BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig25
         (1249 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF492468_1804917 Nicotiana langsdorffii x Nicotiana sanderae ...   270   6e-71   
gb:AY122907_1579785 Arabidopsis thaliana putative storage protei...   240   5e-62   
gb:AP004693_1843528 Oryza sativa (japonica cultivar-group) genom...   229   7e-59   
pir|B84682|B84682 probable carbonic anhydrase [imported] - Arabi...   228   2e-58   Arabidopsis thaliana [mouse-ear cress]
pir|E86215|E86215 protein T6D22.16 [imported] - Arabidopsis thal...   220   5e-56   Arabidopsis thaliana [mouse-ear cress]
gb:AP004693_1843532 Oryza sativa (japonica cultivar-group) genom...   217   5e-55   
gb:AP005537_1853718 Oryza sativa (japonica cultivar-group) genom...   210   4e-53   
gb:AP005301_1850193 Oryza sativa (japonica cultivar-group) genom...   206   1e-51   
gb:AF245019_1780453 Dioscorea alata dioscorin A (dioA-2) mRNA, c...   199   1e-49   
pir|S57766|S57766 dioscorin class A precursor - Dioscorea cayene...   198   2e-49   Dioscorea cayennensis [Lagos yam]
gb:AF242551_1780190 Dioscorea alata dioscorin A (DIOA-1) mRNA, c...   196   1e-48   
gb:AP005537_1853722 Oryza sativa (japonica cultivar-group) genom...   194   2e-48   
gb:AB178473_1528927 Dioscorea batatas DB3S mRNA for tuber storag...   194   4e-48   
pir|S57767|S57767 dioscorin class B - Dioscorea cayenensis (frag...   192   1e-47   Dioscorea cayennensis [Lagos yam]
gb:AB178472_1528926 Dioscorea batatas DB3L mRNA for tuber storag...   192   2e-47   
gb:AF243526_1780254 Dioscorea alata dioscorin B (dioB-1) mRNA, c...   187   4e-46   
gb:AP005110_1848013 Oryza sativa (japonica cultivar-group) genom...   184   2e-45   
pir|T49025|T49025 carbonate dehydratase (EC 4.2.1.1) [similarity...   177   5e-43   Arabidopsis thaliana [mouse-ear cress]
pir|D86215|D86215 protein T6D22.14 [imported] - Arabidopsis thal...   175   2e-42   Arabidopsis thaliana [mouse-ear cress]
gb:ATF21E1_1549583 Arabidopsis thaliana DNA chromosome 5, BAC cl...   173   8e-42   
gb:AB009049_1510599 Arabidopsis thaliana genomic DNA, chromosome...   164   3e-39   
pir|T10642|T10642 carbonic anhydrase homolog T13K14.160 - Arabid...   164   3e-39   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00141_1695582 Oryza sativa genomic DNA, chromosome 4, BAC...   163   6e-39   
gb:AE006227_216793 Pasteurella multocida subsp. multocida str. P...   148   2e-34   
gb:BA000032_710042 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...   140   7e-32   
sp|Q50940|CAH_NEIGO|CAH_NEIGO Carbonic anhydrase precursor (EC 4.2.1.1) (C...   140   7e-32   Neisseria gonorrhoeae
gb:AP004693_1843529 Oryza sativa (japonica cultivar-group) genom...   138   2e-31   
gb:BA000038_724425 Vibrio vulnificus YJ016 DNA, chromosome II, c...   135   2e-30   
gb:AE016813_339174 Vibrio vulnificus CMCP6 chromosome II section...   134   3e-30   
gb:AE012520_283210 Xanthomonas campestris pv. campestris str. AT...   134   4e-30   
gb:CR378673_96638 Photobacterium profundum SS9; segment 11/12.        134   4e-30   
pir|F82479|F82479 carbonic anhydrase VCA0274 [imported] - Vibrio...   134   4e-30   Vibrio cholerae
pir|T10641|T10641 carbonic anhydrase homolog T13K14.150 - Arabid...   134   5e-30   Arabidopsis thaliana [mouse-ear cress]
gb:BA000032_708761 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...   133   7e-30   
gb:AY054466_1563121 Arabidopsis thaliana carbonic anhydrase (CAH...   133   9e-30   
gb:NGU11547_152695 Neisseria gonorrhoeae MS11 UvrB (uvrB) gene, ...   128   2e-28   
gb:CP000023_875509 Streptococcus thermophilus LMG 18311, complet...   128   3e-28   
sp|P94170|CAH_ANASP|CAH_ANASP Carbonic anhydrase precursor (EC 4.2.1.1) (C...   127   5e-28   Anabaena sp.
gb:BX572595_800410 Rhodopseudomonas palustris CGA009 complete ge...   126   1e-27   
pir|H83694|H83694 carbonic anhydrase precursor cah [imported] - ...   126   1e-27   Bacillus halodurans
gb:AE014991_313910 Streptococcus mutans UA159 section 139 of 185...   125   2e-27   
sp|O52535|CAH_KLEPN|CAH_KLEPN Carbonic anhydrase precursor (EC 4.2.1.1) (C...   125   2e-27   Klebsiella pneumoniae
gb:AE016827_343434 Mannheimia succiniciproducens MBEL55E, comple...   125   2e-27   
gb:CP000020_871827 Vibrio fischeri ES114 chromosome I, complete ...   122   1e-26   
gb:BA000040_729397 Bradyrhizobium japonicum USDA 110 DNA, comple...   120   4e-26   
gb:BX950851_839014 Erwinia carotovora subsp. atroseptica SCRI104...   119   1e-25   
gb:AB022175_3898 Rhodopseudomonas palustris acaP gene for a-type...   119   1e-25   
sp|O52538|CAH_ERWCA|CAH_ERWCA Carbonic anhydrase precursor (EC 4.2.1.1) (C...   119   1e-25   Pectobacterium carotovorum
gb:AP006627_565500 Bacillus clausii KSM-K16 DNA, complete genome.     118   3e-25   
gb:AE017146_390674 Helicobacter hepaticus ATCC 51449 section 3 o...   117   4e-25   
gb:AY280612_1315642 Anopheles gambiae carbonic anhydrase (CA) mR...   110   5e-23   
gb:BA000012_670977 Mesorhizobium loti MAFF303099 DNA, complete g...   110   8e-23   
gb:BX321858_772934 Nitrosomonas europaea ATCC 19718, complete ge...   109   1e-22   
gb:AP008231_579862 Synechococcus elongatus PCC 6301 DNA, complet...   109   1e-22   
gb:SPU72501_189660 Synechococcus PCC7942 carbonic anhydrase (eca...   109   1e-22   
gb:CP000024_877436 Streptococcus thermophilus CNRZ1066, complete...   108   2e-22   
gb:AE012056_278985 Xanthomonas axonopodis pv. citri str. 306, se...   107   5e-22   
pir|T08078|T08078 carbonate dehydratase (EC 4.2.1.1) precursor, ...   106   9e-22   Chlamydomonas reinhardtii
gb:MLO672112_148399 Mesorhizobium loti R7A symbiosis island; seg...   106   1e-21   
gb:AP005655_1855555 Oryza sativa (japonica cultivar-group) genom...   105   1e-21   
gb:AE014298_1124683 Drosophila melanogaster chromosome X, comple...   103   6e-21   
gb:AY123054_1579922 Griffithsia japonica carbonic anhydrase mRNA...   102   1e-20   
gb:BC055437_2102041 Mus musculus carbonic anhydrase 6, mRNA (cDN...   102   2e-20   
gb:BC049973_2100294 Mus musculus carbonic anhydrase 6, mRNA (cDN...   102   2e-20   
gb:AF395662_1267750 Aedes aegypti carbonic anhydrase mRNA, compl...   102   2e-20   
sp|P18761|CAH6_MOUSE|CAH6_MOUSE Carbonic anhydrase VI precursor (EC 4.2.1.1...   101   4e-20   Mus musculus [mouse]
gb:AE014297_1138804 Drosophila melanogaster chromosome 3R, compl...   100   5e-20   
pir|E95264|E95264 probable carbonate dehydratase (EC 4.2.1.1) [i...   100   6e-20   Sinorhizobium meliloti
pir|A71847|A71847 carbonic anhydrase - Helicobacter pylori (stra...   100   8e-20   Helicobacter pylori J99
gb:AE017324_443258 Listeria monocytogenes str. 4b F2365, section...   100   1e-19   
pir|AC1176|AC1176 carbonic anhydrase homolog lmo0811 [imported] ...    99   2e-19   Listeria monocytogenes
gb:AY049077_2074545 Mus musculus carbonic anhydrase 9 (Car9) gen...    99   2e-19   
sp|Q8VHB5|CAH9_MOUSE|CAH9_MOUSE Carbonic anhydrase IX precursor (EC 4.2.1.1...    99   2e-19   Mus musculus [mouse]
pir|AG1533|AG1533 carbonic anhydrase homolog lin0807 [imported] ...    98   3e-19   Listeria innocua
sp|Q9D6N1|CAHD_MOUSE|CAHD_MOUSE Carbonic anhydrase XIII (EC 4.2.1.1) (Carbo...    98   3e-19   Mus musculus [mouse]
sp|Q27504|CAH3_CAEEL|CAH3_CAEEL Putative carbonic anhydrase 3 (EC 4.2.1.1) ...    97   5e-19   Caenorhabditis elegans [roundworm]
gb:AE017282_427850 Methylococcus capsulatus str. Bath, complete ...    97   9e-19   
gb:BC004897_1969423 Homo sapiens carbonic anhydrase III, muscle ...    95   3e-18   
sp|P07451|CAH3_HUMAN|CAH3_HUMAN Carbonic anhydrase III (EC 4.2.1.1) (Carbon...    95   3e-18   Homo sapiens [man]
gb:BC057412_2552062 Danio rerio carbonic anhydrase II, mRNA (cDN...    95   3e-18   
gb:AL935260_552317 Lactobacillus plantarum strain WCFS1 complete...    95   3e-18   
pir|A26658|CRHU3 carbonate dehydratase (EC 4.2.1.1) III - human>...    95   3e-18   
pir|A29993|A29993 carbonate dehydratase (EC 4.2.1.1) VI - sheep        94   6e-18   Ovis aries [domestic sheep]
sp|P08060|CAH6_SHEEP|CAH6_SHEEP Carbonic anhydrase VI (EC 4.2.1.1) (Carbona...    94   6e-18   Ovis aries [domestic sheep]
sp|P43166|CAH7_HUMAN|CAH7_HUMAN Carbonic anhydrase VII (EC 4.2.1.1) (Carbon...    94   8e-18   Homo sapiens [man]
gb:BT008173_2151105 Synthetic construct Homo sapiens carbonic an...    93   1e-17   
gb:BC000278_1966572 Homo sapiens carbonic anhydrase XII, transcr...    93   1e-17   
sp|O43570|CAHC_HUMAN|CAHC_HUMAN Carbonic anhydrase XII precursor (EC 4.2.1....    93   1e-17   Homo sapiens [man]
gb:BC077855_2560506 Xenopus laevis carbonic anhydrase 13, mRNA (...    92   2e-17   
gb:AE016952_365748 Enterococcus faecalis V583, section 6 of 11 o...    92   2e-17   
gb:BC031385_2097046 Mus musculus carbonic anyhydrase 12, mRNA (c...    92   2e-17   
gb:U39743_1403082 Caenorhabditis elegans cosmid R173, complete s...    92   2e-17   
gb:AK052639_1170122 Mus musculus 0 day neonate kidney cDNA, RIKE...    92   2e-17   
sp|Q8CI85|CAHC_MOUSE|CAHC_MOUSE Carbonic anhydrase XII precursor (EC 4.2.1....    92   2e-17   Mus musculus [mouse]
gb:AB030829_2044704 Rattus norvegicus CA3 mRNA for carbonic anhy...    92   3e-17   
sp|P18915|CAH6_BOVIN|CAH6_BOVIN Carbonic anhydrase VI precursor (EC 4.2.1.1...    92   3e-17   Bos taurus [bovine]
sp|P14141|CAH3_RAT|CAH3_RAT Carbonic anhydrase III (EC 4.2.1.1) (Carbonat...    92   3e-17   Rattus norvegicus [brown rat]
gb:AF294983S6_2061874 Mus musculus carbonic anhydrase III gene, ...    91   4e-17   
pir|I52551|I52551 carbonate dehydratase (EC 4.2.1.1) III - rat>g...    91   4e-17   Rattus norvegicus [brown rat]
pir|A43641|A43641 carbonate dehydratase (EC 4.2.1.1) III - mouse...    91   4e-17   Mus musculus [mouse]
sp|P16015|CAH3_MOUSE|CAH3_MOUSE Carbonic anhydrase III (EC 4.2.1.1) (Carbon...    91   4e-17   Mus musculus [mouse]
gb:AY075021_2075853 Mus musculus carbonic anhydrase 7 mRNA, comp...    91   6e-17   
sp|Q10462|CAH5_CAEEL|CAH5_CAEEL Putative carbonic anhydrase 5 precursor (EC...    91   6e-17   Caenorhabditis elegans [roundworm]
gb:BC067635_2554807 Danio rerio hypothetical protein LOC407683, ...    90   8e-17   
gb:SHPCAI_1444709 Ovis aries carbonic anhydrase I mRNA, complete...    90   8e-17   
sp|P48282|CAH1_SHEEP|CAH1_SHEEP Carbonic anhydrase I (EC 4.2.1.1) (Carbonat...    90   8e-17   Ovis aries [domestic sheep]
gb:AY641852_2541416 Gekko japonicus GekBS031P mRNA, complete cds.      90   1e-16   
gb:MUSCAIA_2125360 Mouse carbonic anhydrase I (CAI) mRNA, comple...    90   1e-16   
gb:AY789514_1433890 Sus scrofa carbonic anhydrase III (CA3) mRNA...    90   1e-16   
gb:AK003066_1151624 Mus musculus adult male spleen cDNA, RIKEN f...    90   1e-16   
pir|A26344|A26344 carbonate dehydratase (EC 4.2.1.1) I - mouse         90   1e-16   Mus musculus [mouse]
pir|T16772|T16772 hypothetical protein R173.1 - Caenorhabditis e...    90   1e-16   Caenorhabditis elegans [roundworm]
sp|Q8N1Q1|CAHD_HUMAN|CAHD_HUMAN Carbonic anhydrase XIII (EC 4.2.1.1) (Carbo...    90   1e-16   Homo sapiens [man]
sp|P13634|CAH1_MOUSE|CAH1_MOUSE Carbonic anhydrase I (EC 4.2.1.1) (Carbonat...    90   1e-16   Mus musculus [mouse]
gb:BC078387_2560960 Danio rerio cDNA clone IMAGE:7036975, partia...    89   1e-16   
gb:AX817267_1475855 Sequence 15 from Patent WO02081517.                89   1e-16   
sp|P48283|CAH4_RABIT|CAH4_RABIT Carbonic anhydrase IV precursor (EC 4.2.1.1...    89   1e-16   Oryctolagus cuniculus [domestic rabbit]
pir|A01139|CRMQ1R carbonate dehydratase (EC 4.2.1.1) I - rhesus ...    89   2e-16   
pir|A37917|CRHU6 carbonate dehydratase (EC 4.2.1.1) VI precursor...    89   2e-16   
sp|P00916|CAH1_MACMU|CAH1_MACMU Carbonic anhydrase I (EC 4.2.1.1) (Carbonat...    89   2e-16   Macaca mulatta [rhesus macaque]
gb:MACCAANI_2038715 Macaca nemestrina carbonic anhydrase I mRNA,...    89   2e-16   
gb:AL139415_1920752 Human DNA sequence from clone RP3-477M7 on c...    89   2e-16   
gb:AB102863_1873518 Homo sapiens CA6 mRNA for carbonic anhydrase...    89   2e-16   
sp|P35217|CAH1_MACNE|CAH1_MACNE Carbonic anhydrase I (EC 4.2.1.1) (Carbonat...    89   2e-16   Macaca nemestrina [pigtail macaque]
gb:AL133410_1918494 Human DNA sequence from clone RP11-112J3 on ...    88   4e-16   
pir|JN0836|JN0836 carbonate dehydratase (EC 4.2.1.1) I - gorilla       88   4e-16   Gorilla gorilla gorilla [lowland gorilla]
sp|Q16790|CAH9_HUMAN|CAH9_HUMAN Carbonic anhydrase IX precursor (EC 4.2.1.1...    88   4e-16   Homo sapiens [man]
sp|Q7M316|CAH1_GORGO|CAH1_GORGO Carbonic anhydrase I (EC 4.2.1.1) (Carbonat...    88   4e-16   Gorilla gorilla gorilla [lowland gorilla]
gb:AB055617_2462722 Tribolodon hakonensis mRNA for carbonic anhy...    87   5e-16   
sp|Q9ERQ8|CAH7_MOUSE|CAH7_MOUSE Carbonic anhydrase VII (EC 4.2.1.1) (Carbon...    87   5e-16   Mus musculus [mouse]
sp|Q8UWA5|CAH2_TRIHK|CAH2_TRIHK Carbonic anhydrase II (EC 4.2.1.1) (Carbona...    87   5e-16   Tribolodon hakonensis
sp|Q8HY33|CAH1_MONDO|CAH1_MONDO Carbonic anhydrase I (EC 4.2.1.1) (Carbonat...    87   5e-16   Monodelphis domestica
sp|Q9WVT6|CAHE_MOUSE|CAHE_MOUSE Carbonic anhydrase XIV precursor (EC 4.2.1....    87   7e-16   Mus musculus [mouse]
gb:BC072918_2556842 Xenopus laevis MGC80389 protein, mRNA (cDNA ...    87   9e-16   
gb:HUMCA6_2029760 Human carbonic anhydrase isozyme VI (CA6) mRNA...    87   9e-16   
pir|JN0835|JN0835 carbonate dehydratase (EC 4.2.1.1) I - chimpanzee    87   9e-16   Pan troglodytes
sp|P07450|CAH3_HORSE|CAH3_HORSE Carbonic anhydrase III (EC 4.2.1.1) (Carbon...    87   9e-16   Equus caballus [domestic horse]
sp|Q7M317|CAH1_PANTR|CAH1_PANTR Carbonic anhydrase I (EC 4.2.1.1) (Carbonat...    87   9e-16   Pan troglodytes
pir|JQ0786|CRHU1 carbonate dehydratase (EC 4.2.1.1) I [validated...    86   1e-15   
sp|Q95323|CAH4_BOVIN|CAH4_BOVIN Carbonic anhydrase IV precursor (EC 4.2.1.1...    86   1e-15   Bos taurus [bovine]
sp|P00915|CAH1_HUMAN|CAH1_HUMAN Carbonic anhydrase I (EC 4.2.1.1) (Carbonat...    86   1e-15   Homo sapiens [man]
sp|P00917|CAH1_HORSE|CAH1_HORSE Carbonic anhydrase I (EC 4.2.1.1) (Carbonat...    86   1e-15   Equus caballus [domestic horse]
pir|A01145|CRSH2 carbonate dehydratase (EC 4.2.1.1) II - sheep (...    86   2e-15   
sp|Q9MZ30|CAHC_RABIT|CAHC_RABIT Carbonic anhydrase XII precursor (EC 4.2.1....    86   2e-15   Oryctolagus cuniculus [domestic rabbit]
sp|P00922|CAH2_SHEEP|CAH2_SHEEP Carbonic anhydrase II (EC 4.2.1.1) (Carbona...    86   2e-15   Ovis aries [domestic sheep]
gb:BC041213_2547851 Xenopus laevis similar to carbonic anhydrase...    86   2e-15   
sp|Q9ULX7|CAHE_HUMAN|CAHE_HUMAN Carbonic anhydrase XIV precursor (EC 4.2.1....    86   2e-15   Homo sapiens [man]
gb:BC042287_2548107 Xenopus laevis carbonic anhydrase II, mRNA (...    85   3e-15   
gb:AE014298_1124987 Drosophila melanogaster chromosome X, comple...    85   3e-15   
gb:BC089661_2566210 Xenopus tropicalis cDNA clone MGC:107879 IMA...    85   4e-15   
sp|P23280|CAH6_HUMAN|CAH6_HUMAN Carbonic anhydrase VI precursor (EC 4.2.1.1...    85   4e-15   Homo sapiens [man]
gb:AB080972_1409229 Canis familiaris CA6 mRNA for carbonic anhyd...    84   5e-15   
gb:CQ782700_1452104 Sequence 2840 from Patent EP1396543.>gb:AK07...    84   6e-15   
pir|T08466|T08466 carbonate dehydratase (EC 4.2.1.1) - green alg...    84   6e-15   Dunaliella salina
sp|P22748|CAH4_HUMAN|CAH4_HUMAN Carbonic anhydrase IV precursor (EC 4.2.1.1...    84   6e-15   Homo sapiens [man]
gb:AY119174_1300896 Drosophila melanogaster RH54112 full insert ...    84   8e-15   
gb:AE014296_1135978 Drosophila melanogaster chromosome 3L, compl...    84   8e-15   
sp|P54212|CAH_DUNSA|CAH_DUNSA Carbonic anhydrase (EC 4.2.1.1) (Carbonate d...    84   8e-15   Dunaliella salina
gb:BC054242_2550892 Xenopus laevis hypothetical protein MGC64443...    83   1e-14   
gb:BC046495_2099254 Mus musculus carbonic anhydrase 6, mRNA (cDN...    83   1e-14   
sp|P23589|CAH5_MOUSE|CAH5_MOUSE Carbonic anhydrase VA, mitochondrial precur...    83   1e-14   Mus musculus [mouse]
gb:GGCAII12_2572960 G.gallus carbonic anhydrase II gene exons 1-...    83   1e-14   
pir|JC2580|JC2580 carbonate dehydratase (EC 4.2.1.1) II - chicke...    82   2e-14   Gallus gallus [bantam]
sp|P07630|CAH2_CHICK|CAH2_CHICK Carbonic anhydrase II (EC 4.2.1.1) (Carbona...    82   2e-14   Gallus gallus [bantam]
gb:AF079834_2053716 Mus musculus stress-inducible intra-cellular...    82   2e-14   
gb:AF170173_1774245 Acetabularia acetabulum putative carbonic an...    81   4e-14   
gb:AY240020_1427672 Bos taurus carbonic anhydrase II mRNA, compl...    81   4e-14   
sp|Q99N23|CAHF_MOUSE|CAHF_MOUSE Carbonic anhydrase XV precursor (EC 4.2.1.1...    81   4e-14   Mus musculus [mouse]
sp|P00921|CAH2_BOVIN|CAH2_BOVIN Carbonic anhydrase II (EC 4.2.1.1) (Carbona...    81   4e-14   Bos taurus [bovine]
gb:GGCAIIR_2572962 Chicken mRNA for carbonic anhydrase II CA-II ...    80   7e-14   
gb:GCAIIR_2572428 Chicken mRNA for carbonic anhydrase II.              80   7e-14   
pir|A22962|A22962 carbonate dehydratase (EC 4.2.1.1) I - rabbit ...    80   9e-14   Oryctolagus cuniculus [domestic rabbit]
sp|P07452|CAH1_RABIT|CAH1_RABIT Carbonic anhydrase I (EC 4.2.1.1) (Carbonat...    80   9e-14   Oryctolagus cuniculus [domestic rabbit]
gb:HUMCA405_2029757 Human carbonic anhydrase IV gene, exon 7.          80   1e-13   
gb:RABCAI_1443599 Rabbit erythrocyte carbonic anhydrase I mRNA, ...    80   1e-13   
sp|P00919|CAH2_RABIT|CAH2_RABIT Carbonic anhydrase II (EC 4.2.1.1) (Carbona...    80   1e-13   Oryctolagus cuniculus [domestic rabbit]
pir|A27175|CRHU2 carbonate dehydratase (EC 4.2.1.1) II [validate...    79   2e-13   
pir|A01144|CRBO2 carbonate dehydratase (EC 4.2.1.1) II - bovine ...    79   2e-13   
sp|P00918|CAH2_HUMAN|CAH2_HUMAN Carbonic anhydrase II (EC 4.2.1.1) (Carbona...    79   2e-13   Homo sapiens [man]
gb:AY125007_2513955 Lepisosteus osseus erythrocyte carbonic anhy...    79   3e-13   
pir|S12579|S12579 carbonate dehydratase (EC 4.2.1.1), hepatic - ...    79   3e-13   Mus musculus [mouse]
pir|A01142|CRRB2 carbonate dehydratase (EC 4.2.1.1) II - rabbit ...    79   3e-13   
gb:BT009901_2151289 Synthetic construct Homo sapiens carbonic an...    78   3e-13   
gb:RPA439711_1396461 Riftia pachyptila mRNA for carbonic anhydra...    78   3e-13   
pir|JE0375|JE0375 carbonic anhydrase-related protein - human>gb:...    78   3e-13   Homo sapiens [man]
sp|O75493|CAHB_HUMAN|CAHB_HUMAN Carbonic anhydrase-related protein 2 precur...    78   3e-13   Homo sapiens [man]
gb:AF541981_1809975 Dunaliella salina strain UTEX 1644 duplicate...    78   4e-13   
gb:AF183939_1775001 Dunaliella salina duplicated carbonic anhydr...    78   4e-13   
gb:AE014134_1129089 Drosophila melanogaster chromosome 2L, compl...    78   4e-13   
gb:CR860631_1184690 Pongo pygmaeus mRNA; cDNA DKFZp459D0724 (fro...    77   6e-13   
gb:AY075025_2075854 Rattus norvegicus carbonic anhydrase-related...    77   7e-13   
sp|O70354|CAHB_MOUSE|CAHB_MOUSE Carbonic anhydrase-related protein 2 precur...    77   7e-13   Mus musculus [mouse]
sp|P43165|CAH5_RAT|CAH5_RAT Carbonic anhydrase VA, mitochondrial precurso...    77   7e-13   Rattus norvegicus [brown rat]
sp|P35218|CAH5_HUMAN|CAH5_HUMAN Carbonic anhydrase VA, mitochondrial precur...    77   7e-13   Homo sapiens [man]
sp|Q92051|CAHZ_BRARE|CAHZ_BRARE Carbonic anhydrase (EC 4.2.1.1) (Carbonate ...    77   1e-12   Danio rerio [leopard danio]
gb:AB018195_1864894 Homo sapiens ca xi mRNA for carbonic anhydra...    76   2e-12   
gb:BC059693_2552665 Danio rerio carbonic anhydrase VII, mRNA (cD...    75   2e-12   
gb:BC049309_2550167 Danio rerio carbonic anhydrase VII, mRNA (cD...    75   2e-12   
gb:AB103091_1873559 Homo sapiens CA6 mRNA for carbonic anhydrase...    75   2e-12   
gb:RABCARANH_1443605 Rabbit carbonic anhydrase II mRNA, partial ...    75   2e-12   
gb:AK002333_1151128 Mus musculus adult male kidney cDNA, RIKEN f...    75   2e-12   
gb:BC055291_2101959 Mus musculus carbonic anhydrase 2, mRNA (cDN...    75   3e-12   
gb:AF170175_1774247 Acetabularia acetabulum putative carbonic an...    75   3e-12   
gb:AF170174_1774246 Acetabularia acetabulum putative carbonic an...    75   3e-12   
gb:AY075024_1424713 Sus scrofa carbonic anhydrase-related XI pro...    74   5e-12   
gb:AY075023_1424712 Bos taurus carbonic anhydrase-related XI pro...    74   5e-12   
gb:AF140537_1244303 Anthopleura elegantissima carbonic anhydrase...    74   5e-12   
sp|Q95203|CAHB_SHEEP|CAHB_SHEEP Carbonic anhydrase-related protein 2 precur...    74   5e-12   Ovis aries [domestic sheep]
gb:MUSCAIIN7_2125363 Mouse carbonic anhydrase II gene, exon 7.         74   6e-12   
pir|A23900|CRMS2 carbonate dehydratase (EC 4.2.1.1) II - mouse         74   6e-12   
gb:MUSCAIIM_2125362 Mouse carbonic anhydrase isozyme II mRNA, co...    74   8e-12   
pir|JH0527|JH0527 carbonate dehydratase (EC 4.2.1.1) II - rat>gb...    74   8e-12   Rattus norvegicus [brown rat]
sp|P27139|CAH2_RAT|CAH2_RAT Carbonic anhydrase II (EC 4.2.1.1) (Carbonate...    74   8e-12   Rattus norvegicus [brown rat]
sp|P00920|CAH2_MOUSE|CAH2_MOUSE Carbonic anhydrase II (EC 4.2.1.1) (Carbona...    74   8e-12   Mus musculus [mouse]
gb:HUMCA405_2029758 Human carbonic anhydrase IV gene, exon 7.          73   1e-11   
gb:AF050106_1879121 Homo sapiens carbonic anhydrase-related prot...    73   1e-11   
gb:BC011949_1973331 Homo sapiens carbonic anhydrase II, mRNA (cD...    73   1e-11   
sp|Q64444|CAH4_MOUSE|CAH4_MOUSE Carbonic anhydrase IV precursor (EC 4.2.1.1...    73   1e-11   Mus musculus [mouse]
gb:BC083999_2563407 Xenopus laevis hypothetical LOC494969, mRNA ...    72   2e-11   
gb:AB117757_2465947 Oncorhynchus mykiss mRNA for carbonic anhydr...    72   2e-11   
gb:AB117756_2465946 Oncorhynchus mykiss mRNA for carbonic anhydr...    72   2e-11   
gb:AP003616_1831458 Oryza sativa (japonica cultivar-group) genom...    72   2e-11   
gb:BC068819_2555319 Xenopus laevis hypothetical protein MGC81428...    72   2e-11   
gb:AY322477_2527179 Oreochromis mossambicus carbonic anhydrase m...    72   2e-11   
gb:AP005393_1851013 Oryza sativa (japonica cultivar-group) genom...    72   2e-11   
sp|P48284|CAH4_RAT|CAH4_RAT Carbonic anhydrase IV precursor (EC 4.2.1.1) ...    72   2e-11   Rattus norvegicus [brown rat]
gb:AY836578_2546837 Pseudopleuronectes americanus carbonic anhyd...    72   3e-11   
gb:CR749607_1181165 Homo sapiens mRNA; cDNA DKFZp686I20267 (from...    72   3e-11   
gb:BX294140_767336 Pirellula sp. strain 1 complete genome; segme...    72   3e-11   
sp|Q9NS85|CAHA_HUMAN|CAHA_HUMAN Carbonic anhydrase-related protein 10 (Carb...    72   3e-11   Homo sapiens [man]
gb:AY514870_2535829 Oncorhynchus mykiss cytoplasmic carbonic anh...    71   4e-11   
gb:AY232669_1591668 Dunaliella salina carbonic anhydrase gene, c...    70   7e-11   
gb:AX357595_1466181 Sequence 1 from Patent WO0190321.>gb:AX35759...    70   7e-11   
gb:AY075020_1935955 Homo sapiens carbonic anhydrase VII short fo...    70   9e-11   
gb:AK004896_1152675 Mus musculus adult male liver cDNA, RIKEN fu...    70   9e-11   
gb:BC056289_2551732 Danio rerio zgc:77106, mRNA (cDNA clone MGC:...    70   1e-10   
gb:BC010773_2091105 Mus musculus carbonic anhydrase 8, mRNA (cDN...    70   1e-10   
gb:AF192978_2058563 Mus musculus carbonic anhydrase VB mRNA, com...    70   1e-10   
gb:AK085670_1174552 Mus musculus 10 days lactation, adult female...    70   1e-10   
sp|P28651|CAH8_MOUSE|CAH8_MOUSE Carbonic anhydrase-related protein (CARP) (...    70   1e-10   Mus musculus [mouse]
sp|Q9QZA0|CA5B_MOUSE|CA5B_MOUSE Carbonic anhydrase VB, mitochondrial precur...    70   1e-10   Mus musculus [mouse]
pir|B64668|B64668 carbonic anhydrase - Helicobacter pylori (stra...    69   2e-10   Helicobacter pylori
pir|S12867|S12867 carbonate dehydratase-related protein - mouse>...    69   2e-10   Mus musculus [mouse]
sp|Q18932|CAH2_CAEEL|CAH2_CAEEL Putative carbonic anhydrase like protein 2 ...    69   2e-10   Caenorhabditis elegans [roundworm]
gb:BC087769_2565422 Xenopus tropicalis hypothetical LOC496646, m...    69   2e-10   
gb:BC081872_2108118 Rattus norvegicus carbonic anhydrase VB, mit...    69   2e-10   
gb:BC066111_2105727 Mus musculus carbonic anhydrase 10, mRNA (cD...    69   2e-10   
gb:AE014297_1142314 Drosophila melanogaster chromosome 3R, compl...    69   2e-10   
pir|JN0576|JN0576 carbonate dehydratase (EC 4.2.1.1) VIII - huma...    69   2e-10   Homo sapiens [man]
sp|P35219|CAH8_HUMAN|CAH8_HUMAN Carbonic anhydrase-related protein (CARP) (...    69   2e-10   Homo sapiens [man]
gb:AF190735_1775445 Dunaliella salina carbonic anhydrase (CA) mR...    69   3e-10   
gb:AE014298_1124841 Drosophila melanogaster chromosome X, comple...    68   3e-10   
gb:BC087586_2110078 Rattus norvegicus carbonic anhydrase 8 (pred...    67   6e-10   
gb:AE014297_1140792 Drosophila melanogaster chromosome 3R, compl...    67   8e-10   
gb:AY860422_2547122 Oncorhynchus mykiss carbonic anhydrase-relat...    67   1e-09   
gb:CQ824906_1453652 Sequence 17 from Patent EP1431309.                 67   1e-09   
gb:AY070799_1294884 Drosophila melanogaster AT18354 full insert ...    67   1e-09   
gb:AE013599_1133002 Drosophila melanogaster chromosome 2R, compl...    67   1e-09   
gb:AK002498_1151250 Mus musculus adult male kidney cDNA, RIKEN f...    66   1e-09   
gb:BC088704_2565830 Xenopus laevis hypothetical LOC496283, mRNA ...    66   2e-09   
sp|Q05909|PTPG_MOUSE|PTPG_MOUSE Protein-tyrosine phosphatase gamma precurso...    66   2e-09   Mus musculus [mouse]
sp|Q9Y2D0|CA5B_HUMAN|CA5B_HUMAN Carbonic anhydrase VB, mitochondrial precur...    66   2e-09   Homo sapiens [man]
gb:AY177706_2078173 Rattus norvegicus receptor-like protein tyro...    65   3e-09   
gb:AY177705_2078172 Rattus norvegicus receptor-like protein tyro...    65   3e-09   
gb:AY177704_2078171 Rattus norvegicus receptor-like protein tyro...    65   3e-09   
gb:AY177703_2078170 Rattus norvegicus receptor-like protein tyro...    65   3e-09   
gb:BC072710_2556640 Danio rerio cDNA clone IMAGE:7037677, partia...    64   5e-09   
gb:AE014297_1141263 Drosophila melanogaster chromosome 3R, compl...    64   5e-09   
gb:AY514871_2535830 Oncorhynchus mykiss carbonic anhydrase 4 (CA...    64   6e-09   
gb:HSPTPRG28_2019824 Human receptor tyrosine phosphatase gamma (...    64   6e-09   
sp|P23470|PTPG_HUMAN|PTPG_HUMAN Protein-tyrosine phosphatase gamma precurso...    64   8e-09   Homo sapiens [man]
gb:AY113196_1299144 Drosophila melanogaster AT02719 full insert ...    63   1e-08   
gb:S57181_2138636 Ptprg=receptor protein tyrosine phosphatase ga...    62   2e-08   
gb:HSU88967_2027060 Human tyrosine phosphatase zeta polypeptide ...    62   2e-08   
gb:AY280613_1315643 Anopheles gambiae carbonic anhydrase alterna...    62   2e-08   
pir|A48993|A48993 protein-tyrosine-phosphatase (EC 3.1.3.48), re...    62   2e-08   Mus musculus [mouse]
pir|A48148|A48148 protein-tyrosine-phosphatase (EC 3.1.3.48), re...    62   2e-08   Homo sapiens [man]
sp|P23471|PTPZ_HUMAN|PTPZ_HUMAN Receptor-type protein-tyrosine phosphatase ...    62   2e-08   Homo sapiens [man]
sp|Q98936|PTPG_CHICK|PTPG_CHICK Protein-tyrosine phosphatase gamma precurso...    62   2e-08   Gallus gallus [bantam]
gb:MMU428208_2121420 Mus musculus mRNA for phosphacan short isof...    61   4e-08   
sp|P20507|CAH1_CHLRE|CAH1_CHLRE Carbonic anhydrase 1 precursor (EC 4.2.1.1)...    61   5e-08   
gb:BC070850_2555819 Xenopus laevis hypothetical protein MGC84589...    60   7e-08   
gb:MMU133130_2118450 Mus musculus mRNA for DSD-1-proteoglycan.         60   7e-08   
gb:BT012344_1358085 Drosophila melanogaster AT09719 full insert ...    60   7e-08   
sp|P24258|CAH2_CHLRE|CAH2_CHLRE Carbonic anhydrase 2 precursor (EC 4.2.1.1)...    60   7e-08   
gb:CRCAH2_1673211 Chlamydomonas reinhardtii CAH2 gene for carbon...    60   1e-07   
gb:AE014297_1141666 Drosophila melanogaster chromosome 3R, compl...    60   1e-07   
gb:AK081698_1173350 Mus musculus 16 days embryo head cDNA, RIKEN...    59   2e-07   
gb:AB045238_2462123 Xenopus laevis XRPTPb mRNA for receptor-type...    59   2e-07   
gb:AB045237_2462122 Xenopus laevis XRPTPb mRNA for receptor-type...    59   2e-07   
gb:AE014297_1142315 Drosophila melanogaster chromosome 3R, compl...    59   2e-07   
gb:RNU04998_2136724 Rattus norvegicus Sprague-Dawley phosphacan ...    59   3e-07   
sp|Q62656|PTPZ_RAT|PTPZ_RAT Receptor-type protein-tyrosine phosphatase ze...    59   3e-07   
gb:AF050105_2052463 Mus musculus carbonic anhydrase-related prot...    58   4e-07   
gb:BC078205_2560793 Danio rerio cDNA clone IMAGE:7153208, partia...    57   6e-07   
gb:AB086322_2047807 Mus musculus MN/CA9 mRNA for carbonic anhydr...    57   8e-07   
gb:LDI130777_1684114 Laminaria digitata mRNA for carbonic anhydr...    57   8e-07   
gb:AY123050_1579918 Griffithsia japonica carbonate dehydratase m...    56   1e-06   
pir|A60519|A60519 carbonate dehydratase (EC 4.2.1.1) - tiger sha...    56   1e-06   
gb:AE013599_1131137 Drosophila melanogaster chromosome 2R, compl...    55   2e-06   
gb:AL669859_2072512 Mouse DNA sequence from clone RP23-167D6 on ...    55   3e-06   
gb:AE014297_1142313 Drosophila melanogaster chromosome 3R, compl...    55   3e-06   
pir|T34196|T34196 hypothetical protein D1022.8 - Caenorhabditis ...    55   4e-06   
gb:AY369789_1948172 Macaca mulatta carbonic anhydrase II (CA2) m...    52   2e-05   
gb:AY369788_1948171 Pan troglodytes carbonic anhydrase II (CA2) ...    52   3e-05   
gb:CR857484_1181717 Pongo pygmaeus mRNA; cDNA DKFZp459F0821 (fro...    51   4e-05   
sp|Q20781|CAH1_CAEEL|CAH1_CAEEL Putative carbonic anhydrase like protein 1 ...    50   7e-05   
gb:AF161072S2_1415339 Megaderma lyra carbonic anhydrase-related ...    49   3e-04   
gb:D83523_1376288 Pinctada fucata mRNA for nacrein, complete cds.      48   4e-04   
gb:CER01E6_1366387 Caenorhabditis elegans cosmid R01E6, complete...    47   0.001   
gb:CER01E6_1366386 Caenorhabditis elegans cosmid R01E6, complete...    47   0.001   
pir|T23849|T23849 hypothetical protein R01E6.3 - Caenorhabditis ...    47   0.001   
gb:AY123080_1579948 Griffithsia japonica carbonate dehydratase m...    46   0.001   
gb:AY321311_2526768 Pseudopleuronectes americanus carbonic anhyd...    45   0.002   
gb:AB013804_1512270 Chlorella sorokiniana mRNA for soluble carbo...    45   0.004   
gb:AB032613_1195024 Pinctada maxima mRNA for N66 matrix protein,...    44   0.007   
pir|JC7210|JC7210 molluscan shell matrix protein N66 - Pinctada ...    44   0.007   
pir|A36819|A36819 C9 protein - rabbit fibroma virus>gb:AF170722_...    44   0.009   
gb:AF170726_2207895 Myxoma virus strain Lausanne, complete genome.     42   0.020   
pir|T15137|T15137 hypothetical protein T28F2.3 - Caenorhabditis ...    42   0.034   
gb:AB073680_1197499 Turbo marmoratus mRNA for nacrein, complete ...    41   0.045   
gb:AL683819_2072777 Mouse DNA sequence from clone RP23-126J10 on...    38   0.49    
gb:AK035758_1164221 Mus musculus 16 days neonate cerebellum cDNA...    36   1.9     
gb:AK012302_1156880 Mus musculus 11 days embryo whole body cDNA,...    36   1.9     
gb:AE013599_1132996 Drosophila melanogaster chromosome 2R, compl...    36   1.9     
gb:AX884433_1479886 Sequence 296 from Patent EP1033401.                35   4.2     
gb:AE014297_1141264 Drosophila melanogaster chromosome 3R, compl...    35   4.2     
gb:AX885410_1480863 Sequence 1273 from Patent EP1033401.               34   5.5     
gb:AF161072S1_1415338 Megaderma lyra carbonic anhydrase-related ...    34   7.1     
gb:AK017227_1159059 Mus musculus adult male xiphoid cartilage cD...    34   7.1     
gb:AY528667_625670 Aeromonas hydrophila strain AH3 AscU (ascU), ...    34   7.1     
gb:BT014667_1358224 Drosophila melanogaster AT24826 full insert ...    33   9.3     


