVYE--QLKSLLSSNDRSHH------LSLGANVIAASCAGGATTIATNPLWVVKTRFQ 161

Query: 544 THSKKA 561
           T   +A
Sbjct: 162 TQGIRA 167



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 44/135 (32%), Positives = 59/135 (43%), Gaps = 1/135 (0%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           T PL  V TR QTQ   + G      T+  + ++A +EG   LY GL P+L G +    V
Sbjct: 150 TNPLWVVKTRFQTQG-IRAGVIPYKGTLAALKRIAHEEGIRGLYSGLVPALAGIS---HV 205

Query: 364 YYYFYQIFRTKAEVAALDRKR-RGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
              F    + KA +A  D      +  G V + SSL   A S      LT P  V  +R+
Sbjct: 206 AIQFPAYEKIKAYLAERDNTTVEALSFGDVAVASSLAKVAAS-----TLTYPHEVVRSRL 260

Query: 541 QTHSKKAKNSPTGAM 585
           Q     +K   TG M
Sbjct: 261 QEQGAHSKARYTGVM 275



>gb:CR382137_1669893 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 341

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 38/117 (32%), Positives = 62/117 (52%)
 Frame = +1

Query: 217 QTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTK 396
           QT + +K+G+ K  +T++ + ++  ++G    Y GLA S++GT A    Y+Y+Y I   K
Sbjct: 56  QTLKNTKDGEVKYKNTLDVLRKIYAKKGVLGWYHGLASSILGTTAQNFSYFYWYTI--VK 113

Query: 397 AEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQTHSKKAKN 567
              A L    + I +      + L + AL+ C++ L T PI V  T+ QT  K  KN
Sbjct: 114 RVYANL---YKHIPNHKPTTATELFLGALAACISQLFTMPIGVITTQQQT-DKTHKN 166



>gb:AJ720830_2503017 Gallus gallus mRNA for hypothetical protein,
           clone 27c17.
          Length = 675

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 37/136 (27%), Positives = 60/136 (44%), Gaps = 2/136 (1%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKE--GKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
           YP+  V TR Q QR +    G+    ++ +   +V R EG+  LY GL P L+G A  + 
Sbjct: 346 YPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKA 405

Query: 361 VYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           +          K  V    R +    DGSV + + ++    +G   V+ TNP+ +   R+
Sbjct: 406 I----------KLTVNDFVRDKFMSKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRL 455

Query: 541 QTHSKKAKNSPTGAMT 588
           Q   +        A+T
Sbjct: 456 QVAGEITTGPRVSALT 471



>gb:AK002829_1151477 Mus musculus adult male kidney cDNA, RIKEN
           full-length enriched library, clone:0610039E03
           product:solute carrier family 25 (mitochondrial carrier;
           adenine nucleotide translocator), member 13, full insert
           sequence.
          Length = 676

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 36/121 (29%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKE--GKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
           YP+  V TR Q QR +    G+    ++ +   +V R EG+  LY GL P L+G A  + 
Sbjct: 348 YPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKA 407

Query: 361 VYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           +          K  V    R +    DGSV +L+ +     +G   V+ TNP+ +   R+
Sbjct: 408 I----------KLTVNDFVRDKFMHKDGSVPLLAEIFAGGCAGGFQVIFTNPLEIVKIRL 457

Query: 541 Q 543
           Q
Sbjct: 458 Q 458



>sp|O43808|PM34_HUMAN Peroxisomal membrane protein PMP34 (34 kDa
           peroxisomal membrane protein) (Solute carrier family 25,
           member 17).>gb:CQ871242_1454655 Sequence 11 from Patent
           WO2004078112.>gb:AX399870_1467183 Sequence 41 from
           Patent WO0218424.>gb:BC005957_1969964 Homo sapiens
           solute carrier family 25 (mitochondrial carrier;
           peroxisomal membrane protein, 34kDa), member 17, mRNA
           (cDNA clone MGC:14604 IMAGE:4046173), complete
           cds.>gb:BC012998_1973892 Homo sapiens solute carrier
           family 25 (mitochondrial carrier; peroxisomal membrane
           protein, 34kDa), member 17, mRNA (cDNA clone MGC:3539
           IMAGE:3604411), complete cds.>gb:CR456577_1992868 Homo
           sapiens SLC25A17 full length open reading frame (ORF)
           cDNA clone (cDNA clone
           C22ORF:pGEM.SLC25A17).>gb:HS362J20_1998294 Human DNA
           sequence from clone RP3-362J20 on chromosome
           22q13.1-13.31, complete sequence.>gb:HS408N23_1998505
           Human DNA sequence from clone RP3-408N23 on chromosome
           22q13, complete sequence.>gb:HSPMP35HM_2019630 Homo
           sapiens mRNA for peroxisomal integral membrane protein.
          Length = 307

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 43/141 (30%), Positives = 61/141 (43%), Gaps = 3/141 (2%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +PL T   R Q        KRK  +T   + ++ ++EG    Y G  P +     S  VY
Sbjct: 28  FPLDTARLRLQVDE-----KRKSKTTHMVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVY 82

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
           +Y +   +      AL  K +    G       LVV  ++G VNVLLT P+WV  TR++ 
Sbjct: 83  FYTFNSLK------ALWVKGQHSTTGK-----DLVVGFVAGVVNVLLTTPLWVVNTRLKL 131

Query: 547 HSKKAKNS---PTGAMTAXDA 600
              K +N    PT      DA
Sbjct: 132 QGAKFRNEDIVPTNYKGIIDA 152



>gb:BC084385_2563765 Xenopus laevis hypothetical LOC495171, mRNA
           (cDNA clone MGC:85471 IMAGE:6937717), complete cds.
          Length = 310

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 43/146 (29%), Positives = 60/146 (41%), Gaps = 6/146 (4%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YPL T   R Q      + KRK  ST   + ++ R+EG    Y G    +     S  VY
Sbjct: 35  YPLDTARLRLQV-----DDKRKSRSTPAVLLEIMREEGLVAPYRGWFSVISSLCCSNFVY 89

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
           +Y +   +      AL  K      G       L +  ++G VNVLLT P+WV  TR++ 
Sbjct: 90  FYTFNSLK------ALSIKGSAPTTGK-----DLTIGFIAGVVNVLLTTPLWVVNTRLKL 138

Query: 547 HSKKAKNSP------TGAMTAXDAIL 606
              K ++        TG   A   IL
Sbjct: 139 QGAKFRSDDFVPTTYTGIFDAFQRIL 164



>gb:BC016571_2092379 Mus musculus solute carrier family 25
           (mitochondrial carrier, adenine nucleotide
           translocator), member 13, mRNA (cDNA clone MGC:29043
           IMAGE:3600909), complete cds.
          Length = 409

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 36/121 (29%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKE--GKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
           YP+  V TR Q QR +    G+    ++ +   +V R EG+  LY GL P L+G A  + 
Sbjct: 81  YPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKA 140

Query: 361 VYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           +          K  V    R +    DGSV +L+ +     +G   V+ TNP+ +   R+
Sbjct: 141 I----------KLTVNDFVRDKFMHKDGSVPLLAEIFAGGCAGGSQVIFTNPLEIVKIRL 190

Query: 541 Q 543
           Q
Sbjct: 191 Q 191



>gb:AP004045_1836827 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1135_F06.>gb:AP004869_1846314 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0419A09.
          Length = 425

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 32/120 (26%), Positives = 55/120 (45%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           TYP++ V TR   +++  +      + +    ++ R+ G   LY GLAPSL+G       
Sbjct: 240 TYPMELVKTRLTIEKDVYD------NVLHAFVKIVREGGPGELYRGLAPSLIGVVPYAAT 293

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
            +Y Y+  R           RR  G   VG  ++L++ + +G +    T P+ V   +MQ
Sbjct: 294 NFYAYETLRR--------LYRRATGRADVGPAATLLIGSAAGAIASTATFPLEVARKQMQ 345



>gb:AK012670_1157094 Mus musculus 10, 11 days embryo whole body
           cDNA, RIKEN full-length enriched library,
           clone:2810004F14 product:solute carrier family 25
           (mitochondrial carrier; adenine nucleotide
           translocator), member 13, full insert
           sequence.>gb:AK029020_1161290 Mus musculus 10 days
           neonate skin cDNA, RIKEN full-length enriched library,
           clone:4732482D23 product:solute carrier family 25
           (mitochondrial carrier; adenine nucleotide
           translocator), member 13, full insert sequence.
          Length = 675

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 36/121 (29%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKE--GKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
           YP+  V TR Q QR +    G+    ++ +   +V R EG+  LY GL P L+G A  + 
Sbjct: 347 YPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKA 406

Query: 361 VYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           +          K  V    R +    DGSV +L+ +     +G   V+ TNP+ +   R+
Sbjct: 407 I----------KLTVNDFVRDKFMHKDGSVPLLAEIFAGGCAGGSQVIFTNPLEIVKIRL 456

Query: 541 Q 543
           Q
Sbjct: 457 Q 457



>pir|T23170|T23170 hypothetical protein K01C8.7 - Caenorhabditis
           elegans>gb:CEK01C8_1365154 Caenorhabditis elegans cosmid
           K01C8, complete sequence.
          Length = 296

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 29/87 (33%), Positives = 45/87 (51%)
 Frame = +1

Query: 280 QVARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGML 459
           ++ R EG   LY G  PSL+G + S G+Y+ +Y   RTK               GS  + 
Sbjct: 57  KIVRVEGVRGLYQGWTPSLIGASLSWGLYFQWYNSLRTKI--------YENFSTGS-KLA 107

Query: 460 SSLVVAALSGCVNVLLTNPIWVGVTRM 540
           ++L+   +SG   + +TNPIW+  TR+
Sbjct: 108 NNLISGCISGSAIMCITNPIWLTKTRL 134



 Score = 35.0 bits (79), Expect = 1.0
 Identities = 28/127 (22%), Positives = 54/127 (42%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           T P+    TR   Q E+++ K K    ++ + +  +QEG+  LY G    ++GT      
Sbjct: 124 TNPIWLTKTRLCLQYENQQSK-KYAGMMDCLKKTVKQEGFFGLYRGFVTGVIGTTHGAVQ 182

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
              +  I   + +   L +      D  +     ++ ++ S  +   +T P  V  TRMQ
Sbjct: 183 IAAYSWIIDKRCQSQGLPK------DSFLSQTDYVIASSTSKVLATTITFPYQVLRTRMQ 236

Query: 544 THSKKAK 564
            H+  ++
Sbjct: 237 DHNTDSR 243



>sp|Q9QXX4|CMC2_MOUSE Calcium-binding mitochondrial carrier protein
           Aralar2 (Mitochondrial aspartate glutamate carrier 2)
           (Solute carrier family 25, member 13)
           (Citrin).>gb:AF164632_2057529 Mus musculus citrin
           (Slc25a13) mRNA, complete cds.
          Length = 676

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 36/121 (29%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKE--GKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
           YP+  V TR Q QR +    G+    ++ +   +V R EG+  LY GL P L+G A  + 
Sbjct: 348 YPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKA 407

Query: 361 VYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           +          K  V    R +    DGSV +L+ +     +G   V+ TNP+ +   R+
Sbjct: 408 I----------KLTVNDFVRDKFMHKDGSVPLLAEIFAGGCAGGSQVIFTNPLEIVKIRL 457

Query: 541 Q 543
           Q
Sbjct: 458 Q 458



>gb:AX880684_1478377 Sequence 15589 from Patent
           EP1074617.>gb:AK027787_1911229 Homo sapiens cDNA
           FLJ14881 fis, clone PLACE1003420, weakly similar to
           PUTATIVE MITOCHONDRIAL CARRIER YIL006W.
          Length = 315

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 33/129 (25%), Positives = 57/129 (44%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +PL  V  R     +  E + K    +  +  + + +G   LY G+ P++ G   S G+Y
Sbjct: 41  HPLDLVKIRFAVS-DGLELRPKYNGILHCLTTIWKLDGLRGLYQGVTPNIWGAGLSWGLY 99

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
           ++FY   ++       +R         +     LV AA +G + + +TNP+WV  TR+  
Sbjct: 100 FFFYNAIKSYKTEGRAER---------LEATEYLVSAAEAGAMTLCITNPLWVTKTRLML 150

Query: 547 HSKKAKNSP 573
                 NSP
Sbjct: 151 QYDAVVNSP 159



>gb:AX453448_1468806 Sequence 9 from Patent WO0242455.
          Length = 315

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 33/129 (25%), Positives = 57/129 (44%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +PL  V  R     +  E + K    +  +  + + +G   LY G+ P++ G   S G+Y
Sbjct: 41  HPLDLVKIRFAVS-DGLELRPKYNGILHCLTTIWKLDGLRGLYQGVTPNIWGAGLSWGLY 99

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
           ++FY   ++       +R         +     LV AA +G + + +TNP+WV  TR+  
Sbjct: 100 FFFYNAIKSYKTEGRAER---------LEATEYLVSAAEAGAMTLCITNPLWVTKTRLML 150

Query: 547 HSKKAKNSP 573
                 NSP
Sbjct: 151 QYDAVVNSP 159



>gb:AE014296_1135890 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE014296_1135891 Drosophila melanogaster
           chromosome 3L, complete sequence.>gb:AE003544_1214866
           Drosophila melanogaster chromosome 3L, section 41 of 83
           of the complete sequence.>gb:AE003544_1214867 Drosophila
           melanogaster chromosome 3L, section 41 of 83 of the
           complete sequence.>gb:AY051433_1290027 Drosophila
           melanogaster GH10708 full length cDNA.
          Length = 303

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 35/127 (27%), Positives = 59/127 (46%), Gaps = 3/127 (2%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQL---STIEHMCQVARQEGWDRLYGGLAPSLVGTAAS 354
           T+P+ T  TR Q Q +  +    QL      +   +++R+EG   LY G+ P+++  A  
Sbjct: 24  TFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIWPAVLRQATY 83

Query: 355 QGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVT 534
             + +  Y   +  A    L        DGS  + S+++ AA +G ++  + NP  V   
Sbjct: 84  GTIKFGTYYTLKKLANERGLLINE----DGSERVWSNILCAAAAGAISSAIANPTDVLKV 139

Query: 535 RMQTHSK 555
           RMQ H K
Sbjct: 140 RMQVHGK 146



>gb:AE014134_1127042 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003585_1216571 Drosophila melanogaster
           chromosome 2L, section 6 of 83 of the complete
           sequence.>gb:AY058735_1291889 Drosophila melanogaster
           LP02521 full length cDNA.
          Length = 365

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 33/98 (33%), Positives = 51/98 (52%)
 Frame = +1

Query: 250 KQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRR 429
           K +S ++ +  + + EG   L+ GL P+LVG A S+ +Y+  Y   +TK  + +L    R
Sbjct: 107 KSMSIVQCLRHIVQNEGPRALFKGLGPNLVGVAPSRAIYFCTYS--QTKNTLNSLGFVER 164

Query: 430 GIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
                    L  ++ AA +G V+   TNPIW   TRMQ
Sbjct: 165 D------SPLVHIMSAASAGFVSSTATNPIWFVKTRMQ 196



>sp|Q9H2D1|MFTC_HUMAN Mitochondrial folate
           transporter/carrier.>gb:AX879781_1477982 Sequence 14686
           from Patent EP1074617.>gb:AK027531_1911041 Homo sapiens
           cDNA FLJ14625 fis, clone NT2RP2000257, weakly similar to
           PUTATIVE MITOCHONDRIAL CARRIER
           YIL006W.>gb:BC021893_1977593 Homo sapiens mitochondrial
           folate transporter/carrier, mRNA (cDNA clone MGC:21744
           IMAGE:4524907), complete cds.
          Length = 315

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 33/129 (25%), Positives = 57/129 (44%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +PL  V  R     +  E + K    +  +  + + +G   LY G+ P++ G   S G+Y
Sbjct: 41  HPLDLVKIRFAVS-DGLELRPKYNGILHCLTTIWKLDGLRGLYQGVTPNIWGAGLSWGLY 99

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
           ++FY   ++       +R         +     LV AA +G + + +TNP+WV  TR+  
Sbjct: 100 FFFYNAIKSYKTEGRAER---------LEATEYLVSAAEAGAMTLCITNPLWVTKTRLML 150

Query: 547 HSKKAKNSP 573
                 NSP
Sbjct: 151 QYDAVVNSP 159



>gb:AF055463_2052650 Mus musculus peroxisomal integral membrane
           protein (PMP47) mRNA, complete cds.
          Length = 307

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 41/141 (29%), Positives = 58/141 (41%), Gaps = 3/141 (2%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +PL T   R Q        KRK  +T   + ++ ++EG    Y G  P +     S  VY
Sbjct: 28  FPLDTARLRLQVDE-----KRKSKTTHAVVLEIIKEEGLLAPYRGWFPVISSLCCSNFVY 82

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
           +Y +     KA      R   G           L +  ++G VNVLLT P+WV  TR++ 
Sbjct: 83  FYTFNSL--KAVWVKGQRSSTG---------KDLAIGFVAGVVNVLLTTPLWVVNTRLKL 131

Query: 547 HSKKAKNS---PTGAMTAXDA 600
              K +N    PT      DA
Sbjct: 132 QGAKFRNEDIIPTNYKGIIDA 152



>gb:BC016932_1975807 Homo sapiens solute carrier family 25
           (mitochondrial carrier, Aralar), member 12, mRNA (cDNA
           clone MGC:21311 IMAGE:4420100), complete
           cds.>gb:HSA496568_2007649 Homo sapiens mRNA for
           mitochondrial aspartate-glutamate carrier protein
           (SLC25A12 gene).
          Length = 678

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 36/121 (29%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKE--GKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
           YP+  V TR Q QR S    G+    ++ +   +V R EG+  LY GL P L+G A  + 
Sbjct: 345 YPIDLVKTRMQNQRGSGSVVGELMYKNSFDCFKKVLRYEGFFGLYRGLIPQLIGVAPEKA 404

Query: 361 VYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           +          K  V    R +    DGSV + + ++    +G   V+ TNP+ +   R+
Sbjct: 405 I----------KLTVNDFVRDKFTRRDGSVPLPAEVLAGGCAGGSQVIFTNPLEIVKIRL 454

Query: 541 Q 543
           Q
Sbjct: 455 Q 455



>gb:AC002535_1530841 Arabidopsis thaliana chromosome 2 clone T30B22
           map CIC06C03, complete sequence.>gb:AY074833_1567686
           Arabidopsis thaliana At2g47490/T30B22.21 mRNA, complete
           cds.>gb:AY084889_1569971 Arabidopsis thaliana clone
           120306 mRNA, complete sequence.>gb:AF372957_1792671
           Arabidopsis thaliana At2g47490/T30B22.21 mRNA, complete
           cds.
          Length = 312

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 35/125 (28%), Positives = 63/125 (50%), Gaps = 2/125 (1%)
 Frame = +1

Query: 190 PLQTVNTRQQTQRESKEGKR--KQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           PL  + TR Q     K G    K    +  + Q+ ++EG   LY GL+P+++   ++  +
Sbjct: 33  PLDVIKTRFQVHGLPKLGDANIKGSLIVGSLEQIFKREGMRGLYRGLSPTVMALLSNWAI 92

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
           Y+  Y   + K+ + + D K       SVG  ++++ A+ +G    + TNP+WV  TR+Q
Sbjct: 93  YFTMYD--QLKSFLCSNDHKL------SVG--ANVLAASGAGAATTIATNPLWVVKTRLQ 142

Query: 544 THSKK 558
           T   +
Sbjct: 143 TQGMR 147



 Score = 40.8 bits (94), Expect = 0.019
 Identities = 47/164 (28%), Positives = 63/164 (38%), Gaps = 8/164 (4%)
 Frame = +1

Query: 91  LQIFSCSRVTMSDXXXXXXXXXXXXXXXXXXTYPLQTVNTRQQTQRESKEGKRKQLSTIE 270
           L+ F CS                        T PL  V TR QTQ   + G     ST  
Sbjct: 100 LKSFLCSNDHKLSVGANVLAASGAGAATTIATNPLWVVKTRLQTQG-MRVGIVPYKSTFS 158

Query: 271 HMCQVARQEGWDRLYGGLAPSLVGTA--ASQGVYYYFYQIFRTKAEVAALDRKRRGIGDG 444
            + ++A +EG   LY GL P+L G +  A Q   Y   +++  K             GD 
Sbjct: 159 ALRRIAYEEGIRGLYSGLVPALAGISHVAIQFPTYEMIKVYLAKK------------GDK 206

Query: 445 SVGMLSSLVVAALSGCVNVL---LTNPIWVGVTRMQT---HSKK 558
           SV  L++  VA  S    +    LT P  V   R+Q    HS+K
Sbjct: 207 SVDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQGHHSEK 250



>gb:AX879835_1478005 Sequence 14740 from Patent EP1074617.
          Length = 678

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 36/121 (29%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKE--GKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
           YP+  V TR Q QR S    G+    ++ +   +V R EG+  LY GL P L+G A  + 
Sbjct: 345 YPIDLVKTRMQNQRGSGSVVGELMYKNSFDCFKKVLRYEGFFGLYRGLIPQLIGVAPEKS 404

Query: 361 VYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           +          K  V    R +    DGSV + + ++    +G   V+ TNP+ +   R+
Sbjct: 405 I----------KLTVNDFVRDKFTRRDGSVPLPAEVLAGGCAGGSQVIFTNPLEIVKIRL 454

Query: 541 Q 543
           Q
Sbjct: 455 Q 455



>gb:CR858723_1182877 Pongo pygmaeus mRNA; cDNA DKFZp468M1513 (from
           clone DKFZp468M1513).
          Length = 678

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 36/121 (29%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKE--GKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
           YP+  V TR Q QR S    G+    ++ +   +V R EG+  LY GL P L+G A  + 
Sbjct: 345 YPIDLVKTRMQNQRGSGSVVGELMYKNSFDCFKKVLRYEGFFGLYRGLIPQLIGVAPEKA 404

Query: 361 VYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           +          K  V    R +    DGSV + + ++    +G   V+ TNP+ +   R+
Sbjct: 405 I----------KLTVNDFVRDKFTRRDGSVPLPAEVLAGGCAGGSQVIFTNPLEIVKIRL 454

Query: 541 Q 543
           Q
Sbjct: 455 Q 455



>sp|O75746|CMC1_HUMAN Calcium-binding mitochondrial carrier protein
           Aralar1 (Mitochondrial aspartate glutamate carrier 1)
           (Solute carrier family 25, member
           12).>gb:HSARALAR1_2010641 Homo sapiens mRNA for
           mitochondrial carrier protein ARALAR1.
          Length = 678

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 36/121 (29%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKE--GKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
           YP+  V TR Q QR S    G+    ++ +   +V R EG+  LY GL P L+G A  + 
Sbjct: 345 YPIDLVKTRMQNQRGSGSVVGELMYKNSFDCFKKVLRYEGFFGLYRGLIPQLIGVAPEKA 404

Query: 361 VYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           +          K  V    R +    DGSV + + ++    +G   V+ TNP+ +   R+
Sbjct: 405 I----------KLTVNDFVRDKFTRRDGSVPLPAEVLAGGCAGGSQVIFTNPLEIVKIRL 454

Query: 541 Q 543
           Q
Sbjct: 455 Q 455



>gb:HSA496569_2007650 Homo sapiens mRNA for mitochondrial
           aspartate-glutamate carrier protein (SLC25A13 gene).
          Length = 676

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 35/121 (28%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKE--GKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
           YP+  V TR Q QR +    G+    ++ +   +V R EG+  LY GL P L+G A  + 
Sbjct: 348 YPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKA 407

Query: 361 VYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           +          K  V    R +    DGSV + + ++    +G   V+ TNP+ +   R+
Sbjct: 408 I----------KLTVNDFVRDKFMHKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRL 457

Query: 541 Q 543
           Q
Sbjct: 458 Q 458



>gb:HOS17571_1996294 Homo sapiens mRNA for mitochondrial carrier
           protein ARALAR2.
          Length = 675

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 35/121 (28%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKE--GKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
           YP+  V TR Q QR +    G+    ++ +   +V R EG+  LY GL P L+G A  + 
Sbjct: 347 YPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKA 406

Query: 361 VYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           +          K  V    R +    DGSV + + ++    +G   V+ TNP+ +   R+
Sbjct: 407 I----------KLTVNDFVRDKFMHKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRL 456

Query: 541 Q 543
           Q
Sbjct: 457 Q 457



>gb:AB083329_1871866 Macaca fascicularis slc25a13 mRNA for solute
           carrier family 25 member 13, complete cds.
          Length = 674

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 35/121 (28%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKE--GKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
           YP+  V TR Q QR +    G+    ++ +   +V R EG+  LY GL P L+G A  + 
Sbjct: 347 YPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKA 406

Query: 361 VYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           +          K  V    R +    DGSV + + ++    +G   V+ TNP+ +   R+
Sbjct: 407 I----------KLTVNDFVRDKFMHKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRL 456

Query: 541 Q 543
           Q
Sbjct: 457 Q 457



>gb:AB062964_1868955 Macaca fascicularis brain cDNA
           clone:QmoA-10283, full insert sequence.
          Length = 303

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 33/129 (25%), Positives = 57/129 (44%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +PL  V  R     +  E + K    +  +  + + +G   LY G+ P++ G   S G+Y
Sbjct: 41  HPLDLVKIRFAVS-DGLELRPKYNGILHCLTTIWKLDGLRGLYQGVTPNVWGAGLSWGLY 99

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
           ++FY   ++       +R         +     LV AA +G + + +TNP+WV  TR+  
Sbjct: 100 FFFYNAIKSYKTEGRAER---------LEATEYLVSAAEAGAMTLCITNPLWVTKTRLML 150

Query: 547 HSKKAKNSP 573
                 NSP
Sbjct: 151 QYDAVINSP 159



>gb:AB060253_1868687 Macaca fascicularis brain cDNA
           clone:QtrA-11259, full insert sequence.
          Length = 315

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 33/129 (25%), Positives = 57/129 (44%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +PL  V  R     +  E + K    +  +  + + +G   LY G+ P++ G   S G+Y
Sbjct: 41  HPLDPVKIRFAVS-DGLELRPKYNGILHCLTTIWKLDGLRGLYQGVTPNVWGAGLSWGLY 99

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
           ++FY   ++       +R         +     LV AA +G + + +TNP+WV  TR+  
Sbjct: 100 FFFYNAIKSYKTEGRAER---------LEATEYLVSAAEAGAMTLCITNPLWVTKTRLML 150

Query: 547 HSKKAKNSP 573
                 NSP
Sbjct: 151 QYDAVINSP 159



>gb:AE016817_1747376 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 379

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 37/127 (29%), Positives = 56/127 (44%)
 Frame = +1

Query: 190 PLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVYY 369
           PL    TR Q Q     G+R     +  +  + R EG   LY GLAP ++G   +  +Y+
Sbjct: 104 PLDVAKTRLQAQGAGS-GERYYRGIVGTLSAILRDEGVAGLYKGLAPIVLGYFPTWMLYF 162

Query: 370 YFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQTH 549
             Y+             K+R       G +S    A  +G ++  LTNPIWV  TR+   
Sbjct: 163 SVYE-----------KCKQRYPSYLPGGFVSHAASALTAGAISTALTNPIWVVKTRLMIQ 211

Query: 550 SKKAKNS 570
           S  +++S
Sbjct: 212 SDVSRDS 218



 Score = 36.6 bits (83), Expect = 0.36
 Identities = 36/123 (29%), Positives = 54/123 (43%), Gaps = 3/123 (2%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           T P+  V TR   Q +         ST++   ++ R EG    Y GL PSL G      +
Sbjct: 198 TNPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLFG-LFHVAI 256

Query: 364 YYYFYQIFR--TKAEVAALDRKRRGIGDGSVGMLSSLVVAA-LSGCVNVLLTNPIWVGVT 534
           ++  Y+  +        A D +R    D +   L  L+VA+ LS  V  ++T P  +  T
Sbjct: 257 HFPVYEKLKIWLHRNTPAADGQRL---DHNKLQLDRLIVASCLSKVVASVITYPHEILRT 313

