BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig27
         (1187 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:CRO279066_1673473 Catharanthus roseus mRNA for hypothetical p...   142   3e-41   
pir|E84677|E84677 hypothetical protein At2g27830 [imported] - Ar...   128   2e-28   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00286_1191035 Oryza sativa (japonica cultivar-group) chro...   101   2e-21   
gb:AP004777_1844919 Oryza sativa (japonica cultivar-group) genom...    97   5e-21   
gb:AP004855_1846038 Oryza sativa (japonica cultivar-group) genom...    69   2e-10   
pir|T04571|T04571 hypothetical protein T12H17.150 - Arabidopsis ...    57   7e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AP004789_1845094 Oryza sativa (japonica cultivar-group) genom...    56   2e-06   
gb:AF428307_1799237 Arabidopsis thaliana At1g70780/F5A18_4 mRNA,...    52   2e-05   
pir|D96732|D96732 hypothetical protein F15H11.3 [imported] - Ara...    52   2e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AB049714_1520903 Pisum sativum ssa-3 mRNA for putative senesc...    47   6e-04   
gb:BT002946_1636533 Arabidopsis thaliana clone RAFL14-89-O03 (R2...    45   0.003   
gb:AB018107_1513720 Arabidopsis thaliana genomic DNA, chromosome...    42   0.019   
gb:AY085404_1570473 Arabidopsis thaliana clone 150222 mRNA, comp...    41   0.041   
gb:AB018107_1513719 Arabidopsis thaliana genomic DNA, chromosome...    41   0.041   
pir|G86365|G86365 T26J12.8 protein - Arabidopsis thaliana>gb:AE0...    39   0.16    Arabidopsis thaliana [mouse-ear cress]
gb:AP005842_1858912 Oryza sativa (japonica cultivar-group) genom...    34   5.1     


>gb:CRO279066_1673473 Catharanthus roseus mRNA for hypothetical
           protein (ORF1), clone c12.
          Length = 196

 Score =  142 bits (358), Expect(2) = 3e-41
 Identities = 76/126 (60%), Positives = 87/126 (69%)
 Frame = +2

Query: 482 PPKLTKLLLNVTIQRSTGALQVLIPPDSTVDDLIAAALRQYVKEGRRPVLPSTNAADYGL 661
           PPKLTKLLLNVTI  S G +QVL  P++TV+DLI+AALRQY KEGRRP+L ST+AA + L
Sbjct: 73  PPKLTKLLLNVTIMGSVGPIQVLTSPEATVEDLISAALRQYSKEGRRPILKSTDAAGFDL 132

Query: 662 HYSQFSLESLDRTEKLAALGSRNFFLCPEMAETAAVGGVTTXXXXXXXXNEVDKPTKSIG 841
           HYSQFSLESL R EKL +LGSRNFFLCP+        G            E DK TK+ G
Sbjct: 133 HYSQFSLESLHREEKLISLGSRNFFLCPKRC------GAEPTASSSGCSKEADKATKT-G 185

Query: 842 LSWFKF 859
             W KF
Sbjct: 186 TPWLKF 191



 Score = 50.1 bits (118), Expect(2) = 3e-41
 Identities = 29/58 (50%), Positives = 33/58 (56%), Gaps = 5/58 (8%)
 Frame = +1

Query: 271 MPSPKTQ---RRGGTEEKNRKGRLAEKXXX--XXXXXXXXXXXVLLQRPRTVPDLLAG 429
           MPSPK Q   + G   EKNRKGRLAEK                +LL RPRTVP+LL+G
Sbjct: 1   MPSPKNQNHRKSGSVGEKNRKGRLAEKALSFHAGTSVGNAAETMLLNRPRTVPNLLSG 58



>pir|E84677|E84677 hypothetical protein At2g27830 [imported] -
           Arabidopsis thaliana>gb:AC005824_1533028 Arabidopsis
           thaliana chromosome 2 clone F15K20 map B68, complete
           sequence.>gb:AY065133_1566287 Arabidopsis thaliana
           unknown protein (At2g27830; F15K20.7) mRNA, complete
           cds.>gb:AY087289_1572322 Arabidopsis thaliana clone
           33700 mRNA, complete sequence.>gb:AY114584_1578626
           Arabidopsis thaliana unknown protein (At2g27830) mRNA,
           complete cds.
          Length = 190