>gb:AF492468_1804917 Nicotiana langsdorffii x Nicotiana sanderae
           nectarin III (NEC3) mRNA, complete cds.
          Length = 274

 Score =  270 bits (689), Expect = 6e-71
 Identities = 128/256 (50%), Positives = 185/256 (72%), Gaps = 1/256 (0%)
 Frame = +3

Query: 42  KLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID 221
           K+  I+FL LS   + +S EVDDE  FSYDE S+ GP++WG +RP+W +CS GK+Q+PID
Sbjct: 8   KMLFISFLFLSSVFLARSGEVDDESEFSYDEKSENGPANWGNIRPDWKECS-GKLQSPID 66

Query: 222 L-ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF 398
           + + +  V SNL  +Q  Y    ATL N G+ +ML    G  YL IN  +Y  +Q+HWH 
Sbjct: 67  IFDLRAEVVSNLRILQKDYKPSNATLLNRGHDIMLRLDDGG-YLKINETQYQLKQLHWHT 125

Query: 399 PSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
           PSEH +NG R++LEAHLVH SN+G+  V+ ++Y+IG  P+P LS+IE+DLK  A   G++
Sbjct: 126 PSEHTINGERFNLEAHLVHESNNGKFVVIGIVYEIGLWPDPFLSMIENDLKVPANKKGIE 185

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE 758
           +GIG +DPN ++  G++Y+RY+GSLTTPPCTEGVVW + R +++VT++Q+ L++ A+HD 
Sbjct: 186 RGIGIIDPNQIKLDGKKYFRYIGSLTTPPCTEGVVWIIDRKVKTVTRRQIKLLQEAVHDG 245

Query: 759 SKTNARPLQTINDRFV 806
            +TNARP Q  N+R++
Sbjct: 246 FETNARPTQPENERYI 261



>gb:AY122907_1579785 Arabidopsis thaliana putative storage protein
           (At1g08080) mRNA, complete cds.
          Length = 275

 Score =  240 bits (612), Expect = 5e-62
 Identities = 118/256 (46%), Positives = 172/256 (67%), Gaps = 2/256 (0%)
 Frame = +3

Query: 45  LFSIAFLLLSVTHVIKSQ-EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID 221
           LFSI F ++S++    S  EV+DE  F+Y +N ++GP  WGEL+PEW  C  G+MQ+PID
Sbjct: 15  LFSI-FTIVSISSAASSHGEVEDEREFNYKKNDEKGPERWGELKPEWEMCGKGEMQSPID 73

Query: 222 LESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF 398
           L ++ V + S+LG +   Y    ATL+N G+ +ML +  G   + ING  Y  +Q+HWH 
Sbjct: 74  LMNERVNIVSHLGRLNRDYNPSNATLKNRGHDIMLKFEDGAGTIKINGFEYELQQLHWHS 133

Query: 399 PSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
           PSEH +NG R+ LE H+VH   + R+AV+ V+Y+IG     I SL E +L+ +AE    +
Sbjct: 134 PSEHTINGRRFALELHMVHEGRNRRMAVVTVLYKIGRADTFIRSL-EKELEGIAEMEEAE 192

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE 758
           K +G +DP  ++   R+YYRY GSLTTPPCT+ V W+V+R +R+VT++QV L+R A+HD+
Sbjct: 193 KNVGMIDPTKIKIGSRKYYRYTGSLTTPPCTQNVTWSVVRKVRTVTRKQVKLLRVAVHDD 252

Query: 759 SKTNARPLQTINDRFV 806
           + +NARP+Q  N R V
Sbjct: 253 ANSNARPVQPTNKRIV 268



>gb:AP004693_1843528 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0461F06.
          Length = 275

 Score =  229 bits (585), Expect = 7e-59
 Identities = 111/262 (42%), Positives = 171/262 (65%), Gaps = 3/262 (1%)
 Frame = +3

Query: 36  MLKLFSIAFLLLS--VTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQ 209
           +L L + A LLL+  V      +E D E  F+Y    ++GP HWG+L+PEW QC AG+MQ
Sbjct: 6   LLVLLAAASLLLATAVPAARAQEETDHEEEFTYISGDEKGPEHWGKLKPEWAQCGAGEMQ 65

Query: 210 TPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQV 386
           +PIDL  + V +  +LG + + Y    A++ N G+ +M+ +      + ING  Y  RQ+
Sbjct: 66  SPIDLSHERVKLVRDLGYLDDSYRAAEASIVNRGHDIMVRFDGDAGSVVINGTAYYLRQL 125

Query: 387 HWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAET 566
           HWH P+EH V+G RYD+E H+VH S + + AV+ ++Y++G  P+  L  +E  LK +A+ 
Sbjct: 126 HWHSPTEHSVDGRRYDMELHMVHESAEKKAAVIGLLYEVGR-PDRFLQKMEPYLKMIADK 184

Query: 567 PGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNA 746
              ++ +G +DP   + R   YYRYMGSLTTPPCT+GVVWT+++ +R+V++ Q+ L+R A
Sbjct: 185 EDREEKVGMIDPRGARGRASVYYRYMGSLTTPPCTQGVVWTIVKRVRTVSRYQLDLLREA 244

Query: 747 IHDESKTNARPLQTINDRFVKV 812
           +HDE + NARPLQ +N+R + +
Sbjct: 245 VHDEMENNARPLQAVNNRDISI 266



>pir|B84682|B84682 probable carbonic anhydrase [imported] -
           Arabidopsis thaliana>gb:AC006202_1533613 Arabidopsis
           thaliana chromosome 2 clone T3B23 map mi54, complete
           sequence.
          Length = 248

 Score =  228 bits (582), Expect = 2e-58
 Identities = 110/239 (46%), Positives = 161/239 (67%), Gaps = 2/239 (0%)
 Frame = +3

Query: 102 VDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYM 278
           V+DE  FSY+ N + GP+ WG+LRPEW  C  G+MQ+PIDL +K V + ++L  +  +Y 
Sbjct: 5   VEDEHEFSYEWNQENGPAKWGKLRPEWKMCGKGEMQSPIDLMNKRVRLVTHLKKLTRHYK 64

Query: 279 RDVATLENHGYGMMLSW-PLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVH 455
              ATL+N G+ MML +   G   + +NG  Y   Q+HWH PSEH +NG R+ LE H+VH
Sbjct: 65  PCNATLKNRGHDMMLKFGEEGSGSITVNGTEYKLLQLHWHSPSEHTMNGRRFALELHMVH 124

Query: 456 VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYY 635
            + +G +AV+ V+Y+IG  P+  L L+E+ L  + +    +K +  +DP  ++   R++Y
Sbjct: 125 ENINGSLAVVTVLYKIGR-PDSFLGLLENKLSAITDQNEAEKYVDVIDPRDIKIGSRKFY 183

Query: 636 RYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV 812
           RY+GSLTTPPCT+ V+WTV++ +R+VTK QV L+R A+HD S TNARP+Q  N R VK+
Sbjct: 184 RYIGSLTTPPCTQNVIWTVVKKVRTVTKNQVKLLRVAVHDNSDTNARPVQPTNKRVVKL 242



>pir|E86215|E86215 protein T6D22.16 [imported] - Arabidopsis
           thaliana>gb:AE005172_889815 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC026875_1539729 Genomic sequence for
           Arabidopsis thaliana BAC T6D22 from chromosome I,
           complete sequence.
          Length = 263

 Score =  220 bits (560), Expect = 5e-56
 Identities = 113/256 (44%), Positives = 165/256 (64%), Gaps = 2/256 (0%)
 Frame = +3

Query: 45  LFSIAFLLLSVTHVIKSQ-EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID 221
           LFSI F ++S++    S  EV+DE  F+Y +N ++GP  WGEL+PEW  C  G+MQ+PID
Sbjct: 15  LFSI-FTIVSISSAASSHGEVEDEREFNYKKNDEKGPERWGELKPEWEMCGKGEMQSPID 73

Query: 222 LESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF 398
           L ++ V + S+LG +   Y    ATL+N G+ +ML +  G   + ING  Y  +Q+HWH 
Sbjct: 74  LMNERVNIVSHLGRLNRDYNPSNATLKNRGHDIMLKFEDGAGTIKINGFEYELQQLHWHS 133

Query: 399 PSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
           PSEH +NG R            + R+AV+ V+Y+IG     I SL E +L+ +AE    +
Sbjct: 134 PSEHTINGRR------------NRRMAVVTVLYKIGRADTFIRSL-EKELEGIAEMEEAE 180

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE 758
           K +G +DP  ++   R+YYRY GSLTTPPCT+ V W+V+R +R+VT++QV L+R A+HD+
Sbjct: 181 KNVGMIDPTKIKIGSRKYYRYTGSLTTPPCTQNVTWSVVRKVRTVTRKQVKLLRVAVHDD 240

Query: 759 SKTNARPLQTINDRFV 806
           + +NARP+Q  N R V
Sbjct: 241 ANSNARPVQPTNKRIV 256



>gb:AP004693_1843532 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0461F06.
          Length = 275

 Score =  217 bits (552), Expect = 5e-55
 Identities = 108/260 (41%), Positives = 161/260 (61%), Gaps = 4/260 (1%)
 Frame = +3

Query: 45  LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL 224
           L + A LLLS     ++QE DDE  F Y   ++ GP +W  L P W +C+ G MQ+PIDL
Sbjct: 10  LLAAAVLLLSAAPAARAQETDDERKFGYVPGTENGPGNWSRLDPRWAKCNTGNMQSPIDL 69

Query: 225 ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS 404
             + ++  NLG +   Y+   A++ N G+ + + +      + ING  Y  +Q+HWH PS
Sbjct: 70  SHERLM-RNLGYLDYSYLPAEASMVNRGHDIEVKFMGNAGRVVINGKAYKLKQLHWHTPS 128

Query: 405 EHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG 584
           EH VNG RYD+E HLVH   +   AV+  +YQIG  P+P L ++E  ++++A+T    + 
Sbjct: 129 EHTVNGRRYDMELHLVHDDGNSNTAVIGNLYQIG-NPDPFLLMLEPFIRRIADTKDKSEP 187

Query: 585 IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTI----RSVTKQQVALIRNAIH 752
           IG +DP L ++    YYRYMGSLTTPPCTEGV+WTV + +    ++V + Q+ L+R A+ 
Sbjct: 188 IGVVDPQLAKSPDAVYYRYMGSLTTPPCTEGVIWTVFKRVFLLAQTVAQYQLDLLREAVA 247

Query: 753 DESKTNARPLQTINDRFVKV 812
           D  + NARPLQ +N+R + +
Sbjct: 248 DGYENNARPLQKVNNRNISI 267



>gb:AP005537_1853718 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OSJNBa0056L09.
          Length = 276

 Score =  210 bits (535), Expect = 4e-53
 Identities = 105/248 (42%), Positives = 155/248 (62%), Gaps = 2/248 (0%)
 Frame = +3

Query: 63  LLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVV 242
           LLLS T  +   E D   G+SY   S RGP +WG L+PEW  CS+GKMQ+PI+L    + 
Sbjct: 19  LLLSATAPVAGAEDD---GYSYIPGSPRGPQNWGSLKPEWATCSSGKMQSPINLGLLDLT 75

Query: 243 YS-NLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVN 419
            +  LG +   Y    A++ N G+ +M+ +      L ING  Y  RQ+HWH PSEH ++
Sbjct: 76  LAPGLGNLNYTYKNANASVVNRGHDIMVRFDGDAGSLKINGTAYQLRQMHWHTPSEHTID 135

Query: 420 GTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI-GYL 596
           G RYD+E H+VH++   + AV+ ++Y IG TP+  L  +E  +  ++   G +K + G  
Sbjct: 136 GRRYDMELHMVHLNAQNQAAVIGILYTIGTTPDEFLQKMEPYIIAISNQEGKEKMVVGGA 195

Query: 597 DPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNAR 776
           DPN+ + +   YYRYMGS TTPPCTEGV+WTV+R + +V+  Q+ L++ A+   ++ NAR
Sbjct: 196 DPNVAKGKDTVYYRYMGSFTTPPCTEGVIWTVVRKVHTVSLSQITLLKAAVLMGNENNAR 255

Query: 777 PLQTINDR 800
           PLQ +N+R
Sbjct: 256 PLQDVNNR 263



>gb:AP005301_1850193 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OSJNBa0077M12.>gb:AP005537_1853715 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBa0056L09.
          Length = 276

 Score =  206 bits (523), Expect = 1e-51
 Identities = 105/248 (42%), Positives = 157/248 (63%), Gaps = 2/248 (0%)
 Frame = +3