Query: 535 RMQ 543
           RMQ
Sbjct: 314 RMQ 316



>gb:CR382129_1661560 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 337

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 36/140 (25%), Positives = 62/140 (44%), Gaps = 3/140 (2%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +PL  V TR Q Q+   +   +  S ++   ++ + EG   LY G     + T  S   Y
Sbjct: 22  FPLDLVTTRLQVQKGYLDEDDQYKSLLDAFTKIVKNEGIFALYDGAFQDTISTMVSAFFY 81

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
           ++ Y   R       + R   G    ++G+   L+V +L+G     +T+P+   VTR QT
Sbjct: 82  FFAYDFLRNNR--LKMKRLPNGRLPKTLGIAEELLVGSLAGIFCRFITSPLGNIVTRQQT 139

Query: 547 HS---KKAKNSPTGAMTAXD 597
            +   K  + +P  A  A +
Sbjct: 140 AALVQKSNRATPEAAAHASE 159



>gb:AY093232_1575186 Arabidopsis thaliana unknown protein
           (At1g25380) mRNA, complete cds.>gb:BT008746_1639942
           Arabidopsis thaliana At1g25380 gene, complete cds.
          Length = 363

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 30/121 (24%), Positives = 58/121 (47%), Gaps = 2/121 (1%)
 Frame = +1

Query: 190 PLQTVNTRQQTQR--ESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           PL  + TR Q     E+    ++    I  +  + ++EG+  +Y GL+P+++    +  V
Sbjct: 37  PLDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIKEEGYRGMYRGLSPTIIALLPNWAV 96

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
           Y+  Y   +   + +          DG + + S+++ AA +G    + TNP+WV  TR+ 
Sbjct: 97  YFSVYGKLKDVLQSS----------DGKLSIGSNMIAAAGAGAATSIATNPLWVVKTRLM 146

Query: 544 T 546
           T
Sbjct: 147 T 147



 Score = 33.5 bits (75), Expect = 3.0
 Identities = 38/141 (26%), Positives = 58/141 (41%), Gaps = 1/141 (0%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           T PL  V TR  TQ   + G     S +    ++  +EG   LY G+ PSL G +    V
Sbjct: 135 TNPLWVVKTRLMTQG-IRPGVVPYKSVMSAFSRICHEEGVRGLYSGILPSLAGVS---HV 190

Query: 364 YYYFYQIFRTKAEVAALDRKR-RGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
              F    + K  +A +D      +  G+V + SS+     S     +LT P  V   ++
Sbjct: 191 AIQFPAYEKIKQYMAKMDNTSVENLSPGNVAIASSIAKVIAS-----ILTYPHEVIRAKL 245

Query: 541 QTHSKKAKNSPTGAMTAXDAI 603
           Q    + +N+ T      D I
Sbjct: 246 QEQG-QIRNAETKYSGVIDCI 265



>sp|Q95J75|MFTC_MACFA Mitochondrial folate
           transporter/carrier.>gb:AB060884_1868739 Macaca
           fascicularis brain cDNA clone:QtrA-13024, full insert
           sequence.>gb:AB062992_1868966 Macaca fascicularis brain
           cDNA clone:QmoA-10785, full insert sequence.
          Length = 315

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 33/129 (25%), Positives = 57/129 (44%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +PL  V  R     +  E + K    +  +  + + +G   LY G+ P++ G   S G+Y
Sbjct: 41  HPLDLVKIRFAVS-DGLELRPKYNGILHCLTTIWKLDGLRGLYQGVTPNVWGAGLSWGLY 99

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
           ++FY   ++       +R         +     LV AA +G + + +TNP+WV  TR+  
Sbjct: 100 FFFYNAIKSYKTEGRAER---------LEATEYLVSAAEAGAMTLCITNPLWVTKTRLML 150

Query: 547 HSKKAKNSP 573
                 NSP
Sbjct: 151 QYDAVINSP 159



>sp|Q9UJS0|CMC2_HUMAN Calcium-binding mitochondrial carrier protein
           Aralar2 (Mitochondrial aspartate glutamate carrier 2)
           (Solute carrier family 25, member 13)
           (Citrin).>gb:AF118838_1884712 Homo sapiens citrin
           (SLC25A13) mRNA, complete cds.>gb:BC006566_1970392 Homo
           sapiens solute carrier family 25, member 13 (citrin),
           mRNA (cDNA clone MGC:3379 IMAGE:3604257), complete cds.
          Length = 675

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 35/121 (28%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKE--GKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
           YP+  V TR Q QR +    G+    ++ +   +V R EG+  LY GL P L+G A  + 
Sbjct: 347 YPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKA 406

Query: 361 VYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           +          K  V    R +    DGSV + + ++    +G   V+ TNP+ +   R+
Sbjct: 407 I----------KLTVNDFVRDKFMHKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRL 456

Query: 541 Q 543
           Q
Sbjct: 457 Q 457



>gb:CR382137_1669871 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 386

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 35/134 (26%), Positives = 64/134 (47%), Gaps = 5/134 (3%)
 Frame = +1

Query: 190 PLQTVNTRQQTQRESKEGKRKQLSTI-EHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           P++ + TR Q+    K    K LS + + +  + +Q+G   L+ GL  +L       G+Y
Sbjct: 196 PIELLKTRLQSIPSDKLANPKILSNLFKDLYSIVKQKGMGTLFRGLKITLWRDVPFSGIY 255

Query: 367 YYFYQIFRTK-AEVAALDRKRRGIGDGSVG---MLSSLVVAALSGCVNVLLTNPIWVGVT 534
           +  Y++F+ K + V   D ++  I +         +S +  +LSG +    T+P  VG T
Sbjct: 256 WSCYELFKDKISTVLNADFQKSNIAEPVEDWKIFATSFISGSLSGTIGAFCTHPFDVGKT 315

Query: 535 RMQTHSKKAKNSPT 576
           R+Q  S++     T
Sbjct: 316 RLQITSEQVGKETT 329



 Score = 34.7 bits (78), Expect = 1.4
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 2/69 (2%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRES--KEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQ 357
           T+P     TR Q   E   KE   K+ S  + +  + +QEG   LY G+ P ++  A S 
Sbjct: 307 THPFDVGKTRLQITSEQVGKETTHKRPSMFKFLTTIYKQEGLRALYSGIGPRVLKIAPSC 366

Query: 358 GVYYYFYQI 384
            +    Y+I
Sbjct: 367 AIMISSYEI 375



>sp|Q8BH59|CMC1_MOUSE Calcium-binding mitochondrial carrier protein
           Aralar1 (Mitochondrial aspartate glutamate carrier 1)
           (Solute carrier family 25, member
           12).>gb:AK030595_1162080 Mus musculus adult male
           pituitary gland cDNA, RIKEN full-length enriched
           library, clone:5330436C02 product:solute carrier family
           25 (mitochondrial carrier, Aralar), member 12, full
           insert sequence.>gb:AK083156_1173838 Mus musculus adult
           male hippocampus cDNA, RIKEN full-length enriched
           library, clone:C630019M16 product:solute carrier family
           25 (mitochondrial carrier, Aralar), member 12, full
           insert sequence.>gb:BC060505_2104004 Mus musculus solute
           carrier family 25 (mitochondrial carrier, Aralar),
           member 12, mRNA (cDNA clone MGC:67718 IMAGE:6311836),
           complete cds.
          Length = 677

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 35/121 (28%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRE--SKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
           YP+  V TR Q QR   S  G+    ++ +   +V R EG+  LY GL P L+G A  + 
Sbjct: 345 YPIDLVKTRMQNQRGTGSVVGELMYKNSFDCFKKVLRYEGFFGLYRGLIPQLIGVAPEKA 404

Query: 361 VYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           +          K  V    R +    DGS+ + + ++    +G   V+ TNP+ +   R+
Sbjct: 405 I----------KLTVNDFVRDKFTKRDGSIPLPAEILAGGCAGGSQVIFTNPLEIVKIRL 454

Query: 541 Q 543
           Q
Sbjct: 455 Q 455



>gb:BC076521_2559349 Danio rerio zgc:92447, mRNA (cDNA clone
           MGC:92447 IMAGE:7041398), complete cds.
          Length = 311

 Score = 48.9 bits (115), Expect = 7e-05
 Identities = 49/156 (31%), Positives = 69/156 (44%), Gaps = 16/156 (10%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVAR---------------QEGWDRLYG 318
           T PL+ V TR Q+   +      QLST+     VAR               +EG   L+ 
Sbjct: 24  TCPLEVVKTRLQSSSVTFYISEVQLSTVNG-ASVARMAPPGPLHCLKLILEKEGPRSLFR 82

Query: 319 GLAPSLVGTAASQGVYYYFYQIFRTKA-EVAALDRKRRGIGDGSVGMLSSLVVAALSGCV 495
           GL P+LVG A S+ +Y+  Y   + K   V   D  +       V MLS    A L+G  
Sbjct: 83  GLGPNLVGVAPSRAIYFAAYSTSKEKLNNVFDPDSTQ-------VHMLS----AGLAGFT 131

Query: 496 NVLLTNPIWVGVTRMQTHSKKAKNSPTGAMTAXDAI 603
            +  TNPIW+  TR+Q     A+N     M+A + +
Sbjct: 132 AITATNPIWLIKTRLQL---DARNRGERRMSAFECV 164



>gb:AF283645_1894677 Homo sapiens folate transporter/carrier mRNA,
           complete cds; nuclear gene for mitochondrial product.
          Length = 315

 Score = 48.9 bits (115), Expect = 7e-05
 Identities = 34/129 (26%), Positives = 58/129 (44%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +PL  V  R     +  E + K    +  +  + + +G   LY G+ P++ G   S G+Y
Sbjct: 41  HPLDLVKIRFAVS-DGLELRPKYNGILHCLTTIWKLDGLRGLYQGVTPNIWGAGLSWGLY 99

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
           ++FY   ++         K  G  +  +     LV AA +G + + +TNP+WV  TR+  
Sbjct: 100 FFFYNAIKSY--------KTEGRAE-HLEATEYLVSAAEAGAMTLCITNPLWVTKTRLML 150

Query: 547 HSKKAKNSP 573
                 NSP
Sbjct: 151 QYDAVVNSP 159



>gb:AK053646_1170509 Mus musculus 0 day neonate eyeball cDNA, RIKEN
           full-length enriched library, clone:E130118D21
           product:hypothetical Mitochondrial energy transfer
           proteins (carrier protein) containing protein, full
           insert sequence.>gb:AK078779_1172442 Mus musculus 15
           days embryo male testis cDNA, RIKEN full-length enriched
           library, clone:8030476B22 product:hypothetical
           Mitochondrial energy transfer proteins (carrier protein)
           containing protein, full insert
           sequence.>gb:BC008171_2090655 Mus musculus RIKEN cDNA
           C330005L02 gene, mRNA (cDNA clone MGC:12130
           IMAGE:3710468), complete cds.
          Length = 311

 Score = 48.9 bits (115), Expect = 7e-05
 Identities = 39/147 (26%), Positives = 63/147 (42%), Gaps = 14/147 (9%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLST--------------IEHMCQVARQEGWDRLYGG 321
           T PL+ V TR Q+   +      QL+T              +  +  +  +EG   L+ G
Sbjct: 24  TCPLEVVKTRLQSSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKAILEKEGPRSLFRG 83

Query: 322 LAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNV 501
           L P+LVG A S+ +Y+  Y         +    K  G+ D     +  +  AA++G   +
Sbjct: 84  LGPNLVGVAPSRAIYFAAY---------SNCKEKLNGVFDPDSTQV-HMASAAMAGFTAI 133

Query: 502 LLTNPIWVGVTRMQTHSKKAKNSPTGA 582
             TNPIW+  TR+Q  ++       GA
Sbjct: 134 TATNPIWLIKTRLQLDARTRGEKQMGA 160



>sp|Q21153|CMC1_CAEEL Probable calcium-binding mitochondrial carrier
           K02F3.2.>pir|T16533|T16533 hypothetical protein K02F3.2
           - Caenorhabditis elegans>gb:U00052_1401546
           Caenorhabditis elegans cosmid K02F3, complete sequence.
          Length = 702

 Score = 48.9 bits (115), Expect = 7e-05
 Identities = 33/122 (27%), Positives = 52/122 (42%), Gaps = 2/122 (1%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKE--GKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
           YP+  V TR Q QR S    G+    ++++   +V + EG   LY GL P +VG A  + 
Sbjct: 383 YPIDLVKTRMQNQRTSGSFVGEVMYKNSLDCFKKVVKFEGLLGLYRGLLPQIVGVAPEKA 442

Query: 361 VYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           +        R K              DG + +   ++     G   V+ TNP+ +   R+
Sbjct: 443 IKLTMNDYMRDKFTK-----------DGKIPLYGEIIAGGTGGMCQVVFTNPLEIVKIRL 491

Query: 541 QT 546
           QT
Sbjct: 492 QT 493



>gb:AY611603_2086858 Cricetulus griseus mitochondrial folate
           transporter (MFT) mRNA, complete cds; nuclear gene for
           mitochondrial product.
          Length = 316

 Score = 48.5 bits (114), Expect = 9e-05
 Identities = 33/118 (27%), Positives = 56/118 (47%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +PL  V  R     +  E + K    +  +  + + EG   LY G+ P++ G   S G+Y
Sbjct: 41  HPLDLVKIRFAVS-DGLEVRPKYKGILHCLTTIWKVEGLRGLYQGVTPNVWGAGLSWGLY 99

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           ++FY   ++         K  G  +  +  L  LV AA +G + + +TNP+WV  TR+
Sbjct: 100 FFFYNAIKS--------YKTEGRAE-QLEPLEYLVSAAEAGAMTLCITNPLWVTKTRL 148



>gb:NCB13O20_1689219 Neurospora crassa DNA linkage group V BAC clone
           B13O20.
          Length = 351

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 37/152 (24%), Positives = 60/152 (39%), Gaps = 24/152 (15%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEG-WDRLYGGLAPSLVGTAASQGV 363
           +PL  V TR Q  R S       L+T+     +A+ +     LY GL P+L+G A S   
Sbjct: 31  HPLDIVKTRMQVHRSSPTNPSAALTTVSVFRSLAQTDRPLAALYRGLTPNLIGNATSWAS 90

Query: 364 YYYFYQIFR-----------------------TKAEVAALDRKRRGIGDGSVGMLSSLVV 474
           +++F   F                        T  +    DR+ +      +        
Sbjct: 91  FFFFKSRFERLIAHLKAPSSPPAPSHLGGEPTTLPQNVTPDRETQAQIKSHLSPTDFFAA 150

Query: 475 AALSGCVNVLLTNPIWVGVTRMQTHSKKAKNS 570
           + L+G    ++TNPIWV  TRM +  + A ++
Sbjct: 151 SLLAGAATQIITNPIWVLKTRMLSTDRLAADA 182



>gb:DMEY18197_1379514 Drosophila melanogaster mRNA for mitochondrial
           carrier protein ARALAR1.
          Length = 682

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 36/129 (27%), Positives = 59/129 (45%), Gaps = 1/129 (0%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRE-SKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           YP+  V TR Q QR  S  G+    ++ +   +V R EG+  LY GL P L+G A  + +
Sbjct: 348 YPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLLPQLMGVAPEKAI 407

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
                 + R K      D+K      G++   + ++    +G   V+ TNP+ +   R+Q
Sbjct: 408 KLTVNDLVRDKLT----DKK------GNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQ 457

Query: 544 THSKKAKNS 570
              + A  S
Sbjct: 458 VAGEIASGS 466



>gb:AE014297_1142184 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE014297_1142185 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003774_1224177
           Drosophila melanogaster chromosome 3R, section 112 of
           118 of the complete sequence.>gb:AE003774_1224178
           Drosophila melanogaster chromosome 3R, section 112 of
           118 of the complete sequence.>gb:AY058654_1291808
           Drosophila melanogaster LD35441 full length cDNA.
          Length = 682

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 36/129 (27%), Positives = 59/129 (45%), Gaps = 1/129 (0%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRE-SKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           YP+  V TR Q QR  S  G+    ++ +   +V R EG+  LY GL P L+G A  + +
Sbjct: 348 YPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLLPQLMGVAPEKAI 407

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
                 + R K      D+K      G++   + ++    +G   V+ TNP+ +   R+Q
Sbjct: 408 KLTVNDLVRDKLT----DKK------GNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQ 457

Query: 544 THSKKAKNS 570
              + A  S
Sbjct: 458 VAGEIASGS 466



>gb:AE014297_1142183 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003774_1224176 Drosophila melanogaster
           chromosome 3R, section 112 of 118 of the complete
           sequence.
          Length = 679

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 36/129 (27%), Positives = 59/129 (45%), Gaps = 1/129 (0%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRE-SKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           YP+  V TR Q QR  S  G+    ++ +   +V R EG+  LY GL P L+G A  + +
Sbjct: 345 YPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLLPQLMGVAPEKAI 404

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
                 + R K      D+K      G++   + ++    +G   V+ TNP+ +   R+Q
Sbjct: 405 KLTVNDLVRDKLT----DKK------GNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQ 454

Query: 544 THSKKAKNS 570
              + A  S
Sbjct: 455 VAGEIASGS 463



>sp|Q9VA73|CMC1_DROME Calcium-binding mitochondrial carrier
           Aralar1.>gb:AE014297_1142182 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003774_1224175
           Drosophila melanogaster chromosome 3R, section 112 of
           118 of the complete sequence.
          Length = 695

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 36/129 (27%), Positives = 59/129 (45%), Gaps = 1/129 (0%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRE-SKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           YP+  V TR Q QR  S  G+    ++ +   +V R EG+  LY GL P L+G A  + +
Sbjct: 361 YPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLLPQLMGVAPEKAI 420

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
                 + R K      D+K      G++   + ++    +G   V+ TNP+ +   R+Q
Sbjct: 421 KLTVNDLVRDKLT----DKK------GNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQ 470

Query: 544 THSKKAKNS 570
              + A  S
Sbjct: 471 VAGEIASGS 479



>gb:BC031874_2097283 Mus musculus mitochondrial folate
           transporter/carrier, mRNA (cDNA clone MGC:30372
           IMAGE:5149984), complete cds.
          Length = 316

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 32/118 (27%), Positives = 56/118 (47%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +PL  V  R     +  E + K    +  +  + + +G   LY G+ P++ G   S G+Y
Sbjct: 41  HPLDLVKIRFAVS-DGLEVRPKYKGILHCLATIWKVDGLRGLYQGVTPNVWGAGLSWGLY 99

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           ++FY   ++         K  G  +  +  L  LV AA +G + + +TNP+WV  TR+
Sbjct: 100 FFFYNAIKS--------YKTEGRAE-QLEPLEYLVSAAEAGAMTLCITNPLWVTKTRL 148



>gb:BC014064_1974369 Homo sapiens hypothetical protein FLJ10618,
           mRNA (cDNA clone MGC:19966 IMAGE:3842022), complete cds.
          Length = 311

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 44/148 (29%), Positives = 67/148 (45%), Gaps = 15/148 (10%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIE-------------HMCQVA-RQEGWDRLYGG 321
           T PL+ V TR Q+   +      QL+T+              H  +V   +EG   L+ G
Sbjct: 24  TCPLEVVKTRLQSSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKEGPRSLFRG 83

Query: 322 LAPSLVGTAASQGVYYYFYQIFRTKA-EVAALDRKRRGIGDGSVGMLSSLVVAALSGCVN 498
           L P+LVG A S+ +Y+  Y   + K  +V   D  +       V M+S    AA++G   
Sbjct: 84  LGPNLVGVAPSRAIYFAAYSNCKEKLNDVFDPDSTQ-------VHMIS----AAMAGFTA 132

Query: 499 VLLTNPIWVGVTRMQTHSKKAKNSPTGA 582
           +  TNPIW+  TR+Q  ++       GA
Sbjct: 133 ITATNPIWLIKTRLQLDARNRGERRMGA 160



>gb:CR382125_1658281 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 368

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 22/151 (14%)
 Frame = +1

Query: 184 TYPLQTVNTRQQ-----TQRESKEGKRKQLSTIEHMCQ--------------VARQEGWD 306
           T P   V TR Q     TQ +S   +    ST+  + +              V RQEG+ 
Sbjct: 68  TCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGFR 127

Query: 307 RLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALS 486
            L+ GL P+LVG   ++ + +  Y   +        D   R + +G       L+ AA +
Sbjct: 128 SLFKGLGPNLVGVIPARSINFLTYGTTK--------DIYSRTLNNGQEAPWIHLLAAATA 179

Query: 487 GCVNVLLTNPIWVGVTRMQ---THSKKAKNS 570
           G     +TNPIW+  TR+Q     +K  KNS
Sbjct: 180 GWATSTVTNPIWLVKTRLQLDKAGTKTYKNS 210



 Score = 35.4 bits (80), Expect = 0.80
 Identities = 18/67 (26%), Positives = 35/67 (52%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           TYP + V TR + Q  ++ GK K    ++    + ++EG   +Y GL P L+ T  +  +
Sbjct: 297 TYPHEVVRTRLR-QAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRTVPNSII 355

Query: 364 YYYFYQI 384
            +  +++
Sbjct: 356 MFGTWEL 362



>gb:AX876835_1476714 Sequence 11740 from Patent
           EP1074617.>gb:AK001480_1908461 Homo sapiens cDNA
           FLJ10618 fis, clone NT2RP2005465, weakly similar to
           MITOCHONDRIAL CARRIER PROTEIN RIM2.
          Length = 310

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 44/148 (29%), Positives = 67/148 (45%), Gaps = 15/148 (10%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIE-------------HMCQVA-RQEGWDRLYGG 321
           T PL+ V TR Q+   +      QL+T+              H  +V   +EG   L+ G
Sbjct: 24  TCPLEVVKTRLQSSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKEGPRSLFRG 83

Query: 322 LAPSLVGTAASQGVYYYFYQIFRTKA-EVAALDRKRRGIGDGSVGMLSSLVVAALSGCVN 498
           L P+LVG A S+ +Y+  Y   + K  +V   D  +       V M+S    AA++G   
Sbjct: 84  LGPNLVGVAPSRAIYFAAYSNCKEKLNDVFDPDSTQ-------VHMIS----AAMAGFTA 132

Query: 499 VLLTNPIWVGVTRMQTHSKKAKNSPTGA 582
           +  TNPIW+  TR+Q  ++       GA
Sbjct: 133 ITATNPIWLIKTRLQLDARNRGERRMGA 160



>gb:AX453452_1468808 Sequence 13 from Patent WO0242455.
          Length = 316

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 32/118 (27%), Positives = 56/118 (47%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +PL  V  R     +  E + K    +  +  + + +G   LY G+ P++ G   S G+Y
Sbjct: 41  HPLDLVKIRFAVS-DGLEVRPKYKGILHCLATIWKVDGLRGLYQGVTPNVWGAGLSWGLY 99

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           ++FY   ++         K  G  +  +  L  LV AA +G + + +TNP+WV  TR+
Sbjct: 100 FFFYNAIKS--------YKTEGRAE-QLEPLEYLVSAAEAGAMTLCITNPLWVTKTRL 148



>gb:AX453450_1468807 Sequence 11 from Patent WO0242455.
          Length = 316

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 32/118 (27%), Positives = 56/118 (47%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +PL  V  R     +  E + K    +  +  + + +G   LY G+ P++ G   S G+Y
Sbjct: 41  HPLDLVKIRFAVS-DGLEVRPKYKGILHCLATIWKVDGLRGLYQGVTPNVWGAGLSWGLY 99

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           ++FY   ++         K  G  +  +  L  LV AA +G + + +TNP+WV  TR+
Sbjct: 100 FFFYNAIKS--------YKTEGRAE-QLEPLEYLVSAAEAGAMTLCITNPLWVTKTRL 148



>gb:AC115584_1205707 Dictyostelium discoideum chromosome 2 map
           complement(3622543-3568102) strain AX4, complete
           sequence.
          Length = 301

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 37/130 (28%), Positives = 59/130 (45%), Gaps = 2/130 (1%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDR-LYGGLAPSLVGTAASQGV 363
           +PL  V TR Q QR S +G ++    I+   +V + EG  R LY GL+ +L+G    + +
Sbjct: 39  FPLDFVKTRLQQQRVSIDGSKQYNGIIDCFKKVIKNEGGVRGLYRGLSSNLIGIIPEKAL 98

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGS-VGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
                  FRT+ +           GD S + +   +    L+G   V+ TNP+ +   RM
Sbjct: 99  KLAMNDYFRTRFQ-----------GDRSYIKLWEEVASGGLAGMCQVVATNPMELVKIRM 147

Query: 541 QTHSKKAKNS 570
           Q      K +
Sbjct: 148 QVSGLSGKKA 157



>pir|T40033|T40033 probable mitochondrial FAD carrier protein -
           fission yeast  (Schizosaccharomyces
           pombe)>gb:AB004539_1509149 Schizosaccharomyces pombe 38
           kb genomic DNA, clone c1241.>gb:SPBC27B12_1719692
           S.pombe chromosome II cosmid c27B12.
          Length = 277

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 26/77 (33%), Positives = 44/77 (57%)
 Frame = +1

Query: 310 LYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSG 489
           LY GL+ +++G+AAS G Y+  Y    +K  V ++        +G + +L +L  +  +G
Sbjct: 56  LYHGLSINVLGSAASWGAYFCIYDF--SKRVVMSMTP----FNNGEISVLQTLCSSGFAG 109

Query: 490 CVNVLLTNPIWVGVTRM 540
           C+   LTNPIWV  +R+
Sbjct: 110 CIVAALTNPIWVVKSRI 126



>sp|Q8BMG8|MFTC_MOUSE Mitochondrial folate
           transporter/carrier.>gb:AK031187_1162338 Mus musculus 13
           days embryo forelimb cDNA, RIKEN full-length enriched
           library, clone:5930424M21 product:FOLATE
           TRANSPORTER/CARRIER homolog [Homo sapiens], full insert
           sequence.
          Length = 316

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 32/118 (27%), Positives = 56/118 (47%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +PL  V  R     +  E + K    +  +  + + +G   LY G+ P++ G   S G+Y
Sbjct: 41  HPLDLVKIRFAVS-DGLEVRPKYKGILHCLATIWKVDGLRGLYQGVTPNVWGAGLSWGLY 99

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           ++FY   ++         K  G  +  +  L  LV AA +G + + +TNP+WV  TR+
Sbjct: 100 FFFYNAIKS--------YKTEGRAE-QLEPLEYLVSAAEAGAMTLCITNPLWVTKTRL 148



>gb:AE016818_1747896 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 365

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 40/149 (26%), Positives = 62/149 (41%), Gaps = 20/149 (13%)
 Frame = +1

Query: 184 TYPLQTVNTRQQ---------TQRESK-----EGKRKQLSTIEHMCQVARQEGWDRLYGG 321
           T P   V TR Q         TQ  ++     +G      T+  +  V  QEG+  L+ G
Sbjct: 67  TCPFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKG 126

Query: 322 LAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNV 501
           L P+LVG   ++ + ++ Y + +        D   R + DG        +  A +G    
Sbjct: 127 LGPNLVGVIPARSINFFTYGVTK--------DTASRLLNDGQEAPWIHFLAGATAGWATS 178

Query: 502 LLTNPIWVGVTRMQT------HSKKAKNS 570
             TNPIW+  TR+Q        S++ KNS
Sbjct: 179 TATNPIWLVKTRLQLDKAADGRSRRYKNS 207



 Score = 36.2 bits (82), Expect = 0.47
 Identities = 18/67 (26%), Positives = 34/67 (50%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           TYP + V TR + Q   + GK K     +    + ++EG+  +Y GL P L+ T  +  +
Sbjct: 294 TYPHEVVRTRLR-QAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSII 352