 Score =  128 bits (322), Expect = 2e-28
 Identities = 70/129 (54%), Positives = 86/129 (66%)
 Frame = +2

Query: 473 LQFPPKLTKLLLNVTIQRSTGALQVLIPPDSTVDDLIAAALRQYVKEGRRPVLPSTNAAD 652
           +  PP+LTKLLLNVT+Q S GA+Q++I P+STV DLI AA+RQYVKE RRP LP +  + 
Sbjct: 63  VSLPPRLTKLLLNVTVQGSLGAVQIIISPESTVSDLIDAAVRQYVKEARRPFLPESEPSR 122

Query: 653 YGLHYSQFSLESLDRTEKLAALGSRNFFLCPEMAETAAVGGVTTXXXXXXXXNEVDKPTK 832
           + LHYSQFSLES+ R EKL +LGSRNFFLC    ET   G +           E +K  K
Sbjct: 123 FDLHYSQFSLESIVRDEKLISLGSRNFFLCGR-KETG--GFIGCGLSSESCSKEAEKVAK 179

Query: 833 SIGLSWFKF 859
           + G  W KF
Sbjct: 180 T-GFHWLKF 187



>gb:OSJN00286_1191035 Oryza sativa (japonica cultivar-group)
           chromosome 4 clone OSJNBa0042I15, *** SEQUENCING IN
           PROGRESS ***, 11 ordered pieces.
          Length = 240

 Score =  101 bits (251), Expect(2) = 2e-21
 Identities = 50/85 (58%), Positives = 65/85 (76%)
 Frame = +2

Query: 494 TKLLLNVTIQRSTGALQVLIPPDSTVDDLIAAALRQYVKEGRRPVLPSTNAADYGLHYSQ 673
           +K+L++V +QRS   L V+     +V DL+AAA+  YVKEGRRP LPS + +D+GLHYSQ
Sbjct: 109 SKVLVSVAVQRSLWPLHVMASAAWSVADLVAAAVALYVKEGRRPPLPSADPSDFGLHYSQ 168

Query: 674 FSLESLDRTEKLAALGSRNFFLCPE 748
           FSLESLD  EK+  LGSR+FFLCP+
Sbjct: 169 FSLESLDPREKVMELGSRSFFLCPK 193



 Score = 25.0 bits (53), Expect(2) = 2e-21
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 394 QRPRTVPDLLAG 429
           QRP+T PDLLAG
Sbjct: 65  QRPKTQPDLLAG 76



>gb:AP004777_1844919 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0458B05.>gb:AP004879_1846481 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0475F05.
          Length = 200

 Score = 97.4 bits (241), Expect(2) = 5e-21
 Identities = 50/101 (49%), Positives = 73/101 (72%)
 Frame = +2

Query: 482 PPKLTKLLLNVTIQRSTGALQVLIPPDSTVDDLIAAALRQYVKEGRRPVLPSTNAADYGL 661
           P   +++LL V +++S   L V+   + +V DL+AAA+  Y++EGRRP+LPS + A +GL
Sbjct: 66  PAGPSRVLLTVAVRQSMWPLHVMARAEWSVADLVAAAVELYIREGRRPLLPSADPAAFGL 125

Query: 662 HYSQFSLESLDRTEKLAALGSRNFFLCPEMAETAAVGGVTT 784
           H+SQFSL+SL+  EKL  LGSR+FFLCP+ A  AAV  V++
Sbjct: 126 HFSQFSLQSLNPEEKLMELGSRSFFLCPK-AAAAAVAAVSS 165



 Score = 27.3 bits (59), Expect(2) = 5e-21
 Identities = 12/15 (80%), Positives = 13/15 (86%)
 Frame = +1

Query: 385 VLLQRPRTVPDLLAG 429
           +L QRPRT PDLLAG
Sbjct: 36  LLKQRPRTQPDLLAG 50



>gb:AP004855_1846038 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1538_H05.
          Length = 278