Query: 63  LLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVV 242
           LLLS T  +   E D   G+SY   S RGP +WG L+PEW  CS+GKMQ+PI+L    + 
Sbjct: 20  LLLSATAPVAGAEDD---GYSYIPGSPRGPQNWGSLKPEWATCSSGKMQSPINLGLLDLT 76

Query: 243 YS-NLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVN 419
            +  LG +   Y    A++ N G+ +M+ +      L ING  Y  RQ+HWH PSEH ++
Sbjct: 77  LAPGLGNLNYTYQNANASVVNRGHDIMVRFDGDAGSLKINGTAYQLRQMHWHTPSEHTID 136

Query: 420 GTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI-GYL 596
           G RYD+E H+VH++   + AV+ ++Y IG T +  L  +E  + ++++  G ++ I G  
Sbjct: 137 GRRYDMELHMVHLNAQNQAAVIGILYTIG-TRDEFLQKLEPYIIEISKQEGKERVIIGGA 195

Query: 597 DPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNAR 776
           DPN+ + +   YYRYMGS TTPPCTEGV+WTV+R +R+V+  Q+ L++ A+   ++ NAR
Sbjct: 196 DPNVAKGQDTVYYRYMGSFTTPPCTEGVIWTVVRKVRTVSLSQITLLKAAVLTGNENNAR 255

Query: 777 PLQTINDR 800
           PLQ +N+R
Sbjct: 256 PLQGVNNR 263



>gb:AF245019_1780453 Dioscorea alata dioscorin A (dioA-2) mRNA,
           complete cds.
          Length = 273

 Score =  199 bits (506), Expect = 1e-49
 Identities = 103/258 (39%), Positives = 155/258 (60%), Gaps = 1/258 (0%)
 Frame = +3

Query: 36  MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP 215
           +L L  ++ LL S     K Q+ +DE  FSY E S  GP +WG L+PEW  C  G  Q+P
Sbjct: 6   LLHLLLLSSLLFSCLPNAKPQQAEDE--FSYIEGSPNGPENWGSLKPEWKTCGNGMEQSP 63

Query: 216 IDLESKPVVYSN-LGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW 392
           I L    V+    LG ++  Y    A L N G+ +++ +      L IN + Y  +++H+
Sbjct: 64  IQLRDNRVILDQTLGKLRRNYRATDARLRNSGHDVLVEFKNNAGSLSINRVAYQLKRIHF 123

Query: 393 HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG 572
           H P+EH +NG R+DLEA LVH S D + AV++++++ G   +P LS +ED +++L+ +  
Sbjct: 124 HSPAEHEMNGERFDLEAQLVHESQDQKRAVVSILFRFGPA-DPFLSDLEDFIRQLSNSQK 182

Query: 573 VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH 752
            +   G +DPN LQ     YYRYMGS T PPCTE + WTVI+ + +V+ +QV +++ A++
Sbjct: 183 NEINAGVVDPNQLQIDDSAYYRYMGSYTAPPCTEDITWTVIKKLGTVSPKQVLMLKQAVN 242

Query: 753 DESKTNARPLQTINDRFV 806
           + S  NARPLQ  N R V
Sbjct: 243 ENSINNARPLQPTNFRSV 260



>pir|S57766|S57766 dioscorin class A precursor - Dioscorea
           cayenensis>gb:DCSTPRO_1675732 D.cayenensis mRNA for
           storage protein.
          Length = 273

 Score =  198 bits (503), Expect = 2e-49
 Identities = 103/258 (39%), Positives = 155/258 (60%), Gaps = 1/258 (0%)
 Frame = +3

Query: 36  MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP 215
           +L L  ++ LL S     K Q+ +DE  FSY E S  GP +WG L+ EW  C  G  Q+P
Sbjct: 6   LLHLLLLSSLLFSCLPNAKPQQAEDE--FSYIEGSPNGPENWGNLKKEWETCGKGMEQSP 63

Query: 216 IDLESKPVVYSN-LGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW 392
           I L    V++   LG ++  Y    ATL N G+ +++ +      L IN + Y  +++H+
Sbjct: 64  IQLRDNRVIFDQTLGELRRNYRAAEATLRNSGHDVLVEFEGNAGSLSINRVAYQLKRIHF 123

Query: 393 HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG 572
           H PSEH +NG R+DLEA LVH S D + AV++++++ G   +  LS +ED +K+ + +  
Sbjct: 124 HSPSEHEMNGERFDLEAQLVHESQDQKRAVVSILFRFGRA-DTFLSDLEDFIKQFSSSQK 182

Query: 573 VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH 752
            +   G +DPN LQ     Y+RYMGS T PPCTEG+ WTV+R + +V+ +QV L++ A++
Sbjct: 183 NEINAGVVDPNQLQFDDCAYFRYMGSFTAPPCTEGISWTVMRKVATVSPRQVLLLKQAVN 242

Query: 753 DESKTNARPLQTINDRFV 806
           + +  NARPLQ  N R V
Sbjct: 243 ENAINNARPLQPTNYRSV 260



>gb:AF242551_1780190 Dioscorea alata dioscorin A (DIOA-1) mRNA,
           complete cds.
          Length = 272

 Score =  196 bits (497), Expect = 1e-48
 Identities = 100/258 (38%), Positives = 154/258 (59%), Gaps = 1/258 (0%)
 Frame = +3

Query: 36  MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP 215
           +L LF ++ LL S      +  +D E  FSY E S  GP +WG L+PEW  C  G  Q+P
Sbjct: 6   LLHLFLLSSLLFSC---FSNARLDGEDEFSYIEGSPNGPENWGSLKPEWKTCGNGMEQSP 62

Query: 216 IDLESKPVVYSN-LGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW 392
           I L    V++   LG ++  Y    A L N G+ +++ +      L IN + Y  +++H+
Sbjct: 63  IQLRDNGVIFDQTLGKLRRDYRATDARLRNSGHDVLVEFKNNAGSLSINRVAYQLKRIHF 122

Query: 393 HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG 572
           H P+EH +NG R+DLEA LVH S D + A ++++++ G   +P LS +ED +++L+ +  
Sbjct: 123 HSPAEHEMNGERFDLEAQLVHESQDQKRAAVSILFRFGPA-DPFLSDLEDFIRQLSNSQK 181

Query: 573 VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH 752
            +   G +DPN LQ     YYRYMGS T PPC+EG+ WTV+R + +V+ +QV L++  ++
Sbjct: 182 NEINAGVVDPNQLQIDDSAYYRYMGSFTAPPCSEGISWTVMRKVATVSPRQVLLLKQTVN 241

Query: 753 DESKTNARPLQTINDRFV 806
           + +  NARPLQ  N R V
Sbjct: 242 ENAINNARPLQPTNFRSV 259



>gb:AP005537_1853722 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OSJNBa0056L09.
          Length = 277

 Score =  194 bits (494), Expect = 2e-48
 Identities = 101/241 (41%), Positives = 153/241 (63%), Gaps = 7/241 (2%)
 Frame = +3

Query: 99  EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQNYY 275
           E DD++G  Y   + RGP +WG L+PEW  CS+G+MQ+PI+L    +  +  LG +   Y
Sbjct: 27  EEDDQFG--YIPGTPRGPENWGSLKPEWATCSSGEMQSPINLGLLDLTLAPGLGDLNYTY 84

Query: 276 MRDVATLENHGYGMMLSWPLGQRY-----LGINGIRYLFRQVHWHFPSEHVVNGTRYDLE 440
               AT+ N G+ +M+ +  G        L ING  Y  RQVHWH PSEH V+G RYD+E
Sbjct: 85  RNANATVVNRGHDIMVRFDGGDDAAAAGGLVINGTAYRLRQVHWHAPSEHAVDGRRYDME 144

Query: 441 AHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI-GYLDPNLLQA 617
            H+VH++   + AV+ ++Y IG   +  L  +E  + ++A+    +K + G +DPN+ + 
Sbjct: 145 LHMVHLNTQNQTAVVGILYAIG-AQDEFLHKLEPYIIEVADQKDKEKIVNGGVDPNVAKE 203

Query: 618 RGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTIND 797
               YYRYMGSLTTPPCTEGV+WT++R + +V+  Q+AL++ A+ + ++ NARPLQ +N+
Sbjct: 204 HDIVYYRYMGSLTTPPCTEGVIWTIVRKVHTVSLSQLALLKAAVVNGNEKNARPLQDVNN 263

Query: 798 R 800
           R
Sbjct: 264 R 264



>gb:AB178473_1528927 Dioscorea batatas DB3S mRNA for tuber storage
           protein, complete cds.
          Length = 268

 Score =  194 bits (492), Expect = 4e-48
 Identities = 102/249 (40%), Positives = 149/249 (59%), Gaps = 1/249 (0%)
 Frame = +3

Query: 63  LLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVV 242
           LLLS         V+DE  FSY E +  GP +WG L+PEW  C  G  Q+PI L    V+
Sbjct: 10  LLLSSLLFSCLANVEDE--FSYIEGNPNGPENWGNLKPEWETCGKGMEQSPIQLRDNRVI 67

Query: 243 Y-SNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVN 419
           +   LG ++  Y    A L N G+ +++ +      L IN + Y  +++H+H PSEH +N
Sbjct: 68  FDQTLGRLRRNYRAVDARLRNSGHDVLVEFKGNAGSLSINRVAYQLKRIHFHSPSEHEMN 127

Query: 420 GTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLD 599
           G R+DLEA LVH S D + AV+++++  G   +P LS +ED +K+ + +   +   G +D
Sbjct: 128 GERFDLEAQLVHESQDQKRAVVSILFIFGRA-DPFLSDLEDFIKQFSSSQKNEINAGVVD 186

Query: 600 PNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARP 779
           PN LQ     YYRYMGS T PPCTEG+ WTV+R + +V+ +QV L++ A+++ +  NARP
Sbjct: 187 PNQLQIDDSAYYRYMGSFTAPPCTEGISWTVMRKVATVSPRQVLLLKQAVNENAINNARP 246

Query: 780 LQTINDRFV 806
           LQ  N R V
Sbjct: 247 LQPTNFRSV 255



>pir|S57767|S57767 dioscorin class B - Dioscorea cayenensis
           (fragment)
          Length = 246

 Score =  192 bits (488), Expect = 1e-47
 Identities = 97/231 (41%), Positives = 146/231 (63%), Gaps = 2/231 (0%)
 Frame = +3

Query: 120 FSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL-ESKPVVYSNLGPIQNYYMRDVATL 296
           FSY E S  GP +WG LRPEW  C  G  Q+PI+L + K +    LG ++  Y    ATL
Sbjct: 4   FSYIEGSPNGPENWGNLRPEWKTCGNGMKQSPINLCDDKVIQTPALGKLRTSYQAARATL 63

Query: 297 ENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRI 476
           +N+G+ +M+++        IN ++Y  +++H+H PSEH +NG RYDLE  +VH S D R 
Sbjct: 64  KNNGHDIMVNFKSDAGSQFINRVQYQLKRIHFHSPSEHALNGERYDLEIQMVHESQDQRR 123

Query: 477 AVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDP-NLLQARGRRYYRYMGSL 653
           AV A+M++ G + +P LS +ED +K+++ +   +   G +DP  LLQ     YYRYMGS 
Sbjct: 124 AVTAIMFRFGRS-DPFLSDLEDFIKQISRSENFEVDAGVVDPRQLLQFDDPSYYRYMGSF 182

Query: 654 TTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV 806
           T PPCTE + WTVI+ + +V+ +QV +++ A+++ +  NARPLQ +  R V
Sbjct: 183 TAPPCTEDITWTVIKKLGTVSPKQVLMLKQAVNENAINNARPLQPLKFRTV 233



>gb:AB178472_1528926 Dioscorea batatas DB3L mRNA for tuber storage
           protein, complete cds.
          Length = 272

 Score =  192 bits (487), Expect = 2e-47
 Identities = 101/251 (40%), Positives = 154/251 (61%), Gaps = 2/251 (0%)
 Frame = +3

Query: 60  FLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV 239
           FLL S+     S    DE  FSY E S  GP +WG L PEW  C  G  Q+PI+L    V
Sbjct: 10  FLLSSLLFSCLSNARPDEDDFSYIEGSPNGPENWGNLNPEWKTCGNGMEQSPINLCDDRV 69

Query: 240 VYSN-LGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVV 416
           + +  LG ++  Y    ATL+N+G+ +M+++        IN +RY  +++H+H PSEHV+
Sbjct: 70  IQTPALGKLRTSYQAARATLKNNGHDIMVNFKSDAGSQFINQVRYQLKRIHFHSPSEHVL 129

Query: 417 NGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYL 596
           NG R+DLE  +VH S D R AV A++++ G + +P LS +ED + +++++   +   G +
Sbjct: 130 NGERFDLEVQMVHESQDQRRAVTAILFRFGRS-DPFLSDLEDFISQISKSEKNEVDAGVV 188

Query: 597 DP-NLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNA 773
           DP  LLQ     YYRYMGS T PPCTE + WTVI+ + +V+ +QV +++ A+++ +  NA
Sbjct: 189 DPRQLLQFDDPAYYRYMGSFTAPPCTEDITWTVIKKLGTVSPRQVLMLKQAVNENAINNA 248

Query: 774 RPLQTINDRFV 806
           RPLQ +  R +
Sbjct: 249 RPLQPLKFRTI 259



>gb:AF243526_1780254 Dioscorea alata dioscorin B (dioB-1) mRNA,
           complete cds.
          Length = 273

 Score =  187 bits (475), Expect = 4e-46
 Identities = 99/259 (38%), Positives = 154/259 (59%), Gaps = 2/259 (0%)
 Frame = +3

Query: 36  MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP 215
           +  LF ++ LL S      +  +D +  FSY E S  GP +WG LRPEW  C  G  Q+P
Sbjct: 6   LFHLFLLSSLLFSC---FSNARLDGDDDFSYIEGSPNGPENWGNLRPEWKTCGYGMEQSP 62

Query: 216 IDL-ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW 392
           I+L + + +    LG ++  Y    AT++N+G+ +M+ +        IN + Y  +++H+
Sbjct: 63  INLCDDRVIRTPTLGKLRTSYQAARATVKNNGHDIMVYFKSDAGTQFINQVEYQLKRIHF 122

Query: 393 HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG 572
           H PSEH ++G RYDLE  +VH S D R AV+A+M++ G + +P L  +ED + +++    
Sbjct: 123 HSPSEHALSGERYDLEVQMVHESQDQRRAVIAIMFRFGRS-DPFLPDLEDFISQISRRET 181

Query: 573 VKKGIGYLDP-NLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI 749
            +   G +DP  LLQ     YYRYMGS T PPCTE + WTVI+ + +V+ +QV +++ A+
Sbjct: 182 NEVDAGVVDPRQLLQFDDPAYYRYMGSYTAPPCTEDITWTVIKKLGTVSPKQVLMLKQAV 241

Query: 750 HDESKTNARPLQTINDRFV 806
           ++ S  NARPLQ +  R V
Sbjct: 242 NENSMNNARPLQPLKFRTV 260



>gb:AP005110_1848013 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0605D08.>gb:AP005798_1857966 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:B1136H02.
          Length = 266

 Score =  184 bits (468), Expect = 2e-45
 Identities = 99/261 (37%), Positives = 152/261 (58%), Gaps = 6/261 (2%)
 Frame = +3

Query: 51  SIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLES 230
           S  F+ L  TH++ +   D +  F Y  ++  GP HWG L P +  CS G  Q+PI++  
Sbjct: 7   SAIFVALLCTHILVNHACDSDVVFGYSGST--GPEHWGSLSPNFTTCSKGTYQSPINILK 64

Query: 231 KPVVYS-NLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSE 407
              VY+  L P++  Y     T+ ++ + + L +      + ++G +Y  RQ+HWH PSE
Sbjct: 65  DDAVYNPKLEPLEMDYTAANTTIVDNVFNIALRYNDTAGTVKVDGKKYKLRQLHWHSPSE 124

Query: 408 HVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKL-AETPGVKKG 584
           H +NG R+ +E H+VH S+DG I V+AV+Y+ G+ P+P L  I+D L  L  E    +KG
Sbjct: 125 HTINGQRFAVELHMVHHSDDGNITVIAVLYRHGK-PDPFLFQIKDKLAALYLEGCKAEKG 183

Query: 585 ----IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH 752
               +G +D   L+    RY+RY+GSLTTPPCTE V+W +   IR +TK+Q A +R  +H
Sbjct: 184 EPLPVGLVDMRELKKGADRYFRYVGSLTTPPCTENVIWNIFGEIREMTKEQAAALRAPLH 243

Query: 753 DESKTNARPLQTINDRFVKVD 815
              + N RP Q +N R V+++
Sbjct: 244 GSYRHNRRPTQPLNGRTVQLN 264



>pir|T49025|T49025 carbonate dehydratase (EC 4.2.1.1) [similarity] -
           Arabidopsis thaliana>gb:ATF3C22_1550583 Arabidopsis
           thaliana DNA chromosome 3, BAC clone
           F3C22.>gb:ATU73462_1557219 Arabidopsis thaliana carbonic
           anhydrase (CAH1) mRNA, partial cds.
          Length = 284

 Score =  177 bits (448), Expect = 5e-43
 Identities = 93/267 (34%), Positives = 152/267 (56%), Gaps = 6/267 (2%)
 Frame = +3

Query: 30  MDMLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQ 209
           M ++ +  + F  +S+  +  +    +   F Y      GP+ WG L P +  C+ GK+Q
Sbjct: 1   MKIMMMIKLCFFSMSLICIAPADAQTEGVVFGY--KGKNGPNQWGHLNPHFTTCAVGKLQ 58

Query: 210 TPIDLESKPVVYSN-LGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQV 386
           +PID++ + + Y++ L  I   Y    ATL NH   + + +  G   + I    Y   Q+
Sbjct: 59  SPIDIQRRQIFYNHKLNSIHREYYFTNATLVNHVCNVAMFFGEGAGDVIIENKNYTLLQM 118

Query: 387 HWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAE- 563
           HWH PSEH ++G +Y  E H+VH + DG  AV+A +++IG T  P LS +++ L KL E 
Sbjct: 119 HWHTPSEHHLHGVQYAAELHMVHQAKDGSFAVVASLFKIG-TEEPFLSQMKEKLVKLKEE 177

Query: 564 ----TPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVA 731
                   +  +G +D   ++ + R+YYRY+GSLTTPPC+E V WT++  +RS++K+QV 
Sbjct: 178 RLKGNHTAQVEVGRIDTRHIERKTRKYYRYIGSLTTPPCSENVSWTILGKVRSMSKEQVE 237

Query: 732 LIRNAIHDESKTNARPLQTINDRFVKV 812
           L+R+ +    K N+RP Q +N R V++
Sbjct: 238 LLRSPLDTSFKNNSRPCQPLNGRRVEM 264



>pir|D86215|D86215 protein T6D22.14 [imported] - Arabidopsis
           thaliana>gb:AE005172_889813 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC026875_1539727 Genomic sequence for
           Arabidopsis thaliana BAC T6D22 from chromosome I,
           complete sequence.
          Length = 2254

 Score =  175 bits (443), Expect = 2e-42
 Identities = 86/241 (35%), Positives = 135/241 (56%), Gaps = 3/241 (1%)
 Frame = +3

Query: 87  IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPI 263
           I  + ++DE  F+Y++  ++GP +WG L+PEW  C  G MQ+PIDL  K V+   NLG +
Sbjct: 10  ITKKNIEDETQFNYEKKGEKGPENWGRLKPEWAMCGKGNMQSPIDLTDKRVLIDHNLGYL 69

Query: 264 QNYYMRDVATLENHGYGMMLSWPLGQRYLGI--NGIRYLFRQVHWHFPSEHVVNGTRYDL 437
           ++ Y+   AT++N G+ +M+ +  G   LGI  NG  Y  +Q+HWH PSEH +NG RY  
Sbjct: 70  RSQYLPSNATIKNRGHDIMMKFEGGNAGLGITINGTEYKLQQIHWHSPSEHTLNGKRY-- 127

Query: 438 EAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQA 617
                                               LK++ +T   ++ +  + P     
Sbjct: 128 ------------------------------------LKRITDTHESQEFVEMVHPRTFGF 151

Query: 618 RGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTIND 797
             + YYR++GSLTTPPC+E V+WT+ + +R+VT +Q+ ++R  +HD+S +NARPLQ  N+
Sbjct: 152 ESKHYYRFIGSLTTPPCSENVIWTISKEMRTVTLKQLIMLRVTVHDQSNSNARPLQRKNE 211

Query: 798 R 800
           R
Sbjct: 212 R 212



>gb:ATF21E1_1549583 Arabidopsis thaliana DNA chromosome 5, BAC clone
           F21E1 (ESSA project).>gb:AY088872_1573880 Arabidopsis
           thaliana clone 97982 mRNA, complete sequence.
          Length = 277

 Score =  173 bits (438), Expect = 8e-42
 Identities = 92/253 (36%), Positives = 140/253 (55%), Gaps = 2/253 (0%)
 Frame = +3

Query: 54  IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK 233
           + FL LS + +    E +    F Y       PS W  ++ EW  C  GK Q+PI+L  K
Sbjct: 8   VTFLALSSSSLADETETE----FHYKPGEIADPSKWSSIKAEWKICGTGKRQSPINLTPK 63

Query: 234 --PVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSE 407
              +V+++   +Q YY    A L+N G+ M + W      + IN   Y   Q HWH PSE
Sbjct: 64  IARIVHNSTEILQTYYKPVEAILKNRGFDMKVKWEDDAGKIVINDTDYKLVQSHWHAPSE 123

Query: 408 HVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI 587
           H ++G R  +E H+VH S +G +AV+ V+++ GE PN  +S I D + K+A+    +  I
Sbjct: 124 HFLDGQRLAMELHMVHKSVEGHLAVIGVLFREGE-PNAFISRIMDKIHKIADVQDGEVSI 182

Query: 588 GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT 767
           G +DP        ++Y Y GSLTTPPCTE V+WT+I  + +V+++Q+ ++ +A     + 
Sbjct: 183 GKIDPREFGWDLTKFYEYRGSLTTPPCTEDVMWTIINKVGTVSREQIDVLTDARRGGYEK 242

Query: 768 NARPLQTINDRFV 806
           NARP Q +N R V
Sbjct: 243 NARPAQPLNGRLV 255



>gb:AB009049_1510599 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MCD7.
          Length = 350

 Score =  164 bits (416), Expect = 3e-39
 Identities = 93/239 (38%), Positives = 131/239 (54%), Gaps = 3/239 (1%)
 Frame = +3

Query: 99  EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYY 275
           EV+DE  FSY+   ++GP+ WG L  EW  C  GKMQ+PIDL  K VV SN  G +++ Y
Sbjct: 133 EVEDETEFSYETKGNKGPAKWGTLDAEWKMCGIGKMQSPIDLRDKNVVVSNKFGLLRSQY 192

Query: 276 MRDVATLENHGYGMMLSWPLGQRYLG--INGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL 449
           +    T++N G+ +ML +  G + +G  I G RY  +Q+HWH PSEH +NG R+ LE HL
Sbjct: 193 LPSNTTIKNRGHDIMLKFKGGNKGIGVTIRGTRYQLQQLHWHSPSEHTINGKRFALEEHL 252

Query: 450 VHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRR 629
           VH S D R AV+A +Y +G + +P L  +E  LKK+ +T   ++                
Sbjct: 253 VHESKDKRYAVVAFLYNLGAS-DPFLFSLEKQLKKITDTHASEE---------------- 295

Query: 630 YYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV 806
                                   IR+V+ +QV L+R A+HD S +NARPLQ +N R V
Sbjct: 296 -----------------------HIRTVSSKQVKLLRVAVHDASDSNARPLQAVNKRKV 331



>pir|T10642|T10642 carbonic anhydrase homolog T13K14.160 -
           Arabidopsis thaliana>gb:ATCHRIV54_1545938 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           54.>gb:ATT13K14_1554433 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T13K14 (ESSA project).
          Length = 260

 Score =  164 bits (416), Expect = 3e-39
 Identities = 77/206 (37%), Positives = 128/206 (62%)
 Frame = +3

Query: 87  IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQ 266
           + ++E+ ++  F+Y + +++GP+ WG+L P+W  CS GK+Q+PIDL  + V   +   + 
Sbjct: 26  VYAREIGNKPLFTYKQKTEKGPAEWGKLDPQWKVCSTGKIQSPIDLTDERVSLIHDQALS 85

Query: 267 NYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAH 446
            +Y    A +++ G+ +M+SW      + I+   Y   Q HWH PSEH +NGT YDLE H
Sbjct: 86  KHYKPASAVIQSRGHDVMVSWKGDGGKITIHQTDYKLVQCHWHSPSEHTINGTSYDLELH 145

Query: 447 LVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGR 626
           +VH S  G+  V+ V+Y++GE P+  L+ I + +K + +    +  +G +DP  ++    
Sbjct: 146 MVHTSASGKTTVVGVLYKLGE-PDEFLTKILNGIKGVGKK---EIDLGIVDPRDIRFETN 201

Query: 627 RYYRYMGSLTTPPCTEGVVWTVIRTI 704
            +YRY+GSLT PPCTEGV+WTV + +
Sbjct: 202 NFYRYIGSLTIPPCTEGVIWTVQKRV 227



>gb:OSJN00141_1695582 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OJ000126_13, complete
           sequence.>gb:OSJN00148_1695674 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0073L04, complete
           sequence.
          Length = 276

 Score =  163 bits (413), Expect = 6e-39
 Identities = 93/257 (36%), Positives = 141/257 (54%), Gaps = 6/257 (2%)
 Frame = +3

Query: 60  FLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV 239
           F+LL  T  + S   D   G  +      GP  WG L  ++ +CS GK Q+PID+++  +
Sbjct: 10  FVLLLCTLFLPSLACDSG-GVKFGYTGSIGPDFWGNLSADFTRCSNGKQQSPIDIDTNNL 68

Query: 240 VYS-NLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVV 416
           V+  N+ P+   Y    ATL ++ + + L +      L ING++Y  +Q+HWH PSEH +
Sbjct: 69  VHELNMEPLHRNYTAANATLVDNIFNVALRYEEAAGVLSINGVKYTLKQMHWHSPSEHTI 128

Query: 417 NGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKL-AETPGVKKG--- 584
           NG R+ LE H+VH + +G I VLA +Y+ G  P+P     +D L  L AE    +KG   
Sbjct: 129 NGFRFPLELHMVHTNENGNITVLAFLYRFGR-PDPFFE--QDKLAALNAEGCKAEKGSPV 185

Query: 585 -IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES 761
             G +    ++     YYRY+GSLTTPPC E V+W +    R +T QQ A +   + +  
Sbjct: 186 PAGSVSLLTMRQHVHIYYRYVGSLTTPPCAENVIWNIPAMPREMTPQQAADLMAPLDEGY 245

Query: 762 KTNARPLQTINDRFVKV 812
           + N+RP Q +N R V++
Sbjct: 246 RRNSRPTQQMNGRTVQL 262



>gb:AE006227_216793 Pasteurella multocida subsp. multocida str. Pm70
           section 194 of 204 of the complete
           genome.>gb:AE004439_1119523 Pasteurella multocida subsp.
           multocida str. Pm70, complete genome.
          Length = 252

 Score =  148 bits (374), Expect = 2e-34
 Identities = 81/250 (32%), Positives = 130/250 (52%)
 Frame = +3