Query: 364 YYYFYQI 384
            +  +++
Sbjct: 353 MFGTWEL 359



>gb:CR382135_1668366 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 727

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 35/126 (27%), Positives = 53/126 (42%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YP+  V TR Q QR     K    ++ +   ++ + EG   LY GL   LVG A  + + 
Sbjct: 352 YPIDLVKTRMQAQRH----KAVYANSFDCFKKIIKHEGLKGLYSGLGAQLVGVAPEKAI- 406

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
                    K  V  L RK     DG + M   ++    +G   V+ TNP+ +   R+Q 
Sbjct: 407 ---------KLTVNDLMRKIGTDDDGKISMNWEILAGMSAGGCQVIFTNPLEIVKIRLQM 457

Query: 547 HSKKAK 564
               +K
Sbjct: 458 QGGVSK 463



>gb:CR380959_1653875 Candida glabrata strain CBS138 chromosome M
           complete sequence.
          Length = 381

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 28/94 (29%), Positives = 45/94 (47%)
 Frame = +1

Query: 262 TIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGD 441
           T+  +  V RQEG+  L+ GL P+LVG   ++ + ++ Y   +        D   +   +
Sbjct: 123 TVSIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTK--------DIYSKAFNN 174

Query: 442 GSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
           G       L+ AA +G      TNPIW+  TR+Q
Sbjct: 175 GQEAPWIHLMAAATAGWATATATNPIWMVKTRVQ 208



 Score = 34.7 bits (78), Expect = 1.4
 Identities = 18/67 (26%), Positives = 34/67 (50%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           TYP + V TR + Q   + GK K    ++    + ++EG   +Y GL P L+ T  +  +
Sbjct: 308 TYPHEVVRTRLR-QSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSII 366

Query: 364 YYYFYQI 384
            +  +++
Sbjct: 367 MFGTWEV 373



>gb:SPAC688_1718215 S.pombe chromosome I cosmid c688.
          Length = 361

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 37/141 (26%), Positives = 60/141 (42%), Gaps = 14/141 (9%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQ-------RESKEGKRKQLSTIEHMCQ-------VARQEGWDRLYGG 321
           T PL  V TR Q+        +++ + K    +   H          V   EG   L+ G
Sbjct: 66  TAPLDVVKTRLQSDFYKDRFLKQTAKSKSPLTAAYRHFMDTCIILKNVKVHEGTRALFRG 125

Query: 322 LAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNV 501
           L P+L+GT  ++ + ++ Y     K  +A L        +G       L+ AA++G +  
Sbjct: 126 LGPNLIGTIPARSINFFSYG--NGKRILADL------FNNGQENSQIHLMAAAIAGVITS 177

Query: 502 LLTNPIWVGVTRMQTHSKKAK 564
             TNPIW+  TR+Q   K  +
Sbjct: 178 AATNPIWLVKTRLQLDKKSGQ 198



>gb:AP005003_1847110 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0495C02.
          Length = 426

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 36/132 (27%), Positives = 59/132 (44%), Gaps = 9/132 (6%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQ---------RESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSL 336
           TYPL  V T+   Q         RE K  ++     ++ +  + RQ G   LY G+APSL
Sbjct: 205 TYPLDLVRTKLAYQVKGAVKLSLREYKPSEQVYKGILDCVKTIYRQNGLRGLYRGMAPSL 264

Query: 337 VGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNP 516
            G     G+ +YFY+  +T       +  R+ I       ++ L   +++G +   +T P
Sbjct: 265 YGIFPYSGLKFYFYETMKTYVP----EEHRKDI-------IAKLACGSVAGLLGQTITYP 313

Query: 517 IWVGVTRMQTHS 552
           + V   +MQ  S
Sbjct: 314 LDVVRRQMQAFS 325



>gb:AE017343_1755509 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 698

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 37/138 (26%), Positives = 61/138 (44%), Gaps = 6/138 (4%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDR-LYGGLAPSLVGTAASQGV 363
           YP+  V TR Q QR +  G+    +  + + +V   EG  R  Y G+ P LVG A  + +
Sbjct: 370 YPIDLVKTRLQNQRSTVVGEVLYRNAFDCVKKVYTNEGGIRAFYRGVLPQLVGVAPEKAI 429

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
                ++ R KA              G + +L  +V    +G   V++TNP+ +   R+Q
Sbjct: 430 KLTVNELVRKKATDPET---------GRIPLLMEIVAGGSAGGCQVVVTNPLEIIKIRLQ 480

Query: 544 -----THSKKAKNSPTGA 582
                T ++    +P GA
Sbjct: 481 MAGEITRAEGGTAAPRGA 498



>gb:CR382131_1663579 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 315

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 36/136 (26%), Positives = 59/136 (43%), Gaps = 10/136 (7%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGK----------RKQLSTIEHMCQVARQEGWDRLYGGLAPSL 336
           YPL  V TR Q Q + KEG                T++ + ++    G   LY GL   L
Sbjct: 31  YPLDIVKTRLQVQVKRKEGGPLPAFEEGHFEHYEGTVDALKKIYAANGLAGLYQGLPSCL 90

Query: 337 VGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNP 516
           +G A++   Y+Y+Y   R        D   +     ++     L++ A++G +  + T P
Sbjct: 91  LGVASTNFAYFYWYGFIR--------DSYIKRNPGKALSTPIELLLGAVAGALAQVFTIP 142

Query: 517 IWVGVTRMQTHSKKAK 564
           + V  TR QT   K++
Sbjct: 143 VAVITTRQQTSDAKSR 158



>gb:AX453490_1468809 Sequence 51 from Patent
           WO0242455.>gb:BC048057_2550018 Danio rerio zgc:55610,
           mRNA (cDNA clone MGC:55610 IMAGE:2644093), complete cds.
          Length = 324

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 30/111 (27%), Positives = 52/111 (46%), Gaps = 2/111 (1%)
 Frame = +1

Query: 265 IEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDG 444
           ++ M  + + EG   LY G+ P++ G  +S G+Y+ FY   +   +              
Sbjct: 80  LDCMKTIWKLEGIRGLYQGVTPNIWGAGSSWGLYFLFYNAIKAYTQEGR---------QT 130

Query: 445 SVGMLSSLVVAALSGCVNVLLTNPIWVGVTR--MQTHSKKAKNSPTGAMTA 591
            +     LV AA +G + + LTNP+WV  TR  +Q ++  ++    G M A
Sbjct: 131 ELSACEHLVSAAEAGILTLCLTNPVWVTKTRLVLQYNADPSRKQYKGMMDA 181



>sp|P38127|RIM2_YEAST Mitochondrial carrier protein
           RIM2.>pir|S36081|S36081 probable carrier protein RIM2,
           mitochondrial - yeast  (Saccharomyces
           cerevisiae)>gb:AY557871_1614098 Saccharomyces cerevisiae
           clone FLH000960.01X YBR192W gene, complete
           cds.>gb:SCCHRIIFG_1706752 S.cerevisiae RIM, MSI1, PGI,
           and ribosomal protein L21 genes.>gb:SCYBR192W_1711432
           S.cerevisiae chromosome II reading frame ORF YBR192w.
          Length = 377

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 30/102 (29%), Positives = 49/102 (48%), Gaps = 6/102 (5%)
 Frame = +1

Query: 283 VARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLS 462
           V +QEG+  L+ GL P+LVG   ++ + ++ Y   +        D   +   +G    + 
Sbjct: 126 VYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTK--------DMYAKAFNNGQETPMI 177

Query: 463 SLVVAALSGCVNVLLTNPIWVGVTRMQ------THSKKAKNS 570
            L+ AA +G      TNPIW+  TR+Q      T  ++ KNS
Sbjct: 178 HLMAAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNS 219



 Score = 39.3 bits (90), Expect = 0.055
 Identities = 22/68 (32%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Frame = +1

Query: 184 TYPLQTVNTR-QQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
           TYP + V TR +QT +E+  GKRK    ++    + ++EG   +Y GL P L+ T  +  
Sbjct: 306 TYPHEVVRTRLRQTPKEN--GKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMRTVPNSI 363

Query: 361 VYYYFYQI 384
           + +  ++I
Sbjct: 364 IMFGTWEI 371



>gb:BC057495_2552126 Danio rerio solute carrier family 25
           (mitochondrial carrier, Aralar), member 12, mRNA (cDNA
           clone MGC:66248 IMAGE:3819420), complete cds.
          Length = 682

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 31/121 (25%), Positives = 54/121 (44%), Gaps = 2/121 (1%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKE--GKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
           YP+  V TR Q QR +    G+    ++ +   +V R EG+   Y GL P L+G A  + 
Sbjct: 347 YPIDLVKTRMQNQRSTGSFVGELMYKNSFDCAKKVLRYEGFFGFYRGLLPQLIGVAPEKA 406

Query: 361 VYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           +          K  V    R +    D ++ + + ++    +G   V+ TNP+ +   R+
Sbjct: 407 I----------KLTVNDFVRDKFTTNDDTIPLAAEILAGGCAGGSQVIFTNPLEIVKIRL 456

Query: 541 Q 543
           Q
Sbjct: 457 Q 457



>gb:BC087106_2109999 Rattus norvegicus cDNA clone MGC:94707
           IMAGE:7193157, complete cds.
          Length = 291

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 32/135 (23%), Positives = 60/135 (44%), Gaps = 3/135 (2%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQL---STIEHMCQVARQEGWDRLYGGLAPSLVGTAAS 354
           T+P+    TR Q Q ++ + K +++     +  + ++ R+EG   LY G+AP+++  A+ 
Sbjct: 23  TFPIDLTKTRLQIQGQTNDAKFREIRYRGMLHALMRIGREEGLRALYSGIAPAMLRQASY 82

Query: 355 QGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVT 534
             +    YQ  +  A     D            +L ++V   LSG ++  + NP  V   
Sbjct: 83  GTIKIGTYQSLKRLAVERPEDET----------LLINVVCGILSGVISSAIANPTDVLKI 132

Query: 535 RMQTHSKKAKNSPTG 579
           RMQ  +   +    G
Sbjct: 133 RMQAQNSAVQGGMIG 147



>gb:AC087553_1734115 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0685E10, complete sequence.
          Length = 415

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 29/120 (24%), Positives = 53/120 (44%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           TYPL+ + TR   QR   +      + +  + ++ R+EG   LY GL PSL+G       
Sbjct: 246 TYPLELIKTRLTIQRGVYD------NFLHALVKIVREEGPTELYRGLTPSLIGVVPYAAT 299

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
            Y+ Y   +           ++      +G + +L++ + +G ++   T P+ V    MQ
Sbjct: 300 NYFAYDTLK--------KAYKKMFKTNEIGNVPTLLIGSAAGAISSTATFPLEVARKHMQ 351



>sp|P29518|BT1_MAIZE Brittle-1 protein, chloroplast
           precursor.>pir|JQ1459|JQ1459 Bt1 protein precursor -
           maize>gb:MZEBT1A_1687838 Zea mays brittle-1 protein
           (bt1) mRNA, complete cds.
          Length = 436

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 31/121 (25%), Positives = 57/121 (47%), Gaps = 1/121 (0%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           TYP++ + TR   +++  +      +      ++ R EG   LY GL PSL+G       
Sbjct: 247 TYPMELIKTRVTIEKDVYD------NVAHAFVKILRDEGPSELYRGLTPSLIGVVPYAAC 300

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGS-VGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
            +Y Y+  +       L R+  G   G+ VG +++L++ + +G +    T P+ V   +M
Sbjct: 301 NFYAYETLK------RLYRRATGRRPGADVGPVATLLIGSAAGAIASSATFPLEVARKQM 354

Query: 541 Q 543
           Q
Sbjct: 355 Q 355



>gb:AB093647_1872213 Macaca fascicularis brain cDNA
           clone:QflA-20343, full insert sequence.
          Length = 291

 Score = 45.8 bits (107), Expect = 6e-04
 Identities = 33/139 (23%), Positives = 61/139 (43%), Gaps = 7/139 (5%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQL---STIEHMCQVARQEGWDRLYGGLAPSLVGTAA- 351
           T+P+    TR Q Q ++ + K K++     +  + ++ R+EG   LY G+AP+++  ++ 
Sbjct: 23  TFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLKALYSGIAPAMLRQSSY 82

Query: 352 ---SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIW 522
                G Y    ++F  + E   L              L +++   LSG ++  + NP  
Sbjct: 83  GTIKIGTYQSLKRLFVERPEDETL--------------LINVICGILSGVISSTIANPTD 128

Query: 523 VGVTRMQTHSKKAKNSPTG 579
           V   RMQ  S   +    G
Sbjct: 129 VLKIRMQAQSSTIQGGMIG 147



>gb:CR382125_1657818 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 906

 Score = 45.8 bits (107), Expect = 6e-04
 Identities = 32/126 (25%), Positives = 56/126 (44%), Gaps = 4/126 (3%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YP+  V TR Q QR S + K    ++I+ + ++ + +G   LY GL P L+G A  + + 
Sbjct: 523 YPIDLVKTRMQAQRNSVQYK----NSIDCVVKIFQTKGIRGLYSGLGPQLIGVAPEKAIK 578

Query: 367 Y----YFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVT 534
                +  Q F  K+               ++     ++  A +G   V+ TNP+ +   
Sbjct: 579 LTVNDFMRQYFMNKSR--------------TIKWYQEILSGATAGACQVVFTNPLEIVKI 624

Query: 535 RMQTHS 552
           R+Q  S
Sbjct: 625 RLQMRS 630



 Score = 37.0 bits (84), Expect = 0.27
 Identities = 38/142 (26%), Positives = 58/142 (40%), Gaps = 1/142 (0%)
 Frame = +1

Query: 184  TYPLQTVNTRQQTQRESK-EGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
            T PL+ V  R Q + +   E  R QL  +     + RQ G   LY G A  L+       
Sbjct: 616  TNPLEIVKIRLQMRSDYVGENARPQLGAVG----IIRQLGLRGLYKGAAACLLRDVPFSA 671

Query: 361  VYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
            +Y+  Y     K +V   D   +   +  +     L+   ++G     LT P  V  TR+
Sbjct: 672  IYFPTYA--HLKKDVFNFDPNDKNKRN-KLKTWELLLAGGIAGMPAAYLTTPFDVIKTRL 728

Query: 541  QTHSKKAKNSPTGAMTAXDAIL 606
            Q   +K + + TG + A   IL
Sbjct: 729  QIDPRKGETTYTGVIHAARTIL 750



>gb:AP003615_1831435 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0486H12.
          Length = 419

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 28/120 (23%), Positives = 53/120 (44%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           TYPL+ + TR   +++         + +    ++ R+EG   LY GL PSL+G       
Sbjct: 248 TYPLELIKTRLTIEKDVYN------NFLHAFVKILREEGPSELYRGLTPSLIGVVPYAAT 301

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
            YY Y   +           R+      +  +++L++ + +G ++   T P+ V   +MQ
Sbjct: 302 NYYAYDTLK--------KLYRKTFKQEEISNIATLLIGSAAGAISSTATFPLEVARKQMQ 353



>gb:CR380950_1649856 Candida glabrata strain CBS138 chromosome D
           complete sequence.
          Length = 322

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 32/128 (25%), Positives = 61/128 (47%), Gaps = 9/128 (7%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEG-----KRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAA 351
           YPL    T  QTQ ++ +      + K  + I+ + ++ ++ G+  LY GLA ++     
Sbjct: 22  YPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGLYQGLATNVAANFV 81

Query: 352 SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGS----VGMLSSLVVAALSGCVNVLLTNPI 519
              +Y+++Y + R+   V    R +  + D S    +  +  L +   +G +  ++TNPI
Sbjct: 82  QNFIYFFWYSLIRSNYFVFKAGRLQ--LKDDSKFIELSTIEELALGMSAGAMTQVVTNPI 139

Query: 520 WVGVTRMQ 543
            V  TR Q
Sbjct: 140 SVISTRQQ 147



>gb:AX705226_1473542 Sequence 17 from Patent
           WO03014353.>gb:AE016818_1748510 Ashbya gossypii (=
           Eremothecium gossypii) ATCC 10895 chromosome V, complete
           sequence.
          Length = 293

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 33/125 (26%), Positives = 57/125 (45%), Gaps = 1/125 (0%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDR-LYGGLAPSLVGTAASQG 360
           ++PL  +  R Q       G R   +    +  +  ++ W R LY GL  +L+G + +  
Sbjct: 26  SHPLDLLKLRLQLSA----GNRANTTYTGLIRDIFERQQWGRELYRGLGVNLLGNSVAWA 81

Query: 361 VYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           +Y+  Y+  +  A     +    GI D  +   + ++ A  SG    +LTNPIWV  TR+
Sbjct: 82  LYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAAGSSGIATAVLTNPIWVIKTRI 141

Query: 541 QTHSK 555
              S+
Sbjct: 142 MATSR 146



>pir|T00435|T00435 probable mitochondrial carrier protein [imported]
           - Arabidopsis thaliana
          Length = 447

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 24/99 (24%), Positives = 51/99 (51%), Gaps = 6/99 (6%)
 Frame = +1

Query: 280 QVARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGI------GD 441
           Q+ ++EG   LY GL+P+++   ++  +Y+  Y   ++      L    + +      GD
Sbjct: 184 QIFKREGMRGLYRGLSPTVMALLSNWAIYFTMYDQLKSFLCSNGLCFSTQNLVNSCLSGD 243

Query: 442 GSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQTHSKK 558
             + + ++++ A+ +G    + TNP+WV  TR+QT   +
Sbjct: 244 HKLSVGANVLAASGAGAATTIATNPLWVVKTRLQTQGMR 282



 Score = 39.3 bits (90), Expect = 0.055
 Identities = 43/133 (32%), Positives = 58/133 (43%), Gaps = 8/133 (6%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTA--ASQ 357
           T PL  V TR QTQ   + G     ST   + ++A +EG   LY GL P+L G +  A Q
Sbjct: 266 TNPLWVVKTRLQTQG-MRVGIVPYKSTFSALRRIAYEEGIRGLYSGLVPALAGISHVAIQ 324

Query: 358 GVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVL---LTNPIWVG 528
              Y   +++  K             GD SV  L++  VA  S    +    LT P  V 
Sbjct: 325 FPTYEMIKVYLAKK------------GDKSVDNLNARDVAVASSIAKIFASTLTYPHEVV 372

Query: 529 VTRMQT---HSKK 558
             R+Q    HS+K
Sbjct: 373 RARLQEQGHHSEK 385



>gb:XLA289240_2582516 Xenopus laevis mRNA for peroxisomal membrane
           protein PMP34.
          Length = 310

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 38/128 (29%), Positives = 57/128 (44%), Gaps = 1/128 (0%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YPL T   R Q      + +RK  ST   + ++ R+EG    Y G    +     S  VY
Sbjct: 35  YPLDTARLRLQV-----DDQRKSRSTPAVLLEIMREEGILAPYRGWFFVISTLCCSNFVY 89

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSS-LVVAALSGCVNVLLTNPIWVGVTRMQ 543
           +Y    F +  E++           GSV      L +  ++G VNVLLT P+WV  TR++
Sbjct: 90  FY---TFNSLKELSI---------KGSVPTTGKDLTIGFIAGVVNVLLTTPLWVVNTRLK 137

Query: 544 THSKKAKN 567
               K ++
Sbjct: 138 LQGAKFRS 145



>gb:BC068966_2555458 Xenopus laevis peroxisomal membrane protein
           PMP34, mRNA (cDNA clone IMAGE:6637319), partial cds.
          Length = 309

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 38/128 (29%), Positives = 57/128 (44%), Gaps = 1/128 (0%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YPL T   R Q      + +RK  ST   + ++ R+EG    Y G    +     S  VY
Sbjct: 34  YPLDTARLRLQV-----DDQRKSRSTPAVLLEIMREEGILAPYRGWFFVISTLCCSNFVY 88

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSS-LVVAALSGCVNVLLTNPIWVGVTRMQ 543
           +Y    F +  E++           GSV      L +  ++G VNVLLT P+WV  TR++
Sbjct: 89  FY---TFNSLKELSI---------KGSVPTTGKDLTIGFIAGVVNVLLTTPLWVVNTRLK 136

Query: 544 THSKKAKN 567
               K ++
Sbjct: 137 LQGAKFRS 144



>gb:AL627107_1931027 Human DNA sequence from clone XXyac-R12DG2 on
           chromosome 13 Contains 2 novel genes, a calumenin (CALU)
           pseudogene, a novel gene (possible ortholog of RIKEN
           cDNA 4933433D23 gene) and a CpG island, complete
           sequence.
          Length = 291

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 33/139 (23%), Positives = 60/139 (43%), Gaps = 7/139 (5%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQL---STIEHMCQVARQEGWDRLYGGLAPSLVGTAA- 351
           T+P+    TR Q Q ++ + K K++     +  + ++ R+EG   LY G+AP+++  A+ 
Sbjct: 23  TFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLKALYSGIAPAMLRQASY 82

Query: 352 ---SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIW 522
                G Y    ++F  + E   L                +++   LSG ++  + NP  
Sbjct: 83  GTIKIGTYQSLKRLFIERPEDETLP--------------INVICGILSGVISSTIANPTD 128

Query: 523 VGVTRMQTHSKKAKNSPTG 579
           V   RMQ  S   +    G
Sbjct: 129 VLKIRMQAQSNTIQGGMIG 147



>gb:CR382122_1655295 Kluyveromyces lactis strain NRRL Y-1140
           chromosome B of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 355

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 30/120 (25%), Positives = 61/120 (50%), Gaps = 2/120 (1%)
 Frame = +1

Query: 193 LQTVNTRQQTQRESKEG-KRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVYY 369
           +Q +  + +    +KE  +++    ++ + +V R EG+  LY GL+ SL+GT      Y+
Sbjct: 66  IQQIKPKPEPPTATKESLEQRYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYF 125

Query: 370 YFYQIFRTKAEVAALDRKRRGIGDGS-VGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
           ++Y + R         R ++  G+ +    +  L+++ L+   + L TNPI +  T+ QT
Sbjct: 126 FWYTLIRRH-----YFRVKKVKGEAARFSTIEELLLSMLAAATSQLFTNPINIVSTKQQT 180



>gb:AJ720037_2502224 Gallus gallus mRNA for hypothetical protein,
           clone 9m7.
          Length = 313

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 40/156 (25%), Positives = 66/156 (42%), Gaps = 16/156 (10%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEH----------------MCQVARQEGWDRLY 315
           T PL+ V TR Q+   +       L+T+                  +  + ++EG   L+
Sbjct: 24  TCPLEVVKTRLQSSSVTLYISEVHLNTVNGASVNRVTRVSPGPLHCLKMILQKEGPRSLF 83

Query: 316 GGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCV 495
            GL P+LVG A S+ +Y+  Y   + K                 V M+S    A ++G  
Sbjct: 84  RGLGPNLVGVAPSRAIYFAAYSNCKEKL------NNIFNPDSTQVHMIS----AGVAGFT 133

Query: 496 NVLLTNPIWVGVTRMQTHSKKAKNSPTGAMTAXDAI 603
            + +TNPIW+  TR+Q     A+N     M+A + +
Sbjct: 134 AITMTNPIWLVKTRLQL---DARNRGEKRMSAFECV 166



>gb:AE017341_1754628 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 382

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 35/122 (28%), Positives = 55/122 (45%), Gaps = 3/122 (2%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQ-VARQEGWDRLYGGLAPSLVGTAASQG 360
           T PL  V TR Q Q  S   K  Q  T+E + + +    G+   Y GL P+L G   + G
Sbjct: 41  TCPLDVVKTRLQAQAASVHHKDYQ--TVEMIIKDIWTSGGFRGFYRGLGPTLAGYLPTWG 98

Query: 361 VYYYFYQIFRTK--AEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVT 534
           +Y+  Y + + +  A  A  D   +         +  +V A  +G     +T+P+WV  T
Sbjct: 99  IYFTVYDLVKDRLGAWAAHSDLPTK-------PSMVHIVAAMTAGATGTCMTSPLWVIKT 151

Query: 535 RM 540
           R+
Sbjct: 152 RL 153



 Score = 40.8 bits (94), Expect = 0.019
 Identities = 39/150 (26%), Positives = 67/150 (44%), Gaps = 1/150 (0%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           T PL  + TR   Q    +  R + +T+E +  + R EG+   Y GL PSL+G  +   V
Sbjct: 143 TSPLWVIKTRLMAQVGPSDQARYR-NTLEAIVDIYRNEGFRAFYKGLLPSLMG-ISHVAV 200

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGD-GSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
            +  Y+  ++ +E           GD  S+   + L+ +A S  V  + T P  V  TR+
Sbjct: 201 QFPLYEKAKSWSE-----------GDHSSLTPSTILICSAFSKMVASIATYPHEVLRTRL 249

Query: 541 QTHSKKAKNSPTGAMTAXDAILAXVEPPPF 630
           Q      K++ + ++ + +       P PF
Sbjct: 250 QIRKSSPKSNSSSSVFSSNPSKPSHPPLPF 279



>gb:CR380956_1652067 Candida glabrata strain CBS138 chromosome J
           complete sequence.
          Length = 361

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 37/124 (29%), Positives = 53/124 (42%), Gaps = 4/124 (3%)
 Frame = +1

Query: 190 PLQTVNTRQQTQRESKEGKRKQL--STIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           PL    TR Q Q              +I  M  + R EG   LY GL P ++G   +  +
Sbjct: 88  PLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYKGLVPIIMGYFPTWMI 147

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTR-- 537
           Y+  Y+  +        D  R    + S   +S    A  +G V+ ++TNPIWV  TR  
Sbjct: 148 YFSVYEFCK--------DNLRTNSSNWS--FVSHSFSAITAGAVSTVVTNPIWVVKTRLM 197

Query: 538 MQTH 549
           +QTH
Sbjct: 198 LQTH 201



 Score = 36.2 bits (82), Expect = 0.47
 Identities = 30/123 (24%), Positives = 51/123 (41%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           T P+  V TR   Q            T +   ++  QEG   LY GL PSL+G      +
Sbjct: 186 TNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLLG-LLHVAI 244

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
           ++  Y+  R K       R      +  + +   ++ +++S  V  +L+ P  +  TR+Q
Sbjct: 245 HFPVYE--RLKVSFKCYQRDESS-NESKINLKRLILASSVSKMVASVLSYPHEILRTRLQ 301

Query: 544 THS 552
             S
Sbjct: 302 LKS 304



>gb:CR380953_1651003 Candida glabrata strain CBS138 chromosome G
           complete sequence.
          Length = 289

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 31/98 (31%), Positives = 47/98 (47%)
 Frame = +1

Query: 310 LYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSG 489
           LY GL  +LVG   + G+Y+  Y++    A+   ++   R   D  +     L  +A SG
Sbjct: 66  LYRGLTVNLVGNTIAWGLYFASYRV----AKDYLINYNHRIRNDKDLSSWMYLSASASSG 121

Query: 490 CVNVLLTNPIWVGVTRMQTHSKKAKNSPTGAMTAXDAI 603
            +  +LTNP+WV  TRM +   KA +  T      D I
Sbjct: 122 MLTTVLTNPLWVIKTRMMS---KANSDLTSMKVLRDLI 156



>gb:AC079374_1732559 Arabidopsis thaliana chromosome 1 BAC F4F7
           genomic sequence, complete sequence.
          Length = 376

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 34/127 (26%), Positives = 61/127 (48%), Gaps = 8/127 (6%)
 Frame = +1

Query: 190 PLQTVNTRQQTQR--ESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGT----AA 351
           PL  + TR Q     E+    ++    I  +  + ++EG+  +Y GL+P+++      A 
Sbjct: 37  PLDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIKEEGYRGMYRGLSPTIIALLPNWAV 96

Query: 352 SQGVYY--YFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWV 525
           S  V Y   F Q++ +   V    +      DG + + S+++ AA +G    + TNP+WV
Sbjct: 97  STTVLYRALFLQVYFS---VYGKLKDVLQSSDGKLSIGSNMIAAAGAGAATSIATNPLWV 153