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 31/86 (36%), Positives = 57/86 (66%)
 Frame = +2

Query: 482 PPKLTKLLLNVTIQRSTGALQVLIPPDSTVDDLIAAALRQYVKEGRRPVLPSTNAADYGL 661
           P + +K++++VT++ S G ++ ++   ++V + IAA + +Y KEGR P L    A  + L
Sbjct: 124 PREESKVVVSVTVEGSVGPVKAMVRLGASVGEAIAAVVERYAKEGRSPRLDPAAAEAFQL 183

Query: 662 HYSQFSLESLDRTEKLAALGSRNFFL 739
           H+S F L+SL++ +K+  +G RNF+L
Sbjct: 184 HHSHFCLQSLNKNDKIGDVGGRNFYL 209



>pir|T04571|T04571 hypothetical protein T12H17.150 - Arabidopsis
           thaliana>gb:ATCHRIV57_1546113 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           57.>gb:ATT12H17_1554361 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T12H17 (ESSAII project).
          Length = 889

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 28/88 (31%), Positives = 53/88 (60%)
 Frame = +2

Query: 497 KLLLNVTIQRSTGALQVLIPPDSTVDDLIAAALRQYVKEGRRPVLPSTNAADYGLHYSQF 676
           K++++V ++ S G ++ ++     V++ I   + +Y KEGR P L   +A  + LH S F
Sbjct: 123 KVIISVAVEGSPGPVRAMVKLSCNVEETIKIVVDKYCKEGRTPKLDRDSA--FELHQSHF 180

Query: 677 SLESLDRTEKLAALGSRNFFLCPEMAET 760
           S++ L++ E +  LGSR+F++  +  ET
Sbjct: 181 SIQCLEKREIIGELGSRSFYMRKKAPET 208



>gb:AP004789_1845094 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0476C12.
          Length = 152

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 37/94 (39%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = +2

Query: 497 KLLLNVTIQRSTGALQVLIPPDSTVDDLIAAALRQYVKEGRRPVLPSTNAADYGLHYSQF 676
           ++L+ VT+  S G L+ LI    TV  LI AALR Y +EGR P+L   +AA + L+ +  
Sbjct: 24  RMLVTVTVLGSAGPLRFLIDEGETVAGLIRAALRCYAREGRMPLL-GADAAGFLLYTANG 82

Query: 677 SLESLDRTEKLAALGSRNFFLCPEMA-ETAAVGG 775
             ++L   EK+   G R+F L  + A +T A GG
Sbjct: 83  GSDALSADEKIYFNGCRSFLLWQKAARDTMAKGG 116



>gb:AF428307_1799237 Arabidopsis thaliana At1g70780/F5A18_4 mRNA,
           complete cds.
          Length = 149

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 30/90 (33%), Positives = 51/90 (56%)
 Frame = +2

Query: 488 KLTKLLLNVTIQRSTGALQVLIPPDSTVDDLIAAALRQYVKEGRRPVLPSTNAADYGLHY 667
           K  ++L++VT+  S G ++ +   D  V  +I  AL+ Y +EGR P+L S +  D+ L+ 
Sbjct: 14  KGNRILISVTVLGSAGPIRFVAYEDDLVASVIDTALKGYAREGRLPLLGS-DFNDFLLYC 72

Query: 668 SQFSLESLDRTEKLAALGSRNFFLCPEMAE 757
                E+L   + + +LG+RNF LC +  E
Sbjct: 73  PMVGPEALSTWDAIGSLGARNFMLCRKPEE 102



>pir|D96732|D96732 hypothetical protein F15H11.3 [imported] -
           Arabidopsis thaliana>gb:AE005173_894662 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC008148_1536546 Arabidopsis thaliana
           chromosome I BAC F15H11 genomic sequence, complete
           sequence.>gb:AC011663_1537310 Arabidopsis thaliana
           chromosome 1 BAC F5A18 genomic sequence, complete
           sequence.>gb:AY049248_1561890 Arabidopsis thaliana
           At1g70780/F5A18_4 mRNA, complete
           cds.>gb:AY149965_1584914 Arabidopsis thaliana
           At1g70780/F5A18_4 mRNA, complete
           cds.>gb:AF325047_1786501 Arabidopsis thaliana At1g70780
           (At1g70780/F5A18_4) mRNA, complete cds.
          Length = 140