Query: 57  AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKP 236
           A  L + T  +K +E    WG++  E+    P HW EL P++  C  GK QTPID+  K 
Sbjct: 13  ALALTACTSPLKKEETHTHWGYTGHES----PEHWAELSPKFRICGEGKNQTPIDI--KH 66

Query: 237 VVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVV 416
            +   L PI+  Y      + N+G+ + + +      + +NG  +  +Q H+H PSE+++
Sbjct: 67  TIDGKLAPIKLDYRPSNVEIVNNGHTIQVDFKEASNRMQLNGKTFTLKQFHFHVPSENLI 126

Query: 417 NGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYL 596
            G  + +EAH VH  N+G +AVL V+Y +      +  + ++  +K  E   +       
Sbjct: 127 RGKSFPMEAHFVHADNEGNLAVLGVLYVLSSENQRLAPIWQNFPQKAGEKYTLSTA---F 183

Query: 597 DPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNAR 776
           DP  L  + R YYR+ GSLTTPPC+EGV W V++   ++++ QV      +      N R
Sbjct: 184 DPATLIPKKRDYYRFSGSLTTPPCSEGVNWLVLKHYDNISQSQVEAFATLMKGH---NNR 240

Query: 777 PLQTINDRFV 806
           P+Q IN R +
Sbjct: 241 PVQPINARVI 250



>gb:BA000032_710042 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 2, complete sequence.
          Length = 238

 Score =  140 bits (352), Expect = 7e-32
 Identities = 82/231 (35%), Positives = 126/231 (54%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQNYYMRDVAT 293
           WG+        GP HWGE   E   C+ GK Q+PID+ S     + L  +Q  Y   V  
Sbjct: 23  WGYE----GSHGPEHWGEFASE---CAQGKNQSPIDIHS--ATQAELAKLQLDYQGKVVA 73

Query: 294 LENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGR 473
           L N+G+ +  S   G+  L I+   +  +Q H+H PSE+ V+G  Y LEAH VH    G 
Sbjct: 74  LTNNGHTLQTSIE-GENVLTIDSKAFTLKQFHFHTPSENHVDGKSYPLEAHYVHADEQGN 132

Query: 474 IAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSL 653
           +AV+AV ++ G+  NP L+ + +++ +  +   ++      D N L    + YYR+ GSL
Sbjct: 133 LAVVAVFFEQGKA-NPALANLLENVPERDQNVAIR---APFDANALIPSDKDYYRFNGSL 188

Query: 654 TTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV 806
           TTPPC+EGV W VI+  +S++ +Q+A   + + +    N RP+Q +N R V
Sbjct: 189 TTPPCSEGVRWLVIKDPQSISAEQIAQFEHVMGE----NNRPVQPLNARMV 235



>sp|Q50940|CAH_NEIGO Carbonic anhydrase precursor (EC 4.2.1.1)
           (Carbonate dehydratase).>gb:AE004969_60336 Neisseria
           gonorrhoeae FA 1090, complete genome.>gb:MGCAH_143440
           N.gonorrhoeae CAH gene.
          Length = 252

 Score =  140 bits (352), Expect = 7e-32
 Identities = 79/231 (34%), Positives = 124/231 (53%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQNYYMRDVAT 293
           WG++  ++    P  WG L  E+  CS GK Q+P+++     V   L  I+  Y   +  
Sbjct: 33  WGYTGHDS----PESWGNLSEEFRLCSTGKNQSPVNITE--TVSGKLPAIKVNYKPSMVD 86

Query: 294 LENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGR 473
           +EN+G+ + +++P G   L +NG  Y  +Q H+H PSE+ + G  + +EAH VH+  + +
Sbjct: 87  VENNGHTIQVNYPEGGNTLTVNGRTYTLKQFHFHVPSENQIKGRTFPMEAHFVHLDENKQ 146

Query: 474 IAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSL 653
             VLAV+Y+ G+T   + S+       +  T G  K     D + L  +  +YYR+ GSL
Sbjct: 147 PLVLAVLYEAGKTNGRLSSI----WNVMPMTAGKVKLNQPFDASTLLPKRLKYYRFAGSL 202

Query: 654 TTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV 806
           TTPPCTEGV W V++T   + + Q      A+  E   N RP+Q +N R V
Sbjct: 203 TTPPCTEGVSWLVLKTYDHIDQAQAEKFTRAVGSE---NNRPVQPLNARVV 250



>gb:AP004693_1843529 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0461F06.
          Length = 229

 Score =  138 bits (348), Expect = 2e-31
 Identities = 72/182 (39%), Positives = 111/182 (60%), Gaps = 3/182 (1%)
 Frame = +3

Query: 36  MLKLFSIAFLLLS--VTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQ 209
           +L L + A LLL+  V      +E D E  F+Y    ++GP HWG+L+PEW QC AG+MQ
Sbjct: 6   LLVLLAAASLLLATAVPAARAQEETDHEEEFTYISGDEKGPEHWGKLKPEWAQCGAGEMQ 65

Query: 210 TPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQV 386
           +PIDL  + V +  +LG + + Y    A++ N G+ +M+ +      + ING  Y  RQ+
Sbjct: 66  SPIDLSHERVKLVRDLGYLDDSYRAAEASIVNRGHDIMVRFDGDAGSVVINGTAYYLRQL 125

Query: 387 HWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAET 566
           HWH P+EH V+G RYD+E H+VH S + + AV+ ++Y++G  P+  L  +E  LK +A+ 
Sbjct: 126 HWHSPTEHSVDGRRYDMELHMVHESAEKKAAVIGLLYEVGR-PDRFLQKMEPYLKMIADK 184

Query: 567 PG 572
            G
Sbjct: 185 EG 186



>gb:BA000038_724425 Vibrio vulnificus YJ016 DNA, chromosome II,
           complete sequence.
          Length = 257

 Score =  135 bits (339), Expect = 2e-30
 Identities = 83/232 (35%), Positives = 122/232 (52%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQNYYMRDVA 290
           EWG+        GP HWGE+  E   C+ GK Q+PID+       ++L  +  +Y   V 
Sbjct: 40  EWGYE----GKHGPEHWGEIAKE---CAMGKNQSPIDIRQP--TQADLKGLDLHYSGQVI 90

Query: 291 TLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG 470
            L N+G+ +  S   G+  L I+G  +  +Q H+H PSE+++ G +Y LEAH VH    G
Sbjct: 91  ALSNNGHTLQGSLS-GENVLDIDGKSFELKQFHFHTPSENLIQGKQYPLEAHFVHADKAG 149

Query: 471 RIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGS 650
            +AV+AVM++ G     + SLI     K+ +     K     D N L      YYR+ GS
Sbjct: 150 NLAVVAVMFESGSQNQALNSLI----AKVPKAGEEVKLAQAFDVNDLIPAHAEYYRFNGS 205

Query: 651 LTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV 806
           LTTPPC+EGV W VI+    ++  Q  ++  A+ +    N RP+Q +N R V
Sbjct: 206 LTTPPCSEGVRWFVIKEASELSPTQTHVLMQAMGE----NNRPVQPLNARVV 253



>gb:AE016813_339174 Vibrio vulnificus CMCP6 chromosome II section 6
           of 6 of the complete sequence.>gb:AE016796_1048898
           Vibrio vulnificus CMCP6 chromosome II complete sequence.
          Length = 240

 Score =  134 bits (338), Expect = 3e-30
 Identities = 83/232 (35%), Positives = 121/232 (52%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQNYYMRDVA 290
           EWG+        GP HWGE+  E   C+ GK Q+PID+       ++L  +  +Y   V 
Sbjct: 23  EWGYE----GKHGPEHWGEIAKE---CAMGKNQSPIDIRQP--TQADLKGLDLHYSGQVI 73

Query: 291 TLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG 470
            L N+G+ +  S   G+  L I+G  +  +Q H+H PSE+++ G +Y LEAH VH    G
Sbjct: 74  ALSNNGHTLQGSLS-GENVLDIDGKSFELKQFHFHTPSENLIQGKQYPLEAHFVHADKAG 132

Query: 471 RIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGS 650
            +AV+AVM++ G     + SLI     K+ +     K     D N L      YYR+ GS
Sbjct: 133 NLAVVAVMFESGSQNQALNSLI----AKVPKAGEEVKLAQAFDVNDLIPAHSEYYRFNGS 188

Query: 651 LTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV 806
           LTTPPC+EGV W VI+    ++  Q  ++  A+      N RP+Q +N R V
Sbjct: 189 LTTPPCSEGVRWLVIKEASELSPTQTHVLMQAMGQ----NNRPVQPLNARVV 236



>gb:AE012520_283210 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 428 of 460 of the complete
           genome.>gb:AE008922_916492 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 275

 Score =  134 bits (337), Expect = 4e-30
 Identities = 84/239 (35%), Positives = 124/239 (51%), Gaps = 1/239 (0%)
 Frame = +3

Query: 93  SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQNY 272
           +Q    EWG++  E    G  HW EL  E   C  G+  +PIDL  K  + + LG +Q  
Sbjct: 45  TQHDGHEWGYTGPE----GAEHWAELAKENALCGNGQQNSPIDL--KDAIDATLGKLQLD 98

Query: 273 YMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLV 452
           Y      + N G+ + L    G   + + G +Y   Q+H+H PSEH++NG R+ +EAH+V
Sbjct: 99  YGAVPLVVRNTGHSIQLDLHAGGT-MRVGGKQYDALQLHFHHPSEHLLNGRRFPMEAHIV 157

Query: 453 HVSNDGRIAVLAVMYQIGETPNPILSLIEDDL-KKLAETPGVKKGIGYLDPNLLQARGRR 629
           H   DG + VLA+ ++ G+  NP    + D +     +T  V   +      L  A  R 
Sbjct: 158 HQGPDGTLGVLAIFFETGKA-NPAFQRVLDAMPSDKNQTRQVADAVVRASDFLPPANQRS 216

Query: 630 YYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV 806
           +YRY GSLTTPPC+E V W V+     V+++Q+    NA       NARPLQ ++ RF+
Sbjct: 217 FYRYEGSLTTPPCSETVDWVVLSQPVQVSREQI----NAFERVYPFNARPLQPLDRRFL 271



>gb:CR378673_96638 Photobacterium profundum SS9; segment 11/12.
          Length = 241

 Score =  134 bits (337), Expect = 4e-30
 Identities = 79/232 (34%), Positives = 126/232 (54%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQNYYMRDVA 290
           EW ++     + G  HWG+    +  C+ G  QTPID+       + L P+   Y   V 
Sbjct: 25  EWSYT----GEHGTEHWGD---SFATCAEGVNQTPIDINQ--TTQAELAPLHLDYEGQVT 75

Query: 291 TLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG 470
            L N+G+ +  +   G+  L ++G  +  +Q H+H PSE+ + G +Y LEAH VH ++ G
Sbjct: 76  ELVNNGHTIQANLT-GKNTLTVDGKTFELKQFHFHTPSENYLKGKQYPLEAHFVHATDKG 134

Query: 471 RIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGS 650
            +AV+AVM+  G   N  L+ +   +    +T  +K+    L+P  L  R R YYR+ GS
Sbjct: 135 ELAVVAVMFDFGPRSNNELTTLLASIPSKGQTVELKEA---LNPADLLPRDREYYRFNGS 191

Query: 651 LTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV 806
           LTTPPC+EGV W V++  ++ +K Q   ++  + +    NARPLQ +N R +
Sbjct: 192 LTTPPCSEGVRWFVMQEPQTSSKAQTEKLQAVMGN----NARPLQPLNARLI 239



>pir|F82479|F82479 carbonic anhydrase VCA0274 [imported] - Vibrio
           cholerae  (strain N16961 serogroup O1)>gb:AE004367_53415
           Vibrio cholerae O1 biovar eltor str. N16961 chromosome
           II, section 24 of 93 of the complete
           chromosome.>gb:AE003853_1050361 Vibrio cholerae O1
           biovar eltor str. N16961 chromosome II, complete
           chromosome.
          Length = 239

 Score =  134 bits (337), Expect = 4e-30
 Identities = 81/232 (34%), Positives = 124/232 (53%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQNYYMRDVA 290
           EWG+      +  P HWG++ P    C+ GK Q+PID+     V ++L P    Y   V 
Sbjct: 22  EWGYE----GEHAPEHWGKVAP---LCAEGKNQSPIDVAQS--VEADLQPFTLNYQGQVV 72

Query: 291 TLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDG 470
            L N+G+ +  +   G   L I+G  +  +Q H+H PSE+++ G ++ LEAH VH    G
Sbjct: 73  GLLNNGHTLQ-AIVRGNNPLQIDGKTFQLKQFHFHTPSENLLKGKQFPLEAHFVHADEQG 131

Query: 471 RIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGS 650
            +AV+AVMYQ+G + NP+L ++  D+     +  + +GI   D        + YYR+ GS
Sbjct: 132 NLAVVAVMYQVG-SENPLLKVLTADMPTKGNSTQLTQGIPLAD---WIPESKHYYRFNGS 187

Query: 651 LTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV 806
           LTTPPC+EGV W V++    ++ QQ   +   +      N RP+Q  N R V
Sbjct: 188 LTTPPCSEGVRWIVLKEPAHLSNQQEQQLSAVMGH----NNRPVQPHNARLV 235



>pir|T10641|T10641 carbonic anhydrase homolog T13K14.150 -
           Arabidopsis thaliana>gb:ATCHRIV54_1545937 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           54.>gb:ATT13K14_1554432 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T13K14 (ESSA project).
          Length = 150

 Score =  134 bits (336), Expect = 5e-30
 Identities = 58/126 (46%), Positives = 89/126 (70%)
 Frame = +3

Query: 381 QVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLA 560
           Q HWH PSEH VNGTRYDLE H+VH S  GR AV+ V+Y++GE PN  L+ + + +K + 
Sbjct: 12  QCHWHSPSEHTVNGTRYDLELHMVHTSARGRTAVIGVLYKLGE-PNEFLTKLLNGIKAVG 70

Query: 561 ETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIR 740
                +  +G +DP  ++ + R++YRY+GSLT PPCTEGV+WTV++ + +++ +Q+  +R
Sbjct: 71  NK---EINLGMIDPREIRFQTRKFYRYIGSLTVPPCTEGVIWTVVKRVNTISMEQITALR 127

Query: 741 NAIHDE 758
            A+ D+
Sbjct: 128 QAVDDQ 133



>gb:BA000032_708761 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 2, complete sequence.
          Length = 239

 Score =  133 bits (335), Expect = 7e-30
 Identities = 86/256 (33%), Positives = 135/256 (52%)
 Frame = +3

Query: 39  LKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI 218
           L  FS++ L LS            EWG+  D++   GP HWGE+  +   C+  K Q+PI
Sbjct: 5   LLAFSLSLLTLSAAQA-------SEWGYGNDKH---GPEHWGEIAKD---CATTKNQSPI 51

Query: 219 DLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF 398
           ++E+     + L  +   Y   V  L N+G+ +      G+    I+G  +  +Q H+H 
Sbjct: 52  NIENP--ADAKLEALNPSYTGQVIGLTNNGHTLQAQVN-GRNSFTIDGETFELQQFHFHT 108

Query: 399 PSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
           PSE+ + G +Y LEAH VH + DG +AV++VM+  G+  N  LS + + + +  +T   K
Sbjct: 109 PSENQIKGRQYPLEAHFVHANEDGELAVISVMFDAGD-QNAALSKLINAIPQENQTTFFK 167

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE 758
                 + N L  +   YYR+ GSLTTPPC+EGV W V++  ++++K Q A +   +   
Sbjct: 168 ---DTFEINDLLPKTANYYRFNGSLTTPPCSEGVRWFVLKDTQTLSKDQAAKLMEVMGQ- 223

Query: 759 SKTNARPLQTINDRFV 806
              N RPLQ +N R V
Sbjct: 224 ---NNRPLQPLNARVV 236



>gb:AY054466_1563121 Arabidopsis thaliana carbonic anhydrase (CAH1)
           (At3g52720; F3C22_120) mRNA, complete
           cds.>gb:AY081665_1568925 Arabidopsis thaliana carbonic
           anhydrase (CAH1) (At3g52720) mRNA, complete cds.
          Length = 188

 Score =  133 bits (334), Expect = 9e-30
 Identities = 65/158 (41%), Positives = 100/158 (63%), Gaps = 5/158 (3%)
 Frame = +3

Query: 354 INGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSL 533
           I    Y   Q+HWH PSEH ++G +Y  E H+VH + DG  AV+A +++IG T  P LS 
Sbjct: 12  IENKNYTLLQMHWHTPSEHHLHGVQYAAELHMVHQAKDGSFAVVASLFKIG-TEEPFLSQ 70

Query: 534 IEDDLKKLAE-----TPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIR 698
           +++ L KL E         +  +G +D   ++ + R+YYRY+GSLTTPPC+E V WT++ 
Sbjct: 71  MKEKLVKLKEERLKGNHTAQVEVGRIDTRHIERKTRKYYRYIGSLTTPPCSENVSWTILG 130

Query: 699 TIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV 812
            +RS++K+QV L+R+ +    K N+RP Q +N R V++
Sbjct: 131 KVRSMSKEQVELLRSPLDTSFKNNSRPCQPLNGRRVEM 168



>gb:NGU11547_152695 Neisseria gonorrhoeae MS11 UvrB (uvrB) gene,
           complete cds, and (ORF1) and (ORF2) genes, partial cds.
          Length = 203

 Score =  128 bits (322), Expect = 2e-28
 Identities = 73/210 (34%), Positives = 114/210 (54%)
 Frame = +3

Query: 177 EWWQCSAGKMQTPIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGI 356
           E+  CS GK Q+P+++     V   L  I+  Y   +  +EN+G+ + +++P G   L +
Sbjct: 1   EFRLCSTGKNQSPVNITE--TVSGKLPAIKVNYKPSMVDVENNGHTIQVNYPEGGNTLTV 58

Query: 357 NGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLI 536
           NG  Y  +Q H+H PSE+ + G  + +EAH VH+  + +  VLAV+Y+ G+T   + S+ 
Sbjct: 59  NGRTYTLKQFHFHVPSENQIKGRTFPMEAHFVHLDENKQPLVLAVLYEAGKTNGRLSSI- 117

Query: 537 EDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVT 716
                 +  T G  K     D + L  +  +YYR+ GSLTTPPCTEGV W V++T   + 
Sbjct: 118 ---WNVMPMTAGKVKLNQPFDASTLLPKRLKYYRFAGSLTTPPCTEGVSWLVLKTYDHID 174

Query: 717 KQQVALIRNAIHDESKTNARPLQTINDRFV 806
           + Q      A+  E   N RP+Q +N R V
Sbjct: 175 QAQAEKFTRAVGSE---NNRPVQPLNARVV 201



>gb:CP000023_875509 Streptococcus thermophilus LMG 18311, complete
           genome.
          Length = 260

 Score =  128 bits (321), Expect = 3e-28
 Identities = 80/246 (32%), Positives = 128/246 (52%)
 Frame = +3

Query: 72  SVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN 251
           S T    S+  D +WG++       GP HWG+L  ++     GK Q+PI++     V  +
Sbjct: 26  SDTKTEASKPKDVQWGYT----GSTGPDHWGDLSKDYELSKNGKEQSPINITGAEDV--D 79

Query: 252 LGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRY 431
           L  +        A +EN+G+ + +S+   +  L I    Y  +Q H+H P+E+ ++G  Y
Sbjct: 80  LPELNLNNQESEAQVENNGHTIEVSFKNPKNTLTIGKEVYKLQQFHFHAPAENEIDGKTY 139

Query: 432 DLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLL 611
            LE H V+ +++G+I V++V+Y  G+  N  L LI D + + A T         + P+  
Sbjct: 140 PLEGHFVYKTDNGKITVVSVLYNYGD-KNQALQLIWDKMPQAANTETDLSQA--ISPDDF 196

Query: 612 QARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTI 791
               + YY + GSLTTPPCTEGV W V ++  +V+K+QV      +  E   N RP+Q  
Sbjct: 197 YPENKDYYNFEGSLTTPPCTEGVNWIVFKSQETVSKEQVEKFSQTLGFE---NNRPIQDA 253

Query: 792 NDRFVK 809
           N R +K
Sbjct: 254 NGRKIK 259



>sp|P94170|CAH_ANASP Carbonic anhydrase precursor (EC 4.2.1.1)
           (Carbonate dehydratase).>pir|AB2172|AB2172 carbonic
           anhydrase [imported] - Nostoc sp. (strain PCC
           7120)>gb:APU72708_582422 Anabaena PCC7120 carbonic
           anhydrase (ecaA) gene, complete cds.>gb:BA000019_683918
           Nostoc sp. PCC 7120 DNA, complete genome.
          Length = 264

 Score =  127 bits (319), Expect = 5e-28
 Identities = 90/264 (34%), Positives = 129/264 (48%), Gaps = 7/264 (2%)
 Frame = +3

Query: 36  MLKLFSIAFLLLSVTHVIKS--QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQ 209
           +LKL  ++ L  S +  + S  +     WG+        GP HWGEL P++  C  G+ Q
Sbjct: 10  LLKLLGMSVLGTSFSSCVTSPARAKTVNWGYI----GKVGPEHWGELSPDFALCQIGRKQ 65

Query: 210 TPIDLES---KPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFR 380
           TPIDL+    K V  S+   +   Y      L N+G  + +++  G  YL     ++   
Sbjct: 66  TPIDLQIADVKDVHSSSQDLLVTNYQPTALHLINNGKTVQVNYQPGS-YLKYAHQKFELL 124

Query: 381 QVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLA 560
           Q H+H  SEH V+G  YD+E HLVH S  G +AV+ +  Q G   NP L +I D      
Sbjct: 125 QFHFHHFSEHRVDGKLYDMELHLVHRSKSGDLAVMGIFLQAGAF-NPTLQIIWD---ATP 180

Query: 561 ETPGVKKGIG--YLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVAL 734
           +  G  K I    +D +       R++ Y GSLTTPPC+E V+W V+ T    +  Q+A 
Sbjct: 181 QNQGTDKRIEDINIDASQFLPAQHRFFTYSGSLTTPPCSENVLWCVMATPIEASPAQIAK 240

Query: 735 IRNAIHDESKTNARPLQTINDRFV 806
                      NARP+Q +NDR V
Sbjct: 241 FSQMF----PQNARPVQPLNDRLV 260



>gb:BX572595_800410 Rhodopseudomonas palustris CGA009 complete
           genome; segment 3/16.
          Length = 252

 Score =  126 bits (316), Expect = 1e-27
 Identities = 81/231 (35%), Positives = 117/231 (50%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQNYYMRDVAT 293
           WG+      + GP+ WGE+ P    CS G  Q+P+D+ S   V +NL P+Q  +     T
Sbjct: 32  WGYE----GEGGPAKWGEIDPANQICSIGVQQSPVDIRS--TVSANLFPLQVQWADTADT 85

Query: 294 LENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGR 473
           + N+G+ + L+   G   L + G  +   Q H+H PSEH ++G  + +E H VH  + G 
Sbjct: 86  IINNGHTIQLNVAEGST-LKLGGATFKLVQFHFHRPSEHQIDGKSFPMEVHFVHRMDSGT 144

Query: 474 IAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSL 653
           + V+ V+ Q G        ++       +E P VK   G ++PN L      YYRY GSL
Sbjct: 145 LGVVGVLMQEGAANAAFAKIVA--TMPQSEGPAVKADAG-INPNALLPAKLGYYRYEGSL 201

Query: 654 TTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV 806
           TTPPC+E V W V+    +V  + VA    A       NARP+Q  N RFV
Sbjct: 202 TTPPCSEVVDWMVLTDPITVAAEDVA----AFAKLYPMNARPVQKDNRRFV 248



>pir|H83694|H83694 carbonic anhydrase precursor cah [imported] -
           Bacillus halodurans (strain C-125)>gb:BA000004_654306
           Bacillus halodurans C-125 DNA, complete genome.
          Length = 275

 Score =  126 bits (316), Expect = 1e-27
 Identities = 75/223 (33%), Positives = 114/223 (51%), Gaps = 1/223 (0%)
 Frame = +3

Query: 141 DRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMM 320
           D GP HW EL  E+  C+ G+ Q+PI+L+    V ++   IQ +Y     T++N+G+ + 
Sbjct: 55  DTGPEHWAELDSEYGACAQGEEQSPINLDKAEAVDTDT-EIQVHYEPSAFTIKNNGHTIQ 113

Query: 321 LSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQ 500
                    + I+G  Y   Q H+H PSEH + G   D+E H VH + +  +AVL V+ +
Sbjct: 114 AETTSDGNTIEIDGKEYTLVQFHFHIPSEHEMEGKNLDMELHFVHKNENDELAVLGVLMK 173

Query: 501 IGETPNPILSLIED-DLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEG 677
            GE    +  L      ++  E   + + I   D N L    +  + Y GSLTTPPC+EG
Sbjct: 174 AGEENEELAKLWSKLPAEETEENISLDESI---DLNALLPESKEGFHYNGSLTTPPCSEG 230

Query: 678 VVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV 806
           V WTV+    +V+++Q+        D    N RP+Q  NDR V
Sbjct: 231 VKWTVLSEPITVSQEQIDAFAEIFPD----NHRPVQPWNDRDV 269



>gb:AE014991_313910 Streptococcus mutans UA159 section 139 of 185 of
           the complete genome.>gb:AE014133_940911 Streptococcus
           mutans UA159 complete genome.
          Length = 256

 Score =  125 bits (314), Expect = 2e-27
 Identities = 81/256 (31%), Positives = 129/256 (50%), Gaps = 1/256 (0%)
 Frame = +3

Query: 45  LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL 224
           L  +A   +S    +K    D E  +SY  ++   P HWG+L  ++     GK Q+PI++
Sbjct: 11  LVVVAVFCISTFLTLKGDSQDREAHWSYSGSTS--PEHWGDLSDDYKAAKDGKEQSPINI 68

Query: 225 ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS 404
                V  +L  +Q       A +EN+G+ + +     +  L  NG  Y   Q H+H PS
Sbjct: 69  TGAKDV--DLPSLQLNSKNSKAEVENNGHTIEVKLKNKKNTLKFNGKTYTLEQFHFHAPS 126

Query: 405 EHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG 584
           E+ ++G  Y LE H V+ + D +I V++++YQ G+  N  L  +   + + AET   KK 
Sbjct: 127 ENQIDGKTYPLEGHFVYTTKDKKITVISILYQYGK-ENKTLKQVWKKMPQKAET---KKN 182

Query: 585 IGY-LDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES 761
           +   +  + L  +   YY + GSLTTPPCTEGV W V +   +++K QV      +    
Sbjct: 183 LSQPVAISQLFPKDLDYYNFEGSLTTPPCTEGVNWIVFKKQENISKAQVKKFSKTL---G 239

Query: 762 KTNARPLQTINDRFVK 809
             N RP+Q +N R +K
Sbjct: 240 FNNNRPIQKLNGREIK 255



>sp|O52535|CAH_KLEPN Carbonic anhydrase precursor (EC 4.2.1.1)
           (Carbonate dehydratase).>gb:AF040380_472212 Klebsiella
           pneumoniae ribosomal protein L11 methyltransferase
           (prmA) gene, partial cds; carbonic anhydrase (cah) and
           yhdG homolog genes, complete cds; and small DNA binding
           protein Fis (fis) gene, partial cds.
          Length = 246