Query: 526 GVTRMQT 546
             TR+ T
Sbjct: 154 VKTRLMT 160



 Score = 33.5 bits (75), Expect = 3.0
 Identities = 38/141 (26%), Positives = 58/141 (41%), Gaps = 1/141 (0%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           T PL  V TR  TQ   + G     S +    ++  +EG   LY G+ PSL G +    V
Sbjct: 148 TNPLWVVKTRLMTQG-IRPGVVPYKSVMSAFSRICHEEGVRGLYSGILPSLAGVS---HV 203

Query: 364 YYYFYQIFRTKAEVAALDRKR-RGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
              F    + K  +A +D      +  G+V + SS+     S     +LT P  V   ++
Sbjct: 204 AIQFPAYEKIKQYMAKMDNTSVENLSPGNVAIASSIAKVIAS-----ILTYPHEVIRAKL 258

Query: 541 QTHSKKAKNSPTGAMTAXDAI 603
           Q    + +N+ T      D I
Sbjct: 259 QEQG-QIRNAETKYSGVIDCI 278



>gb:AF310895_1261397 Dictyostelium discoideum RIM (rimA) and RacI
           (racI) genes, complete cds; hirB pseudogene, partial
           sequence; and unknown genes.
          Length = 365

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 34/123 (27%), Positives = 61/123 (49%), Gaps = 3/123 (2%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRES---KEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAAS 354
           T PL+ + T+ Q +  +   K+  R   +T   +  + +++G   L+ GL   L+G A +
Sbjct: 73  TSPLEVIKTQLQAKNSNLLVKDKPRFVPTTAYSLYHLLKRDGKSGLWKGLGAHLLGVAPA 132

Query: 355 QGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVT 534
           + +++  Y    TK+ +  L     G  DG +  ++S   A  SG    + T+PIW+  T
Sbjct: 133 RAIHFSSYSF--TKSIMNKL-----GYTDGPILWITS---AVSSGAAVAITTSPIWLIKT 182

Query: 535 RMQ 543
           RMQ
Sbjct: 183 RMQ 185



 Score = 37.7 bits (86), Expect = 0.16
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 1/68 (1%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEG-KRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
           TYP + V TR + Q  +K G K K    I+ +  +AR+EG   L+GG  P ++    +  
Sbjct: 281 TYPHEVVRTRLREQ--TKPGVKSKYTGVIQGLTLIAREEGIRGLFGGAGPHIIRVVPNSC 338

Query: 361 VYYYFYQI 384
           + +  Y++
Sbjct: 339 IMFLTYEL 346



>gb:AK077111_1171667 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4933406J04
           product:hypothetical Mitochondrial energy transfer
           proteins (carrier protein) containing protein, full
           insert sequence.
          Length = 312

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 24/79 (30%), Positives = 39/79 (49%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           +YPL  V TR Q Q ++ EG    +  +    ++  Q+GW  LY G+ P+L+    + G+
Sbjct: 237 SYPLTLVRTRMQAQ-DTVEGSNPTMQGV--FKRILSQQGWPGLYRGMTPTLLKVLPAGGI 293

Query: 364 YYYFYQIFRTKAEVAALDR 420
            Y  Y+  +    V  L R
Sbjct: 294 SYLVYEAMKKTLGVQVLSR 312



>gb:CR382126_1658556 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 307

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 31/98 (31%), Positives = 48/98 (48%), Gaps = 6/98 (6%)
 Frame = +1

Query: 313 YGGLAPSLVGTAASQGVYYYFYQ-----IFRTKAEVAALDRKRRGIGDGSVGMLSSLVVA 477
           Y GL  +++G A + G+Y+  Y+     ++   +E A    + + + D  +     LV A
Sbjct: 74  YRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPAL---QNKFMNDRKMTSSMYLVSA 130

Query: 478 ALSGCVNVLLTNPIWVGVTR-MQTHSKKAKNSPTGAMT 588
             SG    LLTNP+WV  TR M T S +   S   A+T
Sbjct: 131 GASGLATALLTNPMWVIKTRIMSTKSSQGYTSILNAIT 168



 Score = 32.7 bits (73), Expect = 5.2
 Identities = 28/131 (21%), Positives = 57/131 (43%), Gaps = 4/131 (3%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           T P+  + TR  + + S+       S +  + ++  +EG    + GL PSL G      +
Sbjct: 141 TNPMWVIKTRIMSTKSSQG----YTSILNAITRIYTEEGLKTFWRGLVPSLFGVTQG-AL 195

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
           Y+  Y   + K         R  I +  +  + ++ + +LS  ++V    P+ +  T +Q
Sbjct: 196 YFAIYDTLKLK-----YLHDRNDIQERRLNAVETIGIISLSKMISVSSVYPLQLLKTNLQ 250

Query: 544 T----HSKKAK 564
           T    H++ +K
Sbjct: 251 TFRTEHNENSK 261



>gb:AB013389_1512041 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K1F13.
          Length = 310

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 30/108 (27%), Positives = 47/108 (43%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           + L  V TR Q             +T   +  +AR EG   LY G  P+++G+  S G+Y
Sbjct: 25  HSLDVVRTRFQVNDGRGSSLPTYKNTAHAVFTIARLEGLRGLYAGFFPAVIGSTVSWGLY 84

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLT 510
           ++FY          A  R  RG  D  +     L  AA +G + ++L+
Sbjct: 85  FFFYG--------RAKQRYARGRDDEKLSPALHLASAAEAGALGMMLS 124



>gb:AE014134_1127739 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003612_1217846 Drosophila melanogaster
           chromosome 2L, section 21 of 83 of the complete
           sequence.
          Length = 222

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 36/127 (28%), Positives = 53/127 (41%), Gaps = 3/127 (2%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRE--SKEG-KRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQ 357
           YP     TR Q Q E  S+ G K K    +     + R+EG  +LYGG++  L   +   
Sbjct: 55  YPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGLLKLYGGISAMLFRHSLFS 114

Query: 358 GVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTR 537
           G+    Y   R K  V   D      G   +  L S +   L+G    +LTNP  +   +
Sbjct: 115 GIKMLTYDYMREKMIVPDED------GRPQLSFLGSCISGVLAGATASVLTNPTELIKIQ 168

Query: 538 MQTHSKK 558
           MQ   ++
Sbjct: 169 MQMEGQR 175



>gb:AE014134_1127738 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003612_1217845 Drosophila melanogaster
           chromosome 2L, section 21 of 83 of the complete
           sequence.
          Length = 337

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 36/127 (28%), Positives = 53/127 (41%), Gaps = 3/127 (2%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRE--SKEG-KRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQ 357
           YP     TR Q Q E  S+ G K K    +     + R+EG  +LYGG++  L   +   
Sbjct: 55  YPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGLLKLYGGISAMLFRHSLFS 114

Query: 358 GVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTR 537
           G+    Y   R K  V   D      G   +  L S +   L+G    +LTNP  +   +
Sbjct: 115 GIKMLTYDYMREKMIVPDED------GRPQLSFLGSCISGVLAGATASVLTNPTELIKIQ 168

Query: 538 MQTHSKK 558
           MQ   ++
Sbjct: 169 MQMEGQR 175



>gb:AJ720306_2502493 Gallus gallus mRNA for hypothetical protein,
           clone 14i19.
          Length = 284

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 33/140 (23%), Positives = 61/140 (43%), Gaps = 7/140 (5%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQL---STIEHMCQVARQEGWDRLYGGLAPSLVGTAA- 351
           T+P+    TR Q Q +S + + +++        + ++ R+EG   LY G+AP+L+  A+ 
Sbjct: 23  TFPVDLTKTRLQVQGQSADARFREVRYRGMFHALFRICREEGGRALYSGIAPALLRQASY 82

Query: 352 ---SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIW 522
                G+Y    ++F  + E   L              L +++   +SG ++  L NP  
Sbjct: 83  GTIKIGIYQSLKRLFVDRLEDETL--------------LINVICGVVSGVISSALANPTD 128

Query: 523 VGVTRMQTHSKKAKNSPTGA 582
           V   RMQ      +    G+
Sbjct: 129 VLKIRMQAQGNLFQGGMIGS 148



>gb:BC022676_2093856 Mus musculus solute carrier family 25, member
           30, mRNA (cDNA clone MGC:31367 IMAGE:4238839), complete
           cds.
          Length = 210

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 30/126 (23%), Positives = 57/126 (45%), Gaps = 3/126 (2%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQL---STIEHMCQVARQEGWDRLYGGLAPSLVGTAAS 354
           T+P+    TR Q Q ++ +   +++     +  + ++ R+EG   LY G+AP+++  A+ 
Sbjct: 23  TFPIDLTKTRLQIQGQTNDANFREIRYRGMLHALMRIGREEGLKALYSGIAPAMLRQASY 82

Query: 355 QGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVT 534
             +    YQ  +  A     D            +L ++V   LSG ++  + NP  V   
Sbjct: 83  GTIKIGTYQSLKRLAVERPEDET----------LLVNVVCGILSGVISSAIANPTDVLKI 132

Query: 535 RMQTHS 552
           RMQ  +
Sbjct: 133 RMQAQN 138



>gb:AY063892_1565839 Arabidopsis thaliana unknown protein
           (At5g27520) mRNA, complete cds.>gb:AY122919_1579797
           Arabidopsis thaliana unknown protein (At5g27520) mRNA,
           complete cds.
          Length = 321

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 33/120 (27%), Positives = 56/120 (46%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YPL T  ++ Q +   + G++K     +   +         LY GL    + +  S  +Y
Sbjct: 28  YPLDTCKSKFQAEIRVR-GQQKYRYLSDVFWEAISSGNVLSLYQGLGTKNLQSFISSFIY 86

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
           +Y Y  F+       L  +R  IG  S+G  ++L++AA +G    +LT P+    +RMQT
Sbjct: 87  FYSYSYFKR------LHSQR--IGSKSIGTKANLLIAAAAGACTSVLTQPLDTASSRMQT 138



>gb:AK015679_1158455 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4930502G22
           product:similar to BRAIN MITOCHONDRIAL CARRIER PROTEIN-1
           (BMCP-1) (MITOCHONDRIAL UNCOUPLING PROTEIN 5) (UCP 5)
           (SOLUTE CARRIER FAMILY 25, MEMBER 14) [Homo sapiens],
           full insert sequence.>gb:AK017035_1158999 Mus musculus
           adult male testis cDNA, RIKEN full-length enriched
           library, clone:4933433D23 product:similar to BRAIN
           MITOCHONDRIAL CARRIER PROTEIN-1 (BMCP-1) (MITOCHONDRIAL
           UNCOUPLING PROTEIN 5) (UCP 5) (SOLUTE CARRIER FAMILY 25,
           MEMBER 14) [Homo sapiens], full insert sequence.
          Length = 291

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 30/126 (23%), Positives = 57/126 (45%), Gaps = 3/126 (2%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQL---STIEHMCQVARQEGWDRLYGGLAPSLVGTAAS 354
           T+P+    TR Q Q ++ +   +++     +  + ++ R+EG   LY G+AP+++  A+ 
Sbjct: 23  TFPIDLTKTRLQIQGQTNDANFREIRYRGMLHALMRIGREEGLKALYSGIAPAMLRQASY 82

Query: 355 QGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVT 534
             +    YQ  +  A     D            +L ++V   LSG ++  + NP  V   
Sbjct: 83  GTIKIGTYQSLKRLAVERPEDET----------LLVNVVCGILSGVISSAIANPTDVLKI 132

Query: 535 RMQTHS 552
           RMQ  +
Sbjct: 133 RMQAQN 138



>gb:HS20I3_1997479 Human DNA sequence from clone RP1-20I3 on
           chromosome Xq25-26 Contains a SNRPN upstream reading
           frame (SNURF) pseudogene, the SLC25A14 gene for solute
           carrier family 25 (mitochondrial carrier, brain),member
           14 (UCP5, BMCP1), the gene for G-protein coupled
           receptor 2 (GPCR2), the gene for CGI-79 protein and a
           CpG island, complete sequence.
          Length = 198

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 33/140 (23%), Positives = 62/140 (44%), Gaps = 7/140 (5%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLS---TIEHMCQVARQEGWDRLYGGLAPSLVGTAA- 351
           T+P+    TR Q Q +S + + K++        + ++ ++EG   LY G+AP+L+  A+ 
Sbjct: 58  TFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASY 117

Query: 352 ---SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIW 522
                G+Y    ++F  + E   L              L +++   +SG ++  + NP  
Sbjct: 118 GTIKIGIYQSLKRLFVERLEDETL--------------LINMICGVVSGVISSTIANPTD 163

Query: 523 VGVTRMQTHSKKAKNSPTGA 582
           V   RMQ      + S  G+
Sbjct: 164 VLKIRMQAQGSLFQGSMIGS 183



>gb:AF155811_1886677 Homo sapiens mitochondrial uncoupling protein 5
           short form mRNA, complete cds; nuclear gene for
           mitochondrial product.>gb:HS20I3_1997478 Human DNA
           sequence from clone RP1-20I3 on chromosome Xq25-26
           Contains a SNRPN upstream reading frame (SNURF)
           pseudogene, the SLC25A14 gene for solute carrier family
           25 (mitochondrial carrier, brain),member 14 (UCP5,
           BMCP1), the gene for G-protein coupled receptor 2
           (GPCR2), the gene for CGI-79 protein and a CpG island,
           complete sequence.
          Length = 322

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 33/140 (23%), Positives = 62/140 (44%), Gaps = 7/140 (5%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLS---TIEHMCQVARQEGWDRLYGGLAPSLVGTAA- 351
           T+P+    TR Q Q +S + + K++        + ++ ++EG   LY G+AP+L+  A+ 
Sbjct: 55  TFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASY 114

Query: 352 ---SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIW 522
                G+Y    ++F  + E   L              L +++   +SG ++  + NP  
Sbjct: 115 GTIKIGIYQSLKRLFVERLEDETL--------------LINMICGVVSGVISSTIANPTD 160

Query: 523 VGVTRMQTHSKKAKNSPTGA 582
           V   RMQ      + S  G+
Sbjct: 161 VLKIRMQAQGSLFQGSMIGS 180



>gb:AF155810_1886676 Homo sapiens mitochondrial uncoupling protein 5
           short form with insertion mRNA, complete cds; nuclear
           gene for mitochondrial product.>gb:HS20I3_1997477 Human
           DNA sequence from clone RP1-20I3 on chromosome Xq25-26
           Contains a SNRPN upstream reading frame (SNURF)
           pseudogene, the SLC25A14 gene for solute carrier family
           25 (mitochondrial carrier, brain),member 14 (UCP5,
           BMCP1), the gene for G-protein coupled receptor 2
           (GPCR2), the gene for CGI-79 protein and a CpG island,
           complete sequence.
          Length = 353

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 33/140 (23%), Positives = 62/140 (44%), Gaps = 7/140 (5%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLS---TIEHMCQVARQEGWDRLYGGLAPSLVGTAA- 351
           T+P+    TR Q Q +S + + K++        + ++ ++EG   LY G+AP+L+  A+ 
Sbjct: 55  TFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASY 114

Query: 352 ---SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIW 522
                G+Y    ++F  + E   L              L +++   +SG ++  + NP  
Sbjct: 115 GTIKIGIYQSLKRLFVERLEDETL--------------LINMICGVVSGVISSTIANPTD 160

Query: 523 VGVTRMQTHSKKAKNSPTGA 582
           V   RMQ      + S  G+
Sbjct: 161 VLKIRMQAQGSLFQGSMIGS 180



>sp|O95258|UCP5_HUMAN Brain mitochondrial carrier protein-1 (BMCP-1)
           (Mitochondrial uncoupling protein 5) (UCP 5) (Solute
           carrier family 25, member 14)
           (UNQ791/PRO1682).>gb:AF078544_1881264 Homo sapiens brain
           mitochondrial carrier protein-1 (BMCP1) mRNA, nuclear
           gene encoding mitochondrial protein, complete
           cds.>gb:AF155809_1886675 Homo sapiens mitochondrial
           uncoupling protein 5 long form mRNA, complete cds;
           nuclear gene for mitochondrial
           product.>gb:AY358099_1946978 Homo sapiens clone DNA80562
           UCP5 (UNQ791) mRNA, complete cds.>gb:HS20I3_1997476
           Human DNA sequence from clone RP1-20I3 on chromosome
           Xq25-26 Contains a SNRPN upstream reading frame (SNURF)
           pseudogene, the SLC25A14 gene for solute carrier family
           25 (mitochondrial carrier, brain),member 14 (UCP5,
           BMCP1), the gene for G-protein coupled receptor 2
           (GPCR2), the gene for CGI-79 protein and a CpG island,
           complete sequence.
          Length = 325

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 33/140 (23%), Positives = 62/140 (44%), Gaps = 7/140 (5%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLS---TIEHMCQVARQEGWDRLYGGLAPSLVGTAA- 351
           T+P+    TR Q Q +S + + K++        + ++ ++EG   LY G+AP+L+  A+ 
Sbjct: 58  TFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASY 117

Query: 352 ---SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIW 522
                G+Y    ++F  + E   L              L +++   +SG ++  + NP  
Sbjct: 118 GTIKIGIYQSLKRLFVERLEDETL--------------LINMICGVVSGVISSTIANPTD 163

Query: 523 VGVTRMQTHSKKAKNSPTGA 582
           V   RMQ      + S  G+
Sbjct: 164 VLKIRMQAQGSLFQGSMIGS 183



>gb:AB028879_2044525 Rattus norvegicus BMCP1 mRNA for brain
           mitochondrial carrier protein-1, complete cds.
          Length = 322

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 34/140 (24%), Positives = 62/140 (44%), Gaps = 7/140 (5%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLS---TIEHMCQVARQEGWDRLYGGLAPSLVGTAA- 351
           T+P+    TR Q Q +S + + K++        + ++ R+EG   LY G+AP+L+  A+ 
Sbjct: 55  TFPVDLTKTRLQVQGQSIDVRFKEIKYRGMFHALFRIYREEGILALYSGIAPALLRQASY 114

Query: 352 ---SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIW 522
                G+Y    ++F  + E   L              L +++   +SG ++  + NP  
Sbjct: 115 GTIKIGIYQSLKRLFVERLEDETL--------------LINMICGVVSGVISSTIANPTD 160

Query: 523 VGVTRMQTHSKKAKNSPTGA 582
           V   RMQ      + S  G+
Sbjct: 161 VLKIRMQAQGSLFQGSMIGS 180



>gb:AC150162_1745056 Solanum demissum chromosome 5 clone PGEC160O2
           map MAP_LOC, complete sequence.
          Length = 281

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 28/126 (22%), Positives = 57/126 (45%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           T+P+  + T+ Q   ES    R+ +S +  + ++ R +G   LY GL+P+++       +
Sbjct: 7   TFPVDLIKTKLQLHGESLVSSRR-ISAVRVVAEILRNDGILGLYKGLSPAIIRHMFYTPI 65

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
               Y+  R     A          D ++ + S  ++  +SG +  ++ +P  +   RMQ
Sbjct: 66  RIVNYEFLRNSLVPA----------DHTLSLSSKAIIGGISGVIAQVVASPADLVKVRMQ 115

Query: 544 THSKKA 561
             S+ A
Sbjct: 116 ADSRMA 121



>gb:CR382138_1671058 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 365

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 36/141 (25%), Positives = 53/141 (37%), Gaps = 13/141 (9%)
 Frame = +1

Query: 184 TYPLQTVNTRQQ------TQRESKEGKRKQLSTIEHMCQVAR-------QEGWDRLYGGL 324
           T PL  V TR Q      T   + +     +   +H  +           EG   L+ GL
Sbjct: 71  TCPLDVVKTRLQSDVYHSTYNRTPKSSNPVIKAAQHFKETGTVIRGLYANEGTRALFKGL 130

Query: 325 APSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVL 504
            P+LVG   ++ + ++ Y         A  D       +G       LV    +G V   
Sbjct: 131 GPNLVGVIPARSINFFTYG--------ATKDFISSNFNNGQEETWIHLVSGINAGFVTST 182

Query: 505 LTNPIWVGVTRMQTHSKKAKN 567
            TNPIW+  TR+Q    K K+
Sbjct: 183 ATNPIWLIKTRLQLDKTKGKH 203



 Score = 38.5 bits (88), Expect = 0.094
 Identities = 21/67 (31%), Positives = 33/67 (49%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           TYP + V TR +       GK K    I+    V ++EG   +YGGL P L+ T  +  +
Sbjct: 293 TYPHEVVRTRLRQAPLESTGKPKYTGLIQCFKLVIKEEGLASIYGGLTPHLLRTVPNSII 352

Query: 364 YYYFYQI 384
            +  ++I
Sbjct: 353 MFGTWEI 359



>gb:AY088489_1573508 Arabidopsis thaliana clone 7124 mRNA, complete
           sequence.
          Length = 322

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 31/120 (25%), Positives = 54/120 (45%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YPL T  ++ Q +  ++ G++K     + M +   +     LY GL      +  SQ +Y
Sbjct: 26  YPLDTCKSKFQAEVRAR-GQQKYRYLSDVMWEAISKGHVFSLYQGLGTKNFQSFISQFIY 84

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
           +Y Y  F+               G  S+G  ++L++AA +G    +L  P+    +RMQT
Sbjct: 85  FYSYSYFKRVHSERT--------GSKSIGTKANLLIAAAAGACTSVLIQPLDTASSRMQT 136



>gb:ATAC009177_1542867 Arabidopsis thaliana chromosome III BAC T12H1
           genomic sequence, complete sequence.>gb:AY048291_1561752
           Arabidopsis thaliana AT3g05290/T12H1_26 mRNA, complete
           cds.>gb:BT000838_1635093 Arabidopsis thaliana
           At3g05290/T12H1_26 mRNA, complete cds.
          Length = 322

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 31/120 (25%), Positives = 54/120 (45%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YPL T  ++ Q +  ++ G++K     + M +   +     LY GL      +  SQ +Y
Sbjct: 26  YPLDTCKSKFQAEVRAR-GQQKYRYLSDVMWEAISKGQVFSLYQGLGTKNFQSFISQFIY 84

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
           +Y Y  F+               G  S+G  ++L++AA +G    +L  P+    +RMQT
Sbjct: 85  FYSYSYFKRVHSERT--------GSKSIGTKANLLIAAAAGACTSVLIQPLDTASSRMQT 136



>gb:AB042429_1519887 Triticum aestivum WhUCP1b mRNA for uncoupling
           protein, complete cds.
          Length = 286

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 34/143 (23%), Positives = 60/143 (41%), Gaps = 2/143 (1%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           T PL T   R Q Q+++  G    +  +  M  +AR+EG   L+ G+ P         G+
Sbjct: 25  TIPLDTAKVRLQLQKKTAAGPAATVGMLGTMMSIAREEGVSALWKGIIPGFHRQCLYGGL 84

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
               Y+       V AL      +  G   +++ ++ A  +G + + + NP  +   R+Q
Sbjct: 85  RVGLYE------PVKAL-----FVFVGDATLMNKILAALTTGVIAIAVANPTDLVKVRLQ 133

Query: 544 THSKK--AKNSPTGAMTAXDAIL 606
              K    K   +GA+ A   I+
Sbjct: 134 ADGKSTAVKRHYSGALNAYATIV 156



>gb:AB016885_1513123 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K19M22.>gb:AB021706_1514889 Arabidopsis
           thaliana mRNA for uncoupling protein, complete
           cds.>gb:AY088200_1573222 Arabidopsis thaliana clone
           42926 mRNA, complete sequence.
          Length = 305

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 37/149 (24%), Positives = 62/149 (41%), Gaps = 4/149 (2%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQL----STIEHMCQVARQEGWDRLYGGLAPSLVGTAA 351
           T PL T   R Q QR+   G  + L     +I  +  +AR+EG   L+ G+   L     
Sbjct: 30  TIPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAREEGISGLWKGVIAGLHRQCI 89

Query: 352 SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGV 531
             G+    Y+  +T    +        IGD  + +   ++ A L+G + +++ NP  +  
Sbjct: 90  YGGLRIGLYEPVKTLLVGSDF------IGD--IPLYQKILAALLTGAIAIIVANPTDLVK 141

Query: 532 TRMQTHSKKAKNSPTGAMTAXDAILAXVE 618
            R+Q+  K     P     A DA    V+
Sbjct: 142 VRLQSEGKLPAGVPRRYAGAVDAYFTIVK 170



>pir|T04273|T04273 hypothetical protein F20B18.290 - Arabidopsis
           thaliana>gb:ATCHRIV64_1546499 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           64.>gb:ATF20B18_1549466 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F20B18 (ESSA project).
          Length = 325

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 34/123 (27%), Positives = 55/123 (44%), Gaps = 3/123 (2%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQL---STIEHMCQVARQEGWDRLYGGLAPSLVGTAAS 354
           TYPL  V T+   Q + K    +Q+     ++   +  R+ G   LY G+APSL G    
Sbjct: 131 TYPLDLVRTKLAYQTQVKAIPVEQIIYRGIVDCFSRTYRESGARGLYRGVAPSLYGIFPY 190

Query: 355 QGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVT 534
            G+ +YFY+           + KR    +    +   LV  +++G +   LT P+ V   
Sbjct: 191 AGLKFYFYE-----------EMKRHVPPEHKQDISLKLVCGSVAGLLGQTLTYPLDVVRR 239

Query: 535 RMQ 543
           +MQ
Sbjct: 240 QMQ 242



 Score = 41.2 bits (95), Expect = 0.015
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 1/75 (1%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRK-QLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
           TYPL  V  + Q +R     K + +  T++ + ++AR+EGW +L+ GL+ + +    S  
Sbjct: 231 TYPLDVVRRQMQVERLYSAVKEETRRGTMQTLFKIAREEGWKQLFSGLSINYLKVVPSVA 290

Query: 361 VYYYFYQIFRTKAEV 405
           + +  Y I +    V
Sbjct: 291 IGFTVYDIMKLHLRV 305



>pir|JC7553|JC7553 brain mitochondrial carrier protein-1 -
           rat>gb:AF300424_2062033 Rattus norvegicus brain
           mitochondrial carrier protein-1 (BMCP1) mRNA, complete
           cds; nuclear gene for mitochondrial
           product.>gb:RNO300165_2135847 Rattus norvegicus mRNA for
           brain mitochondrial carrier protein BMCP1 (Bmcp1 gene).
          Length = 325

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 34/140 (24%), Positives = 62/140 (44%), Gaps = 7/140 (5%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLS---TIEHMCQVARQEGWDRLYGGLAPSLVGTAA- 351
           T+P+    TR Q Q +S + + K++        + ++ R+EG   LY G+AP+L+  A+ 
Sbjct: 58  TFPVDLTKTRLQVQGQSIDVRFKEIKYRGMFHALFRIYREEGILALYSGIAPALLRQASY 117

Query: 352 ---SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIW 522
                G+Y    ++F  + E   L              L +++   +SG ++  + NP  
Sbjct: 118 GTIKIGIYQSLKRLFVERLEDETL--------------LINMICGVVSGVISSTIANPTD 163

Query: 523 VGVTRMQTHSKKAKNSPTGA 582
           V   RMQ      + S  G+
Sbjct: 164 VLKIRMQAQGSLFQGSMIGS 183



>gb:BC011293_2091362 Mus musculus RIKEN cDNA 5730438N18 gene, mRNA
           (cDNA clone MGC:19266 IMAGE:3989313), complete cds.
          Length = 320

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 41/143 (28%), Positives = 59/143 (41%), Gaps = 19/143 (13%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRE---------------SKEGKRKQLSTIEHMCQVAR----QEGWD 306
           T PL+ + TR Q+ R                S  G  +  S    + QV +    +EG  
Sbjct: 29  TCPLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSVTPGLLQVLKSILEKEGPK 88