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 30/90 (33%), Positives = 51/90 (56%)
 Frame = +2

Query: 488 KLTKLLLNVTIQRSTGALQVLIPPDSTVDDLIAAALRQYVKEGRRPVLPSTNAADYGLHY 667
           K  ++L++VT+  S G ++ +   D  V  +I  AL+ Y +EGR P+L S +  D+ L+ 
Sbjct: 14  KGNRILISVTVLGSAGPIRFVAYEDDLVASVIDTALKGYAREGRLPLLGS-DFNDFLLYC 72

Query: 668 SQFSLESLDRTEKLAALGSRNFFLCPEMAE 757
                E+L   + + +LG+RNF LC +  E
Sbjct: 73  PMVGPEALSTWDAIGSLGARNFMLCRKPEE 102



>gb:AB049714_1520903 Pisum sativum ssa-3 mRNA for putative
           senescence-associated protein, partial cds.
          Length = 221

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 32/126 (25%), Positives = 59/126 (46%), Gaps = 3/126 (2%)
 Frame = +2

Query: 497 KLLLNVTIQRSTGALQVLIPPDSTVDDLIAAALRQYVKEGRRPVLPSTNAADYGLHYSQF 676
           +LL+++ +  S G ++ ++  +  V  +I  AL+ Y +EGR PVL   +   + L+    
Sbjct: 53  RLLISINVFGSAGPIRFVVKEEELVAAVIDTALKSYAREGRLPVL-GGDIRTFALYCPLV 111

Query: 677 SLESLDRTEKLAALGSRNFFLCPEMAETA---AVGGVTTXXXXXXXXNEVDKPTKSIGLS 847
             ++L   + + ++G+RNF LC +   T    A  G  T          V +     G +
Sbjct: 112 GSDALSPWDTIGSVGARNFMLCKKPQATTGDEAANGTGT--------EVVSRSRGGSGKA 163

Query: 848 WFKFTL 865
           WF  +L
Sbjct: 164 WFHQSL 169



>gb:BT002946_1636533 Arabidopsis thaliana clone RAFL14-89-O03
           (R20284) unknown protein (At1g23150) mRNA, complete
           cds.>gb:BT004432_1637504 Arabidopsis thaliana clone
           U20284 unknown protein (At1g23150) mRNA, complete cds.
          Length = 141

 Score = 45.1 bits (105), Expect = 0.003
 Identities = 28/94 (29%), Positives = 47/94 (50%)
 Frame = +2

Query: 488 KLTKLLLNVTIQRSTGALQVLIPPDSTVDDLIAAALRQYVKEGRRPVLPSTNAADYGLHY 667
           K  ++L++VT   S G ++ +      V  +I  AL+ Y +EGR P+L S +  D+  + 
Sbjct: 12  KGNRILISVTFLGSAGPIRFVANEGDLVASVIDTALKCYAREGRLPILGS-DFNDFVFYC 70

Query: 668 SQFSLESLDRTEKLAALGSRNFFLCPEMAETAAV 769
                 +L   E + ++G RNF LC +  E   V
Sbjct: 71  PMVGPGALSPWEAIGSVGVRNFMLCKKKPEEKKV 104



>gb:AB018107_1513720 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K12B20.
          Length = 109

 Score = 42.4 bits (98), Expect = 0.019
 Identities = 24/74 (32%), Positives = 38/74 (51%)
 Frame = +2

Query: 497 KLLLNVTIQRSTGALQVLIPPDSTVDDLIAAALRQYVKEGRRPVLPSTNAADYGLHYSQF 676
           KLL++V +  S G ++ L   D  V  +I   L+ Y ++GR PVL        G+ Y+Q 
Sbjct: 7   KLLVSVNVLGSVGPIRFLANEDDEVSSVINTTLKAYARQGRIPVL--------GIEYTQE 58