 Score =  125 bits (314), Expect = 2e-27
 Identities = 76/230 (33%), Positives = 129/230 (56%), Gaps = 1/230 (0%)
 Frame = +3

Query: 120 FSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQNYYMRDVATLE 299
           +SY+   +  P HWG L  E+  C  G  Q+PI++++     ++L P+  +Y+    TL 
Sbjct: 25  WSYE--GEGSPEHWGALNEEYKTCQNGMNQSPINIDA--TFKTHLSPLDTHYIDGPITLI 80

Query: 300 NHGYGMMLSWPLGQR-YLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRI 476
           N+G+ +  +        + I+G  ++ +Q H+H PSE+ V+G  Y +E HLVH +  G +
Sbjct: 81  NNGHTIQAALKTTTADTITIDGTPFILQQFHFHAPSENTVHGKHYAMEMHLVHKNAKGAV 140

Query: 477 AVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLT 656
           AV+AVM++ G   N  L+ +   + + AE     K +  +D N L    + Y+R+ GSLT
Sbjct: 141 AVVAVMFEQG-AENTELNKLWATMPEQAEQ--TAKIVTQMDLNALLPIDKTYWRFSGSLT 197

Query: 657 TPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV 806
           TPPC+EGV   V++   +++  Q+A   +A+H +   N RP+Q +N R V
Sbjct: 198 TPPCSEGVTRIVLKHPLTLSSAQLAKFSHAMHHD---NNRPVQPLNGRVV 244



>gb:AE016827_343434 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 224

 Score =  125 bits (313), Expect = 2e-27
 Identities = 72/222 (32%), Positives = 114/222 (51%), Gaps = 1/222 (0%)
 Frame = +3

Query: 36  MLKLFSIAFLLLSVTHVIKS-QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQT 212
           M KL S A  LL    ++      +  WG++     D  P +WG L  ++  C+ G+ Q+
Sbjct: 2   MKKLLSTAAALLVSGFILSGCSTTEKHWGYT----GDVSPEYWGGLSDKFKTCAVGQKQS 57

Query: 213 PIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW 392
           P++++ +     +L  +   Y+   AT+ N+G+ +          L ING  Y  +Q H+
Sbjct: 58  PVNIQVQKATDKDLPALNINYLASKATVVNNGHSIQTDLTDENSTLTINGKVYTLKQFHF 117

Query: 393 HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG 572
           H PSE+ ++G    LE H VHV+ DG I V+AV+Y+IG     +  +     +K  E   
Sbjct: 118 HSPSENTIDGQYLPLEGHFVHVAKDGGIVVVAVLYEIGGENAQLADIWAGMPEKAGEKVK 177

Query: 573 VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIR 698
           +K      +P  L +  + YY + GSLTTPPCTEGV W V++
Sbjct: 178 LK---AKFNPATLISSKQSYYSFEGSLTTPPCTEGVDWIVLK 216



>gb:CP000020_871827 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 235

 Score =  122 bits (307), Expect = 1e-26
 Identities = 87/257 (33%), Positives = 130/257 (50%), Gaps = 2/257 (0%)
 Frame = +3

Query: 36  MLKLFSIAFLL--LSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQ 209
           M KLF+   +L  LS T    + E    WG++     D GP+HW  +      C  G  Q
Sbjct: 1   MKKLFTTLAVLSALSATPFASASE----WGYT----GDTGPNHWHGV------CQTGVNQ 46

Query: 210 TPIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVH 389
           +PID+ +   + S L PI   Y +    + N+G+ + ++    Q  + + G  +   Q+H
Sbjct: 47  SPIDITN--AIESELEPITFNYGQAGENIVNNGHTVQVNIKSPQS-IQVEGKTFSLLQLH 103

Query: 390 WHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETP 569
           +H PSE+++ G  Y LE HLVH   DG +AV+ VM++ G+  NP L+ I   +    E  
Sbjct: 104 FHAPSENLIAGHSYPLEMHLVHADKDGNLAVVGVMFKEGKA-NPELAKIWSQMPGSGEVT 162

Query: 570 GVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI 749
             KK    L    L    + YYR+ GSLTTPPC+EGV W V++    ++ +Q+A  R   
Sbjct: 163 LDKK----LTLTNLLPNDQAYYRFNGSLTTPPCSEGVTWLVMKNPIEISSEQLAQFRELY 218

Query: 750 HDESKTNARPLQTINDR 800
           +     N RP Q IN R
Sbjct: 219 NG----NNRPTQAINAR 231



>gb:BA000040_729397 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 291

 Score =  120 bits (302), Expect = 4e-26
 Identities = 76/219 (34%), Positives = 118/219 (53%)
 Frame = +3

Query: 150 PSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSW 329
           P+ WG+L      C+ G  Q+PID+E+   + S L  ++  + +   T+ N+G+ + L++
Sbjct: 79  PAKWGDLDAANKACAVGLQQSPIDIEA--TIKSQLPTLKLNWGKSADTIVNNGHTIQLNF 136

Query: 330 PLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGE 509
             G   L +  ++Y   QVH+H PSEH++ G  + +EAH VH ++ G +AV+ V+   G+
Sbjct: 137 AEGST-LTLGDVKYKLLQVHFHRPSEHMIGGKNFPMEAHFVHRNDAGGLAVVGVLMAEGK 195

Query: 510 TPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWT 689
            PNP    I   +   A+ P VK     +DP  +      Y+RY GSLTTPPC+E V W 
Sbjct: 196 -PNPAFGKIVKTM-PAADGPAVKADAS-IDPLAMLPTRLSYFRYPGSLTTPPCSEVVEWL 252

Query: 690 VIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV 806
           ++ T   V+   VA    A       NARP+Q  N R+V
Sbjct: 253 LLTTPIQVSAADVA----AFAKLYPMNARPVQKDNRRYV 287



>gb:BX950851_839014 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 244

 Score =  119 bits (299), Expect = 1e-25
 Identities = 72/253 (28%), Positives = 130/253 (51%)
 Frame = +3

Query: 48  FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLE 227
           FSIA +L +      S  V   WG  Y+ + D  P+HWG+L P++  C  GK Q+P++++
Sbjct: 5   FSIALMLSACFSASASDSV--HWG--YEGSGD--PAHWGKLSPDFSLCETGKNQSPVNIQ 58

Query: 228 SKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSE 407
               + +   P+Q  +      + N+G+ + ++   G   L ++   +  +Q H+H PSE
Sbjct: 59  Q--ALNAQHDPLQLAFQSGTQQIINNGHTVQVNVSSGNTLL-LDNETFALQQFHFHAPSE 115

Query: 408 HVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI 587
           + ++G ++ LE H V+ + DG + V+A+M+Q G     + +  +     + +   V+  I
Sbjct: 116 NEIDGKQFPLEGHFVYKNADGALTVIALMFQEGAANPQLATAWQQIPAHVDQAEDVRTPI 175

Query: 588 GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT 767
                  L      YYR+ GSLTTPPC+EG+ W V+    + + +Q+    + +H     
Sbjct: 176 AI---QALLPTSLNYYRFSGSLTTPPCSEGIRWLVLDHPVTASAEQINQFSSVMH---HA 229

Query: 768 NARPLQTINDRFV 806
           N RP+Q +N R +
Sbjct: 230 NNRPIQPLNGRII 242



>gb:AB022175_3898 Rhodopseudomonas palustris acaP gene for a-type
           carbonic anhydrase, complete cds.
          Length = 255

 Score =  119 bits (299), Expect = 1e-25
 Identities = 81/234 (34%), Positives = 116/234 (49%), Gaps = 3/234 (1%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQNYYMRDVAT 293
           WG+      + GP+ WGEL P    CS G  Q+P+D+ S   V +NL P+Q  +     T
Sbjct: 32  WGYE----GEGGPAKWGELDPANQICSIGVQQSPVDIRS--TVSANLFPLQVQWADTADT 85

Query: 294 LENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGR 473
           + N+G+ + L+   G   L + G  +   Q H+H PSEH ++G  + +E H VH  + G 
Sbjct: 86  IINNGHTIQLNVAEGST-LKLGGATFKLVQFHFHRPSEHQIDGKSFPMEVHFVHRMDSGT 144

Query: 474 ---IAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYM 644
              + V+ V+ Q G        ++       +E P VK     ++PN L      YYRY 
Sbjct: 145 LGVVGVVGVLMQEGAANAAFAKIVA--TMPQSEGPAVKADAA-INPNALLPAKLGYYRYE 201

Query: 645 GSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV 806
           GSLTTPPC+E V W V+    +V  + VA    A       NARP+Q  N RFV
Sbjct: 202 GSLTTPPCSEVVDWMVLTDPITVAAEDVA----AFAKLYPMNARPVQKDNRRFV 251



>sp|O52538|CAH_ERWCA Carbonic anhydrase precursor (EC 4.2.1.1)
           (Carbonate dehydratase).>gb:AF040381_472216 Erwinia
           carotovora ribosomal protein L11 methyltransferase
           (prmA) gene, partial cds; and carbonic anhydrase (cah),
           yhdG homolog, and small DNA binding protein Fis (fis)
           genes, complete cds.
          Length = 244

 Score =  119 bits (299), Expect = 1e-25
 Identities = 70/248 (28%), Positives = 129/248 (52%)
 Frame = +3

Query: 63  LLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVV 242
           L+LSV     S    D   + Y+ N D  P+HWG+L P++  C  GK Q+PI++  +  +
Sbjct: 9   LMLSVCF---SASATDSVHWGYEGNGD--PAHWGKLSPDFSLCETGKNQSPINI--RQAL 61

Query: 243 YSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNG 422
            +   P+Q  +      + N+G+ + ++   G   L ++   +  +Q H+H PSE+ ++G
Sbjct: 62  NAQHDPLQLAFQSGTQQIINNGHTIQVNVSPGNTLL-LDNETFTLQQFHFHAPSENEIDG 120

Query: 423 TRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDP 602
            ++ LE H V+ + DG + V+A+M+Q G     + +  +    ++ +   V+  +     
Sbjct: 121 KQFPLEGHFVYKNADGALTVIALMFQEGAANPQLATAWQQIPARVDQAEDVRTPVAI--- 177

Query: 603 NLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPL 782
             L      YYR+ GSLTTPPC+EG+ W V+    + + +Q++   + +H     N RP+
Sbjct: 178 QALLPTSLNYYRFSGSLTTPPCSEGIRWLVLDHPVTASAEQISQFSSVMH---HANNRPI 234

Query: 783 QTINDRFV 806
           Q +N R +
Sbjct: 235 QPLNGRII 242



>gb:AP006627_565500 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 263

 Score =  118 bits (295), Expect = 3e-25
 Identities = 78/227 (34%), Positives = 114/227 (50%), Gaps = 1/227 (0%)
 Frame = +3

Query: 123 SYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQNYYMRDVATLEN 302
           S+    + GP  WG+L   +  CS GK Q+PI+L       S      +Y      ++EN
Sbjct: 39  SWSYEGETGPEFWGDLDEAFAACSNGKEQSPINLFYDREQTSKWNWAFSY-SEAAFSVEN 97

Query: 303 HGYGMMLSWPLGQRY-LGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIA 479
           +G+ +  +        L ING  Y   Q H+H PSEH +  T + +E HLVH ++ G +A
Sbjct: 98  NGHTIQANVENEDAGGLEINGEAYQLIQFHFHTPSEHTIEETSFPMELHLVHANHAGDLA 157

Query: 480 VLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTT 659
           VL V+ ++G     I ++ E     + E  G       LDPNL        Y+Y GSLTT
Sbjct: 158 VLGVLMEMGNDHEGIEAVWE----VMPEEEGTAAYSISLDPNLFLPESVTAYQYDGSLTT 213

Query: 660 PPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDR 800
           PPC+EGV WTV+    S+++ Q+    +A  D    N RP+Q + DR
Sbjct: 214 PPCSEGVKWTVLNDTISISETQL----DAFRDIYPQNYRPVQELGDR 256



>gb:AE017146_390674 Helicobacter hepaticus ATCC 51449 section 3 of 6
           of the complete genome.>gb:AE017125_1024936 Helicobacter
           hepaticus ATCC 51449 complete genome.
          Length = 247

 Score =  117 bits (294), Expect = 4e-25
 Identities = 71/257 (27%), Positives = 128/257 (49%), Gaps = 6/257 (2%)
 Frame = +3

Query: 60  FLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV 239
           FLL  +T  +++      WG+  D+ +++    W  L P++  C  GK Q+PI+     +
Sbjct: 5   FLLFFITSFLQAAH----WGYGIDDGAEK----WASLSPDYALCKTGKRQSPIN-----I 51

Query: 240 VYSNLGPIQNY------YMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP 401
             S+L P +N       +   V  + N+G+ + +++  G   + +    Y   Q+H+H P
Sbjct: 52  TRSHLKPTENQLRFLYKHQEKVKNIINNGHSVQINFQNGSA-VRLKNTYYSLVQLHFHSP 110

Query: 402 SEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK 581
           SE  + G  + +E H+VH    G   V+A +++ G+    +  +IE   +K+ ++    K
Sbjct: 111 SETQIEGKNFPMEMHIVHQDKQGNTLVIAALFEEGKENPSLHKIIESMPQKVNQS----K 166

Query: 582 GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES 761
             G L+ N +  +   YY + GSLTTPPC E V W V      ++K+Q+   +  +H   
Sbjct: 167 PFGTLNINNILPKQNGYYAFDGSLTTPPCNENVQWVVFVNPIQISKKQIETFQAVLHH-- 224

Query: 762 KTNARPLQTINDRFVKV 812
             NAR +Q + DR ++V
Sbjct: 225 --NARNVQPLGDRVIEV 239



>gb:AY280612_1315642 Anopheles gambiae carbonic anhydrase (CA) mRNA,
           complete cds.
          Length = 309

 Score =  110 bits (276), Expect = 5e-23
 Identities = 84/256 (32%), Positives = 122/256 (47%), Gaps = 25/256 (9%)
 Frame = +3

Query: 108 DEWGFSYDENSD--RGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPI--QNYY 275
           DEW +     +     P  WG       QC  G+ Q+PIDL     V     P+   NY 
Sbjct: 21  DEWNYPTPGTNGVMSEPERWGG------QCDNGRRQSPIDLTIAAAVRGQFAPLFFSNYM 74

Query: 276 MR-DVATLENHGYGMMLS---WPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEA 443
           +      + N G+ + ++     +  +  G+ G R++  Q+H+H+ SEH ++ TRY LE 
Sbjct: 75  LPLKQPRVTNTGHSIQINNRDSAITMQGGGLGG-RFVLDQMHFHWGSEHTLDDTRYGLEL 133

Query: 444 HLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI- 587
           HLVH           V     +AVL V++ +G  PN  +  I D   ++    G +  + 
Sbjct: 134 HLVHHDTRYASLEDAVQARNGVAVLGVLFHVGSQPNMHIDTILDTATEIQNEVGKEALLR 193

Query: 588 GYLDP-NLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD--- 755
           G L P NLL +    +YRY GSLTTP C E V+WTV     SV+ +QV   + AIHD   
Sbjct: 194 GKLSPYNLLPSNRTSFYRYEGSLTTPACAESVIWTVFTESISVSLEQVERFK-AIHDQTG 252

Query: 756 -ESKTNARPLQTINDR 800
            E   N R +Q +N R
Sbjct: 253 RELVNNFRSVQPLNTR 268



>gb:BA000012_670977 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 250

 Score =  110 bits (274), Expect = 8e-23
 Identities = 75/253 (29%), Positives = 115/253 (45%), Gaps = 3/253 (1%)
 Frame = +3

Query: 57  AFLLLSVTHVIK--SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLES 230
           AF+ L V  +    ++     WG+        GP HW +L    + CSAG+ Q+PID+  
Sbjct: 9   AFIALGVCPICAQTARAASAHWGYG----GSVGPEHWADLDTRNFACSAGRQQSPIDIAG 64

Query: 231 KPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEH 410
              V +++  I   +++    + N+G+ + ++ P G      + + Y   Q+H+H PSEH
Sbjct: 65  --TVKADIPRIDISWLKGGGRMVNNGHTIQINMPEGSTLTRGDRV-YQLAQLHFHAPSEH 121

Query: 411 VVNGTRYDLEAHLVHV-SNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI 587
            V G  + +EAH VH  +    + VL+ +   G T N    L     K     PG +  +
Sbjct: 122 HVAGMSFPMEAHFVHKDTKSDTLGVLSALLMPGATNNSFAGLA----KVFPARPGEEMAV 177

Query: 588 GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT 767
              DPN L      Y+ Y GSLTTPPCTE V W V      V    +            +
Sbjct: 178 DEFDPNGLLPASLGYWTYEGSLTTPPCTENVEWMVAMEPVEVDTADIKRFTTLY----AS 233

Query: 768 NARPLQTINDRFV 806
           NAR ++  N RF+
Sbjct: 234 NARSIRPSNRRFI 246



>gb:BX321858_772934 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 3/10.
          Length = 265

 Score =  109 bits (273), Expect = 1e-22
 Identities = 71/221 (32%), Positives = 117/221 (52%), Gaps = 8/221 (3%)
 Frame = +3

Query: 168 LRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYYMRDVATLENHGYGMMLSWP---L 335
           LR  + +C  G+ Q+P+DL    +V +  L  +   Y  D  T  N G+ + ++      
Sbjct: 48  LRYPYAECGIGQHQSPVDLADAKIVSAKPLNKLSAQYKTDTPTFFNTGHAIQVNTSKNFA 107

Query: 336 GQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETP 515
           G   +G   +  +  Q+H+H PSEHV  G ++  E H VH++ DGRIAVL V+  IG+  
Sbjct: 108 GGLKVGKELLPLI--QLHFHEPSEHVFGGKKFPAELHFVHINKDGRIAVLGVVINIGK-E 164

Query: 516 NPILSLIEDDLKK---LAETPG-VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVV 683
           N +   I D++ +    A +P  V+     L P+ + A   +Y    GSLTTPPC+EGV 
Sbjct: 165 NAVFQTILDNMPRHEGEANSPSRVRFNPAKLLPSGVNAANLKYLTLAGSLTTPPCSEGVQ 224

Query: 684 WTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV 806
           W ++    +++  Q+  +++  HD    NAR  Q++N+R +
Sbjct: 225 WYILTKSITISADQLEQMKSFYHD----NARSAQSLNERSI 261



>gb:AP008231_579862 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 237

 Score =  109 bits (273), Expect = 1e-22
 Identities = 73/222 (32%), Positives = 105/222 (47%), Gaps = 2/222 (0%)
 Frame = +3

Query: 126 YDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQNYYMRDVATLENH 305
           +D +  RGP  W +L P +  C  G+ Q+PI+L  +P    +  P+          L+  
Sbjct: 30  WDYSRRRGPRQWAKLDPAYAICQQGRQQSPINLTGQP----DRTPLDYRDRPFKGILQQA 85

Query: 306 GYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVL 485
            + + +  P G  +    G  Y   Q H+H PSEH   G R+  E H VH S+  ++AV+
Sbjct: 86  PHSLRIDCPAGNGFWEA-GTFYELLQFHFHTPSEHQHQGQRFPAEIHFVHRSDRDQLAVV 144

Query: 486 AVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI--GYLDPNLLQARGRRYYRYMGSLTT 659
            V    G+ P PIL  +      LA  P     +    + P  L  R R  +RY GSLTT
Sbjct: 145 GVFLAAGDRPLPILDTL------LAVPPSTDNQLLSTAIQPTDLMPRDRTVWRYSGSLTT 198

Query: 660 PPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQ 785
           PPC+E V+W V      V +QQ+  +R  +      NARPLQ
Sbjct: 199 PPCSEPVLWRVCDRPLFVARQQLRQLRQRL----GMNARPLQ 236



>gb:SPU72501_189660 Synechococcus PCC7942 carbonic anhydrase (ecaA)
           gene, complete cds.
          Length = 237

 Score =  109 bits (272), Expect = 1e-22
 Identities = 72/220 (32%), Positives = 106/220 (48%)
 Frame = +3

Query: 126 YDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQNYYMRDVATLENH 305
           +D +  RGP  W +L P +  C  G+ Q+PI+L  +P    +  P+          L+  
Sbjct: 30  WDYSRRRGPRQWAKLDPAYAICQQGRQQSPINLTGQP----DRTPLDYRDRPFKGILQQA 85

Query: 306 GYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVL 485
            + + +  P G  +    G  Y   Q H+H PSEH   G R+  E H VH S+  ++AV+
Sbjct: 86  PHSLRIDCPAGNGFWEA-GTFYELLQFHFHTPSEHQHQGQRFPAEIHFVHRSDRDQLAVV 144

Query: 486 AVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPP 665
            V    G+ P PIL    D+L  +  +   +     + P  L  R R  +RY GSLTTPP
Sbjct: 145 GVFLAAGDRPLPIL----DNLLAVPPSTDNQLLSTAIQPTDLMPRDRTVWRYSGSLTTPP 200

Query: 666 CTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQ 785
           C+E V+W V      V +QQ+  +R  +      NARPLQ
Sbjct: 201 CSEPVLWRVCDRPLFVARQQLRQLRQRL----GMNARPLQ 236



>gb:CP000024_877436 Streptococcus thermophilus CNRZ1066, complete
           genome.
          Length = 220

 Score =  108 bits (270), Expect = 2e-22
 Identities = 71/219 (32%), Positives = 114/219 (52%), Gaps = 4/219 (1%)
 Frame = +3

Query: 36  MLKLFSIAFLLL---SVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKM 206
           +L L +   LL+   S T    S+  D +WG++       GP HWG+L  ++     GK 
Sbjct: 11  LLSLIAATILLVACQSDTKTEASKPKDVQWGYT----GSTGPDHWGDLSKDYELSKNGKE 66

Query: 207 QTPIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQV 386
           Q+PI++     V  +L  +        A +EN+G+ + +S+   +  L I    Y  +Q 
Sbjct: 67  QSPINITGAEDV--DLPELNLNNQESEAQVENNGHTIEVSFKNPKNTLTIGKEVYKLQQF 124

Query: 387 HWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAET 566
           H+H P+E+ ++G  Y LE H V+ +++G+I V++V+Y  G+  N  L LI D + + A T
Sbjct: 125 HFHAPAENEIDGKTYPLEGHFVYKTDNGKITVVSVLYNYGD-KNQALQLIWDKMPQAANT 183

Query: 567 -PGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGV 680
              + + I   D        + YY + GSLTTPPCTEGV
Sbjct: 184 ETDLSQAISLDD---FYPENKDYYNFEGSLTTPPCTEGV 219



>gb:AE012056_278985 Xanthomonas axonopodis pv. citri str. 306,
           section 434 of 469 of the complete
           genome.>gb:AE008923_920760 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 271

 Score =  107 bits (267), Expect = 5e-22
 Identities = 64/187 (34%), Positives = 97/187 (51%)
 Frame = +3

Query: 246 SNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGT 425
           +NLG +   Y      + N G+ + L    G   +   G +Y   Q+H+H PSEH++NG 
Sbjct: 86  ANLGTLLLSYSAVPLVVRNTGHSIQLDLHDGGS-MATGGKQYQALQLHFHHPSEHLLNGR 144

Query: 426 RYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPN 605
           R+ +EAHLVH   DG + VLA+ ++ G+       +++   K   +T  V       +  
Sbjct: 145 RFPMEAHLVHQGPDGTLGVLAIFFETGKANTAFQRVLDAMPKDKDQTRQVANATVSAEAF 204

Query: 606 LLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQ 785
           L  +  R +YRY GSLTTPPC+E V W V+     V++ Q+    NA       NARPLQ
Sbjct: 205 LPPSNQRSFYRYEGSLTTPPCSETVDWVVLSQPVQVSEAQI----NAFERVYPFNARPLQ 260

Query: 786 TINDRFV 806
            ++ RF+
Sbjct: 261 PLDRRFL 267



>pir|T08078|T08078 carbonate dehydratase (EC 4.2.1.1) precursor,
           alpha type - Chlamydomonas
           reinhardtii>gb:CRU40871_1673691 Chlamydomonas
           reinhardtii intracellular carbonic anhydrase, alpha type
           (CAH3) mRNA, complete cds.>gb:CRU73856_1673732
           Chlamydomonas reinhardtii carbonic anhydrase, alpha type
           (CAH3) gene, nuclear gene encoding chloroplast protein,
           complete cds.
          Length = 310

 Score =  106 bits (265), Expect = 9e-22
 Identities = 85/238 (35%), Positives = 120/238 (50%), Gaps = 18/238 (7%)
 Frame = +3

Query: 156 HWGELR-PEWWQ--CSAGKMQTPIDLE---SKPVVYSNLGPIQNYYMR-DVATLENHGYG 314
           ++GE+  P  W+  C+ GK Q+PI++    S P V + +G     Y   +   + N G+G
Sbjct: 76  NYGEVAGPPTWKGVCATGKRQSPINIPLNTSAPKVDAEMGEFDFAYGSFEKCDVLNTGHG 135

Query: 315 -MMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVS-NDGRIAVLA 488
            M +++P G     I  +     Q H+H PSEH ++G RY +EAHLVH + + G +AVL 
Sbjct: 136 TMQVNFPAGNLAF-IGNMELELLQFHFHAPSEHAMDGRRYAMEAHLVHKNKSTGNLAVLG 194

Query: 489 VMYQIGE-TPNPILSLIEDDLKKLAETPGVK----KGIG--YLDPNLLQARGRRYYRYMG 647
           +M + G    NP LS     L+   E P  K    KGI    L P   +A  R +  Y G
Sbjct: 195 IMLEPGGLIKNPALSTA---LEVAPEVPLAKKPSPKGINPVMLLPKKSKAGTRPFVHYPG 251

Query: 648 SLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES--KTNARPLQTINDRFVKVD 815
           SLTTPPC+EGV W V      V   Q+      + D     TN RPLQ +N R V+ +
Sbjct: 252 SLTTPPCSEGVDWFVFMQPIKVPDSQILDFMRFVGDNKTYATNTRPLQLLNSRLVEYE 309



>gb:MLO672112_148399 Mesorhizobium loti R7A symbiosis island;
           segment 1/4.
          Length = 250

 Score =  106 bits (264), Expect = 1e-21
 Identities = 70/232 (30%), Positives = 106/232 (45%), Gaps = 1/232 (0%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQNYYMRDVAT 293
           WG+        GP HW +L    + CSAG+ Q+PID+     V +++  I   +++    
Sbjct: 30  WGYG----GSVGPEHWADLDTRNFACSAGRQQSPIDIAG--TVKADIPRIDISWLKGGGR 83

Query: 294 LENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHV-SNDG 470
           + N+G+ + ++ P G      + + Y   Q+H+H PSEH V G  + +EAH VH  +   
Sbjct: 84  MVNNGHTIQINMPEGSTLTRGDRV-YQLAQLHFHAPSEHHVAGMSFPMEAHFVHKDTKSD 142

Query: 471 RIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGS 650
            + VL+ +   G T      L     K     PG +  +   DPN L      Y+ Y GS
Sbjct: 143 TLGVLSALLTPGATNKSFAGLA----KVFPARPGEEMAVDEFDPNGLLPASLGYWTYEGS 198