Query: 307 RLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALS 486
            L+ GL P+LVG A S+ VY+  Y   + +     +          +V +LS    A  +
Sbjct: 89  SLFRGLGPNLVGVAPSRAVYFACYSKAKEQFNGVFVP------NSNTVHILS----AGSA 138

Query: 487 GCVNVLLTNPIWVGVTRMQTHSK 555
             V   L NPIW+  TRMQ   K
Sbjct: 139 AFVTNTLMNPIWMVKTRMQLERK 161



>gb:AP002970_1824027 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0504D03.>gb:AP003213_1825309 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OSJNBa0054L14.
          Length = 314

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 33/134 (24%), Positives = 57/134 (42%), Gaps = 11/134 (8%)
 Frame = +1

Query: 190 PLQTVNTRQQTQ------RESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAA 351
           PL  + TR Q          +    R  +S  +H   + + EG   LY GL+P++V    
Sbjct: 37  PLDVIKTRLQVYGLPSNLSSTAPPGRVIISGFQH---ILKNEGLPGLYRGLSPTIVALFP 93

Query: 352 SQGVYYYFY-----QIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNP 516
           +    Y F        F     +  L   + G   G + + ++++ A+ +G    + TNP
Sbjct: 94  TWAAKYCFMIDACLVTFSVYNHLKGLLHSQ-GDNTGELSVQANILAASCAGIATAVATNP 152

Query: 517 IWVGVTRMQTHSKK 558
           +WV  TR+QT   +
Sbjct: 153 LWVVKTRLQTQGMR 166



 Score = 33.5 bits (75), Expect = 3.0
 Identities = 18/67 (26%), Positives = 34/67 (50%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           TYP + V ++ Q Q  ++ G       I+ + QV ++EG    Y G A +L+ T  +  +
Sbjct: 237 TYPHEVVRSKLQEQGRARHGAVHYTGVIDCIKQVYQKEGIPGFYRGCATNLLRTTPNAVI 296

Query: 364 YYYFYQI 384
            +  Y++
Sbjct: 297 TFTSYEM 303



>gb:AB189674_1529556 Philodendron bipinnatifidum PbUCPa mRNA for
           uncoupling protein a, complete cds.
          Length = 250

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 41/151 (27%), Positives = 63/151 (41%), Gaps = 10/151 (6%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHM----CQVARQEGWDRLYGGLAPSLVGTAA 351
           T PL T   R Q Q++S  G    L     M      +AR+EG   L+ G+ P L     
Sbjct: 31  TIPLDTAKVRLQLQKKSVAGDGVSLPKYRGMLGTVATIAREEGLSALWKGIVPGLHRQCL 90

Query: 352 SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVG--MLSSLVVAAL-SGCVNVLLTNPIW 522
             G+    Y+             K   +G+G VG   LS  ++A L +G + + + NP  
Sbjct: 91  FGGLRIGLYE-----------PVKSFYVGEGFVGDVPLSKKILAGLTAGALAITVANPTD 139

Query: 523 VGVTRMQTHSKKAKNSP---TGAMTAXDAIL 606
           +   R+Q   K +   P   +GA+ A   I+
Sbjct: 140 LVKVRLQAEGKLSPGIPRRYSGALNAYSTIV 170



>gb:AB088762_1524791 Helicodiceros muscivorus HmUCPa mRNA for
           mitochondrial uncoupling protein, complete cds.
          Length = 304

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 41/151 (27%), Positives = 63/151 (41%), Gaps = 10/151 (6%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHM----CQVARQEGWDRLYGGLAPSLVGTAA 351
           T PL T   R Q Q++S  G    L     M      +AR+EG   L+ G+ P L     
Sbjct: 31  TIPLDTAKVRLQLQKKSVAGDGVSLPKYRGMLGTVATIAREEGLSALWKGIVPGLHRQCL 90

Query: 352 SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVG--MLSSLVVAAL-SGCVNVLLTNPIW 522
             G+    Y+             K   +G+G VG   LS  ++A L +G + + + NP  
Sbjct: 91  FGGLRIGLYE-----------PVKSFYVGEGFVGDVPLSKKILAGLTTGALAITVANPTD 139

Query: 523 VGVTRMQTHSKKAKNSP---TGAMTAXDAIL 606
           +   R+Q   K +   P   +GA+ A   I+
Sbjct: 140 LVKVRLQAEGKLSPGIPRRYSGALNAYSTIV 170



>gb:AB019236_1514251 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MXK3.>gb:BT008613_1639827 Arabidopsis thaliana
           clone RAFL15-32-C04 (R20929) putative mitochondrial
           carrier protein (At5g64970) mRNA, complete
           cds.>gb:BT015788_1642406 Arabidopsis thaliana At5g64970
           mRNA, complete cds.
          Length = 428

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 23/74 (31%), Positives = 35/74 (47%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           TYP + V  R Q Q  +K     +LS +    ++  Q G   LY GL PSL+    S  +
Sbjct: 356 TYPFEVVRRRLQMQSHAK-----RLSAVATCVKIIEQGGVPALYAGLIPSLLQVLPSAAI 410

Query: 364 YYYFYQIFRTKAEV 405
            Y+ Y+  +   +V
Sbjct: 411 SYFVYEFMKVVLKV 424



 Score = 40.0 bits (92), Expect = 0.032
 Identities = 33/114 (28%), Positives = 49/114 (42%), Gaps = 13/114 (11%)
 Frame = +1

Query: 256 LSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKR--- 426
           +    HM Q    EG+  LY GL PSLV  A S  V+Y  Y I ++        +KR   
Sbjct: 264 VGAFRHMIQT---EGFFSLYKGLVPSLVSMAPSGAVFYGVYDILKSAYLHTPEGKKRLEH 320

Query: 427 --------RGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTR--MQTHSKK 558
                          +G + +L+  A++G  +   T P  V   R  MQ+H+K+
Sbjct: 321 MKQEGEELNAFDQLELGPMRTLLYGAIAGACSEAATYPFEVVRRRLQMQSHAKR 374



>gb:AB017063_1513347 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K3K7.
          Length = 487

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 37/131 (28%), Positives = 53/131 (40%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YPL  V TR QT          +L T+     +   EG    Y GL PSL+G     G+ 
Sbjct: 322 YPLDLVKTRLQTYTSQAGVAVPRLGTLTK--DILVHEGPRAFYKGLFPSLLGIIPYAGID 379

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
              Y+  +  +    L        D   G L  L    +SG +      P+ V  TRMQ 
Sbjct: 380 LAAYETLKDLSRTYILQ-------DAEPGPLVQLGCGTISGALGATCVYPLQVVRTRMQ- 431

Query: 547 HSKKAKNSPTG 579
            +++A+ S +G
Sbjct: 432 -AERARTSMSG 441



 Score = 37.7 bits (86), Expect = 0.16
 Identities = 22/73 (30%), Positives = 35/73 (47%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YPLQ V TR Q +R      R  +S +    +   +EG+  LY GL P+L+    +  + 
Sbjct: 421 YPLQVVRTRMQAERA-----RTSMSGVFR--RTISEEGYRALYKGLLPNLLKVVPAASIT 473

Query: 367 YYFYQIFRTKAEV 405
           Y  Y+  +   E+
Sbjct: 474 YMVYEAMKKSLEL 486



>gb:AB042428_1519886 Triticum aestivum WhUCP1a mRNA for uncoupling
           protein, complete cds.
          Length = 286

 Score = 41.6 bits (96), Expect = 0.011
 Identities = 34/143 (23%), Positives = 60/143 (41%), Gaps = 2/143 (1%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           T PL T   R Q Q+++  G    +  +  M  +AR+EG   L+ G+ P         G+
Sbjct: 25  TIPLDTAKVRLQLQKKTAAGPAGTVGMLGTMMSIAREEGVTALWKGIIPGFHRQCLYGGL 84

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
               Y+       V AL      +  G   +++ ++ A  +G + + + NP  +   R+Q
Sbjct: 85  RVGLYE------PVKAL-----FVFVGDATLMNKILAALTTGVIAIAVANPTDLVKVRLQ 133

Query: 544 THSKK--AKNSPTGAMTAXDAIL 606
              K    K   +GA+ A   I+
Sbjct: 134 ADGKSTAVKRHYSGALNAYATIV 156



>pir|T21149|T21149 hypothetical protein F20D1.9 - Caenorhabditis
           elegans>gb:CEF20D1_1362715 Caenorhabditis elegans cosmid
           F20D1, complete sequence.
          Length = 300

 Score = 41.6 bits (96), Expect = 0.011
 Identities = 33/140 (23%), Positives = 59/140 (42%), Gaps = 5/140 (3%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           T P++ +  + Q Q  + +  +++LS  +   ++ ++ G   LY GL+ +L        +
Sbjct: 119 TTPMELLKIQMQDQGRTLKPGQQKLSATQLTMKLVKENGIAALYKGLSSTLARDVTFSVI 178

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
           Y+  +    + A        R+  G G      S +    SG  +     P+ V  TRMQ
Sbjct: 179 YFPLFAYLDSLAP-------RKPDGSGDAVFYGSFLAGLTSGAASSFCVTPLDVIKTRMQ 231

Query: 544 THSKKA-----KNSPTGAMT 588
           T +K A     KN P   +T
Sbjct: 232 TINKGANEIVYKNIPDAFVT 251



>gb:AF535151_2067731 Mus musculus brain mitochondrial carrier
           protein long-inserted form (Tm4sf10) mRNA, complete cds;
           nuclear gene for mitochondrial product.
          Length = 356

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 33/140 (23%), Positives = 62/140 (44%), Gaps = 7/140 (5%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLS---TIEHMCQVARQEGWDRLYGGLAPSLVGTAA- 351
           T+P+    TR Q Q +S + + K++        + ++ ++EG   LY G+AP+L+  A+ 
Sbjct: 89  TFPVDLTKTRLQVQGQSIDVRFKEIKYRGMFHALFRIYKEEGILALYSGIAPALLRQASY 148

Query: 352 ---SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIW 522
                G+Y    ++F  + E   L              L +++   +SG ++  + NP  
Sbjct: 149 GTIKIGIYQSLKRLFVERLEDETL--------------LINMICGVVSGVISSTIANPTD 194

Query: 523 VGVTRMQTHSKKAKNSPTGA 582
           V   RMQ      + S  G+
Sbjct: 195 VLKIRMQAQGSLFQGSMIGS 214



>gb:AF535150_2067730 Mus musculus brain mitochondrial carrier
           protein short-inserted form (Tm4sf10) mRNA, complete
           cds; nuclear gene for mitochondrial product.
          Length = 353

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 33/140 (23%), Positives = 62/140 (44%), Gaps = 7/140 (5%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLS---TIEHMCQVARQEGWDRLYGGLAPSLVGTAA- 351
           T+P+    TR Q Q +S + + K++        + ++ ++EG   LY G+AP+L+  A+ 
Sbjct: 86  TFPVDLTKTRLQVQGQSIDVRFKEIKYRGMFHALFRIYKEEGILALYSGIAPALLRQASY 145

Query: 352 ---SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIW 522
                G+Y    ++F  + E   L              L +++   +SG ++  + NP  
Sbjct: 146 GTIKIGIYQSLKRLFVERLEDETL--------------LINMICGVVSGVISSTIANPTD 191

Query: 523 VGVTRMQTHSKKAKNSPTGA 582
           V   RMQ      + S  G+
Sbjct: 192 VLKIRMQAQGSLFQGSMIGS 211



>gb:AF076981_2053591 Mus musculus brain mitochondrial carrier
           protein BMCP1 (Bmcp1) mRNA, complete
           cds.>gb:AF155813_2056935 Mus musculus mitochondrial
           uncoupling protein 5 short form mRNA, complete cds;
           nuclear gene for mitochondrial product.
          Length = 322

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 33/140 (23%), Positives = 62/140 (44%), Gaps = 7/140 (5%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLS---TIEHMCQVARQEGWDRLYGGLAPSLVGTAA- 351
           T+P+    TR Q Q +S + + K++        + ++ ++EG   LY G+AP+L+  A+ 
Sbjct: 55  TFPVDLTKTRLQVQGQSIDVRFKEIKYRGMFHALFRIYKEEGILALYSGIAPALLRQASY 114

Query: 352 ---SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIW 522
                G+Y    ++F  + E   L              L +++   +SG ++  + NP  
Sbjct: 115 GTIKIGIYQSLKRLFVERLEDETL--------------LINMICGVVSGVISSTIANPTD 160

Query: 523 VGVTRMQTHSKKAKNSPTGA 582
           V   RMQ      + S  G+
Sbjct: 161 VLKIRMQAQGSLFQGSMIGS 180



>gb:AP003334_1828137 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1114B07.
          Length = 340

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 37/139 (26%), Positives = 57/139 (41%), Gaps = 10/139 (7%)
 Frame = +1

Query: 184 TYPL---------QTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDR-LYGGLAPS 333
           TYPL         Q  N  Q        G++     I+ + +   +EG  R LY G+ P+
Sbjct: 144 TYPLDLARTKLAYQVSNVGQPGNALGNAGRQPAYGGIKDVFKTVYKEGGARALYRGVGPT 203

Query: 334 LVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTN 513
           L+G     G+ +Y Y+           D K R   D    ++  L   AL+G     LT 
Sbjct: 204 LIGILPYAGLKFYIYE-----------DLKSRVPEDYKRSVVLKLSCGALAGLFGQTLTY 252

Query: 514 PIWVGVTRMQTHSKKAKNS 570
           P+ V   +MQ  +K+  N+
Sbjct: 253 PLDVVRRQMQVQNKQPHNA 271



>gb:AP003334_1828136 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1114B07.
          Length = 330

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 37/139 (26%), Positives = 57/139 (41%), Gaps = 10/139 (7%)
 Frame = +1

Query: 184 TYPL---------QTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDR-LYGGLAPS 333
           TYPL         Q  N  Q        G++     I+ + +   +EG  R LY G+ P+
Sbjct: 134 TYPLDLARTKLAYQVSNVGQPGNALGNAGRQPAYGGIKDVFKTVYKEGGARALYRGVGPT 193

Query: 334 LVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTN 513
           L+G     G+ +Y Y+           D K R   D    ++  L   AL+G     LT 
Sbjct: 194 LIGILPYAGLKFYIYE-----------DLKSRVPEDYKRSVVLKLSCGALAGLFGQTLTY 242

Query: 514 PIWVGVTRMQTHSKKAKNS 570
           P+ V   +MQ  +K+  N+
Sbjct: 243 PLDVVRRQMQVQNKQPHNA 261



>gb:AY644460_1619789 Saccharum officinarum mitochondrial uncoupling
           protein 1 mRNA, complete cds; nuclear gene for
           mitochondrial product.
          Length = 296

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 43/152 (28%), Positives = 65/152 (42%), Gaps = 11/152 (7%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESK---------EGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSL 336
           T PL T   R Q QR++                L+TI  MC +AR+EG   L+ G+ P L
Sbjct: 26  TIPLDTAKVRLQLQRKTPLPAPPAAAAAAGGGMLATI--MC-IAREEGVAALWKGVIPGL 82

Query: 337 VGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNP 516
                  G+    Y+    KA          G   G V +LS ++ A  +G + +++ NP
Sbjct: 83  HRQFLYGGLRIGLYE--PVKAFFVG------GAAVGDVSLLSKILAALTTGVIAIVVANP 134

Query: 517 IWVGVTRMQTHSK--KAKNSPTGAMTAXDAIL 606
             +   R+Q   K    K S +GA+ A   I+
Sbjct: 135 TDLVKVRLQADGKANTVKRSYSGALNAYATII 166



>gb:AY054689_1563343 Arabidopsis thaliana Unknown protein
           (AT4g15010) mRNA, complete cds.>gb:BT008473_1639690
           Arabidopsis thaliana At4g15610 gene, complete cds.
          Length = 378

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 34/136 (25%), Positives = 57/136 (41%), Gaps = 1/136 (0%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YPL T+ T  Q       G  K+LS+ +   +V R  G+  LY GL    +G  +  G  
Sbjct: 29  YPLDTIKTIIQVG----SGPNKKLSSFQVFNRVLRFSGYSGLYSGLGSLTLGRISGFGAR 84

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPI-WVGVTRMQ 543
           +  Y+I             + G  D  V +  + +   + G    ++T+P   + V +  
Sbjct: 85  FGVYEILTA--------FYKDGRHDNYVSVGEAFLAGLVGGAAETVMTSPFELIKVRKQV 136

Query: 544 THSKKAKNSPTGAMTA 591
           T + +A N+   A TA
Sbjct: 137 TAASRAPNASAVAETA 152



>gb:AC116925_1206488 Dictyostelium discoideum chromosome 2 map
           4189423-4228998 strain AX4, complete
           sequence.>gb:AY392437_1325143 Dictyostelium discoideum
           carrier protein RIM and asparaginase genes, complete
           cds.
          Length = 338

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 36/147 (24%), Positives = 56/147 (38%), Gaps = 24/147 (16%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQL---------------STIEHMC---------QVARQ 294
           YPL+ V  + Q Q  S       L               S+I H            + R 
Sbjct: 46  YPLECVEAKLQVQSSSTAVAATMLGLKKNGGSGSGSSSSSSISHQTPNGPIAMAKSILRN 105

Query: 295 EGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVV 474
           EG+   Y G++P+++G A + GVY+  Y+          ++  +   G   VG   S + 
Sbjct: 106 EGFKGFYQGVSPTILGNAVNWGVYFSIYRATNHWWNSTDINGNQYQ-GPAWVGHSVSAIT 164

Query: 475 AALSGCVNVLLTNPIWVGVTRMQTHSK 555
           A   G +   + NP WV   R+ T  K
Sbjct: 165 A---GVITTAIVNPFWVLKIRLATSKK 188



>sp|Q9Z2B2|UCP5_MOUSE Brain mitochondrial carrier protein-1 (BMCP-1)
           (Mitochondrial uncoupling protein 5) (UCP 5) (Solute
           carrier family 25, member 14).>gb:AF155812_2056934 Mus
           musculus mitochondrial uncoupling protein 5 long form
           mRNA, complete cds; nuclear gene for mitochondrial
           product.>gb:BC048692_2099778 Mus musculus solute carrier
           family 25 (mitochondrial carrier, brain), member 14,
           mRNA (cDNA clone MGC:59323 IMAGE:6333237), complete cds.
          Length = 325

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 33/140 (23%), Positives = 62/140 (44%), Gaps = 7/140 (5%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLS---TIEHMCQVARQEGWDRLYGGLAPSLVGTAA- 351
           T+P+    TR Q Q +S + + K++        + ++ ++EG   LY G+AP+L+  A+ 
Sbjct: 58  TFPVDLTKTRLQVQGQSIDVRFKEIKYRGMFHALFRIYKEEGILALYSGIAPALLRQASY 117

Query: 352 ---SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIW 522
                G+Y    ++F  + E   L              L +++   +SG ++  + NP  
Sbjct: 118 GTIKIGIYQSLKRLFVERLEDETL--------------LINMICGVVSGVISSTIANPTD 163

Query: 523 VGVTRMQTHSKKAKNSPTGA 582
           V   RMQ      + S  G+
Sbjct: 164 VLKIRMQAQGSLFQGSMIGS 183



>gb:BC031671_1980220 Homo sapiens hypothetical protein MGC34725,
           mRNA (cDNA clone MGC:34725 IMAGE:5164630), complete cds.
          Length = 251

 Score = 40.8 bits (94), Expect = 0.019
 Identities = 21/69 (30%), Positives = 37/69 (53%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           +YPL  V TR Q Q ++ EG    +  +  + ++  Q+GW  LY G+ P+L+    + G+
Sbjct: 181 SYPLTLVRTRMQAQ-DTVEGSNPTMRGV--LQRILAQQGWLGLYRGMTPTLLKVLPAGGI 237

Query: 364 YYYFYQIFR 390
            Y  Y+  +
Sbjct: 238 SYVVYEAMK 246



>gb:AK097761_1914975 Homo sapiens cDNA FLJ40442 fis, clone
           TESTI2040102, moderately similar to Oryctolagus
           cuniculus peroxisomal Ca-dependent solute carrier mRNA.
          Length = 232

 Score = 40.8 bits (94), Expect = 0.019
 Identities = 21/69 (30%), Positives = 37/69 (53%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           +YPL  V TR Q Q ++ EG    +  +  + ++  Q+GW  LY G+ P+L+    + G+
Sbjct: 162 SYPLTLVRTRMQAQ-DTVEGSNPTMRGV--LQRILAQQGWLGLYRGMTPTLLKVLPAGGI 218

Query: 364 YYYFYQIFR 390
            Y  Y+  +
Sbjct: 219 SYVVYEAMK 227



>gb:AF495714_1905238 Homo sapiens mitochondrial carrier protein
           mRNA, complete cds; nuclear gene for mitochondrial
           product.>gb:AL928921_1933238 Human DNA sequence from
           clone RP13-392I16 on chromosome 1, complete
           sequence.>gb:AL954705_1933483 Human DNA sequence from
           clone RP13-15M17 on chromosome 1, complete
           sequence.>gb:BC004991_1969504 Homo sapiens mitochondrial
           carrier protein, mRNA (cDNA clone MGC:4399
           IMAGE:2905957), complete cds.>gb:BC073135_1989035 Homo
           sapiens mitochondrial carrier protein, mRNA (cDNA clone
           MGC:87888 IMAGE:6172562), complete cds.
          Length = 321

 Score = 40.8 bits (94), Expect = 0.019
 Identities = 41/143 (28%), Positives = 62/143 (43%), Gaps = 19/143 (13%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRE---------------SKEGKRKQLSTIEHMCQVAR----QEGWD 306
           T PL+ + TR Q+ R                S  G  +  S    + QV +    +EG  
Sbjct: 29  TCPLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSVTPGLFQVLKSILEKEGPK 88

Query: 307 RLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALS 486
            L+ GL P+LVG A S+ VY+  Y    +KA+      +  GI   +  ++      + +
Sbjct: 89  SLFRGLGPNLVGVAPSRAVYFACY----SKAK-----EQFNGIFVPNSNIVHIFSAGSAA 139

Query: 487 GCVNVLLTNPIWVGVTRMQTHSK 555
              N L+ NPIW+  TRMQ   K
Sbjct: 140 FITNSLM-NPIWMVKTRMQLEQK 161



>gb:AE016820_1749890 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VII, complete sequence.
          Length = 296

 Score = 40.8 bits (94), Expect = 0.019
 Identities = 32/101 (31%), Positives = 43/101 (42%)
 Frame = +1

Query: 289 RQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSL 468
           R+ G   LYGGL P  +  A++Q V +  Y   +      A+ R      D  +G   + 
Sbjct: 161 RELGLRGLYGGLVPVALRQASNQAVRFGCYTQLKQ-----AVQRYAGTPADQPLGSGQTF 215

Query: 469 VVAALSGCVNVLLTNPIWVGVTRMQTHSKKAKNSPTGAMTA 591
           +V ALSG V V  T P+    TRMQ        S  G   A
Sbjct: 216 LVGALSGIVTVYATMPVDTVKTRMQALDAARYGSTVGCFRA 256



 Score = 32.0 bits (71), Expect = 8.8
 Identities = 21/66 (31%), Positives = 30/66 (45%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           T P+ TV TR Q    ++ G     ST+     V R+EG   L+ G  P L     S G+
Sbjct: 229 TMPVDTVKTRMQALDAARYG-----STVGCFRAVVREEGVRALWRGATPRLGRLVLSGGI 283

Query: 364 YYYFYQ 381
            +  Y+
Sbjct: 284 VFTAYE 289



>gb:AP004869_1846306 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0419A09.
          Length = 476

 Score = 40.4 bits (93), Expect = 0.025
 Identities = 35/131 (26%), Positives = 51/131 (38%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YP+  V TR QT      GK   L  +     +  QEG    Y GL PSL+G     G+ 
Sbjct: 307 YPIDLVKTRLQTFA-CGSGKIPSLGALSR--DIWMQEGPRAFYRGLVPSLLGMVPYAGID 363

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
              Y+  +  ++   L        D   G L  L    +SG +      P+ V  TR+Q 
Sbjct: 364 LTVYETLKEMSKTYVLK-------DSDPGPLVQLGCGTVSGALGATCVYPLQVIRTRLQA 416

Query: 547 HSKKAKNSPTG 579
               ++ +  G
Sbjct: 417 QRANSEAAYRG 427



>gb:AP002483_1822209 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0019D06.>gb:AP003311_1827803
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 1, PAC clone:P0024G09.
          Length = 305

 Score = 40.4 bits (93), Expect = 0.025
 Identities = 38/139 (27%), Positives = 60/139 (43%), Gaps = 5/139 (3%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           TYPL  V TR  TQ+ ++  K         +  + R EG   LY GL  +L+G   S  +
Sbjct: 130 TYPLDVVRTRLATQKTTRYYK----GIFHAVSTICRDEGVKGLYKGLGATLLGVGPSIAI 185

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
            +  Y+  R+  +   ++R +          + SL   +LSG  +   T P+ +   RMQ
Sbjct: 186 SFTVYESLRSHWQ---MERPQ------DSPAVVSLFSGSLSGIASSTATFPLDLVKRRMQ 236

Query: 544 TH-----SKKAKNSPTGAM 585
                  S   K+S TG +
Sbjct: 237 LQGAAGTSSVCKSSITGTI 255



>gb:BC056716_2551909 Danio rerio zgc:65787, mRNA (cDNA clone
           MGC:65787 IMAGE:6790740), complete
           cds.>gb:BC065854_2554145 Danio rerio zgc:65787, mRNA
           (cDNA clone MGC:77728 IMAGE:7000719), complete cds.
          Length = 314

 Score = 40.0 bits (92), Expect = 0.032
 Identities = 29/91 (31%), Positives = 43/91 (47%)
 Frame = +1

Query: 283 VARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLS 462
           +  +EG   L+ GL P+LVG A S+ +Y+  Y   ++K     +     G+    V M S
Sbjct: 74  ILEKEGPRSLFRGLGPNLVGVAPSRAIYFAAYS--KSKETFNGIFVPNSGV----VHMSS 127

Query: 463 SLVVAALSGCVNVLLTNPIWVGVTRMQTHSK 555
               A  +  +   L NPIW+  TRMQ   K
Sbjct: 128 ----AGFAAFITNSLMNPIWMVKTRMQLEKK 154



>gb:CR382131_1663747 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 404

 Score = 40.0 bits (92), Expect = 0.032
 Identities = 32/122 (26%), Positives = 52/122 (42%), Gaps = 1/122 (0%)
 Frame = +1

Query: 190 PLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVYY 369
           P++   TR Q+       +     T+  M  +  Q+G+  L+ GL  +L       GVY+
Sbjct: 226 PMELFRTRLQSYPFESSSQLAFQKTLTGMKTMIAQDGYRSLWRGLVLTLWRDVPFSGVYW 285

Query: 370 YFYQIFRTKAEVAALDRKRRGIGDGSVGMLS-SLVVAALSGCVNVLLTNPIWVGVTRMQT 546
             Y+ F+ K         R     GSV   + S +  + +G +  ++T P  VG TR Q 
Sbjct: 286 SAYETFKAKL-------LRTQYFHGSVDAFTPSFIAGSAAGALASIITQPFDVGKTRRQI 338

Query: 547 HS 552
            S
Sbjct: 339 AS 340



>gb:CR382130_1662581 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 316

 Score = 40.0 bits (92), Expect = 0.032
 Identities = 32/126 (25%), Positives = 52/126 (41%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YP  TV  R Q+Q +     +  L   +   Q  R EG+   Y G++  +VG AA     
Sbjct: 28  YPFDTVKVRLQSQSDVNPQFKGPLDCFK---QTFRNEGFLGFYRGISSPIVGAAAETASL 84

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
           + FY           L +   G  +  + M + L   A++G +   +  PI +   +MQ 
Sbjct: 85  FVFY------GACQRLVKNMTGTPEDKLPMSTLLGCGAVAGALTSFILTPIELIKCQMQV 138