Query: 677 SLESLDRTEKLAAL 718
            + S+D T  L  +
Sbjct: 59  KIGSMDVTNSLLCM 72



>gb:AY085404_1570473 Arabidopsis thaliana clone 150222 mRNA,
           complete sequence.
          Length = 182

 Score = 41.2 bits (95), Expect = 0.041
 Identities = 24/85 (28%), Positives = 41/85 (48%)
 Frame = +2

Query: 488 KLTKLLLNVTIQRSTGALQVLIPPDSTVDDLIAAALRQYVKEGRRPVLPSTNAADYGLHY 667
           K  KLL++V +  S G ++ L   D  V   I   L+ Y ++GR PVL   +  ++  + 
Sbjct: 14  KNKKLLVSVNVLGSVGPIRFLANEDDEVSSAINTTLKAYARQGRIPVL-GFDVDNFIFYS 72

Query: 668 SQFSLESLDRTEKLAALGSRNFFLC 742
                 +L   EK+ ++   NF +C
Sbjct: 73  INAGFNTLHPQEKIGSMDVTNFLMC 97



>gb:AB018107_1513719 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K12B20.
          Length = 182

 Score = 41.2 bits (95), Expect = 0.041
 Identities = 24/85 (28%), Positives = 41/85 (48%)
 Frame = +2

Query: 488 KLTKLLLNVTIQRSTGALQVLIPPDSTVDDLIAAALRQYVKEGRRPVLPSTNAADYGLHY 667
           K  KLL++V +  S G ++ L   D  V   I   L+ Y ++GR PVL   +  ++  + 
Sbjct: 14  KNKKLLVSVNVLGSVGPIRFLANEDDEVSSAINTTLKAYARQGRIPVL-GFDVDNFIFYS 72

Query: 668 SQFSLESLDRTEKLAALGSRNFFLC 742
                 +L   EK+ ++   NF +C
Sbjct: 73  INAGFNTLHPQEKIGSMDVTNFLMC 97



>pir|G86365|G86365 T26J12.8 protein - Arabidopsis
           thaliana>gb:AE005172_891264 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC002311_1530220 Arabidopsis thaliana
           chromosome I BAC T26J12 genomic sequence, complete
           sequence.
          Length = 151

 Score = 39.3 bits (90), Expect = 0.16
 Identities = 29/103 (28%), Positives = 46/103 (44%), Gaps = 9/103 (8%)
 Frame = +2

Query: 488 KLTKLLLNVTIQRSTGALQVLIPPDSTVDDLIAAALRQYVKEGRRPVLPS---------T 640
           K  ++L++VT   S G ++ +      V  +I  AL+ Y +EGR P+L S          
Sbjct: 12  KGNRILISVTFLGSAGPIRFVANEGDLVASVIDTALKCYAREGRLPILGSDFNDFVFYCP 71

Query: 641 NAADYGLHYSQFSLESLDRTEKLAALGSRNFFLCPEMAETAAV 769
                G   +  S  S+   E + ++G RNF LC +  E   V
Sbjct: 72  MVGPGGNLSNTQSFSSVFPWEAIGSVGVRNFMLCKKKPEEKKV 114



>gb:AP005842_1858912 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBb0003H22.
          Length = 263

 Score = 34.3 bits (77), Expect = 5.1
 Identities = 16/41 (39%), Positives = 21/41 (51%)
 Frame = -2

Query: 649 GGVGGGEHRPPSFLHVLAERGGDEVVHRGIRRNQHLQRAGA 527
           GGVGG + +P     V    GGD+V H  +    H+QR  A
Sbjct: 116 GGVGGQQQQPAPLPEVELHGGGDQVSHATLEARHHVQRPHA 156


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 995,658,313
Number of Sequences: 1806583
Number of extensions: 18559906
Number of successful extensions: 61339
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 58971
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 61135
length of database: 581,917,975
effective HSP length: 127
effective length of database: 352,481,934
effective search space used: 94465158312
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)