Query: 651 LTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV 806
           LTTPPCTE V W V      V    +            +NAR ++  N RF+
Sbjct: 199 LTTPPCTENVEWMVAMEPVEVDTADIKRFTTLY----ASNARSIRPSNRRFI 246



>gb:AP005655_1855555 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0025H07.
          Length = 223

 Score =  105 bits (263), Expect = 1e-21
 Identities = 55/139 (39%), Positives = 74/139 (53%), Gaps = 2/139 (1%)
 Frame = +3

Query: 120 FSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLES-KPVVYSNLGPIQNYYMRDVATL 296
           F Y EN   GP+ WG L  EW  C  GK Q+PID+ + +P       P+   Y     T+
Sbjct: 56  FGY-ENDATGPAKWGSLHKEWAVCGDGKKQSPIDITTVEPQKVKE--PLMQAYKAGATTI 112

Query: 297 ENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRI 476
           +N G+  ML W  G   L + G  Y  +QVHWH PSEH +NGTR+D E H+VH       
Sbjct: 113 QNRGHDYMLKWKDGNSKLTVQGKEYTLKQVHWHEPSEHTINGTRFDAEMHMVHEDPSMAR 172

Query: 477 AVLAVMYQI-GETPNPILS 530
           AV++V+       PN +L+
Sbjct: 173 AVVSVLLSTKAGQPNAVLT 191



>gb:AE014298_1124683 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003442_1209865 Drosophila melanogaster
           chromosome X, section 26 of 74 of the complete sequence.
          Length = 321

 Score =  103 bits (258), Expect = 6e-21
 Identities = 83/293 (28%), Positives = 139/293 (47%), Gaps = 31/293 (10%)
 Frame = +3

Query: 30  MDMLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQ 209
           +D++ +F+ +  LL ++ V+ S E   EW ++YD  S  GPS WG + P+W  C+ G+ Q
Sbjct: 2   LDLIGIFAHSLSLL-LSEVLSSWE---EW-WTYDGIS--GPSFWGLINPQWNMCNKGRRQ 54

Query: 210 TPIDLESKPVVYS-NLGPIQNYYMRDVATLENHGYGMMLSWPLG-QRYLGING----IRY 371
           +PID+    +++   L P+     +   TL N G  ++       ++++ I+G     RY
Sbjct: 55  SPIDVVPDKLLFDPYLRPLHIDKHKVSGTLHNTGQSLVFRVDKDTKQHVNISGGPLAYRY 114

Query: 372 LFRQVHWHF------PSEHVVNGTR-------YDLEAHLVHVSNDGR-----IAVLAVMY 497
            F +++ H+       SEH + G         Y     L H  ++ +     I  L++M 
Sbjct: 115 QFEEIYIHYGTENVRGSEHFIQGYSFPGEIQIYGFNKELYHNMSEAQHKSQGIVGLSLMV 174

Query: 498 QIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEG 677
           QIGETPNP L +I     K+    G    I ++    L      Y  Y GS T P C E 
Sbjct: 175 QIGETPNPELRIITSTFNKVLYR-GFSTPIRHISVRSLLPNTDHYITYEGSTTHPGCWES 233

Query: 678 VVWTVIRTIRSVTKQQVALIRNAIHDESKT-------NARPLQTINDRFVKVD 815
            VW ++     +TKQ++  +R  +     T       NARP+Q+++ R V+ +
Sbjct: 234 TVWIIVNKPIYITKQELYQLRRLMQGSESTPKAPLGNNARPVQSLHHRTVRTN 286



>gb:AY123054_1579922 Griffithsia japonica carbonic anhydrase mRNA,
           complete cds.
          Length = 288

 Score =  102 bits (255), Expect = 1e-20
 Identities = 74/253 (29%), Positives = 120/253 (47%), Gaps = 20/253 (7%)
 Frame = +3

Query: 108 DEWGFSYDEN-SDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNL-GPIQNYYMR 281
           D   +SYD    + GP  WG+   E+  C  G++Q+PID  ++      + GP+ N  + 
Sbjct: 40  DTVSYSYDMTVGENGPGEWGDSE-EFSTCKTGQIQSPIDFPTEVQYGMKMDGPMPNISVS 98

Query: 282 DVATLENHGYGMMLSWPLGQR--YLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVH 455
           D   +    +   L+    Q   Y    G +Y    +H H PSEH +NG +Y LEAH+VH
Sbjct: 99  DFE-MSAGSFNWALNCKESQTCGYTMFGGEKYYVLNIHMHSPSEHWLNGKQYPLEAHIVH 157

Query: 456 VSNDGRIAVLAVMYQIGET----------------PNPILSLIEDDLKKLAETPGVKKGI 587
           ++ +G+  V+A M++  +                  NP L  I +++ K  +   V  G 
Sbjct: 158 LTPEGKPLVIATMFETYDADAYPVRVYENANMLYGTNPFLKSILNNVAKGKQEFPVHLG- 216

Query: 588 GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT 767
                +++ A  + Y  Y+GSLTTPPCTEGV + + + ++ +  +Q              
Sbjct: 217 -----SIIDA-SKGYCSYVGSLTTPPCTEGVTFMMAQKVQMMNPKQAREYLRTAGACVDG 270

Query: 768 NARPLQTINDRFV 806
           NARP+Q +N R V
Sbjct: 271 NARPIQELNGRQV 283



>gb:BC055437_2102041 Mus musculus carbonic anhydrase 6, mRNA (cDNA
           clone MGC:65279 IMAGE:4190566), complete cds.
          Length = 317

 Score =  102 bits (254), Expect = 2e-20
 Identities = 81/268 (30%), Positives = 130/268 (48%), Gaps = 29/268 (10%)
 Frame = +3

Query: 99  EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQ--N 269
           +   +W +S D+    G S W E  P       G+ Q+PID++++ V+++ +L P+   N
Sbjct: 16  QAHSDWSYSGDDGV--GESQWSEQYPS----CGGERQSPIDVKTEEVMFNPSLKPLSLVN 69

Query: 270 YYMRDVA-TLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP--------SEHVVNG 422
           Y   ++  T+ N+G+ + +  P        +G  ++ +  H+H+         SEH ++G
Sbjct: 70  YEKENLEFTMTNNGHTVSIDLPPSMYLETSDGTEFISKAFHFHWGGRDWELSGSEHTIDG 129

Query: 423 TRYDLEAHLVHVSND-----------GRIAVLAVMYQIGE-TPNPILSLIEDDLKKLAET 566
            R  +EAH VH + +             +AVLAV+++I E   N   S I   LK + E 
Sbjct: 130 IRSIMEAHFVHFNKEYGTYENAKDQKNGLAVLAVLFKIDEYAENTYYSDIISALKNI-EK 188

Query: 567 PGVKKGIGYLD-PNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRN 743
           PG    +      NLL      YY Y GSLTTPPCTE V W V+R   +++K QV  I N
Sbjct: 189 PGETTTLKDTTIRNLLPKDVHHYYTYPGSLTTPPCTENVQWFVLRDKVTLSKAQVVTIEN 248

Query: 744 AIHDES----KTNARPLQTINDRFVKVD 815
           ++ D +    +   R  Q  N R V+ +
Sbjct: 249 SVMDHNNNTIQNGYRSTQPNNHRVVEAN 276



>gb:BC049973_2100294 Mus musculus carbonic anhydrase 6, mRNA (cDNA
           clone IMAGE:4193056), partial cds.
          Length = 325

 Score =  102 bits (254), Expect = 2e-20
 Identities = 81/268 (30%), Positives = 130/268 (48%), Gaps = 29/268 (10%)
 Frame = +3

Query: 99  EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQ--N 269
           +   +W +S D+    G S W E  P       G+ Q+PID++++ V+++ +L P+   N
Sbjct: 24  QAHSDWSYSGDDGV--GESQWSEQYPS----CGGERQSPIDVKTEEVMFNPSLKPLSLVN 77

Query: 270 YYMRDVA-TLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP--------SEHVVNG 422
           Y   ++  T+ N+G+ + +  P        +G  ++ +  H+H+         SEH ++G
Sbjct: 78  YEKENLEFTMTNNGHTVSIDLPPSMYLETSDGTEFISKAFHFHWGGRDWELSGSEHTIDG 137

Query: 423 TRYDLEAHLVHVSND-----------GRIAVLAVMYQIGE-TPNPILSLIEDDLKKLAET 566
            R  +EAH VH + +             +AVLAV+++I E   N   S I   LK + E 
Sbjct: 138 IRSIMEAHFVHFNKEYGTYENAKDQKNGLAVLAVLFKIDEYAENTYYSDIISALKNI-EK 196

Query: 567 PGVKKGIGYLD-PNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRN 743
           PG    +      NLL      YY Y GSLTTPPCTE V W V+R   +++K QV  I N
Sbjct: 197 PGETTTLKDTTIRNLLPKDVHHYYTYPGSLTTPPCTENVQWFVLRDKVTLSKAQVVTIEN 256

Query: 744 AIHDES----KTNARPLQTINDRFVKVD 815
           ++ D +    +   R  Q  N R V+ +
Sbjct: 257 SVMDHNNNTIQNGYRSTQPNNHRVVEAN 284



>gb:AF395662_1267750 Aedes aegypti carbonic anhydrase mRNA, complete
           cds.
          Length = 298

 Score =  102 bits (254), Expect = 2e-20
 Identities = 84/274 (30%), Positives = 125/274 (45%), Gaps = 28/274 (10%)
 Frame = +3

Query: 63  LLLSVTHVIKSQEVDDEWGFSYDENSDRG----PSHWGELRPEWWQCSAGKMQTPIDLES 230
           + L V  ++ S    DEW   Y   +  G    P  WG       QC  G+ Q+PIDL  
Sbjct: 2   IALFVATLLPSTIRADEW--HYPTPAPNGVINEPERWGG------QCETGRRQSPIDLTY 53

Query: 231 KPVVYSNLGP-IQNYYMRDV--ATLENHGYGMMLSW--PLGQRYLGINGIRYLFRQVHWH 395
           +  V  +  P + + YM  +  A L N G+ + +    P    Y G    +++  Q+H+H
Sbjct: 54  QAAVKGDFAPFLFSNYMNPIRNAQLTNTGHSIQIDSTDPSVTLYGGGLPGKFVLDQMHFH 113

Query: 396 FPSEHVVNGTRYDLEAHLVHVSNDGR-------------IAVLAVMYQIGETPNPILSLI 536
           + SEH + G RY  E H+VH  +D R             +AV+ V++ +    N  + ++
Sbjct: 114 WGSEHTIAGVRYGQELHMVH--HDSRYNSLTEAGAVKNAVAVIGVLFHVSNQDNTHMDVV 171

Query: 537 EDDLKKLAETPGVKKGI-GYLDP-NLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRS 710
            +  + + +  G    + G L P N L      Y+RY GSLTTP C E V+WTV      
Sbjct: 172 LETSQDIRDAAGKSAPLKGKLSPHNPLPKNRTSYFRYEGSLTTPTCAESVIWTVFTESLP 231

Query: 711 VTKQQVALIRNAIHD----ESKTNARPLQTINDR 800
           V+  QV L +  IHD    E   N R LQ +N R
Sbjct: 232 VSLDQVELFK-TIHDPSGHELVINFRSLQPLNAR 264



>sp|P18761|CAH6_MOUSE Carbonic anhydrase VI precursor (EC 4.2.1.1)
           (Carbonate dehydratase VI) (CA-VI) (Secreted carbonic
           anhydrase) (Salivary carbonic
           anhydrase).>gb:AF079835_2053717 Mus musculus secreted
           carbonic anhydrase isozyme VI precursor, mRNA, complete
           cds.
          Length = 317

 Score =  101 bits (251), Expect = 4e-20
 Identities = 79/271 (29%), Positives = 134/271 (49%), Gaps = 32/271 (11%)
 Frame = +3

Query: 99  EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQ--N 269
           +   +W +S D+    G S W E  P       G+ Q+PID++++ V+++ +L P+   N
Sbjct: 16  QAHSDWSYSGDDGV--GESQWSEQYPS----CGGERQSPIDVKTEEVMFNPSLKPLSLVN 69

Query: 270 YYMRDVA-TLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP--------SEHVVNG 422
           Y   ++  T+ N+G+ + +  P        +G  ++ +  H+H+         SEH ++G
Sbjct: 70  YEKENLEFTMTNNGHTVSIDLPPSMYLETSDGTEFISKAFHFHWGGRDWELSGSEHTIDG 129

Query: 423 TRYDLEAHLVHVSND-----------GRIAVLAVMYQIGETP-----NPILSLIEDDLKK 554
            R  +EAH VH + +             +AVLAV+++I E       + I+S ++D ++K
Sbjct: 130 IRSIMEAHFVHFNKEYGTYENAKDQKNGLAVLAVLFKIDEYAENTYYSDIISALKD-IEK 188

Query: 555 LAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVAL 734
             ET  +K        +LL      YY Y GSLTTPPCTE V W V+R   +++K QV  
Sbjct: 189 PGETTTLKDTT---IRDLLPKDVHHYYTYPGSLTTPPCTENVQWFVLRDRVTLSKAQVVT 245

Query: 735 IRNAIHDES----KTNARPLQTINDRFVKVD 815
           I N++ D +    +   R  Q  N R V+ +
Sbjct: 246 IENSVMDHNNNTIQNGYRSTQPNNHRVVEAN 276



>gb:AE014297_1138804 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003685_1220797 Drosophila melanogaster
           chromosome 3R, section 23 of 118 of the complete
           sequence.
          Length = 304

 Score =  100 bits (250), Expect = 5e-20
 Identities = 79/258 (30%), Positives = 118/258 (45%), Gaps = 25/258 (9%)
 Frame = +3

Query: 108 DEWGF-SYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPI--QNY-- 272
           +EWG+   D N D     WG L      C +GK Q+PI+L  K  +      +  +NY  
Sbjct: 20  NEWGYPDLDNNQDEPFPKWGGL------CDSGKKQSPINLHVKGALKGEFDALKFENYDE 73

Query: 273 YMRDVATLENHGYGMMLSWPLGQRYLGINGIR--YLFRQVHWHFPSEHVVNGTRYDLEAH 446
           + +++  + N+G+ + LS    +  L    +   ++  Q+H H+ SEH +N  RY LE H
Sbjct: 74  HQKNLRMV-NNGHSIQLSGFDHELTLSGGALLQDFVVEQIHMHWWSEHTINDIRYPLEVH 132

Query: 447 LVHVSN------------DGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIG 590
           +VH +             DG I V+ V+Y +  TPN  +  I   L  +     + K + 
Sbjct: 133 IVHRNTIYPNMTMAANFKDG-IVVIGVLYHVSNTPNEAIGSIIKSLGAVKSYDSMNKPVL 191

Query: 591 YLDP---NLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES 761
             D    + L      Y+ Y GSLTTP C E V W V+     VT  QV   +   +DE 
Sbjct: 192 VADSLAVDDLVPSVENYFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQVNEFKEIEYDEG 251

Query: 762 K---TNARPLQTINDRFV 806
           K    N R LQ+ N+R V
Sbjct: 252 KQLHNNYRELQSENNRAV 269



>pir|E95264|E95264 probable carbonate dehydratase (EC 4.2.1.1)
           [imported] - Sinorhizobium meliloti (strain 1021)
           magaplasmid pSymA>gb:AE007197_223981 Sinorhizobium
           meliloti 1021 plasmid pSymA section 3 of 121 of the
           complete plasmid sequence.>gb:AE006469_1101749
           Sinorhizobium meliloti 1021 plasmid pSymA, complete
           sequence.
          Length = 249

 Score =  100 bits (249), Expect = 6e-20
 Identities = 75/231 (32%), Positives = 106/231 (45%), Gaps = 1/231 (0%)
 Frame = +3

Query: 117 GFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQNYYMRDVATL 296
           G  +    + GP HWG L  E   CSAG  Q+PID+     V +++ P      +   T+
Sbjct: 28  GVHWRYEGEEGPEHWGSLAKENSACSAGSQQSPIDIRG--AVKADI-PELTADWKSGGTI 84

Query: 297 ENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSND-GR 473
            N+G+ + ++   G    G     Y   Q H+H PSEH V+G  + +EAH VH + + G 
Sbjct: 85  LNNGHTIQVNAAGGTLRRGDKS--YDLVQYHFHSPSEHFVDGKSFPMEAHFVHKNAETGT 142

Query: 474 IAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSL 653
           + VL V    G   +   SL E    K    PG +  +  +DP  L      Y+ Y GSL
Sbjct: 143 LGVLGVFLVPGAANSTFASLAE----KFPRNPGEESPLITIDPKGLLPSSLSYWTYEGSL 198

Query: 654 TTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV 806
           TTPPC+E V W V      V    +     A++     NARP    N R+V
Sbjct: 199 TTPPCSEIVDWMVAMEAVEVDPGDIKKF-TALY---SMNARPALAGNRRYV 245



>pir|A71847|A71847 carbonic anhydrase - Helicobacter pylori (strain
           J99)>gb:AE001539_36103 Helicobacter pylori, strain J99
           section 100 of 132 of the complete
           genome.>gb:AE001439_884873 Helicobacter pylori, strain
           J99 complete genome.
          Length = 247

 Score =  100 bits (248), Expect = 8e-20
 Identities = 82/269 (30%), Positives = 125/269 (46%), Gaps = 19/269 (7%)
 Frame = +3

Query: 36  MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP 215
           M K F IA   L++T  +   E + +W +   +N + GP  W +L  ++  C +GK Q+P
Sbjct: 1   MKKTFLIA---LALTASLIGAE-NTKWDY---KNKENGPHRWDKLHKDFEVCKSGKSQSP 53

Query: 216 IDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLG--------------QRYLG 353
           I++E              Y+ +D A L+   +    S P                  ++ 
Sbjct: 54  INIE------------HYYHTQDKADLQ---FKYAASKPKAVFFTHHTLKASFEPTNHIN 98

Query: 354 INGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIG-ETPN--PI 524
             G  Y+   VH+H P E ++N     L AH VH    GR+ VLA+ ++ G E PN  PI
Sbjct: 99  YRGHDYVLDNVHFHAPMEFLINNKTRPLSAHFVHKDAKGRLLVLAIGFEEGKENPNLDPI 158

Query: 525 LSLIE--DDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIR 698
           L  I+   +LK++A    + K I Y             Y + GSLT PPCTEGV W VI 
Sbjct: 159 LEGIQKKQNLKEVALDAFLPKSINY-------------YHFNGSLTAPPCTEGVAWFVIE 205

Query: 699 TIRSVTKQQVALIRNAIHDESKTNARPLQ 785
               V+ +Q+A I+  +  ++  N RP+Q
Sbjct: 206 EPLEVSAKQLAEIKKRM--KNSPNQRPVQ 232



>gb:AE017324_443258 Listeria monocytogenes str. 4b F2365, section 3
           of 10 of the complete genome.>gb:AE017262_1075614
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 233

 Score = 99.8 bits (247), Expect = 1e-19
 Identities = 67/229 (29%), Positives = 105/229 (45%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQNYYMRDVAT 293
           WG  YDE +  GP  WG +  ++     GK Q+P+D+E   VV      ++ YY     T
Sbjct: 8   WG--YDEKT--GPEMWGHICSDFEIAHTGKAQSPVDIEQADVVKLKPSTMKFYYKETDYT 63

Query: 294 LENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGR 473
           +      + +     ++ L  NG  Y     H H P+EH+++G  Y +E H VH   DG 
Sbjct: 64  IRRIEQSVHVFPHDKEQGLRFNGEYYPLVSFHAHIPAEHLLDGYVYPIEWHFVHEKPDGT 123

Query: 474 IAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSL 653
             V++   +I  T N     +     ++      ++ I  LD N      R +Y Y GS 
Sbjct: 124 TLVMSAWMEIDNTNNVEFKDLPTYFPEVFADFETEREIT-LDVNEFMPEERVFYTYQGSR 182

Query: 654 TTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDR 800
           TTPP  EGV W V++  +++ ++       AI + S    RP+Q +N R
Sbjct: 183 TTPPTVEGVTWIVLKNAKTLGQEDFTEFEKAIGNTS----RPVQDLNGR 227



>pir|AC1176|AC1176 carbonic anhydrase homolog lmo0811 [imported] -
           Listeria monocytogenes (strain EGD-e)>gb:AL591976_535302
           Listeria monocytogenes strain EGD, complete genome,
           segment 4/12.
          Length = 233

 Score = 99.0 bits (245), Expect = 2e-19
 Identities = 67/229 (29%), Positives = 104/229 (45%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQNYYMRDVAT 293
           WG  YDE +  GP  WG +  ++     GK Q+P+D+E   VV      ++ YY     T
Sbjct: 8   WG--YDEKT--GPEMWGHICSDFEIAHTGKAQSPVDIEQADVVKLKPSTMKFYYKETDYT 63

Query: 294 LENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGR 473
           +      + +     ++ L  NG  Y     H H P+EH+++G  Y +E H VH   DG 
Sbjct: 64  IRRIEQSVHVFPHDKEQGLRFNGEYYPLVSFHAHIPAEHLLDGYIYPIEWHFVHEKPDGT 123

Query: 474 IAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSL 653
             V++    I  T N     +     ++      ++ I  LD N      R +Y Y GS 
Sbjct: 124 TLVMSAWMDIDNTNNIEFKNLPTYFPEVFADFETEREIT-LDVNEFMPEERVFYTYQGSR 182

Query: 654 TTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDR 800
           TTPP  EGV W V++  +++ ++       AI + S    RP+Q +N R
Sbjct: 183 TTPPTVEGVTWIVLKNAKTLGQEDFTEFEKAIGNTS----RPVQDLNGR 227



>gb:AY049077_2074545 Mus musculus carbonic anhydrase 9 (Car9) gene,
           complete cds.
          Length = 437

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 78/260 (30%), Positives = 125/260 (48%), Gaps = 31/260 (11%)
 Frame = +3

Query: 123 SYDENSDRGPSHWGE----LRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQ--NYYMR 281
           S+ +    G SHW      L P+     AG+ Q+P+D+  +   +   L P++   Y ++
Sbjct: 108 SHGDEKGGGHSHWSYGGTLLWPQVSPACAGRFQSPVDIRLERTAFCRTLQPLELLGYELQ 167

Query: 282 DVA--TLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP------SEHVVNGTRYDL 437
            +   +L N+G+ + L+ P G +     G  Y   Q+H H+       SEH VNG R+  
Sbjct: 168 PLPELSLSNNGHTVQLTLPPGLKMALGPGQEYRALQLHLHWGTSDHPGSEHTVNGHRFPA 227

Query: 438 EAHLVHVSN-----------DGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG 584
           E H+VH+S             G +AVLA   Q     N     +   L++++E  G K  
Sbjct: 228 EIHVVHLSTAFSELHEALGRPGGLAVLAAFLQESPEENSAYEQLLSHLEEISEE-GSKIE 286

Query: 585 IGYLDPN-LLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI---- 749
           I  LD + LL +   RYYRY GSLTTPPC++GV+WTV      ++ +Q+  +  ++    
Sbjct: 287 IPGLDVSALLPSDLSRYYRYEGSLTTPPCSQGVIWTVFNETVKLSAKQLHTLSVSLWGXR 346

Query: 750 HDESKTNARPLQTINDRFVK 809
               + N R  Q +N R ++
Sbjct: 347 DSRLQLNFRATQPLNGRTIE 366



>sp|Q8VHB5|CAH9_MOUSE Carbonic anhydrase IX precursor (EC 4.2.1.1)
           (Carbonate dehydratase IX) (CA-IX) (CAIX) (Membrane
           antigen MN homolog).>gb:MMU245857_2119709 Mus musculus
           mRNA for carbonic anhydrase (MN/CA9 gene).
          Length = 437

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 78/260 (30%), Positives = 125/260 (48%), Gaps = 31/260 (11%)
 Frame = +3

Query: 123 SYDENSDRGPSHWGE----LRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQ--NYYMR 281
           S+ +    G SHW      L P+     AG+ Q+P+D+  +   +   L P++   Y ++
Sbjct: 108 SHGDEKGGGHSHWSYGGTLLWPQVSPACAGRFQSPVDIRLERTAFCRTLQPLELLGYELQ 167

Query: 282 DVA--TLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP------SEHVVNGTRYDL 437
            +   +L N+G+ + L+ P G +     G  Y   Q+H H+       SEH VNG R+  
Sbjct: 168 PLPELSLSNNGHTVQLTLPPGLKMALGPGQEYRALQLHLHWGTSDHPGSEHTVNGHRFPA 227

Query: 438 EAHLVHVSN-----------DGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG 584
           E H+VH+S             G +AVLA   Q     N     +   L++++E  G K  
Sbjct: 228 EIHVVHLSTAFSELHEALGRPGGLAVLAAFLQESPEENSAYEQLLSHLEEISEE-GSKIE 286

Query: 585 IGYLDPN-LLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI---- 749
           I  LD + LL +   RYYRY GSLTTPPC++GV+WTV      ++ +Q+  +  ++    
Sbjct: 287 IPGLDVSALLPSDLSRYYRYEGSLTTPPCSQGVIWTVFNETVKLSAKQLHTLSVSLWGPR 346

Query: 750 HDESKTNARPLQTINDRFVK 809
               + N R  Q +N R ++
Sbjct: 347 DSRLQLNFRATQPLNGRTIE 366



>pir|AG1533|AG1533 carbonic anhydrase homolog lin0807 [imported] -
           Listeria innocua (strain Clip11262)>gb:AL596166_538153
           Listeria innocua Clip11262 complete genome, segment
           4/12.
          Length = 233

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 66/229 (28%), Positives = 106/229 (46%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQNYYMRDVAT 293
           WG  YDE +  GP  WG +  ++     GK Q+P+++E   VV      ++ YY     T
Sbjct: 8   WG--YDEKT--GPEMWGHICSDFEIAHTGKAQSPVNIEQADVVKLKPSTMKFYYKETDYT 63

Query: 294 LENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGR 473
           ++     + +     ++ L  NG  Y     H H P+EH+++G  Y +E H VH   DG 
Sbjct: 64  IKRIEQSVHVFPHDKEQGLRFNGEYYPLVSFHAHIPAEHLLDGYVYPIEWHFVHEKPDGT 123

Query: 474 IAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSL 653
             V++   +I  T N     +     ++      ++ I  LD N      R +Y Y GS 
Sbjct: 124 TLVMSAWMEIDNTNNVEFKDLPTYFPEVFADFETEREIT-LDVNEFMPEERVFYTYQGSR 182

Query: 654 TTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDR 800
           TTPP  EGV W V++  +++ ++       AI + S    RP+Q +N R
Sbjct: 183 TTPPTVEGVTWIVLKNAKTLGQEDFTEFEKAIGNTS----RPVQDLNGR 227



>sp|Q9D6N1|CAHD_MOUSE Carbonic anhydrase XIII (EC 4.2.1.1)
           (Carbonate dehydratase XIII) (CA-
           XIII).>gb:AK010166_1155574 Mus musculus adult male
           tongue cDNA, RIKEN full-length enriched library,
           clone:2310075C21 product:carbonic anhydrase 13, full
           insert sequence.>gb:AF231123_2060042 Mus musculus
           carbonic anhydrase XIII (Car13) mRNA, complete
           cds.>gb:BC064050_2105303 Mus musculus carbonic anhydrase
           13, mRNA (cDNA clone MGC:73575 IMAGE:949505), complete
           cds.
          Length = 262