Query: 547 HSKKAK 564
            +  AK
Sbjct: 139 QALYAK 144



>gb:AB024734_1516047 Symplocarpus foetidus mRNA for SfUCPb, complete
           cds.
          Length = 268

 Score = 40.0 bits (92), Expect = 0.032
 Identities = 40/151 (26%), Positives = 63/151 (41%), Gaps = 10/151 (6%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHM----CQVARQEGWDRLYGGLAPSLVGTAA 351
           T PL T   R Q Q+++  G    L     M      +AR+EG   L+ G+ P L     
Sbjct: 29  TIPLDTAKVRLQLQKKAVTGDVVALPKYRGMLGTVATIAREEGLSALWKGIVPGLHRQCL 88

Query: 352 SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVG--MLSSLVVAAL-SGCVNVLLTNPIW 522
             G+    Y+             K   +GD  VG   LS  ++A L +G + +++ NP  
Sbjct: 89  FGGLRIGLYE-----------PVKSFYVGDNFVGDIPLSKKILAGLTTGALAIIVANPTD 137

Query: 523 VGVTRMQTHSKKAKNSP---TGAMTAXDAIL 606
           +   R+Q+  K     P   +GA+ A   I+
Sbjct: 138 LVKVRLQSEGKLPPGVPRRYSGALNAYSTIV 168



>gb:AB024733_1516046 Symplocarpus foetidus mRNA for SfUCPa, complete
           cds.
          Length = 303

 Score = 40.0 bits (92), Expect = 0.032
 Identities = 40/151 (26%), Positives = 63/151 (41%), Gaps = 10/151 (6%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHM----CQVARQEGWDRLYGGLAPSLVGTAA 351
           T PL T   R Q Q+++  G    L     M      +AR+EG   L+ G+ P L     
Sbjct: 29  TIPLDTAKVRLQLQKKAVTGDVVALPKYRGMLGTVATIAREEGLSALWKGIVPGLHRQCL 88

Query: 352 SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVG--MLSSLVVAAL-SGCVNVLLTNPIW 522
             G+    Y+             K   +GD  VG   LS  ++A L +G + +++ NP  
Sbjct: 89  FGGLRIGLYE-----------PVKSFYVGDNFVGDIPLSKKILAGLTTGALAIIVANPTD 137

Query: 523 VGVTRMQTHSKKAKNSP---TGAMTAXDAIL 606
           +   R+Q+  K     P   +GA+ A   I+
Sbjct: 138 LVKVRLQSEGKLPPGVPRRYSGALNAYSTIV 168



>gb:AE014296_1136883 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003519_1213782 Drosophila melanogaster
           chromosome 3L, section 66 of 83 of the complete
           sequence.
          Length = 302

 Score = 40.0 bits (92), Expect = 0.032
 Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 2/119 (1%)
 Frame = +1

Query: 190 PLQTVNTRQQTQRESKEGKRKQLSTI-EHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           P   +N R QT  +    KR+    + + + ++ ++EGW  LY G + ++  ++ S    
Sbjct: 128 PTDLINVRMQTDMKEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQ 187

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDG-SVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
             FY I +T+       RK   + DG  +  L+SL  + +S  +    T+P+ V  T M
Sbjct: 188 IAFYDIIKTEV------RKNISVNDGLPLHFLTSLGTSIISSAI----THPLDVVRTIM 236



>gb:BC084458_2563832 Xenopus tropicalis cDNA clone MGC:89262
           IMAGE:6976608, complete cds.
          Length = 291

 Score = 39.7 bits (91), Expect = 0.042
 Identities = 30/135 (22%), Positives = 57/135 (42%), Gaps = 3/135 (2%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQL---STIEHMCQVARQEGWDRLYGGLAPSLVGTAAS 354
           T+P+    TR Q Q ++ + K K++     +  + ++ ++EG   LY G+AP+++  A+ 
Sbjct: 23  TFPIDLTKTRLQVQGQANDAKYKEIRYRGMLHAIVRIWKEEGVKALYSGIAPAMLRQASY 82

Query: 355 QGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVT 534
             +    YQ  +        D            ++ ++    LSG V+  + NP  V   
Sbjct: 83  GTIKIGTYQSLKRLFVDCPEDET----------LVINVFCGVLSGVVSSCIANPTDVLKI 132

Query: 535 RMQTHSKKAKNSPTG 579
           RMQ      +    G
Sbjct: 133 RMQAQGSLIQGGMIG 147



>gb:BC063207_2553479 Xenopus tropicalis hypothetical protein
           LOC394840, mRNA (cDNA clone IMAGE:5308614), partial cds.
          Length = 315

 Score = 39.7 bits (91), Expect = 0.042
 Identities = 30/135 (22%), Positives = 57/135 (42%), Gaps = 3/135 (2%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQL---STIEHMCQVARQEGWDRLYGGLAPSLVGTAAS 354
           T+P+    TR Q Q ++ + K K++     +  + ++ ++EG   LY G+AP+++  A+ 
Sbjct: 47  TFPIDLTKTRLQVQGQANDAKYKEIRYRGMLHAIVRIWKEEGVKALYSGIAPAMLRQASY 106

Query: 355 QGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVT 534
             +    YQ  +        D            ++ ++    LSG V+  + NP  V   
Sbjct: 107 GTIKIGTYQSLKRLFVDCPEDET----------LVINVFCGVLSGVVSSCIANPTDVLKI 156

Query: 535 RMQTHSKKAKNSPTG 579
           RMQ      +    G
Sbjct: 157 RMQAQGSLIQGGMIG 171



>gb:AP002900_1823705 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0443E07.>gb:AP002902_1823767 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0492F05.
          Length = 211

 Score = 39.7 bits (91), Expect = 0.042
 Identities = 29/120 (24%), Positives = 55/120 (45%), Gaps = 2/120 (1%)
 Frame = +1

Query: 190 PLQTVNTRQQTQRESKEGKRK--QLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           P++ V  R Q +   ++ +R       ++    + R+EG   +Y GLA + +  A + GV
Sbjct: 27  PVELVKIRLQLEAAGQKHRRPGDHHGPVDMARDILRKEGVRGIYRGLAVTALRDAPAHGV 86

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
           Y++ Y+  R +          RG G     + + LV   L+G  + +   P+ V  +R+Q
Sbjct: 87  YFWTYEYARERLHPGC-----RGHGGEQESLATMLVSGGLAGVASWVCCYPLDVVKSRLQ 141



>gb:AE017350_1759155 Cryptococcus neoformans var. neoformans JEC21
           chromosome 10, complete sequence.
          Length = 435

 Score = 39.7 bits (91), Expect = 0.042
 Identities = 25/107 (23%), Positives = 51/107 (47%)
 Frame = +1

Query: 244 KRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRK 423
           K ++   +  + ++   EG   ++ G   +++GT + Q  Y++F+   R K  +A L   
Sbjct: 94  KLQRWGMLTMLIRIVHMEGISGVFHGYGATMIGTFSQQFTYFFFHTFLR-KTYLARLTAS 152

Query: 424 RRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQTHSKKAK 564
            +     S+   + L++ AL+G +  + T P+ V  TR Q     A+
Sbjct: 153 SK---RASLSTSTELLLGALAGALAQIFTIPVSVIATRQQLWDPPAR 196



>gb:NC20H10_1688473 Neurospora crassa DNA linkage group V Cosmid
           contig 20H10.
          Length = 450

 Score = 39.7 bits (91), Expect = 0.042
 Identities = 32/125 (25%), Positives = 57/125 (45%), Gaps = 2/125 (1%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKE-GKRKQLSTIEHMCQVA-RQEGWDRLYGGLAPSLVGTAASQ 357
           T PL  + T+ Q Q   +  G+ +  + +    +V  R EG   +Y GL P ++G   + 
Sbjct: 109 TCPLDVIKTKLQAQGAGQHVGQPRMYNGLVGTAKVIWRHEGIRGMYRGLGPIIMGYLPTW 168

Query: 358 GVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTR 537
            V++  Y   ++K  +     K   I  G+         + ++G  + + TNPIWV  TR
Sbjct: 169 AVWFTVYN--KSKIWLRQYTDKPIAINFGA---------SIIAGASSTIATNPIWVIKTR 217

Query: 538 MQTHS 552
           + + S
Sbjct: 218 LMSQS 222



>gb:AB189672_1529554 Dracunculus vulgaris DvUCPa mRNA for uncoupling
           protein a, complete cds.
          Length = 304

 Score = 39.7 bits (91), Expect = 0.042
 Identities = 40/151 (26%), Positives = 62/151 (41%), Gaps = 10/151 (6%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHM----CQVARQEGWDRLYGGLAPSLVGTAA 351
           T PL T   R Q Q++S  G    L     M      +AR+EG   L+ G+ P L     
Sbjct: 31  TIPLDTAKVRLQLQKKSVAGDGVSLPKYRGMLGTVATIAREEGLSALWKGIVPGLHRQCL 90

Query: 352 SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVG--MLSSLVVAAL-SGCVNVLLTNPIW 522
             G+    Y+             K   +G+G VG   LS  ++A L +G + + + +P  
Sbjct: 91  FGGLRIGLYE-----------PVKSLYVGEGFVGDVPLSKKILAGLTTGALAITVADPTD 139

Query: 523 VGVTRMQTHSKKAKNSP---TGAMTAXDAIL 606
           +   R+Q   K     P   +GA+ A   I+
Sbjct: 140 LVKVRLQAEGKLPPGIPRRYSGALNAYSTIV 170



>gb:AY094704_1297878 Drosophila melanogaster GH11346 full insert
           cDNA.
          Length = 311

 Score = 39.7 bits (91), Expect = 0.042
 Identities = 36/147 (24%), Positives = 61/147 (41%), Gaps = 4/147 (2%)
 Frame = +1

Query: 190 PLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVG----TAASQ 357
           PL  + TR Q       G R+  ++ E + +V + EG   LY GL+  L+     T+A  
Sbjct: 34  PLDLLKTRMQIS--GTLGTREYKNSFEVLSKVLKNEGILSLYNGLSAGLLRQATYTSAKM 91

Query: 358 GVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTR 537
           GVY               LD  R+  G+    M++S+ +  ++G    +  NP  V + R
Sbjct: 92  GVYQ------------MELDWYRKNFGN-YPSMVASMTMGIVAGAFGAMCGNPAEVALIR 138

Query: 538 MQTHSKKAKNSPTGAMTAXDAILAXVE 618
           M + ++             DA +  V+
Sbjct: 139 MMSDNRLIPEDRRNYKNVGDAFVRIVK 165



>gb:AE014297_1139113 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003693_1221106 Drosophila melanogaster
           chromosome 3R, section 31 of 118 of the complete
           sequence.>gb:AY119214_1300936 Drosophila melanogaster
           SD15982 full insert cDNA.
          Length = 321

 Score = 39.7 bits (91), Expect = 0.042
 Identities = 28/125 (22%), Positives = 52/125 (41%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +PL  V TR Q Q+    G+R   S  +   +  + EG+  +Y G   +++     + + 
Sbjct: 40  FPLDLVKTRLQNQQIGPNGERMYNSMFDCFRKTYKAEGYFGMYRGSGVNILLITPEKAIK 99

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
                 FR K              DG + + S +V   L+G   +++T P+ +   +MQ 
Sbjct: 100 LTANDYFRHKLTTK----------DGKLPLTSQMVAGGLAGAFQIIVTTPMELLKIQMQD 149

Query: 547 HSKKA 561
             + A
Sbjct: 150 AGRVA 154



>gb:AE014296_1134790 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003482_1212089 Drosophila melanogaster
           chromosome 3L, section 16 of 83 of the complete
           sequence.
          Length = 311

 Score = 39.7 bits (91), Expect = 0.042
 Identities = 36/147 (24%), Positives = 61/147 (41%), Gaps = 4/147 (2%)
 Frame = +1

Query: 190 PLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVG----TAASQ 357
           PL  + TR Q       G R+  ++ E + +V + EG   LY GL+  L+     T+A  
Sbjct: 34  PLDLLKTRMQIS--GTLGTREYKNSFEVLSKVLKNEGILSLYNGLSAGLLRQATYTSAKM 91

Query: 358 GVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTR 537
           GVY               LD  R+  G+    M++S+ +  ++G    +  NP  V + R
Sbjct: 92  GVYQ------------MELDWYRKNFGN-YPSMVASMTMGIVAGAFGAMCGNPAEVALIR 138

Query: 538 MQTHSKKAKNSPTGAMTAXDAILAXVE 618
           M + ++             DA +  V+
Sbjct: 139 MMSDNRLMPEDRRNYKNVGDAFVRIVK 165



>pir|T49871|T49871 peroxisomal Ca-dependent solute carrier-like
           protein - Arabidopsis thaliana>gb:ATT2I1_1555665
           Arabidopsis thaliana DNA chromosome 5, BAC clone T2I1
           (ESSA project).>gb:AK175228_1817216 Arabidopsis thaliana
           mRNA for peroxisomal Ca-dependent solute carrier-like
           protein, complete cds, clone: RAFL21-65-I24.
          Length = 479

 Score = 39.7 bits (91), Expect = 0.042
 Identities = 38/124 (30%), Positives = 50/124 (40%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YP+  V TR QT   S+ GK  +L  +     V  +EG    Y GL PSL+G     G+ 
Sbjct: 315 YPMDLVKTRLQTC-VSEGGKAPKLWKLTKDIWV--REGPRAFYKGLFPSLLGIVPYAGID 371

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
              Y+  +  +    L        D   G L  L     SG +      P+ V  TRMQ 
Sbjct: 372 LAAYETLKDLSRTYILQ-------DTEPGPLIQLSCGMTSGALGASCVYPLQVVRTRMQA 424

Query: 547 HSKK 558
            S K
Sbjct: 425 DSSK 428



>pir|T40968|T40968 probable mitochondrial carrier protein - fission
           yeast  (Schizosaccharomyces pombe)>gb:SPCC1442_1720895
           S.pombe chromosome III cosmid c1442.>gb:SPCC1450_1720928
           S.pombe chromosome III cosmid c1450.
          Length = 338

 Score = 39.7 bits (91), Expect = 0.042
 Identities = 24/89 (26%), Positives = 40/89 (44%)
 Frame = +1

Query: 280 QVARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGML 459
           Q+A+QEG    + G   +++      G    FY+  R  A+        +  G   +G+ 
Sbjct: 164 QIAKQEGMKTFFYGYRATILRDIPFSGFQLLFYEKLRQVAQ--------KECGQKDIGVF 215

Query: 460 SSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
             L+  +L+G     LT P+ V  TR+QT
Sbjct: 216 RELITGSLAGAGAGFLTTPLDVAKTRLQT 244



>gb:CR382127_1660151 Yarrowia lipolytica chromosome A of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 299

 Score = 39.3 bits (90), Expect = 0.055
 Identities = 26/77 (33%), Positives = 37/77 (48%)
 Frame = +1

Query: 310 LYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSG 489
           LY GL  +L+G AA  GVY+  Y I            K+  + DG  G   +   A ++G
Sbjct: 63  LYRGLGINLLGNAAGYGVYFSLYGIV-----------KKMHLFDGPHGYFFN---ALITG 108

Query: 490 CVNVLLTNPIWVGVTRM 540
               + TNP+WV  TR+
Sbjct: 109 TATSIATNPLWVLKTRI 125



>gb:CR382124_1656764 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 364

 Score = 39.3 bits (90), Expect = 0.055
 Identities = 25/88 (28%), Positives = 45/88 (51%)
 Frame = +1

Query: 283 VARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLS 462
           + R+EGW  L+ G   +L       G+ + FY+ FR  A   A++ K     D  + + +
Sbjct: 205 IVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQLA--FAVENK---TFDEDLSLSN 259

Query: 463 SLVVAALSGCVNVLLTNPIWVGVTRMQT 546
            ++  A +G +  ++T P+ V  TR+QT
Sbjct: 260 EIITGAAAGGLAGIITTPLDVVKTRIQT 287



>pir|T47570|T47570 uncoupling protein [imported] - Arabidopsis
           thaliana>gb:ATF24B22_1549820 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F24B22.>gb:ATH18291_1552038
           Arabidopsis thaliana ucp gene, exons
           1-9.>gb:ATMTUNCOU_1553744 Arabidopsis thaliana mRNA for
           mitochondrial uncoupling protein.>gb:AY056272_1563587
           Arabidopsis thaliana putative uncoupling protein
           ucp/PUMP (At3g54110) mRNA, complete
           cds.>gb:AY091185_1574395 Arabidopsis thaliana putative
           uncoupling protein (At3g54110) mRNA, complete
           cds.>gb:AF146226_1772159 Arabidopsis thaliana putative
           uncoupling protein PUMP2 (UCP2) mRNA, complete cds;
           nuclear gene for mitochondrial product.
          Length = 306

 Score = 39.3 bits (90), Expect = 0.055
 Identities = 36/147 (24%), Positives = 62/147 (42%), Gaps = 6/147 (4%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGK---RKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAAS 354
           T PL T   R Q Q+ +  G     K    +  +  +AR+EG   L+ G+ P L      
Sbjct: 29  TIPLDTAKVRLQLQKSALAGDVTLPKYRGLLGTVGTIAREEGLRSLWKGVVPGLHRQCLF 88

Query: 355 QGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVT 534
            G+    Y+       V  L   +  +GD  V +   ++    +G + +++ NP  +   
Sbjct: 89  GGLRIGMYE------PVKNLYVGKDFVGD--VPLSKKILAGLTTGALGIMVANPTDLVKV 140

Query: 535 RMQTHSKKAKNSP---TGAMTAXDAIL 606
           R+Q   K A  +P   +GA+ A   I+
Sbjct: 141 RLQAEGKLAAGAPRRYSGALNAYSTIV 167



>pir|T52024|T52024 uncoupling protein [imported] - Arabidopsis
           thaliana>gb:ATPUMP_1553919 Arabidopsis thaliana mRNA for
           plant uncoupling mitochondrial protein (PUMP).
          Length = 306

 Score = 39.3 bits (90), Expect = 0.055
 Identities = 36/147 (24%), Positives = 62/147 (42%), Gaps = 6/147 (4%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGK---RKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAAS 354
           T PL T   R Q Q+ +  G     K    +  +  +AR+EG   L+ G+ P L      
Sbjct: 29  TIPLDTAKVRLQLQKSALAGDVTLPKYRGLLGTVGTIAREEGLRSLWKGVVPGLHRQCLF 88

Query: 355 QGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVT 534
            G+    Y+       V  L   +  +GD  V +   ++    +G + +++ NP  +   
Sbjct: 89  GGLRIGMYE------PVKNLYVGKDFVGD--VPLSKKILAGLTTGALGIMVANPTDLVKV 140

Query: 535 RMQTHSKKAKNSP---TGAMTAXDAIL 606
           R+Q   K A  +P   +GA+ A   I+
Sbjct: 141 RLQAEGKLAAGAPRRYSGALNAYSTIV 167



>gb:BC013194_1974008 Homo sapiens hypothetical protein FLJ20551,
           mRNA (cDNA clone MGC:8852 IMAGE:3918744), complete
           cds.>gb:CR457242_1993449 Homo sapiens full open reading
           frame cDNA clone RZPDo834H0812D for gene FLJ20551,
           hypothetical protein FLJ20551; complete cds, incl.
           stopcodon.
          Length = 304

 Score = 38.9 bits (89), Expect = 0.072
 Identities = 28/91 (30%), Positives = 42/91 (46%), Gaps = 4/91 (4%)
 Frame = +1

Query: 190 PLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY- 366
           PL  + TR QT + S  G R+ +  +  + +V R E    L+ G++PS+V      G+Y 
Sbjct: 47  PLDLLKTRLQTLQPSDHGSRR-VGMLAVLLKVVRTESLLGLWKGMSPSIVRCVPGVGIYF 105

Query: 367 ---YYFYQIFRTKAEVAALDRKRRGIGDGSV 450
              Y   Q F       AL+    G+G  SV
Sbjct: 106 GTLYSLKQYFLRGHPPTALESVMLGVGSRSV 136



 Score = 33.5 bits (75), Expect = 3.0
 Identities = 30/123 (24%), Positives = 50/123 (40%)
 Frame = +1

Query: 190 PLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVYY 369
           P+  + TR ++ +   E     L +I H       EG   L+ GL  +L+  A   G+Y 
Sbjct: 143 PITVIKTRYESGKYGYESIYAALRSIYH------SEGHRGLFSGLTATLLRDAPFSGIYL 196

Query: 370 YFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQTH 549
            FY   +       +D     I + S G+ + ++ +        L+T P  V  T MQ +
Sbjct: 197 MFYNQTKNIVPHDQVDATLIPITNFSCGIFAGILAS--------LVTQPADVIKTHMQLY 248

Query: 550 SKK 558
             K
Sbjct: 249 PLK 251



>gb:AK054901_1911376 Homo sapiens cDNA FLJ30339 fis, clone
           BRACE2007401, moderately similar to Oryctolagus
           cuniculus peroxisomal Ca-dependent solute carrier mRNA.
          Length = 384

 Score = 38.9 bits (89), Expect = 0.072
 Identities = 22/66 (33%), Positives = 33/66 (50%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           +YPL  V TR Q Q   + G   QLS +  +  +  QEG   LY G+AP+ +    +  +
Sbjct: 310 SYPLALVRTRMQAQASIEGGP--QLSMLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSI 367

Query: 364 YYYFYQ 381
            Y  Y+
Sbjct: 368 SYVVYE 373



>gb:AK000558_1908000 Homo sapiens cDNA FLJ20551 fis, clone KAT11656.
          Length = 304

 Score = 38.9 bits (89), Expect = 0.072
 Identities = 28/91 (30%), Positives = 42/91 (46%), Gaps = 4/91 (4%)
 Frame = +1

Query: 190 PLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY- 366
           PL  + TR QT + S  G R+ +  +  + +V R E    L+ G++PS+V      G+Y 
Sbjct: 47  PLDLLKTRLQTLQPSDHGSRR-VGMLAVLLKVVRTESLLGLWKGMSPSIVRCVPGVGIYF 105

Query: 367 ---YYFYQIFRTKAEVAALDRKRRGIGDGSV 450
              Y   Q F       AL+    G+G  SV
Sbjct: 106 GTLYSLKQYFLRGHPPTALESVMLGVGSRSV 136



 Score = 34.3 bits (77), Expect = 1.8
 Identities = 30/123 (24%), Positives = 50/123 (40%)
 Frame = +1

Query: 190 PLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVYY 369
           P+  + TR ++ +   E     L +I H       EG   L+ GL  +L+  A   G+Y 
Sbjct: 143 PITVIKTRYESGKYGYESIYAALRSIYH------SEGHRGLFSGLTATLLRDAPFSGIYL 196

Query: 370 YFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQTH 549
            FY   +       +D     I + S G+ + ++ +        L+T P  V  T MQ +
Sbjct: 197 MFYNQTKNIVPHDQVDATLIPITNFSCGIFAGILAS--------LVTQPAGVIKTHMQLY 248

Query: 550 SKK 558
             K
Sbjct: 249 PLK 251



>gb:AJ619962_1907003 Homo sapiens partial mRNA for mitochondrial
           ATP-Mg/Pi carrier isoform 2, (SLC25A23
           gene).>gb:AJ619988_1907006 Homo sapiens mRNA for small
           calcium-binding mitochondrial carrier 3 (SCAMC-3
           gene).>gb:AY750170_1961662 Homo sapiens mitochondrial
           Ca2+-dependent solute carrier protein 2 (SLC25A23) mRNA,
           complete cds; nuclear gene for mitochondrial product.
          Length = 468

 Score = 38.9 bits (89), Expect = 0.072
 Identities = 22/66 (33%), Positives = 33/66 (50%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           +YPL  V TR Q Q   + G   QLS +  +  +  QEG   LY G+AP+ +    +  +
Sbjct: 394 SYPLALVRTRMQAQASIEGGP--QLSMLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSI 451

Query: 364 YYYFYQ 381
            Y  Y+
Sbjct: 452 SYVVYE 457



>gb:AB049997_1520935 Oryza sativa (japonica cultivar-group) OsUCP1
           gene for uncoupling protein, complete cds.
          Length = 293

 Score = 38.9 bits (89), Expect = 0.072
 Identities = 38/150 (25%), Positives = 63/150 (42%), Gaps = 9/150 (6%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRK-------QLSTIEHMCQVARQEGWDRLYGGLAPSLVG 342
           T PL T   R Q Q+++              L TI  MC +AR+EG   L+ G+ P L  
Sbjct: 23  TIPLDTAKVRLQLQKKAALATGGGGGTTGGMLGTI--MC-IAREEGVAALWNGIIPGLHR 79

Query: 343 TAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIW 522
                G+    Y+       V A   +      G V + + ++ A ++G + +++ NP  
Sbjct: 80  QCVYGGLRIALYE------PVKAFFIRDGDTVAGGVSLFAKILAALMTGVIAIVVANPTD 133

Query: 523 VGVTRMQTHSK--KAKNSPTGAMTAXDAIL 606
           +   R+Q   K    K   +GA+ A   I+
Sbjct: 134 LVKVRLQADGKATTVKRHYSGALNAYATII 163



>gb:AX817352_1475896 Sequence 100 from Patent WO02081517.
          Length = 468

 Score = 38.9 bits (89), Expect = 0.072
 Identities = 22/66 (33%), Positives = 33/66 (50%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           +YPL  V TR Q Q   + G   QLS +  +  +  QEG   LY G+AP+ +    +  +
Sbjct: 394 SYPLALVRTRMQAQASIEGGP--QLSMLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSI 451

Query: 364 YYYFYQ 381
            Y  Y+
Sbjct: 452 SYVVYE 457



>gb:CQ782543_1452030 Sequence 2683 from Patent
           EP1396543.>gb:AK074579_1912557 Homo sapiens cDNA
           FLJ90098 fis, clone HEMBA1005945, weakly similar to
           Oryctolagus cuniculus peroxisomal Ca-dependent solute
           carrier mRNA.
          Length = 208

 Score = 38.9 bits (89), Expect = 0.072
 Identities = 22/66 (33%), Positives = 33/66 (50%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           +YPL  V TR Q Q   + G   QLS +  +  +  QEG   LY G+AP+ +    +  +
Sbjct: 134 SYPLALVRTRMQAQASIEGGP--QLSMLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSI 191

Query: 364 YYYFYQ 381
            Y  Y+
Sbjct: 192 SYVVYE 197



>gb:BC072926_2556850 Xenopus laevis MGC80420 protein, mRNA (cDNA
           clone MGC:80420 IMAGE:5155229), complete cds.
          Length = 291

 Score = 38.5 bits (88), Expect = 0.094
 Identities = 30/123 (24%), Positives = 53/123 (43%), Gaps = 3/123 (2%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQL---STIEHMCQVARQEGWDRLYGGLAPSLVGTAAS 354
           T+P+    TR Q Q +  + K K++     +  + ++ R+EG   LY G+AP+++  A+ 
Sbjct: 23  TFPIDLTKTRLQVQGQPNDAKYKEIRYRGMMHAIVRIWREEGVKALYSGIAPAMLRQASY 82

Query: 355 QGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVT 534
             +    YQ  +        D            ++ +     LSG V+  + NP  V   
Sbjct: 83  GTIKIGTYQSLKRLFVDCPEDET----------LVLNAFCGVLSGVVSSCIANPTDVLKI 132

Query: 535 RMQ 543
           RMQ
Sbjct: 133 RMQ 135



>gb:CR382124_1656951 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 431

 Score = 38.5 bits (88), Expect = 0.094
 Identities = 29/108 (26%), Positives = 43/108 (39%)
 Frame = +1

Query: 283 VARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLS 462
           + R E    LY G+ P ++G   +  +Y+  Y+  R K                    LS
Sbjct: 168 IVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYE--RCKLSYPRYFNNSE--------FLS 217

Query: 463 SLVVAALSGCVNVLLTNPIWVGVTRMQTHSKKAKNSPTGAMTAXDAIL 606
             + A  +G ++  LTNPIWV  TR+   S K     T      DA +
Sbjct: 218 HSMSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFI 265



>gb:AK007934_1154290 Mus musculus 10 day old male pancreas cDNA,
           RIKEN full-length enriched library, clone:1810062G21
           product:MITOCHONDRIAL CARRIER PROTEIN CGI-69 LONG FORM
           homolog [Homo sapiens], full insert
           sequence.>gb:AK078417_1172315 Mus musculus 12 days
           embryo male wolffian duct includes surrounding region
           cDNA, RIKEN full-length enriched library,
           clone:6720453G02 product:MITOCHONDRIAL CARRIER PROTEIN
           CGI-69 LONG FORM homolog [Homo sapiens], full insert
           sequence.
          Length = 359

 Score = 38.5 bits (88), Expect = 0.094
 Identities = 39/151 (25%), Positives = 61/151 (40%)
 Frame = +1

Query: 91  LQIFSCSRVTMSDXXXXXXXXXXXXXXXXXXTYPLQTVNTRQQTQRESKEGKRKQLSTIE 270
           L+ F C +   SD                    PL+ V T+ Q Q  S    R+  S+++
Sbjct: 148 LKAFLCGQSLTSDLYAPMVAGALARMGTVTVVSPLELVRTKLQAQHVSY---RELASSVQ 204

Query: 271 HMCQVARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSV 450
                  Q GW  L+ G  P+ +       +Y++ Y++   K+ ++ L  K       SV
Sbjct: 205 ---AAVTQGGWRSLWLGWGPTALRDVPFSALYWFNYEL--VKSWLSGLRPK----DQTSV 255

Query: 451 GMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
           G+  S V   +SG V   LT P  V  T+ Q
Sbjct: 256 GI--SFVAGGISGMVAATLTLPFDVVKTQRQ 284



>pir|T07793|T07793 uncoupling protein (clone StUCP7), mitochonrial -
           potato>gb:STAJ2586_1722704 Solanum tuberosum gene for
           mitochondrial uncoupling protein.>gb:STUCPMRNA_1723167
           Solanum tuberosum mRNA for mitochondrial uncoupling
           protein.
          Length = 306

 Score = 38.5 bits (88), Expect = 0.094
 Identities = 36/148 (24%), Positives = 61/148 (41%), Gaps = 7/148 (4%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMC----QVARQEGWDRLYGGLAPSLVGTAA 351
           T PL T   R Q Q+++ EG    L     +      +A++EG   L+ G+ P L     
Sbjct: 32  TLPLDTAKVRLQLQKKAVEGDGLALPKYRGLLGTVGTIAKEEGIASLWKGIVPGLHRQCI 91

Query: 352 SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGV 531
             G+    Y+       V  L   +  +GD  V +   ++ A  +G + + + NP  +  
Sbjct: 92  YGGLRIGMYE------PVKNLYVGKDHVGD--VPLSKKILAALTTGALGITIANPTDLVK 143

Query: 532 TRMQTHSKKAKNSP---TGAMTAXDAIL 606
            R+Q   K     P   +GA+ A   I+
Sbjct: 144 VRLQAEGKLPAGVPRRYSGALNAYSTIV 171



>gb:BC088076_2565587 Xenopus tropicalis hypothetical LOC496786, mRNA
           (cDNA clone IMAGE:7024914), partial cds.
          Length = 362

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 38/145 (26%), Positives = 64/145 (44%), Gaps = 13/145 (8%)
 Frame = +1

Query: 190 PLQTVNTRQQTQRESKEGKRKQLSTIE-HMC--QVARQEGWDRLYGGLAPSLVGTAASQG 360
           PL+ + T+ Q+         +QLS +E  +C      Q+GW  L+ G  P+++       
Sbjct: 185 PLELIRTKMQS---------RQLSYMELGVCLRSAVSQDGWLSLWKGWGPTVLRDVPFSA 235

Query: 361 VYYYFYQIFRTKAE--VAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVT 534
           +Y++ Y++ + K     AA++             L S    A+SG V  +LT P  V  T
Sbjct: 236 LYWFNYELVKKKMSNTKAAVESP----------FLVSFSAGAVSGAVAAVLTLPFDVVKT 285

Query: 535 RMQTH--------SKKAKNSPTGAM 585
           + Q          S+K ++S  GAM
Sbjct: 286 QRQIELGNLELGPSRKQRSSTWGAM 310



>gb:AP004622_1842244 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0689E12.>gb:AP005509_1853078 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1003_A09.
          Length = 385

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 30/129 (23%), Positives = 54/129 (41%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +PL+ +  R    RE+        +      ++ + +G   LY GL P+LVG       Y
Sbjct: 217 HPLEVLKDRLTVNREAYPSIGLAFN------KIYQTDGIGGLYAGLCPTLVGMLPYSTCY 270

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
           Y+ Y+  +T        +K+      S+     L++ ALSG     ++ P+ V   R+  
Sbjct: 271 YFMYETIKT--SYCRAHKKK------SLSRPELLIIGALSGLTASTISFPLEVARKRLMV 322

Query: 547 HSKKAKNSP 573
            + + K  P
Sbjct: 323 GTLQGKCPP 331



>gb:AF472619_1803087 Lycopersicon esculentum putative uncoupling
           protein mRNA, complete cds.
          Length = 306

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 36/148 (24%), Positives = 62/148 (41%), Gaps = 7/148 (4%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKR----KQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAA 351
           T PL T   R Q Q+++ EG      K    +  +  +A++EG   L+ G+ P L     
Sbjct: 32  TLPLDTAKVRLQLQKKAVEGDGLGLPKYRGLLGTVGTIAKEEGVASLWKGIVPGLHRQCI 91

Query: 352 SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGV 531
             G+    Y+       V  L   +  +GD  V +   ++ A  +G + + + NP  +  
Sbjct: 92  YGGLRIGMYE------PVKNLYVGKDHVGD--VPLSKKILAALTTGALGITVANPTDLVK 143

Query: 532 TRMQTHSKKAKNSP---TGAMTAXDAIL 606
            R+Q   K     P   +GA+ A   I+
Sbjct: 144 VRLQAEGKLPAGVPRRYSGALNAYSTIV 171



>gb:AY062478_1565134 Arabidopsis thaliana putative protein
           (F5K20.24) mRNA, complete cds.>gb:AY093262_1575216
           Arabidopsis thaliana putative protein (F5K20.24) mRNA,
           complete cds.
          Length = 365

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 26/72 (36%), Positives = 34/72 (47%), Gaps = 2/72 (2%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRES--KEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQ 357
           TYPL  V TR   QR S   +G      TI       R+EG   LY GL  +L+G   S 
Sbjct: 194 TYPLDLVRTRLSAQRNSIYYQGVGHAFRTI------CREEGILGLYKGLGATLLGVGPSL 247

Query: 358 GVYYYFYQIFRT 393
            + +  Y+ F+T
Sbjct: 248 AISFAAYETFKT 259



>gb:AF216971_1251846 Trichomonas vaginalis hydrogenosomal membrane
           protein 31 precursor (HMP31) gene, complete cds.
          Length = 316

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 34/147 (23%), Positives = 59/147 (40%), Gaps = 5/147 (3%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           TYPL  + TR         G      T+       ++EG+  L+ G+ P+++G    +G 
Sbjct: 128 TYPLDVIRTRITVYSGKYTGIFNCAFTM------LKEEGFTSLFAGIVPTVMGVIPYEGA 181

Query: 364 YYYFY----QIFRTKAEVAALDRKRRGIGDGS-VGMLSSLVVAALSGCVNVLLTNPIWVG 528
            +Y Y    Q++ TK            I  G  +   ++ ++ A +G  +   + P  V 
Sbjct: 182 QFYAYGGLKQLYTTK------------IAPGKPISPWANCLIGAAAGMFSQTFSYPFDVI 229

Query: 529 VTRMQTHSKKAKNSPTGAMTAXDAILA 609
             RM    +K K   +G M A   + A
Sbjct: 230 RKRMMLKDEKGKPIYSGMMQAFSTVYA 256



>pir|T43493|T43493 hypothetical protein DKFZp434C119.1 -
           human>gb:HSM801436_1186175 Homo sapiens mRNA; cDNA
           DKFZp434C119 (from clone
           DKFZp434C119).>gb:BC009330_1971917 Homo sapiens CGI-69
           protein, mRNA (cDNA clone MGC:16684 IMAGE:4126268),
           complete cds.
          Length = 351

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 39/151 (25%), Positives = 57/151 (37%)
 Frame = +1

Query: 91  LQIFSCSRVTMSDXXXXXXXXXXXXXXXXXXTYPLQTVNTRQQTQRESKEGKRKQLSTIE 270
           L+ F C R   SD                    PL+ + T+ Q Q  S       + T  
Sbjct: 140 LKAFLCGRALTSDLYAPMVAGALARLGTVTVISPLELMRTKLQAQHVSYRELGACVRT-- 197

Query: 271 HMCQVARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSV 450
                  Q GW  L+ G  P+ +       +Y++ Y++   K+ +  L  K       SV
Sbjct: 198 ----AVAQGGWRSLWLGWGPTALRDVPFSALYWFNYEL--VKSWLNGLRPK----DQTSV 247

Query: 451 GMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
           GM  S V   +SG V  +LT P  V  T+ Q
Sbjct: 248 GM--SFVAGGISGTVAAVLTLPFDVVKTQRQ 276



>sp|Q9BZJ4|CG69_HUMAN Mitochondrial carrier protein CGI-69
           (PRO2163).>gb:AF317711_1896525 Homo sapiens
           mitochondrial carrier protein CGI-69 long form mRNA,
           complete cds.
          Length = 359

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 39/151 (25%), Positives = 57/151 (37%)
 Frame = +1

Query: 91  LQIFSCSRVTMSDXXXXXXXXXXXXXXXXXXTYPLQTVNTRQQTQRESKEGKRKQLSTIE 270
           L+ F C R   SD                    PL+ + T+ Q Q  S       + T  
Sbjct: 148 LKAFLCGRALTSDLYAPMVAGALARLGTVTVISPLELMRTKLQAQHVSYRELGACVRT-- 205

Query: 271 HMCQVARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSV 450
                  Q GW  L+ G  P+ +       +Y++ Y++   K+ +  L  K       SV
Sbjct: 206 ----AVAQGGWRSLWLGWGPTALRDVPFSALYWFNYEL--VKSWLNGLRPK----DQTSV 255

Query: 451 GMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
           GM  S V   +SG V  +LT P  V  T+ Q
Sbjct: 256 GM--SFVAGGISGTVAAVLTLPFDVVKTQRQ 284



>gb:BC046767_2099350 Mus musculus solute carrier family 25
           (mitochondrial deoxynucleotide carrier), member 19, mRNA
           (cDNA clone MGC:57924 IMAGE:5694117), complete cds.
          Length = 318

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 5/73 (6%)
 Frame = +1

Query: 184 TYPLQTVNTRQQT-----QRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTA 348
           TYPL  +  R Q       R +    R     ++   QV ++EG    + GL+PSL+  A
Sbjct: 234 TYPLDLIKKRLQVGGFEHARSAFGQVRSYRGLLDLTQQVLQEEGTRGFFKGLSPSLMKAA 293

Query: 349 ASQGVYYYFYQIF 387
            S G  +++Y++F
Sbjct: 294 LSTGFMFFWYELF 306



>gb:CR382134_1667348 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 390

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 31/122 (25%), Positives = 49/122 (40%), Gaps = 5/122 (4%)
 Frame = +1

Query: 190 PLQTVNTRQQT-----QRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAAS 354
           PL  V TR Q      Q       +K    +     + R+EG   LY GL P  +G   +
Sbjct: 84  PLDVVKTRFQAHGALAQSTGSLASKKYRGFLGAFKTILREEGLRGLYRGLVPITIGYLPT 143

Query: 355 QGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVT 534
             +Y+  Y+  R K       +    +   ++    S + A ++  + V   NPIWV  T
Sbjct: 144 WTIYFTVYE--RAKLFYPEFLKSHFNLETHALNHFCSALTAGMTSSIAV---NPIWVVKT 198

Query: 535 RM 540
           R+
Sbjct: 199 RL 200



 Score = 35.0 bits (79), Expect = 1.0
 Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 1/71 (1%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLST-IEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
           TYP + + TR Q Q  ++    KQ    I  + ++ ++EG    Y G   +L+ T  +  
Sbjct: 311 TYPHEILRTRMQIQSSNRNKSDKQKGKLINSIIKIYQKEGLKGFYAGYGVNLIRTVPASA 370

Query: 361 VYYYFYQIFRT 393
           V    ++ F+T
Sbjct: 371 VTLVSFEYFKT 381



>gb:CR382131_1664134 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 306

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 33/131 (25%), Positives = 59/131 (45%), Gaps = 3/131 (2%)
 Frame = +1

Query: 190 PLQTVNTRQQTQR--ESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           PL  + TR Q +   + + G  K   T   M  + + +G   LY G+ P ++G + +  +
Sbjct: 39  PLDVIKTRLQAEGALDKQRGSLKGGLT-RTMDSIVKHDGVRGLYRGVIPIILGYSPTWMI 97

Query: 364 YYYFYQIFR-TKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           Y+  Y+  +   + V  LD              S  + A  +G  +  +TNPIWV  TR+
Sbjct: 98  YFAVYEKSKYLLSTVPQLD---------PYPFFSHCLSALGAGAASTTITNPIWVVKTRL 148

Query: 541 QTHSKKAKNSP 573
            +   + +N+P
Sbjct: 149 MS---QGRNTP 156



>gb:CR380958_1653156 Candida glabrata strain CBS138 chromosome L
           complete sequence.
          Length = 297

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 34/135 (25%), Positives = 55/135 (40%), Gaps = 2/135 (1%)
 Frame = +1

Query: 190 PLQTVNTRQQTQRESKEGKRKQ--LSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           P + + T     ++S   K +    S   +   + + EG+  LYGG+ P  +  AA+Q V
Sbjct: 127 PFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLPVSMRQAANQAV 186

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
               Y   +   +      K + +  G      + +V A SG V V  T PI    TRMQ
Sbjct: 187 RLGCYNKIKVLVQDYTGAPKDKPLTSG-----LTFIVGAFSGVVTVYATMPIDTVKTRMQ 241

Query: 544 THSKKAKNSPTGAMT 588
           + +    +S     T
Sbjct: 242 SLTASKYSSTLNCFT 256



>gb:AF043695_1235931 Caenorhabditis elegans cosmid C42C1, complete
           sequence.
          Length = 313

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 4/71 (5%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQ----VARQEGWDRLYGGLAPSLVGTAAS 354
           YPL  V  R Q     + G  K  +  + + +    V + E W  L+ GL PS +  AA+
Sbjct: 231 YPLDMVRHRLQMNGFERAGFGKTSNYSQGLFKTIGMVVKNESWYGLFKGLWPSQIKAAAN 290

Query: 355 QGVYYYFYQIF 387
            G  + FY+IF
Sbjct: 291 SGCAFLFYEIF 301



 Score = 35.8 bits (81), Expect = 0.61
 Identities = 33/121 (27%), Positives = 54/121 (44%), Gaps = 4/121 (3%)
 Frame = +1

Query: 190 PLQTVNTRQQTQRESKEGKR--KQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           PL  +  R Q Q E   GK+  K    ++ +  + R+EG    + G  P+  G +A+ G+
Sbjct: 35  PLDVLKIRFQLQEEPIRGKKSGKYKGVMQSIFLITREEGAHAFWKGHIPAQ-GLSATYGL 93

Query: 364 YYY--FYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTR 537
             +  F  + +  A+V   D +       SV   S     ALSGC+ +    P+ V  TR
Sbjct: 94  VQFSSFEWLSQQAAKVIPADNQ-------SVRSTSDFACGALSGCLAMTAAMPLDVIRTR 146

Query: 538 M 540
           +
Sbjct: 147 L 147



>gb:AK017628_1159245 Mus musculus 8 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:5730438N18
           product:hypothetical Mitochondrial energy transfer
           proteins (carrier protein) containing protein, full
           insert sequence.
          Length = 345

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 32/94 (34%), Positives = 45/94 (47%), Gaps = 3/94 (3%)
 Frame = +1

Query: 283 VARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGI---GDGSVG 453
           +  +EG   L+ GL P+LVG A S+ VY+  Y    +KA+      +  GI      +V 
Sbjct: 81  ILEKEGPKSLFRGLGPNLVGVAPSRAVYFACY----SKAK-----EQFNGIFVPNSNNVH 131

Query: 454 MLSSLVVAALSGCVNVLLTNPIWVGVTRMQTHSK 555
           +LS    A  +  V   L NPIW+   RMQ   K
Sbjct: 132 ILS----AGSAAFVTNTLMNPIWMVKKRMQLERK 161



>sp|P40556|YIA6_YEAST Putative mitochondrial carrier
           YIL006W.>pir|S48451|S48451 probable membrane protein
           YIL006w - yeast (Saccharomyces
           cerevisiae)>gb:SC4554_1705293 S.cerevisiae chromosome IX
           lambda clone 4554.
          Length = 373

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 35/138 (25%), Positives = 56/138 (40%), Gaps = 1/138 (0%)
 Frame = +1

Query: 190 PLQTVNTRQQTQR-ESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           PL    TR Q Q  +++         +  +  + R EG   LY GL P ++G   +  +Y
Sbjct: 97  PLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKGLVPIVLGYFPTWMIY 156

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
           +  Y+  +         +   GI       ++    A  +G  +  LTNPIWV  TR+  
Sbjct: 157 FSVYEFSK---------KFFHGIFP-QFDFVAQSCAAITAGAASTTLTNPIWVVKTRLML 206

Query: 547 HSKKAKNSPTGAMTAXDA 600
            S   ++ PT      DA
Sbjct: 207 QSNLGEH-PTHYKGTFDA 223



 Score = 37.0 bits (84), Expect = 0.27
 Identities = 30/123 (24%), Positives = 53/123 (43%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           T P+  V TR   Q    E       T +   ++  QEG+  LY GL PSL+G      +
Sbjct: 194 TNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLG-LFHVAI 252

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
           ++  Y+  + +    +     R     S+ +   ++ +++S  +   +T P  +  TRMQ
Sbjct: 253 HFPIYEDLKVRFHCYS-----RENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQ 307

Query: 544 THS 552
             S
Sbjct: 308 LKS 310



>sp|Q9DAM5|DNC_MOUSE Mitochondrial deoxynucleotide
           carrier.>gb:AK005710_1153186 Mus musculus adult male
           testis cDNA, RIKEN full-length enriched library,
           clone:1700007G02 product:solute carrier family 25
           (mitochondrial deoxynucleotide carrier), member 19, full
           insert sequence.>gb:BC018167_2092563 Mus musculus solute
           carrier family 25 (mitochondrial deoxynucleotide
           carrier), member 19, mRNA (cDNA clone MGC:25742
           IMAGE:3989263), complete cds.
          Length = 318

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 5/73 (6%)
 Frame = +1

Query: 184 TYPLQTVNTRQQT-----QRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTA 348
           TYPL  +  R Q       R +    R     ++   QV ++EG    + GL+PSL+  A
Sbjct: 234 TYPLDLIKKRLQVGGFEHARSAFGQVRSYRGLLDLTQQVLQEEGTRGFFKGLSPSLMKAA 293

Query: 349 ASQGVYYYFYQIF 387
            S G  +++Y++F
Sbjct: 294 LSTGFMFFWYELF 306



>gb:BC055369_2102017 Mus musculus solute carrier family 25
           (mitochondrial carrier, phosphate carrier), member 24,
           mRNA (cDNA clone MGC:60830 IMAGE:30055307), complete
           cds.
          Length = 475

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 24/75 (32%), Positives = 37/75 (49%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           +YPL  V TR Q Q  + EG   QLS +    ++  +EG   LY G+ P+ +    + G+
Sbjct: 401 SYPLALVRTRMQAQA-TVEGA-PQLSMVGLFQRIVSKEGVSGLYRGITPNFMKVLPAVGI 458

Query: 364 YYYFYQIFRTKAEVA 408
            Y  Y+  +    VA
Sbjct: 459 SYVVYENMKQTLGVA 473



>gb:BC022637_2093833 Mus musculus solute carrier family 25
           (mitochondrial carrier, phosphate carrier), member 24,
           mRNA (cDNA clone IMAGE:4208509), partial cds.
          Length = 232

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 24/75 (32%), Positives = 37/75 (49%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           +YPL  V TR Q Q  + EG   QLS +    ++  +EG   LY G+ P+ +    + G+
Sbjct: 158 SYPLALVRTRMQAQA-TVEGA-PQLSMVGLFQRIVSKEGVSGLYRGITPNFMKVLPAVGI 215

Query: 364 YYYFYQIFRTKAEVA 408
            Y  Y+  +    VA
Sbjct: 216 SYVVYENMKQTLGVA 230



>gb:AK032806_1163075 Mus musculus 12 days embryo male wolffian duct
           includes surrounding region cDNA, RIKEN full-length
           enriched library, clone:6720455K09 product:PEROXISOMAL
           CA-DEPENDENT SOLUTE CARRIER homolog [Oryctolagus
           cuniculus], full insert sequence.
          Length = 475

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 24/75 (32%), Positives = 37/75 (49%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           +YPL  V TR Q Q  + EG   QLS +    ++  +EG   LY G+ P+ +    + G+
Sbjct: 401 SYPLALVRTRMQAQA-TVEGA-PQLSMVGLFQRIVSKEGVSGLYRGITPNFMKVLPAVGI 458

Query: 364 YYYFYQIFRTKAEVA 408
            Y  Y+  +    VA
Sbjct: 459 SYVVYENMKQTLGVA 473



>gb:AE014296_1134789 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003482_1212088 Drosophila melanogaster
           chromosome 3L, section 16 of 83 of the complete
           sequence.>gb:AY089436_1297092 Drosophila melanogaster
           AT25476 full insert cDNA.
          Length = 301

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 35/137 (25%), Positives = 60/137 (43%), Gaps = 3/137 (2%)
 Frame = +1

Query: 190 PLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVYY 369
           PL  V TR Q    + E K    S+ + + +V + EG   LY GL+  L+  A       
Sbjct: 32  PLDLVKTRMQISATTGEYK----SSFDCLLKVFKNEGILALYNGLSAGLMRQATYTTARM 87

Query: 370 YFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQTH 549
            FYQ+         +D  R+   +    +L+S+ +  L+G    +  NP  V + RM + 
Sbjct: 88  GFYQM--------EIDAYRKQF-NAPPTVLASMGMGILAGAFGAMFGNPAEVALIRMMSD 138

Query: 550 SK---KAKNSPTGAMTA 591
           ++     + + TG + A
Sbjct: 139 NRLPPAERRNYTGVLNA 155



>sp|P39953|YEA6_YEAST Putative mitochondrial carrier
           YEL006W.>pir|S50453|S50453 hypothetical protein YEL006w
           - yeast (Saccharomyces cerevisiae)>gb:SCE9871_1708256
           Saccharomyces cerevisiae chromosome V cosmids 9871,
           8199, 9867, 9495 and lambda clones 6693 and 5898.
          Length = 335

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 27/96 (28%), Positives = 42/96 (43%)
 Frame = +1

Query: 283 VARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLS 462
           + + EG   LY GL P+++G   +  +Y+  Y   R K  V                 LS
Sbjct: 91  IFKDEGAAGLYKGLQPTVLGYIPTLMIYFSVYDFCR-KYSVDIFPHSP---------FLS 140

Query: 463 SLVVAALSGCVNVLLTNPIWVGVTRMQTHSKKAKNS 570
           +   A  +G ++ + TNPIWV  TR+   +   K S
Sbjct: 141 NASSAITAGAISTVATNPIWVVKTRLMLQTGIGKYS 176



 Score = 32.7 bits (73), Expect = 5.2
 Identities = 18/53 (33%), Positives = 26/53 (49%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVG 342
           T P+  V TR   Q    +       TI+   ++ +QEG   LY GL P+L+G
Sbjct: 156 TNPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALLG 208



>gb:BX649502_2567819 Zebrafish DNA sequence from clone DKEY-204F11
           in linkage group 3 Contains part of the IgH locus
           (annotation by J. Bussmann, Steiner lab), five novel
           genes, a novel gene similar to mouse CARM1
           (coactivator-associated arginine methyltransferase 1), a
           novel gene similar to human and mouse CLPP (ClpP
           caseinolytic protease, ATP-dependent, proteolytic
           subunit homolog (E. coli)), the aldh3d1 gene for
           aldehyde dehydrogenase 3 family, member D1 and a CpG
           island, complete sequence.
          Length = 481

 Score = 37.0 bits (84), Expect = 0.27
 Identities = 22/66 (33%), Positives = 32/66 (48%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           +YPL  + TR Q Q  S EG   QLS +     +   EG   LY G+AP+ +    +  +
Sbjct: 408 SYPLALIRTRMQAQA-SAEGA-PQLSMVGQFKHIVSHEGVPGLYRGIAPNFLKVIPAVSI 465

Query: 364 YYYFYQ 381
            Y  Y+
Sbjct: 466 SYVVYE 471



>gb:AF151827_1886313 Homo sapiens CGI-69 protein mRNA, complete
           cds.>gb:AK026060_1910497 Homo sapiens cDNA: FLJ22407
           fis, clone HRC08407.>gb:BC001398_1967556 Homo sapiens
           CGI-69 protein, mRNA (cDNA clone MGC:1163
           IMAGE:3051436), complete cds.
          Length = 351

 Score = 37.0 bits (84), Expect = 0.27
 Identities = 38/151 (25%), Positives = 55/151 (36%)
 Frame = +1

Query: 91  LQIFSCSRVTMSDXXXXXXXXXXXXXXXXXXTYPLQTVNTRQQTQRESKEGKRKQLSTIE 270
           L+ F C R   SD                    PL+ + T+ Q Q  S       + T  
Sbjct: 140 LKAFLCGRALTSDLYAPMVAGALARLGTVTVISPLELMRTKLQAQHVSYRELGACVRT-- 197

Query: 271 HMCQVARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSV 450
                  Q GW  L+ G  P+ +       +Y++ Y++      V +     R     SV
Sbjct: 198 ----AVAQGGWRSLWLGWGPTALRDVPFSALYWFNYEL------VKSWLNGFRPKDQTSV 247

Query: 451 GMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
           GM  S V   +SG V  +LT P  V  T+ Q
Sbjct: 248 GM--SFVAGGISGTVAAVLTLPFDVVKTQRQ 276



>gb:AP001080_1820751 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0499C11.>gb:AP001383_1821237
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 1, clone:P0453A06.
          Length = 381

 Score = 37.0 bits (84), Expect = 0.27
 Identities = 33/144 (22%), Positives = 57/144 (39%), Gaps = 2/144 (1%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQ--RESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQ 357
           T PL  V    QT   R   E  +K +  +E + ++ ++EG    + G  P ++      
Sbjct: 107 TAPLDRVKLLMQTHSVRVVGESTKKGIGFLEAIAEIGKEEGLKGYWKGNLPQVIRIVPYS 166

Query: 358 GVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTR 537
            V  + Y++++         RK     DG + +   L   A +G  + L+T P+ V   R
Sbjct: 167 AVQLFSYEVYK-----KFFRRK-----DGELTVFGRLAAGACAGMTSTLVTYPLDVLRLR 216

Query: 538 MQTHSKKAKNSPTGAMTAXDAILA 609
           +   S  +  S        D  LA
Sbjct: 217 LAVQSGHSTMSQVAMNMLRDEGLA 240



 Score = 35.0 bits (79), Expect = 1.0
 Identities = 43/149 (28%), Positives = 53/149 (35%), Gaps = 4/149 (2%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVA----RQEGWDRLYGGLAPSLVGTAA 351
           TYPL  +  R   Q           S    M QVA    R EG    YGGL PSL+G A 
Sbjct: 207 TYPLDVLRLRLAVQ-----------SGHSTMSQVAMNMLRDEGLASFYGGLGPSLIGIAP 255