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 85/263 (32%), Positives = 119/263 (45%), Gaps = 31/263 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQ-NYYMRDV 287
           WG+        GP HW EL P     + G  Q+PI++++K V Y S+L P+   Y     
Sbjct: 6   WGYG----EHNGPIHWNELFP----IADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPASA 57

Query: 288 ATLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWHF------PSEHVVNGTRYDL 437
             + N G+   + +   +    + G      Y  RQ H H+       SEHVV+G RY  
Sbjct: 58  KIISNSGHSFNVDFDDTEDKSVLRGGPLTGNYRLRQFHLHWGSADDHGSEHVVDGVRYAA 117

Query: 438 EAHLVHVSND------------GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK 581
           E H+VH ++D              +AVL V  QIGE  NP L  I D L  + E  G + 
Sbjct: 118 ELHVVHWNSDKYPSFVEAAHESDGLAVLGVFLQIGE-HNPQLQKITDILDSIKE-KGKQT 175

Query: 582 GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI---H 752
                DP  L      Y+ Y GSLT PP  E V W V++   S++ QQ+A  R+ +    
Sbjct: 176 RFTNFDPLCLLPSSWDYWTYPGSLTVPPLLESVTWIVLKQPISISSQQLARFRSLLCTAE 235

Query: 753 DESK----TNARPLQTINDRFVK 809
            ES     +N RP Q +  R V+
Sbjct: 236 GESAAFLLSNHRPPQPLKGRRVR 258



>sp|Q27504|CAH3_CAEEL Putative carbonic anhydrase 3 (EC 4.2.1.1)
           (Carbonate dehydratase 3).>pir|T16575|T16575
           hypothetical protein K05G3.3 - Caenorhabditis
           elegans>gb:U41539_1404046 Caenorhabditis elegans cosmid
           K05G3, complete sequence.
          Length = 246

 Score = 97.4 bits (241), Expect = 5e-19
 Identities = 77/245 (31%), Positives = 114/245 (46%), Gaps = 18/245 (7%)
 Frame = +3

Query: 120 FSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGP---IQNYYMRDVA 290
           +SY ++ + GP+ W            G+ Q+PI+++   V   +        NY      
Sbjct: 5   WSYCDDDECGPNRW----------PTGQHQSPINIDLGEVERKDTHDGIKFVNYDHPIQG 54

Query: 291 TLENHGYGMMLSWPLGQRYLGI--NGIRYLFRQVHWHFP--------SEHVVNGTRYDLE 440
            + N+G+ + ++  L   +  I   G+  ++R V +HF         SEH + G RY  E
Sbjct: 55  DIVNNGHSVQMTPELRSEHPEIYGGGLDQVYRLVQYHFHWGENDNEGSEHTLGGLRYPAE 114

Query: 441 AHLVH--VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQ 614
            HLVH  V + G++AV+ V  Q+G+     LS  E  L KL     V +         L 
Sbjct: 115 LHLVHQGVEDPGKLAVVGVFLQLGKE-GKALSNEERVLGKLCNPETVTRVENVRLSEKLP 173

Query: 615 ARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES---KTNARPLQ 785
           A  R ++RY GSLTTPPC+E V WT+     +VT  Q+ L R     E    K N RP Q
Sbjct: 174 ANKRSFWRYEGSLTTPPCSEIVTWTIFTEPVTVTHDQLELFRQVQDIEKRPIKKNYRPTQ 233

Query: 786 TINDR 800
            +NDR
Sbjct: 234 NLNDR 238



>gb:AE017282_427850 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 264

 Score = 96.7 bits (239), Expect = 9e-19
 Identities = 78/260 (30%), Positives = 121/260 (46%), Gaps = 26/260 (10%)
 Frame = +3

Query: 105 DDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQNYY-MR 281
           + +W +S       GPS+W  L P   QC  G  Q+P D+ +  V  ++L  +  +Y + 
Sbjct: 30  EPDWSYS----GANGPSNWNTLFPI--QCGTGSRQSPFDIVTANVTKADLPKLSFHYNVA 83

Query: 282 DVATLE-------NHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLE 440
           DV  L+       NHG G          ++ I   R+    +H H PSE+ +NG ++ +E
Sbjct: 84  DVLYLDHDDQVAFNHGNG---------NFIKIGKDRFDLINIHEHTPSEYTLNGQQFPME 134

Query: 441 AHLVHVSND-GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNL--- 608
            HLVH +   G++AV+ V    G+                 E  GVK+   + DP+    
Sbjct: 135 IHLVHQNKQTGQLAVIGVFVVTGK-----------------ENKGVKEAPSFNDPSTVAL 177

Query: 609 ----LQARGRRYYRYMGSLTT-------PPCTEGVVWTVIRTIRSVTKQQVALIRNAIH- 752
               L  + R Y R+ GSLTT       P C EGV+WT + T  +++  Q+A  +++   
Sbjct: 178 KLTGLIPKKRNYVRFNGSLTTPGENIALPRCAEGVLWTEMLTPIAMSSDQIAAFQDSAQV 237

Query: 753 --DESKTNARPLQTINDRFV 806
               S TN RPLQ  N+RF+
Sbjct: 238 CWGTSITN-RPLQPSNNRFL 256



>gb:BC004897_1969423 Homo sapiens carbonic anhydrase III, muscle
           specific, mRNA (cDNA clone MGC:3470 IMAGE:3532715),
           complete cds.
          Length = 260

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 81/264 (30%), Positives = 123/264 (46%), Gaps = 31/264 (11%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQ-NYYMRD 284
           EWG++    S  GP HW EL P     + G+ Q+PI+L +K + +  +L P   +Y    
Sbjct: 4   EWGYA----SHNGPDHWHELFPN----AKGENQSPIELHTKDIRHDPSLQPWSVSYDGGS 55

Query: 285 VATLENHGYGMMLSWPLGQRYLGINGIR----YLFRQVHWHFPS------EHVVNGTRYD 434
             T+ N+G    + +        + G      Y  RQ H H+ S      EH V+G +Y 
Sbjct: 56  AKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYA 115

Query: 435 LEAHLVHVS------------NDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
            E HLVH +             DG IAV+ +  +IG   N    +  D L K+ +T G +
Sbjct: 116 AELHLVHWNPKYNTFKEALKQRDG-IAVIGIFLKIGHE-NGEFQIFLDALDKI-KTKGKE 172

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE 758
                 DP+ L    R Y+ Y GS TTPPC E +VW +++   +V+  Q+A +R+ +   
Sbjct: 173 APFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSA 232

Query: 759 SK-------TNARPLQTINDRFVK 809
                    +N RP Q IN+R V+
Sbjct: 233 ENEPPVPLVSNWRPPQPINNRVVR 256



>sp|P07451|CAH3_HUMAN Carbonic anhydrase III (EC 4.2.1.1) (Carbonate
           dehydratase III) (CA- III).
          Length = 259

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 81/264 (30%), Positives = 123/264 (46%), Gaps = 31/264 (11%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQ-NYYMRD 284
           EWG++    S  GP HW EL P     + G+ Q+PI+L +K + +  +L P   +Y    
Sbjct: 3   EWGYA----SHNGPDHWHELFPN----AKGENQSPIELHTKDIRHDPSLQPWSVSYDGGS 54

Query: 285 VATLENHGYGMMLSWPLGQRYLGINGIR----YLFRQVHWHFPS------EHVVNGTRYD 434
             T+ N+G    + +        + G      Y  RQ H H+ S      EH V+G +Y 
Sbjct: 55  AKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYA 114

Query: 435 LEAHLVHVS------------NDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
            E HLVH +             DG IAV+ +  +IG   N    +  D L K+ +T G +
Sbjct: 115 AELHLVHWNPKYNTFKEALKQRDG-IAVIGIFLKIGHE-NGEFQIFLDALDKI-KTKGKE 171

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE 758
                 DP+ L    R Y+ Y GS TTPPC E +VW +++   +V+  Q+A +R+ +   
Sbjct: 172 APFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSA 231

Query: 759 SK-------TNARPLQTINDRFVK 809
                    +N RP Q IN+R V+
Sbjct: 232 ENEPPVPLVSNWRPPQPINNRVVR 255



>gb:BC057412_2552062 Danio rerio carbonic anhydrase II, mRNA (cDNA
           clone MGC:63898 IMAGE:6789967), complete cds.
          Length = 260

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 80/264 (30%), Positives = 121/264 (45%), Gaps = 30/264 (11%)
 Frame = +3

Query: 108 DEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYYMRD 284
           D WG  YD+++  GP  WGE  P     + G  Q+PID++S    Y   L P++  Y   
Sbjct: 3   DHWG--YDKHN--GPDKWGESYP----IANGSRQSPIDIKSSTTTYDEKLTPLKLKYDPS 54

Query: 285 VAT-LENHGYGMMLSWPLGQRYLGINGI----RYLFRQVHWHFPS------EHVVNGTRY 431
            +  ++N+G+   +S+   Q    + G      +  +Q H+H+ S      EH VNG  Y
Sbjct: 55  TSLDIQNNGHSFQVSFVDDQNSSTLTGGPVTGTFRLKQFHFHWGSADDKGSEHTVNGKCY 114

Query: 432 DLEAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
             E HLVH           V     +AV+ +  +IG   NP L  I D +  + ++ G +
Sbjct: 115 PAELHLVHWNTKYPSFKDAVDKPDGLAVVGIFLKIG-ADNPKLQKILDAMDAI-KSKGKQ 172

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH-- 752
                 DP++L      Y+ Y+GSLTTPP  E V W V +   SV+  Q+   R+ +   
Sbjct: 173 TPFPNFDPSVLLPSSLDYWTYLGSLTTPPLLESVTWIVCKQSISVSSAQMKRFRSLLFSG 232

Query: 753 DESK-----TNARPLQTINDRFVK 809
           D  K      N RP Q +  R V+
Sbjct: 233 DGEKACCMVNNYRPPQPLKGRVVR 256



>gb:AL935260_552317 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 9/11.
          Length = 211

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 63/206 (30%), Positives = 104/206 (50%)
 Frame = +3

Query: 183 WQCSAGKMQTPIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGING 362
           W  ++G+ Q+PID++++ V  S L  I    +    T+      +  S  +G  YL  N 
Sbjct: 11  WPMTSGQHQSPIDIQTQHVQSSQLSAINWRGLYQAKTITGEATTLKASG-IGAAYL--ND 67

Query: 363 IRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIED 542
             + F+Q+H+H P+EH+++G    +E HLVH S  G++AV+AV  +IG+  + +  L++ 
Sbjct: 68  RDFAFQQIHFHTPAEHLIDGQAAPIEWHLVHQSATGQLAVVAVFGRIGKPNSSLQGLLDQ 127

Query: 543 DLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQ 722
              + +        +  L P+         Y Y+GSLTTPP +E V W V      + +Q
Sbjct: 128 FTAQTSHELTTPVNLTELLPDT-----GTVYHYLGSLTTPPLSETVEWYVCADTVMIGEQ 182

Query: 723 QVALIRNAIHDESKTNARPLQTINDR 800
           Q+A    A       N R +Q +NDR
Sbjct: 183 QLA----AYQQLFAANNRKIQPLNDR 204



>pir|A26658|CRHU3 carbonate dehydratase (EC 4.2.1.1) III -
           human>gb:AX399834_1467147 Sequence 5 from Patent
           WO0218424.>gb:HUMCAIII7_2029789 Human carbonic anhydrase
           III gene, exon 7.
          Length = 260

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 80/264 (30%), Positives = 123/264 (46%), Gaps = 31/264 (11%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQ-NYYMRD 284
           EWG++    S  GP HW EL P     + G+ Q+P++L +K + +  +L P   +Y    
Sbjct: 4   EWGYA----SHNGPDHWHELFPN----AKGENQSPVELHTKDIRHDPSLQPWSVSYDGGS 55

Query: 285 VATLENHGYGMMLSWPLGQRYLGINGIR----YLFRQVHWHFPS------EHVVNGTRYD 434
             T+ N+G    + +        + G      Y  RQ H H+ S      EH V+G +Y 
Sbjct: 56  AKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYA 115

Query: 435 LEAHLVHVS------------NDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
            E HLVH +             DG IAV+ +  +IG   N    +  D L K+ +T G +
Sbjct: 116 AELHLVHWNPKYNTFKEALKQRDG-IAVIGIFLKIGHE-NGEFQIFLDALDKI-KTKGKE 172

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE 758
                 DP+ L    R Y+ Y GS TTPPC E +VW +++   +V+  Q+A +R+ +   
Sbjct: 173 APFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSA 232

Query: 759 SK-------TNARPLQTINDRFVK 809
                    +N RP Q IN+R V+
Sbjct: 233 ENEPPVPLVSNWRPPQPINNRVVR 256



>pir|A29993|A29993 carbonate dehydratase (EC 4.2.1.1) VI - sheep
          Length = 307

 Score = 94.0 bits (232), Expect = 6e-18
 Identities = 82/268 (30%), Positives = 131/268 (48%), Gaps = 33/268 (12%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS------NLGPIQNY 272
           EW +S     +   +HW    P  +    G+ Q+PIDL+ K V Y+      NL     +
Sbjct: 5   EWTYSEGMLDE---AHW----PLEYPKCGGRRQSPIDLQMKKVQYNPSLRALNLTGYGLW 57

Query: 273 YMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP--------SEHVVNGTR 428
           +     T  N+G+ + +S P        +G +YL +Q+H+H+         SEH V+G R
Sbjct: 58  HGEFPVT--NNGHTVQISLPSTMSMTTSDGTQYLAKQMHFHWGGASSEISGSEHTVDGMR 115

Query: 429 YDLEAHLVHVSN------------DGRIAVLAVMYQIGE-TPNPILSLIEDDLKKL--AE 563
           Y +E H+VH ++            DG +AVLA + ++ + T N   S     L+ +  A 
Sbjct: 116 YVIEIHVVHYNSKYNSYEEAQKEPDG-LAVLAALVEVKDYTENAYYSKFISHLEDIRYAG 174

Query: 564 TPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRN 743
              V +G+   D  +L    R YY Y+GSLTTPPCTE V W V+     ++K QV  + N
Sbjct: 175 QSTVLRGLDIED--MLPGDLRYYYSYLGSLTTPPCTENVHWFVVADTVKLSKTQVEKLEN 232

Query: 744 A-IHDESKT---NARPLQTINDRFVKVD 815
           + ++ ++KT   + R  Q +N R V+ +
Sbjct: 233 SLLNHQNKTIQNDYRRTQPLNHRVVEAN 260



>sp|P08060|CAH6_SHEEP Carbonic anhydrase VI (EC 4.2.1.1) (Carbonate
           dehydratase VI) (CA-VI) (Secreted carbonic anhydrase)
           (Salivary carbonic anhydrase).
          Length = 307

 Score = 94.0 bits (232), Expect = 6e-18
 Identities = 82/268 (30%), Positives = 131/268 (48%), Gaps = 33/268 (12%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS------NLGPIQNY 272
           EW +S     +   +HW    P  +    G+ Q+PIDL+ K V Y+      NL     +
Sbjct: 5   EWTYSEGMLDE---AHW----PLEYPKCGGRRQSPIDLQMKKVQYNPSLRALNLTGYGLW 57

Query: 273 YMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP--------SEHVVNGTR 428
           +     T  N+G+ + +S P        +G +YL +Q+H+H+         SEH V+G R
Sbjct: 58  HGEFPVT--NNGHTVQISLPSTMSMTTSDGTQYLAKQMHFHWGGASSEISGSEHTVDGMR 115

Query: 429 YDLEAHLVHVSN------------DGRIAVLAVMYQIGE-TPNPILSLIEDDLKKL--AE 563
           Y +E H+VH ++            DG +AVLA + ++ + T N   S     L+ +  A 
Sbjct: 116 YVIEIHVVHYNSKYNSYEEAQKEPDG-LAVLAALVEVKDYTENAYYSKFISHLEDIRYAG 174

Query: 564 TPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRN 743
              V +G+   D  +L    R YY Y+GSLTTPPCTE V W V+     ++K QV  + N
Sbjct: 175 QSTVLRGLDIED--MLPGDLRYYYSYLGSLTTPPCTENVHWFVVADTVKLSKTQVEKLEN 232

Query: 744 A-IHDESKT---NARPLQTINDRFVKVD 815
           + ++ ++KT   + R  Q +N R V+ +
Sbjct: 233 SLLNHQNKTIQNDYRRTQPLNHRVVEAN 260



>sp|P43166|CAH7_HUMAN Carbonic anhydrase VII (EC 4.2.1.1) (Carbonate
           dehydratase VII) (CA- VII).>pir|A55272|CRHU7 carbonate
           dehydratase (EC 4.2.1.1) VII - human>gb:AY075019_1935954
           Homo sapiens carbonic anhydrase VII mRNA, complete
           cds.>gb:BC033865_1981112 Homo sapiens carbonic anhydrase
           VII, mRNA (cDNA clone MGC:45245 IMAGE:5185069), complete
           cds.>gb:HUAC004638_2028716 Homo sapiens Chromosome 16
           BAC clone CIT987SK-A-116A10, complete
           sequence.>gb:HUMCAVII5_2029867 H.sapiens carbonic
           anhydrase VII (CA VII) gene, exons 4,5,6, and 7, and
           complete cds.
          Length = 264

 Score = 93.6 bits (231), Expect = 8e-18
 Identities = 75/263 (28%), Positives = 123/263 (46%), Gaps = 31/263 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQNYYMRDVA 290
           WG+  D+    GPSHW +L P     + G  Q+PI++ S   VYS +L P++  Y   ++
Sbjct: 7   WGYGQDD----GPSHWHKLYP----IAQGDRQSPINIISSQAVYSPSLQPLELSYEACMS 58

Query: 291 -TLENHGYGMMLSWPLGQRYLGINGIR----YLFRQVHWHFP------SEHVVNGTRYDL 437
            ++ N+G+ + + +        + G      Y  +Q H+H+       SEH V+G  +  
Sbjct: 59  LSITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDVGSEHTVDGKSFPS 118

Query: 438 EAHLVH------------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK 581
           E HLVH             S    +AV+ V  + G+  +P ++ + D L  +    G K 
Sbjct: 119 ELHLVHWNAKKYSTFGEAASAPDGLAVVGVFLETGDE-HPSMNRLTDALY-MVRFKGTKA 176

Query: 582 GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI---H 752
                +P  L    R Y+ Y GSLTTPP +E V W V+R    ++++Q+   R+ +    
Sbjct: 177 QFSCFNPKCLLPASRHYWTYPGSLTTPPLSESVTWIVLREPICISERQMGKFRSLLFTSE 236

Query: 753 DESK----TNARPLQTINDRFVK 809
           D+ +     N RP Q +  R VK
Sbjct: 237 DDERIHMVNNFRPPQPLKGRVVK 259



>gb:BT008173_2151105 Synthetic construct Homo sapiens carbonic
           anhydrase XII mRNA, partial cds.
          Length = 344

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 71/241 (29%), Positives = 111/241 (46%), Gaps = 24/241 (9%)
 Frame = +3

Query: 147 GPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQ----NYYMRDVATLENHGY 311
           G + W +  P       G +Q+PIDL S  + Y ++L P++    N        L N+G+
Sbjct: 39  GENSWSKKYPS----CGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGH 94

Query: 312 GMMLSWPLGQRYLGINGIRYLFRQVHWHFP-------SEHVVNGTRYDLEAHLVHVSND- 467
            + L+ P      G+   RY   Q+H H+        SEH V+G  +  E H+VH ++D 
Sbjct: 95  SVKLNLPSDMHIQGLQS-RYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDL 153

Query: 468 -----------GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQ 614
                        +AVLAV+ ++G   NP    I   L+ +          G+    LL 
Sbjct: 154 YPDASTASNKSEGLAVLAVLIEMGSF-NPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLP 212

Query: 615 ARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTIN 794
            R   YYRY GSLTTPPC   V+WTV R    ++++Q+  +  A++     +  P + IN
Sbjct: 213 ERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMIN 272

Query: 795 D 797
           +
Sbjct: 273 N 273



>gb:BC000278_1966572 Homo sapiens carbonic anhydrase XII, transcript
           variant 2, mRNA (cDNA clone MGC:1792 IMAGE:3357439),
           complete cds.>gb:BC011691_1973136 Homo sapiens carbonic
           anhydrase XII, transcript variant 2, mRNA (cDNA clone
           MGC:19666 IMAGE:3344734), complete
           cds.>gb:BT006656_1990094 Homo sapiens carbonic anhydrase
           XII mRNA, complete cds.
          Length = 343

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 71/241 (29%), Positives = 111/241 (46%), Gaps = 24/241 (9%)
 Frame = +3

Query: 147 GPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQ----NYYMRDVATLENHGY 311
           G + W +  P       G +Q+PIDL S  + Y ++L P++    N        L N+G+
Sbjct: 39  GENSWSKKYPS----CGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGH 94

Query: 312 GMMLSWPLGQRYLGINGIRYLFRQVHWHFP-------SEHVVNGTRYDLEAHLVHVSND- 467
            + L+ P      G+   RY   Q+H H+        SEH V+G  +  E H+VH ++D 
Sbjct: 95  SVKLNLPSDMHIQGLQS-RYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDL 153

Query: 468 -----------GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQ 614
                        +AVLAV+ ++G   NP    I   L+ +          G+    LL 
Sbjct: 154 YPDASTASNKSEGLAVLAVLIEMGSF-NPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLP 212

Query: 615 ARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTIN 794
            R   YYRY GSLTTPPC   V+WTV R    ++++Q+  +  A++     +  P + IN
Sbjct: 213 ERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMIN 272

Query: 795 D 797
           +
Sbjct: 273 N 273



>sp|O43570|CAHC_HUMAN Carbonic anhydrase XII precursor (EC 4.2.1.1)
           (Carbonate dehydratase XII) (CA-XII) (Tumor antigen
           HOM-RCC-3.1.3).>gb:AX057576_1458363 Sequence 1 from
           Patent WO0075190.>gb:AF037335_1878074 Homo sapiens
           carbonic anhydrase precursor (CA 12) mRNA, complete
           cds.>gb:AF051882_1879185 Homo sapiens carbonic anhydrase
           XII precursor (CA-XII) mRNA, complete
           cds.>gb:BC023981_1978190 Homo sapiens carbonic anhydrase
           XII, transcript variant 1, mRNA (cDNA clone MGC:22865
           IMAGE:4042589), complete cds.
          Length = 354

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 71/241 (29%), Positives = 111/241 (46%), Gaps = 24/241 (9%)
 Frame = +3

Query: 147 GPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQ----NYYMRDVATLENHGY 311
           G + W +  P       G +Q+PIDL S  + Y ++L P++    N        L N+G+
Sbjct: 39  GENSWSKKYPS----CGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGH 94

Query: 312 GMMLSWPLGQRYLGINGIRYLFRQVHWHFP-------SEHVVNGTRYDLEAHLVHVSND- 467
            + L+ P      G+   RY   Q+H H+        SEH V+G  +  E H+VH ++D 
Sbjct: 95  SVKLNLPSDMHIQGLQS-RYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDL 153

Query: 468 -----------GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQ 614
                        +AVLAV+ ++G   NP    I   L+ +          G+    LL 
Sbjct: 154 YPDASTASNKSEGLAVLAVLIEMGSF-NPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLP 212

Query: 615 ARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTIN 794
            R   YYRY GSLTTPPC   V+WTV R    ++++Q+  +  A++     +  P + IN
Sbjct: 213 ERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMIN 272

Query: 795 D 797
           +
Sbjct: 273 N 273



>gb:BC077855_2560506 Xenopus laevis carbonic anhydrase 13, mRNA
           (cDNA clone MGC:80571 IMAGE:5440148), complete cds.
          Length = 263

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 75/266 (28%), Positives = 125/266 (46%), Gaps = 33/266 (12%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQ-NYYMRD 284
           +WG+  D N   GP  W +L P     + G  Q+PI++ +K  +Y  +L P+  +Y    
Sbjct: 4   QWGYE-DHN---GPDVWQDLFP----LANGDRQSPINIITKDALYDPSLQPLLVDYDPHS 55

Query: 285 VATLENHGYGMMLSWPLGQRYLGINGI----RYLFRQVHWHFP------SEHVVNGTRYD 434
              + N G+ + + +  G     + G      Y  RQ+H+H+       SEH V+G  Y 
Sbjct: 56  AKVISNSGHTVAVEFDDGDDSSVVRGGPLMGNYRLRQLHFHWGPSDGHGSEHKVDGVDYA 115

Query: 435 LEAHLVHVSND------------GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
            E H+VH +++              +AVL V  ++GE PN  +  I D    +  + G +
Sbjct: 116 AELHIVHWNSEKFSSFVKAACAPDGLAVLGVFLKVGE-PNRYIEKITDTFGAI-RSKGKQ 173

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE 758
                 DP+ L      ++ Y GSLT PP  E VVWTV++   S++ +Q+A+ R+ +  +
Sbjct: 174 SPFTNFDPSCLLPASMDFWTYPGSLTVPPLLESVVWTVLKDPISISCEQLAMFRSLLSTK 233

Query: 759 S---------KTNARPLQTINDRFVK 809
                      TN RP+Q + +R V+
Sbjct: 234 ETAGIESCCMTTNHRPVQPLKNRKVR 259



>gb:AE016952_365748 Enterococcus faecalis V583, section 6 of 11 of
           the complete genome.>gb:AE016830_992236 Enterococcus
           faecalis V583, complete genome.
          Length = 232

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 66/237 (27%), Positives = 108/237 (45%)
 Frame = +3

Query: 90  KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQN 269
           K + +D EW ++ ++    GP HW  L   + + +    Q+PI LE +     N   I  
Sbjct: 3   KIKNMDVEWSYTGND----GPEHWHTLCDWFAEGAKFAYQSPIALEKESAETVN-SQITF 57

Query: 270 YYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL 449
           +Y ++  T +          P  + Y+    + Y    +H+H PSEH+++G +Y LE HL
Sbjct: 58  HYKKEEFTEKEFKNTFHFVPPNTESYVMFENVAYHLTDIHFHMPSEHLLSGKQYPLEFHL 117

Query: 450 VHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRR 629
           VH+++ G   V+  ++ I E  N       +    +    G  +   + +P++     R 
Sbjct: 118 VHMNDAGENLVVGCLFTITEEEN----RFSEANHPMDWENGTHQ--QWFNPSIFLPEERL 171

Query: 630 YYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDR 800
           +Y Y+GSLTTPP    V W V  TI+   K   A +          N RPLQ +N R
Sbjct: 172 HYHYVGSLTTPPTKGPVKWFVFDTIQ---KMDQAFLNKIKEGMLAFNNRPLQPLNGR 225



>gb:BC031385_2097046 Mus musculus carbonic anyhydrase 12, mRNA (cDNA
           clone MGC:38624 IMAGE:5355557), complete cds.
          Length = 344

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 70/241 (29%), Positives = 109/241 (45%), Gaps = 24/241 (9%)
 Frame = +3

Query: 147 GPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQ----NYYMRDVATLENHGY 311
           G  +W +  P       G +Q+PIDL S  + Y ++L P+Q    N  +  +  L N G+
Sbjct: 39  GEKNWSKKYPS----CGGLLQSPIDLHSDILQYDASLAPLQFQGYNVSVEKLLNLTNDGH 94