Query: 352 SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGV 531
              V +  + + +         R             +SL  A LS     L+  P+    
Sbjct: 256 YIAVNFCVFDLMKKSVPEKYKSRPE-----------TSLATALLSATFATLMCYPLDTVR 304

Query: 532 TRMQTHSKKAKNSPTGAMTAXDAILAXVE 618
            +MQ      K SP    T  DAI   VE
Sbjct: 305 RQMQ-----MKGSPYN--TVLDAIPGIVE 326



>gb:AE017345_1756867 Cryptococcus neoformans var. neoformans JEC21
           chromosome 5, complete sequence.
          Length = 342

 Score = 37.0 bits (84), Expect = 0.27
 Identities = 30/125 (24%), Positives = 56/125 (44%), Gaps = 3/125 (2%)
 Frame = +1

Query: 190 PLQTVNTRQQTQRESKEGKR---KQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
           P++ +  R Q Q+ S        +  +       + R+EG   LY G++ + +  A +QG
Sbjct: 153 PMEVIKIRLQAQQHSLADPLDIPRYRNAAHAAFTIVREEGIATLYRGVSLTALRQATNQG 212

Query: 361 VYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           V +  YQ F+      A+D + +    G +    ++++  +SG +      PI    TR+
Sbjct: 213 VNFTAYQQFKK----WAMDFQPQHKESGQLPSWQTMILGLVSGAMGPFSNAPIDTIKTRI 268

Query: 541 QTHSK 555
           Q  SK
Sbjct: 269 QKASK 273



>gb:AE016819_1748966 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 344

 Score = 37.0 bits (84), Expect = 0.27
 Identities = 32/122 (26%), Positives = 54/122 (44%), Gaps = 4/122 (3%)
 Frame = +1

Query: 190 PLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQE----GWDRLYGGLAPSLVGTAASQ 357
           PL+ + TR Q+   +++ +R  +  I  + +  R E    G+  L+ GL  +L       
Sbjct: 156 PLELLRTRLQSVPRARDTERT-IYLIGDLLREMRHEVSVMGYRALFKGLEITLWRDVPFS 214

Query: 358 GVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTR 537
            +Y+  Y+  +T+              D  +G   S    ++ G V  LLT+P  VG TR
Sbjct: 215 AIYWGTYEFCKTQFWARHAATHNASNWDHFIG---SFACGSMGGAVAALLTHPFDVGKTR 271

Query: 538 MQ 543
           MQ
Sbjct: 272 MQ 273



>gb:AE016814_1745865 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome I, complete sequence.
          Length = 317

 Score = 37.0 bits (84), Expect = 0.27
 Identities = 36/119 (30%), Positives = 50/119 (42%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           T P+ TV  R+Q Q  S+      L T      VAR+EG   L+ G  P+         +
Sbjct: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFR---TVAREEGVRALWKGNVPASAMYVLYGSL 98

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
            +  Y    T A  A L  +             SL V AL+G V+ LLT P+ +  TR+
Sbjct: 99  QFGTYAWLNTAAASAGLPPQAH-----------SLAVGALAGLVSSLLTYPLDLLRTRL 146



>gb:AX453443_1468804 Sequence 4 from Patent WO0242455.
          Length = 335

 Score = 37.0 bits (84), Expect = 0.27
 Identities = 29/125 (23%), Positives = 50/125 (40%), Gaps = 1/125 (0%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEH-MCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           +PL    TR Q   E  +   K + T    +  + R EG+  LY G +  +        +
Sbjct: 55  FPLDVAKTRMQVDGEQAKKTGKAMPTFRATLTNMIRVEGFKSLYAGFSAMVTRNFIFNSL 114

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
               Y +FR       L +  R   +  + +  +L  +  +GC+   L NP  +   RMQ
Sbjct: 115 RVVLYDVFRRPF----LYQNERN--EEVLKIYMALGCSFTAGCIAQALANPFDIVKVRMQ 168

Query: 544 THSKK 558
           T  ++
Sbjct: 169 TEGRR 173



>gb:AE013599_1131793 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003815_1225863 Drosophila melanogaster
           chromosome 2R, section 35 of 74 of the complete
           sequence.
          Length = 307

 Score = 37.0 bits (84), Expect = 0.27
 Identities = 33/136 (24%), Positives = 51/136 (37%), Gaps = 4/136 (2%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEH----MCQVARQEGWDRLYGGLAPSLVGTAA 351
           T P+  V TR Q Q E    +   +    H    M Q+   +G   L  GLAP+L     
Sbjct: 20  TNPIDVVKTRMQLQGELA-ARGTYVKPYRHLPQAMLQIVLNDGLLALEKGLAPALC---- 74

Query: 352 SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGV 531
               Y +     R      AL+       DGS+     +   AL GC      +P +  +
Sbjct: 75  ----YQFVLNSVRLSVYSNALELGYLQNADGSISFYRGMFFGALGGCTGTYFASPFY--M 128

Query: 532 TRMQTHSKKAKNSPTG 579
            + Q H++  ++   G
Sbjct: 129 IKAQQHAQAVQSIAVG 144



>gb:AE014134_1127737 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003612_1217844 Drosophila melanogaster
           chromosome 2L, section 21 of 83 of the complete
           sequence.>gb:AY089345_1297001 Drosophila melanogaster
           AT16588 full insert cDNA.
          Length = 335

 Score = 37.0 bits (84), Expect = 0.27
 Identities = 29/125 (23%), Positives = 50/125 (40%), Gaps = 1/125 (0%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEH-MCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           +PL    TR Q   E  +   K + T    +  + R EG+  LY G +  +        +
Sbjct: 55  FPLDVAKTRMQVDGEQAKKTGKAMPTFRATLTNMIRVEGFKSLYAGFSAMVTRNFIFNSL 114

Query: 364 YYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
               Y +FR       L +  R   +  + +  +L  +  +GC+   L NP  +   RMQ
Sbjct: 115 RVVLYDVFRRPF----LYQNERN--EEVLKIYMALGCSFTAGCIAQALANPFDIVKVRMQ 168

Query: 544 THSKK 558
           T  ++
Sbjct: 169 TEGRR 173



>gb:AE005172_890450 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC010657_1536982 Genomic sequence
           for Arabidopsis thaliana BAC T5E21 from chromosome I,
           complete sequence.
          Length = 319

 Score = 37.0 bits (84), Expect = 0.27
 Identities = 36/140 (25%), Positives = 59/140 (42%), Gaps = 11/140 (7%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQ----RESKEG------KRKQLSTIEHMCQVARQEGWDR-LYGGLAP 330
           TYPL    T+   Q    R+S  G      ++   S I+ +  +A +EG  R LY G+ P
Sbjct: 125 TYPLDLARTKLAYQVSDTRQSLRGGANGFYRQPTYSGIKEVLAMAYKEGGPRGLYRGIGP 184

Query: 331 SLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLT 510
           +L+G     G+ +Y Y+           + KR    +    +   L   AL+G     +T
Sbjct: 185 TLIGILPYAGLKFYIYE-----------ELKRHVPEEHQNSVRMHLPCGALAGLFGQTIT 233

Query: 511 NPIWVGVTRMQTHSKKAKNS 570
            P+ V   +MQ  + +   S
Sbjct: 234 YPLDVVRRQMQVENLQPMTS 253



>pir|G86383|G86383 probable mitochondrial carrier protein [imported]
           - Arabidopsis thaliana>gb:AE005172_891459 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC079281_1732454 Arabidopsis thaliana
           chromosome 1 BAC F2J7 genomic sequence, complete
           sequence.
          Length = 311

 Score = 37.0 bits (84), Expect = 0.27
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 1/56 (1%)
 Frame = +1

Query: 382 IFRTKAEVAAL-DRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQT 546
           + +T+ +V  L +    G  DG + + S+++ AA +G    + TNP+WV  TR+ T
Sbjct: 40  VIKTRLQVLGLPEAPASGQRDGKLSIGSNMIAAAGAGAATSIATNPLWVVKTRLMT 95



 Score = 33.5 bits (75), Expect = 3.0
 Identities = 38/141 (26%), Positives = 58/141 (41%), Gaps = 1/141 (0%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           T PL  V TR  TQ   + G     S +    ++  +EG   LY G+ PSL G +    V
Sbjct: 83  TNPLWVVKTRLMTQG-IRPGVVPYKSVMSAFSRICHEEGVRGLYSGILPSLAGVS---HV 138

Query: 364 YYYFYQIFRTKAEVAALDRKR-RGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
              F    + K  +A +D      +  G+V + SS+     S     +LT P  V   ++
Sbjct: 139 AIQFPAYEKIKQYMAKMDNTSVENLSPGNVAIASSIAKVIAS-----ILTYPHEVIRAKL 193

Query: 541 QTHSKKAKNSPTGAMTAXDAI 603
           Q    + +N+ T      D I
Sbjct: 194 QEQG-QIRNAETKYSGVIDCI 213



>gb:BC073249_2557101 Xenopus laevis MGC80594 protein, mRNA (cDNA
           clone MGC:80594 IMAGE:5505839), complete cds.
          Length = 356

 Score = 36.6 bits (83), Expect = 0.36
 Identities = 35/143 (24%), Positives = 60/143 (41%), Gaps = 11/143 (7%)
 Frame = +1

Query: 190 PLQTVNTRQQTQRESKEGKRKQLSTIE-HMC--QVARQEGWDRLYGGLAPSLVGTAASQG 360
           PL+ + T+ Q+         +QLS +E  +C      Q+GW  L+ G  P+++       
Sbjct: 179 PLELIRTKMQS---------RQLSYMELGVCLRSAVAQDGWLSLWKGWGPTVLRDVPFSA 229

Query: 361 VYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRM 540
           +Y++ Y++ + K                    L S +  A+SG V  +LT P  V  T+ 
Sbjct: 230 LYWFNYELVKRKMS--------NTNAAAESPFLVSFIAGAVSGAVAAILTLPFDVVKTQR 281

Query: 541 QTH--------SKKAKNSPTGAM 585
           Q          S+  ++S  GAM
Sbjct: 282 QIELGNLELGPSRGQRSSTWGAM 304



>gb:BC083723_2108796 Rattus norvegicus cDNA clone MGC:94620
           IMAGE:7191003, complete cds.
          Length = 302

 Score = 36.6 bits (83), Expect = 0.36
 Identities = 37/148 (25%), Positives = 64/148 (43%), Gaps = 8/148 (5%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEG---KRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAAS 354
           T PL+ V TR Q Q E +      R     +  +  VAR +G   L  GLA  L+     
Sbjct: 22  TNPLEVVKTRLQLQGELQAPGTYPRPYRGFVSSVTAVARADGLWGLQKGLAAGLLYQGLM 81

Query: 355 QGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVT 534
            GV +Y Y +    A  A L ++  G          ++V  A++G +   + +P ++  T
Sbjct: 82  NGVRFYCYSL----ACQAGLTQQPGG----------TVVAGAVAGALGAFVGSPAYLVKT 127

Query: 535 RMQTHSKKA-----KNSPTGAMTAXDAI 603
           ++Q  +  A     ++   G ++A + I
Sbjct: 128 QLQAQTGAAVAVGHQHQHQGVLSALETI 155



>gb:BC072660_2106623 Mus musculus RIKEN cDNA 2310067G05 gene, mRNA
           (cDNA clone MGC:100028 IMAGE:30360302), complete cds.
          Length = 467

 Score = 36.6 bits (83), Expect = 0.36
 Identities = 21/66 (31%), Positives = 33/66 (50%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           +YPL  V TR Q Q   + G   Q+S +  +  +  QEG   LY G+AP+ +    +  +
Sbjct: 393 SYPLALVRTRMQAQASIEGGP--QVSMVGLLRHILSQEGVWGLYRGIAPNFMKVIPAVSI 450

Query: 364 YYYFYQ 381
            Y  Y+
Sbjct: 451 SYVVYE 456



>gb:AE017350_1759100 Cryptococcus neoformans var. neoformans JEC21
           chromosome 10, complete sequence.
          Length = 332

 Score = 36.6 bits (83), Expect = 0.36
 Identities = 28/119 (23%), Positives = 49/119 (41%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +P   +  R Q+Q   +    K    ++   Q + +EGW  LY G++  +VG A      
Sbjct: 8   HPFDLIKVRLQSQPTDQA--LKFTGPLDCFKQTSAKEGWRGLYRGISAPIVGAACENATL 65

Query: 367 YYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQ 543
           +  Y   +    +   D K +   D    M  + + AA +G +   +  PI +   RMQ
Sbjct: 66  FLAYNKCKEGIYLLRPDGKGK---DREFNMKETALAAAGAGSIASFILTPIELIKCRMQ 121



>gb:SPBC12D12_1718900 S.pombe chromosome II cosmid c12D12.
          Length = 426

 Score = 36.6 bits (83), Expect = 0.36
 Identities = 21/65 (32%), Positives = 32/65 (49%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +PL  + TR QTQ  S          I+   +  + EG+  LY GL+P+L+  A S  + 
Sbjct: 354 FPLNVIRTRLQTQGTSAHPATYD-GFIDCFYKTTKNEGFRGLYKGLSPNLLKVAPSVAIS 412

Query: 367 YYFYQ 381
           Y  Y+
Sbjct: 413 YLVYE 417



>gb:CR382121_1654671 Kluyveromyces lactis strain NRRL Y-1140
           chromosome A of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 366

 Score = 36.6 bits (83), Expect = 0.36
 Identities = 29/122 (23%), Positives = 55/122 (45%), Gaps = 4/122 (3%)
 Frame = +1

Query: 190 PLQTVNTRQQTQRESKEGKRKQL---STIEHMCQVARQEGWDRLYGGLAPSLVGTAASQG 360
           PL+ + TR Q+   S++    Q+     ++      R  G+  L+ GL  +L        
Sbjct: 173 PLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGYKVLFKGLEITLWRDVPFSA 232

Query: 361 VYYYFYQIFRTKAEVAALDRKRR-GIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVTR 537
           +Y+  Y+ ++    +   ++  R  +       ++S +  ++SG    LLT+P  VG TR
Sbjct: 233 IYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINSFIGGSVSGSSAALLTHPFDVGKTR 292

Query: 538 MQ 543
           MQ
Sbjct: 293 MQ 294



>pir|T39385|T39385 probable mitochondrial carrier protein - fission
           yeast  (Schizosaccharomyces pombe)
          Length = 500

 Score = 36.6 bits (83), Expect = 0.36
 Identities = 21/65 (32%), Positives = 32/65 (49%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           +PL  + TR QTQ  S          I+   +  + EG+  LY GL+P+L+  A S  + 
Sbjct: 354 FPLNVIRTRLQTQGTSAHPATYD-GFIDCFYKTTKNEGFRGLYKGLSPNLLKVAPSVAIS 412

Query: 367 YYFYQ 381
           Y  Y+
Sbjct: 413 YLVYE 417



>gb:BC045395_2549235 Danio rerio zgc:55596, mRNA (cDNA clone
           MGC:55596 IMAGE:2643533), complete cds.
          Length = 286

 Score = 36.2 bits (82), Expect = 0.47
 Identities = 30/133 (22%), Positives = 55/133 (41%), Gaps = 4/133 (3%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAA---- 351
           T+P+    TR Q Q ++   + +       + ++ R+EG   LY G++P+L+  A+    
Sbjct: 23  TFPIDLTKTRLQVQGQTHCMEVRYRGMFHALLRIGREEGVRALYSGISPALLRQASYGTI 82

Query: 352 SQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGV 531
             G Y    ++F +  E                 M+ ++    +SG ++  L NP  V  
Sbjct: 83  KIGTYNTLKKLFVSHPEEET--------------MVINVFCGVVSGVLSSSLANPTDVLK 128

Query: 532 TRMQTHSKKAKNS 570
            RMQ      + S
Sbjct: 129 IRMQAQGSLLQGS 141



>gb:AK176097_1818085 Arabidopsis thaliana mRNA, complete cds, clone:
           RAFL22-88-G03.>gb:AK176129_1818117 Arabidopsis thaliana
           mRNA, complete cds, clone: RAFL22-93-K20.
          Length = 156

 Score = 36.2 bits (82), Expect = 0.47
 Identities = 28/102 (27%), Positives = 45/102 (44%), Gaps = 11/102 (10%)
 Frame = +1

Query: 295 EGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRT------KAEVAALDRKRRG-----IGD 441
           EG   LY GL PS+   A S  V+Y  Y I ++      +     +D K++G     +  
Sbjct: 5   EGLFSLYKGLVPSIASMALSGAVFYGVYDILKSSFLHTPEGRKRLIDMKQQGQELNALDR 64

Query: 442 GSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQTHSKKAKN 567
             +G + +L+  A++G    + T P    V R Q   +  KN
Sbjct: 65  LELGPIRTLMYGAIAGACTEVATYPF--EVVRRQLQMQMGKN 104



 Score = 34.3 bits (77), Expect = 1.8
 Identities = 22/74 (29%), Positives = 34/74 (45%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           TYP + V  + Q Q     GK K L+ +     +  + G   LY GL PSL+    S  +
Sbjct: 87  TYPFEVVRRQLQMQM----GKNK-LNALAMGFNIIERGGIPALYAGLLPSLLQVLPSASI 141

Query: 364 YYYFYQIFRTKAEV 405
            Y+ Y+  +   +V
Sbjct: 142 SYFVYECMKIVLKV 155



>gb:AY088459_1573478 Arabidopsis thaliana clone 6836 mRNA, complete
           sequence.
          Length = 342

 Score = 36.2 bits (82), Expect = 0.47
 Identities = 28/133 (21%), Positives = 54/133 (40%), Gaps = 5/133 (3%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YP+  + TRQQ           ++S       +AR EG    Y G   SL+GT  ++ +Y
Sbjct: 54  YPIVVLKTRQQVSPT-------RVSCANISLAIARLEGLKGFYKGFGTSLLGTIPARALY 106

Query: 367 YYFYQIFRTKAEVAAL-----DRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGV 531
               +I ++    A +     D     + +G+ G+ S++    +   ++++    +  G 
Sbjct: 107 MTALEITKSSVGQATVRLGLSDTTSLAVANGAAGLTSAVAAQTVWTPIDIVSQRLMVQGD 166

Query: 532 TRMQTHSKKAKNS 570
             +  H     NS
Sbjct: 167 VSLSKHLPGVMNS 179



>gb:AY085360_1570431 Arabidopsis thaliana clone 147875 mRNA,
           complete sequence.>gb:AY125549_1580354 Arabidopsis
           thaliana AT4g27940/T13J8_50 mRNA, complete
           cds.>gb:AF428433_1799363 Arabidopsis thaliana
           AT4g27940/T13J8_50 mRNA, complete cds.
          Length = 413

 Score = 36.2 bits (82), Expect = 0.47
 Identities = 29/119 (24%), Positives = 49/119 (41%), Gaps = 1/119 (0%)
 Frame = +1

Query: 262 TIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGD 441
           T +   ++ RQEG  RL+ G    L       G+Y  FY +FR + E  + ++       
Sbjct: 149 TFDVFTKIIRQEGLGRLWRGTNAGLALAVPMVGIYLPFYDMFRNRLEELSREKA------ 202

Query: 442 GSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQTHSK-KAKNSPTGAMTAXDAILAXV 615
            ++      V  +L+  +   +  PI +  TRMQ   + KA   P G       + + V
Sbjct: 203 PAMTFCVPTVAGSLARSLACTVCYPIDLARTRMQAFKEAKAGVKPPGVFKTLVGVFSEV 261



>gb:AY058876_1564412 Arabidopsis thaliana AT5g26200/T19G15_50 mRNA,
           complete cds.>gb:BT000490_1634768 Arabidopsis thaliana
           mitochondrial carrier-like protein (At5g26200/T19G15_50)
           mRNA, complete cds.
          Length = 342

 Score = 36.2 bits (82), Expect = 0.47
 Identities = 28/133 (21%), Positives = 54/133 (40%), Gaps = 5/133 (3%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YP+  + TRQQ           ++S       +AR EG    Y G   SL+GT  ++ +Y
Sbjct: 54  YPIVVLKTRQQVSPT-------RVSCANISLAIARLEGLKGFYKGFGTSLLGTIPARALY 106

Query: 367 YYFYQIFRTKAEVAAL-----DRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGV 531
               +I ++    A +     D     + +G+ G+ S++    +   ++++    +  G 
Sbjct: 107 MTALEITKSSVGQATVRLGLSDTTSLAVANGAAGLTSAVAAQTVWTPIDIVSQGLMVQGD 166

Query: 532 TRMQTHSKKAKNS 570
             +  H     NS
Sbjct: 167 VSLSKHLPGVMNS 179



>pir|T01839|T01839 hypothetical protein F9D12.12 - Arabidopsis
           thaliana>gb:F9D12_1678661 Arabidopsis thaliana BAC
           F9D12.
          Length = 336

 Score = 36.2 bits (82), Expect = 0.47
 Identities = 28/133 (21%), Positives = 54/133 (40%), Gaps = 5/133 (3%)
 Frame = +1

Query: 187 YPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGVY 366
           YP+  + TRQQ           ++S       +AR EG    Y G   SL+GT  ++ +Y
Sbjct: 48  YPIVVLKTRQQVSPT-------RVSCANISLAIARLEGLKGFYKGFGTSLLGTIPARALY 100

Query: 367 YYFYQIFRTKAEVAAL-----DRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGV 531
               +I ++    A +     D     + +G+ G+ S++    +   ++++    +  G 
Sbjct: 101 MTALEITKSSVGQATVRLGLSDTTSLAVANGAAGLTSAVAAQTVWTPIDIVSQGLMVQGD 160

Query: 532 TRMQTHSKKAKNS 570
             +  H     NS
Sbjct: 161 VSLSKHLPGVMNS 173



>pir|B96811|B96811 hypothetical protein T11I11.12 [imported] -
           Arabidopsis thaliana>gb:AE005173_895341 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC012680_1537807 Arabidopsis thaliana
           chromosome 1 BAC T11I11 genomic sequence, complete
           sequence.
          Length = 418

 Score = 36.2 bits (82), Expect = 0.47
 Identities = 28/102 (27%), Positives = 45/102 (44%), Gaps = 11/102 (10%)
 Frame = +1

Query: 295 EGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRT------KAEVAALDRKRRG-----IGD 441
           EG   LY GL PS+   A S  V+Y  Y I ++      +     +D K++G     +  
Sbjct: 267 EGLFSLYKGLVPSIASMALSGAVFYGVYDILKSSFLHTPEGRKRLIDMKQQGQELNALDR 326

Query: 442 GSVGMLSSLVVAALSGCVNVLLTNPIWVGVTRMQTHSKKAKN 567
             +G + +L+  A++G    + T P    V R Q   +  KN
Sbjct: 327 LELGPIRTLMYGAIAGACTEVATYPF--EVVRRQLQMQMGKN 366



 Score = 34.3 bits (77), Expect = 1.8
 Identities = 22/74 (29%), Positives = 34/74 (45%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEGKRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAASQGV 363
           TYP + V  + Q Q     GK K L+ +     +  + G   LY GL PSL+    S  +
Sbjct: 349 TYPFEVVRRQLQMQM----GKNK-LNALAMGFNIIERGGIPALYAGLLPSLLQVLPSASI 403

Query: 364 YYYFYQIFRTKAEV 405
            Y+ Y+  +   +V
Sbjct: 404 SYFVYECMKIVLKV 417



>pir|T37992|T37992 probable tricarboxylate transport protein -
           fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC19G12_1716930 S.pombe chromosome I cosmid
           c19G12.
          Length = 291

 Score = 36.2 bits (82), Expect = 0.47
 Identities = 27/98 (27%), Positives = 47/98 (47%), Gaps = 2/98 (2%)
 Frame = +1

Query: 283 VARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLS 462
           +  + G   LY GLA ++   AA+ GV +  Y   +   +        R   D  +  ++
Sbjct: 153 IVHENGIRGLYRGLAATVARQAANSGVRFTAYNSIKQSLQ-------SRLPPDEKLSTVT 205

Query: 463 SLVVAALSGCVNVLLTNPIWVGVTRMQ--THSKKAKNS 570
           + +V +++G + V  T PI    +RMQ  + SK+ KNS
Sbjct: 206 TFLVGSVAGIITVYCTQPIDTVKSRMQSLSASKEYKNS 243



>sp|Q03829|YM39_YEAST Putative mitochondrial carrier
           YMR166C.>pir|S54524|S54524 hypothetical protein YMR166c
           - yeast (Saccharomyces cerevisiae)>gb:AY558121_1614348
           Saccharomyces cerevisiae clone FLH110908.01X YMR166C
           gene, complete cds.>gb:SC8520X_1705674 S.cerevisiae
           chromosome XIII cosmid 8520.
          Length = 368

 Score = 36.2 bits (82), Expect = 0.47
 Identities = 23/102 (22%), Positives = 52/102 (50%)
 Frame = +1

Query: 283 VARQEGWDRLYGGLAPSLVGTAASQGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLS 462
           V ++EG+  L+ G   +L        + + FY+ FR      A   +++   DG + + +
Sbjct: 203 VIKEEGFRSLFFGYKATLARDLPFSALQFAFYEKFRQ----LAFKIEQKDGRDGELSIPN 258

Query: 463 SLVVAALSGCVNVLLTNPIWVGVTRMQTHSKKAKNSPTGAMT 588
            ++  A +G +  ++T P+ V  TR+QT    ++++ + ++T
Sbjct: 259 EILTGACAGGLAGIITTPMDVVKTRVQTQQPPSQSNKSYSVT 300



>gb:AL450998_1928075 Human DNA sequence from clone RP11-169K16 on
           chromosome 1 Contains the 3' end of the gene for a novel
           RUN and PH domain-containing protein (KIAA0842), the 5'
           end of a novel gene, two genes for a novel proteins, a
           novel gene, the gene for filamin-binding LIM protein-1
           (FBLP-1), a ribosomal protein L12 (RPL12) pseudogene, a
           ubiquinol-cytochrome c reductase hinge protein (UQCRH)
           pseudogene, a ribosomal protein S16 (RPS16) pseudogene,
           a novel gene (FLJ42024), the 5' end of the gene for
           SMART/HDAC1 associated repressor protein (SHARP) and
           three CpG islands, complete
           sequence.>gb:BC027998_1979057 Homo sapiens hypothetical
           protein LOC284723, mRNA (cDNA clone MGC:40185
           IMAGE:5189944), complete cds.
          Length = 304

 Score = 35.8 bits (81), Expect = 0.61
 Identities = 35/129 (27%), Positives = 56/129 (43%), Gaps = 3/129 (2%)
 Frame = +1

Query: 184 TYPLQTVNTRQQTQRESKEG---KRKQLSTIEHMCQVARQEGWDRLYGGLAPSLVGTAAS 354
           T PL+ V TR Q Q E +      R     I  +  VAR +G   L  GLA  L+     
Sbjct: 24  TNPLEVVKTRLQLQGELQARGTYPRPYHGFIASVAAVARADGLWGLQKGLAAGLLYQGLM 83

Query: 355 QGVYYYFYQIFRTKAEVAALDRKRRGIGDGSVGMLSSLVVAALSGCVNVLLTNPIWVGVT 534
            GV +Y Y +    A  A L ++  G          ++V  A++G +   + +P ++  T
Sbjct: 84  NGVRFYCYSL----ACQAGLTQQPGG----------TVVAGAVAGALGAFVGSPAYLIKT 129

Query: 535 RMQTHSKKA 561
           ++Q  +  A
Sbjct: 130 QLQAQTVAA 138


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 608,973,664
Number of Sequences: 1806583
Number of extensions: 11634451
Number of successful extensions: 50419
Number of sequences better than 10.0: 382
Number of HSP's better than 10.0 without gapping: 41795
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 49763
length of database: 581,917,975
effective HSP length: 119
effective length of database: 366,934,598
effective search space used: 33024113820
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)