Query: 312 GMMLSWPLGQRYLGINGIRYLFRQVHWHFP-------SEHVVNGTRYDLEAHLVHVSND- 467
            + L+        G+    Y   Q+H H+        SEH V+G  +  E H+VH ++D 
Sbjct: 95  SVRLNLNSDMYIQGLQPHHYRAEQLHLHWGNRNDPHGSEHTVSGKHFAAELHIVHYNSDL 154

Query: 468 -----------GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQ 614
                        +AVLAV+ +IG   NP    I   L+ +          G+    LL 
Sbjct: 155 YPDFSTASDKSEGLAVLAVLIEIGSA-NPSYDKIFSHLQHVKYKGQQVLIPGFNIEELLP 213

Query: 615 ARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTIN 794
                YYRY GSLTTPPC   V+WTV R    ++++Q+  +  A++     +  P + IN
Sbjct: 214 ESPGEYYRYEGSLTTPPCYPTVLWTVFRNPVQISQEQLLALETALYFTHMDDPTPREMIN 273

Query: 795 D 797
           +
Sbjct: 274 N 274



>gb:U39743_1403082 Caenorhabditis elegans cosmid R173, complete
           sequence.
          Length = 310

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 84/278 (30%), Positives = 122/278 (43%), Gaps = 30/278 (10%)
 Frame = +3

Query: 66  LLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY 245
           LL    V+ S     + G+ YDEN+  GP  W        +C     Q+PID+ +  V Y
Sbjct: 10  LLVALLVVVSCGPGSDHGWGYDENN--GPDTWQG------KCQNHLKQSPIDIRAPDVDY 61

Query: 246 SNLGPIQ--NYYMRDVATLENHGY----GMMLSWPLGQRYLGINGI--RYLFRQVHWHFP 401
           + L  +   NY M     L N G     G   SW   Q  +   G+  RY   Q H H+ 
Sbjct: 62  ALLHRMHFLNYDMDGKIELSNTGRTLFAGGFESWQHKQPMIQGGGLKHRYKLAQFHLHWG 121

Query: 402 ------SEHVVNGTRYDLEAHLVHV----------SNDGRIAVLAVMYQIGETPNPI--- 524
                 SEH +    Y  E HLVHV          S    +AV+ V   + +T +P+   
Sbjct: 122 QNDAVGSEHAMGSLHYPAELHLVHVREGLTLKEALSRPDGLAVVGVF--LAKTNDPVANK 179

Query: 525 LSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTI 704
            S I + L  L  +    +   +    +L      +YRY GSLTTP C+E V+WTV+   
Sbjct: 180 FSPISERLHDLRHSGNKTELKNFRTKYVLPLDTEAFYRYEGSLTTPDCSEAVIWTVLAEP 239

Query: 705 RSVTKQQVALIRNAIHDE---SKTNARPLQTINDRFVK 809
            +++  Q+ L+R   + E   S  N RPLQ +N R ++
Sbjct: 240 MAISSHQLHLLRQLHNKELVKSDKNYRPLQPLNGRRIQ 277



>gb:AK052639_1170122 Mus musculus 0 day neonate kidney cDNA, RIKEN
           full-length enriched library, clone:D630010E08
           product:similar to CARBONIC ANHYDRASE XII PRECURSOR (EC
           4.2.1.1) (CARBONATE DEHYDRATASE XII) (CA-XII) (TUMOR
           ANTIGEN HOM-RCC-3.1.3) [Homo sapiens], full insert
           sequence.
          Length = 354

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 70/241 (29%), Positives = 109/241 (45%), Gaps = 24/241 (9%)
 Frame = +3

Query: 147 GPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQ----NYYMRDVATLENHGY 311
           G  +W +  P       G +Q+PIDL S  + Y ++L P+Q    N  +  +  L N G+
Sbjct: 39  GEKNWSKKYPS----CGGLLQSPIDLHSDILQYDASLAPLQFQGYNVSVEKLLNLTNDGH 94

Query: 312 GMMLSWPLGQRYLGINGIRYLFRQVHWHFP-------SEHVVNGTRYDLEAHLVHVSND- 467
            + L+        G+    Y   Q+H H+        SEH V+G  +  E H+VH ++D 
Sbjct: 95  SVRLNLNSDMYIQGLQPHHYRAEQLHLHWGNRNDPHGSEHTVSGKHFAAELHIVHYNSDL 154

Query: 468 -----------GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQ 614
                        +AVLAV+ +IG   NP    I   L+ +          G+    LL 
Sbjct: 155 YPDFSTASDKSEGLAVLAVLIEIGSA-NPSYDKIFSHLQHVKYKGQQVLIPGFNIEELLP 213

Query: 615 ARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTIN 794
                YYRY GSLTTPPC   V+WTV R    ++++Q+  +  A++     +  P + IN
Sbjct: 214 ESPGEYYRYEGSLTTPPCYPTVLWTVFRNPVQISQEQLLALETALYFTHMDDPTPREMIN 273

Query: 795 D 797
           +
Sbjct: 274 N 274



>sp|Q8CI85|CAHC_MOUSE Carbonic anhydrase XII precursor (EC 4.2.1.1)
           (Carbonate dehydratase XII)
           (CA-XII).>gb:BC035941_2097843 Mus musculus carbonic
           anyhydrase 12, mRNA (cDNA clone MGC:31022
           IMAGE:3987392), complete cds.
          Length = 354

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 70/241 (29%), Positives = 109/241 (45%), Gaps = 24/241 (9%)
 Frame = +3

Query: 147 GPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQ----NYYMRDVATLENHGY 311
           G  +W +  P       G +Q+PIDL S  + Y ++L P+Q    N  +  +  L N G+
Sbjct: 39  GEKNWSKKYPS----CGGLLQSPIDLHSDILQYDASLAPLQFQGYNVSVEKLLNLTNDGH 94

Query: 312 GMMLSWPLGQRYLGINGIRYLFRQVHWHFP-------SEHVVNGTRYDLEAHLVHVSND- 467
            + L+        G+    Y   Q+H H+        SEH V+G  +  E H+VH ++D 
Sbjct: 95  SVRLNLNSDMYIQGLQPHHYRAEQLHLHWGNRNDPHGSEHTVSGKHFAAELHIVHYNSDL 154

Query: 468 -----------GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQ 614
                        +AVLAV+ +IG   NP    I   L+ +          G+    LL 
Sbjct: 155 YPDFSTASDKSEGLAVLAVLIEIGSA-NPSYDKIFSHLQHVKYKGQQVLIPGFNIEELLP 213

Query: 615 ARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTIN 794
                YYRY GSLTTPPC   V+WTV R    ++++Q+  +  A++     +  P + IN
Sbjct: 214 ESPGEYYRYEGSLTTPPCYPTVLWTVFRNPVQISQEQLLALETALYFTHMDDPTPREMIN 273

Query: 795 D 797
           +
Sbjct: 274 N 274



>gb:AB030829_2044704 Rattus norvegicus CA3 mRNA for carbonic
           anhydrase III, complete cds.>gb:AB030830_2044705 Rattus
           norvegicus CA3 mRNA for carbonic anhydrase III, complete
           cds.>gb:AF037072_2051837 Rattus norvegicus carbonic
           anhydrase III (CA3) mRNA, complete
           cds.>gb:BC061980_2104757 Rattus norvegicus carbonic
           anhydrase 3, mRNA (cDNA clone MGC:72261 IMAGE:5597975),
           complete cds.
          Length = 260

 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 80/271 (29%), Positives = 117/271 (43%), Gaps = 38/271 (14%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQ-NYYMRD 284
           EWG++    S  GP HW EL P     + G  Q+PI+L +K + +  +L P   +Y    
Sbjct: 4   EWGYA----SHNGPEHWHELYP----IAKGDNQSPIELHTKDIRHDPSLQPWSVSYDPGS 55

Query: 285 VATLENHGY------------GMMLSWPLGQRYLGINGIRYLFRQVHWHFPS------EH 410
             T+ N+G              M+   PL   Y          RQ H H+ S      EH
Sbjct: 56  AKTILNNGKTCRVVFDDTFDRSMLRGGPLSGPYR--------LRQFHLHWGSSDDHGSEH 107

Query: 411 VVNGTRYDLEAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKL 557
            V+G +Y  E HLVH           +     IAV+ +  +IG        L+ D L K+
Sbjct: 108 TVDGVKYAAELHLVHWNPKYNTFGEALKQPDGIAVVGIFLKIGREKGEFQILL-DALDKI 166

Query: 558 AETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALI 737
            +T G +    + DP+ L    R Y+ Y GS TTPPC E +VW +++   +V+  Q+A +
Sbjct: 167 -KTKGKEAPFNHFDPSCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPMTVSSDQMAKL 225

Query: 738 RNAIHDESKT-------NARPLQTINDRFVK 809
           R+               N RP Q I  R V+
Sbjct: 226 RSLFASAENEPPVPLVGNWRPPQPIKGRVVR 256



>sp|P18915|CAH6_BOVIN Carbonic anhydrase VI precursor (EC 4.2.1.1)
           (Carbonate dehydratase VI) (CA-VI) (Secreted carbonic
           anhydrase) (Salivary carbonic
           anhydrase).>pir|S71877|S71877 carbonate dehydratase (EC
           4.2.1.1) isoform VI precursor -
           bovine>gb:BTCARANVI_1436950 B.taurus mRNA for carbonic
           anhydrase VI.
          Length = 319

 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 78/277 (28%), Positives = 132/277 (47%), Gaps = 33/277 (11%)
 Frame = +3

Query: 84  VIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS---NL 254
           ++   +   EW +S     ++   HW   R ++  C  G  Q+PIDL+ K V Y+     
Sbjct: 8   LVVGAQAQHEWTYSEGVLDEK---HW---RLQYPDCG-GTRQSPIDLKMKKVRYNPSLRA 60

Query: 255 GPIQNYYMRDVA-TLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP--------SE 407
             +  Y +R     + N+G+ + +S P   R    +G +YL +Q+H+H+         SE
Sbjct: 61  LNLTGYGLRQGEFPMTNNGHTVQISLPSSMRMTTSDGSQYLAKQMHFHWGGDSSEISGSE 120

Query: 408 HVVNGTRYDLEAHLVHVSN------------DGRIAVLAVMYQIGETP-----NPILSLI 536
           H V+G RY +E H+VH  +            DG +AVLA + ++ +       +  +S +
Sbjct: 121 HTVDGMRYIIEIHVVHYHSKYGSYEEAQNEPDG-LAVLAALVEVKDYAENTYYSNFISHL 179

Query: 537 EDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVT 716
           ED   + A    V + +   D  +L    R YY Y+GSLTTP CTE V W V+     ++
Sbjct: 180 EDI--RYAGQSTVLRDLDIQD--MLPGDLRYYYSYLGSLTTPSCTENVHWFVVADTVKLS 235

Query: 717 KQQVALIRNAI----HDESKTNARPLQTINDRFVKVD 815
           K Q+  + N++    ++  + N R  Q +N R V+ +
Sbjct: 236 KTQIEKLENSLLNHQNETIQNNYRSTQPLNHRVVEAN 272



>sp|P14141|CAH3_RAT Carbonic anhydrase III (EC 4.2.1.1) (Carbonate
           dehydratase III) (CA- III).
          Length = 259

 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 80/271 (29%), Positives = 117/271 (43%), Gaps = 38/271 (14%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQ-NYYMRD 284
           EWG++    S  GP HW EL P     + G  Q+PI+L +K + +  +L P   +Y    
Sbjct: 3   EWGYA----SHNGPEHWHELYP----IAKGDNQSPIELHTKDIRHDPSLQPWSVSYDPGS 54

Query: 285 VATLENHGY------------GMMLSWPLGQRYLGINGIRYLFRQVHWHFPS------EH 410
             T+ N+G              M+   PL   Y          RQ H H+ S      EH
Sbjct: 55  AKTILNNGKTCRVVFDDTFDRSMLRGGPLSGPYR--------LRQFHLHWGSSDDHGSEH 106

Query: 411 VVNGTRYDLEAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKL 557
            V+G +Y  E HLVH           +     IAV+ +  +IG        L+ D L K+
Sbjct: 107 TVDGVKYAAELHLVHWNPKYNTFGEALKQPDGIAVVGIFLKIGREKGEFQILL-DALDKI 165

Query: 558 AETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALI 737
            +T G +    + DP+ L    R Y+ Y GS TTPPC E +VW +++   +V+  Q+A +
Sbjct: 166 -KTKGKEAPFNHFDPSCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPMTVSSDQMAKL 224

Query: 738 RNAIHDESKT-------NARPLQTINDRFVK 809
           R+               N RP Q I  R V+
Sbjct: 225 RSLFASAENEPPVPLVGNWRPPQPIKGRVVR 255



>gb:AF294983S6_2061874 Mus musculus carbonic anhydrase III gene,
           exon 7 and complete cds.>gb:BC011129_2091257 Mus
           musculus carbonic anhydrase 3, mRNA (cDNA clone
           MGC:18583 IMAGE:4195712), complete cds.
          Length = 260

 Score = 91.3 bits (225), Expect = 4e-17
 Identities = 77/263 (29%), Positives = 117/263 (44%), Gaps = 30/263 (11%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQ-NYYMRD 284
           EWG++    S  GP HW EL P     + G  Q+PI+L +K + +  +L P   +Y    
Sbjct: 4   EWGYA----SHNGPDHWHELYP----IAKGDNQSPIELHTKDIKHDPSLQPWSASYDPGS 55

Query: 285 VATLENHGYGMML----SWPLGQRYLGINGIRYLFRQVHWHFPS------EHVVNGTRYD 434
             T+ N+G    +    ++       G     Y  RQ H H+ S      EH V+G +Y 
Sbjct: 56  AKTILNNGKTCRVVFDDTYDRSMLRGGPLSGPYRLRQFHLHWGSSDDHGSEHTVDGVKYA 115

Query: 435 LEAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK 581
            E HLVH           +     IAV+ +  +IG        L+ D L K+ +T G + 
Sbjct: 116 AELHLVHWNPKYNTFGEALKQPDGIAVVGIFLKIGREKGEFQILL-DALDKI-KTKGKEA 173

Query: 582 GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES 761
              + DP+ L    R Y+ Y GS TTPPC E +VW +++   +V+  Q+A +R+      
Sbjct: 174 PFTHFDPSCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLFSSAE 233

Query: 762 KT-------NARPLQTINDRFVK 809
                    N RP Q +  R V+
Sbjct: 234 NEPPVPLVGNWRPPQPVKGRVVR 256



>pir|I52551|I52551 carbonate dehydratase (EC 4.2.1.1) III -
           rat>gb:RATCAIII_2131665 Rat carbonic anhydrase III
           (CAIII) mRNA, complete cds.
          Length = 260

 Score = 91.3 bits (225), Expect = 4e-17
 Identities = 80/271 (29%), Positives = 116/271 (42%), Gaps = 38/271 (14%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQ-NYYMRD 284
           EWG+     S  GP HW EL P     + G  Q+PI+L +K + +  +L P   +Y    
Sbjct: 4   EWGYG----SHNGPEHWHELYP----IAKGDNQSPIELHTKDIRHDPSLQPWSVSYDPGS 55

Query: 285 VATLENHGY------------GMMLSWPLGQRYLGINGIRYLFRQVHWHFPS------EH 410
             T+ N+G              M+   PL   Y          RQ H H+ S      EH
Sbjct: 56  AKTILNNGKTCRVVFDDTFDRSMLRGGPLSGPYR--------LRQFHLHWGSSDDHGSEH 107

Query: 411 VVNGTRYDLEAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKL 557
            V+G +Y  E HLVH           +     IAV+ +  +IG        L+ D L K+
Sbjct: 108 TVDGVKYAAELHLVHWNPKYNTSEEALKQPDGIAVVGIFLKIGREKGEFQILL-DALDKI 166

Query: 558 AETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALI 737
            +T G +    + DP+ L    R Y+ Y GS TTPPC E +VW +++   +V+  Q+A +
Sbjct: 167 -KTKGKEAPFNHFDPSCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPMTVSSDQMANV 225

Query: 738 RNAIHDESKT-------NARPLQTINDRFVK 809
           R+               N RP Q I  R V+
Sbjct: 226 RSLFASAENEPPVPLVGNWRPPQPIKGRVVR 256



>pir|A43641|A43641 carbonate dehydratase (EC 4.2.1.1) III -
           mouse>gb:MUSCAIIIA_2125361 Mouse carbonic anhydrase III
           (CAIII) mRNA, complete cds.
          Length = 260

 Score = 91.3 bits (225), Expect = 4e-17
 Identities = 78/271 (28%), Positives = 118/271 (43%), Gaps = 38/271 (14%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQ-NYYMRD 284
           EWG++       GP HW EL P     + G  Q+PI+L +K + +  +L P   +Y    
Sbjct: 4   EWGYA----RHNGPDHWHELYP----IAKGDNQSPIELHTKDIKHDPSLQPWSASYDPGS 55

Query: 285 VATLENHGY------------GMMLSWPLGQRYLGINGIRYLFRQVHWHFPS------EH 410
             T+ N+G              M+   PL + Y          RQ H H+ S      EH
Sbjct: 56  AKTILNNGKTCRVVFDDTYDRSMLRGGPLSRPYR--------LRQFHLHWGSSDDHGSEH 107

Query: 411 VVNGTRYDLEAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKL 557
            V+G +Y  E HLVH           +     IAV+ ++ +IG        L+ D L K+
Sbjct: 108 TVDGVKYAAELHLVHWNPRYNTFGEALKQPDGIAVVGILLKIGREKGEFQILL-DALDKI 166

Query: 558 AETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALI 737
            +T G +    + DP+ L    R Y+ Y GS TTPPC E +VW +++   +V+  Q+A +
Sbjct: 167 -KTKGKEAPFTHFDPSCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPMTVSSDQMAKL 225

Query: 738 RNAIHDESKT-------NARPLQTINDRFVK 809
           R+               N RP Q +  R V+
Sbjct: 226 RSLFSSAENEPPVPLVGNWRPPQPVKGRVVR 256



>sp|P16015|CAH3_MOUSE Carbonic anhydrase III (EC 4.2.1.1) (Carbonate
           dehydratase III) (CA- III).
          Length = 259

 Score = 91.3 bits (225), Expect = 4e-17
 Identities = 77/263 (29%), Positives = 117/263 (44%), Gaps = 30/263 (11%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQ-NYYMRD 284
           EWG++    S  GP HW EL P     + G  Q+PI+L +K + +  +L P   +Y    
Sbjct: 3   EWGYA----SHNGPDHWHELYP----IAKGDNQSPIELHTKDIKHDPSLQPWSASYDPGS 54

Query: 285 VATLENHGYGMML----SWPLGQRYLGINGIRYLFRQVHWHFPS------EHVVNGTRYD 434
             T+ N+G    +    ++       G     Y  RQ H H+ S      EH V+G +Y 
Sbjct: 55  AKTILNNGKTCRVVFDDTYDRSMLRGGPLSGPYRLRQFHLHWGSSDDHGSEHTVDGVKYA 114

Query: 435 LEAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK 581
            E HLVH           +     IAV+ +  +IG        L+ D L K+ +T G + 
Sbjct: 115 AELHLVHWNPKYNTFGEALKQPDGIAVVGIFLKIGREKGEFQILL-DALDKI-KTKGKEA 172

Query: 582 GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES 761
              + DP+ L    R Y+ Y GS TTPPC E +VW +++   +V+  Q+A +R+      
Sbjct: 173 PFTHFDPSCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLFSSAE 232

Query: 762 KT-------NARPLQTINDRFVK 809
                    N RP Q +  R V+
Sbjct: 233 NEPPVPLVGNWRPPQPVKGRVVR 255



>gb:AY075021_2075853 Mus musculus carbonic anhydrase 7 mRNA,
           complete cds.
          Length = 264

 Score = 90.5 bits (223), Expect = 6e-17
 Identities = 74/264 (28%), Positives = 127/264 (48%), Gaps = 32/264 (12%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQNYYMRDVA 290
           WG+  D+    GPS+W +L P     + G  Q+PI++ S   VYS +L P++ +Y   ++
Sbjct: 7   WGYGQDD----GPSNWHKLYP----IAQGDRQSPINIISSQAVYSPSLQPLELFYEACMS 58

Query: 291 -TLENHGYGMMLSWPLGQRYLGINGIR----YLFRQVHWHFP------SEHVVNGTRYDL 437
            ++ N+G+ + + +        ++G      Y  +Q+H+H+       SEH V+G  +  
Sbjct: 59  LSITNNGHSVQVDFNDSDDRTVVSGGPLEGPYRLKQLHFHWGKKRDMGSEHTVDGKSFPS 118

Query: 438 EAHLVH-------------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
           E HLVH              + DG +AV+ V  + G+  +P ++ + D L  +      K
Sbjct: 119 ELHLVHWNAKKYSTFGEAAAAPDG-LAVVGVFLETGDE-HPSMNRLTDALY-MVRFKDTK 175

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI--- 749
                 +P  L    R Y+ Y GSLTTPP +E V W V+R    ++++Q+   R+ +   
Sbjct: 176 AQFSCFNPKCLLPTSRHYWTYPGSLTTPPLSESVTWIVLREPIRISERQMEKFRSLLFTS 235

Query: 750 HDESK----TNARPLQTINDRFVK 809
            D+ +     N RP Q +  R VK
Sbjct: 236 EDDERIHMVDNFRPPQPLKGRVVK 259



>sp|Q10462|CAH5_CAEEL Putative carbonic anhydrase 5 precursor (EC
           4.2.1.1) (Carbonate dehydratase 5).
          Length = 309

 Score = 90.5 bits (223), Expect = 6e-17
 Identities = 83/277 (29%), Positives = 121/277 (43%), Gaps = 29/277 (10%)
 Frame = +3

Query: 66  LLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY 245
           LL    V+ S     + G+ YDEN+  GP  W        +C     Q+PID+ +  V Y
Sbjct: 10  LLVALLVVVSCGPGSDHGWGYDENN--GPDTWQG------KCQNHLKQSPIDIRAPDVDY 61

Query: 246 SNLGPIQ--NYYMRDVATLENHGYGMML---SWPLGQRYLGINGI--RYLFRQVHWHFP- 401
           + L  +   NY M     L N G        SW   Q  +   G+  RY   Q H H+  
Sbjct: 62  ALLHRMHFLNYDMDGKIELSNTGRTFCRRFESWQHKQPMIQGGGLKHRYKLAQFHLHWGQ 121

Query: 402 -----SEHVVNGTRYDLEAHLVHV----------SNDGRIAVLAVMYQIGETPNPI---L 527
                SEH +    Y  E HLVHV          S    +AV+ V   + +T +P+    
Sbjct: 122 NDAVGSEHAMGSLHYPAELHLVHVREGLTLKEALSRPDGLAVVGVF--LAKTNDPVANKF 179

Query: 528 SLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIR 707
           S I + L  L  +    +   +    +L      +YRY GSLTTP C+E V+WTV+    
Sbjct: 180 SPISERLHDLRHSGNKTELKNFRTKYVLPLDTEAFYRYEGSLTTPDCSEAVIWTVLAEPM 239

Query: 708 SVTKQQVALIRNAIHDE---SKTNARPLQTINDRFVK 809
           +++  Q+ L+R   + E   S  N RPLQ +N R ++
Sbjct: 240 AISSHQLHLLRQLHNKELVKSDKNYRPLQPLNGRRIQ 276



>gb:BC067635_2554807 Danio rerio hypothetical protein LOC407683,
           mRNA (cDNA clone IMAGE:6961398), partial cds.
          Length = 309

 Score = 90.1 bits (222), Expect = 8e-17
 Identities = 76/281 (27%), Positives = 131/281 (46%), Gaps = 34/281 (12%)
 Frame = +3

Query: 66  LLSVTHVIKSQEV-DDEWGFSYD---ENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK 233
           +LS++ V+ + ++   EW +       ++  GPS W   +  +  C  G+ Q+PI++ + 
Sbjct: 4   ILSLSSVLLALKLCSGEWCYQSQLSCNHTCEGPSQW---KINYTSCG-GQKQSPINIITS 59

Query: 234 PVVYSNLGPIQNYYMRDV------ATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH 395
            V Y    P    ++ D        ++ENHG+    + P      G  G++  ++ V +H
Sbjct: 60  KVKYD---PKLTSFIFDGHEDAFNMSVENHGHSAHFTLPPSAHLSG-GGLKGKYKAVQFH 115

Query: 396 FP--------SEHVVNGTRYDLEAHLVHVS-----------NDGRIAVLAVMYQIGETPN 518
                     SEH V+G RY +E H+V++            N   +AVLA  +++    N
Sbjct: 116 LHWGENGSQGSEHSVDGERYPMELHIVYIGEEYINLTKALQNSTGVAVLAFFFEVTALQN 175

Query: 519 PILSLIEDDLKKLAETPGVKKGIGY-LDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVI 695
                I + LKK+       K   + L   + Q   ++YYRY GSLTTP C E V+WTV 
Sbjct: 176 QKFERIIEALKKVRHENTTSKVENFKLSDIIPQVNSQKYYRYSGSLTTPSCEEAVLWTVF 235

Query: 696 RTIRSVTKQQV-ALIRNAIHDESKTNA---RPLQTINDRFV 806
           +    ++K Q+ ++ +  +    K  A   RP+Q +N+R V
Sbjct: 236 QQTIGISKMQMESMDKLLLFGTDKPMAGIFRPVQNLNERVV 276



>gb:SHPCAI_1444709 Ovis aries carbonic anhydrase I mRNA, complete
           cds.
          Length = 261

 Score = 90.1 bits (222), Expect = 8e-17
 Identities = 76/264 (28%), Positives = 120/264 (45%), Gaps = 31/264 (11%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQ-NYYMRD 284
           +WG+    + + GP HW +L P     + G  Q+PID+++       +L P+  +Y    
Sbjct: 5   DWGY----DGENGPEHWCKLHP----IANGNNQSPIDIKTSETKRDPSLKPLSISYNPAT 56

Query: 285 VATLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWHFPS------EHVVNGTRYD 434
              + N G+   +++        + G      Y  RQ H+H+ S      EH+V+G  + 
Sbjct: 57  AKEIVNVGHSFHVNFEDSDNRSVLKGGPLPESYRLRQFHFHWGSTDDCGSEHLVDGATFS 116

Query: 435 LEAHLVH------------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
            E HLVH             S    + V+ V+ ++G+  NP L  + D LK + +T   K
Sbjct: 117 AELHLVHWNSAKYPSFADAASQADGLVVVGVLMKVGQA-NPNLQKVLDALKTV-KTKNKK 174

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVA----LIRNA 746
                 DP++L      Y+ Y GSLT PP  E V W + +   SV+ +Q+A    L+ NA
Sbjct: 175 APFTNFDPSVLLPSCPDYWAYFGSLTHPPLHESVTWIIFKETISVSAEQLAQFRSLLANA 234

Query: 747 IHDES---KTNARPLQTINDRFVK 809
             D+    K N RP Q +  R VK
Sbjct: 235 EGDKEVCIKQNYRPPQPLKGRTVK 258



>sp|P48282|CAH1_SHEEP Carbonic anhydrase I (EC 4.2.1.1) (Carbonate
           dehydratase I) (CA-I).
          Length = 260

 Score = 90.1 bits (222), Expect = 8e-17
 Identities = 76/264 (28%), Positives = 120/264 (45%), Gaps = 31/264 (11%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQ-NYYMRD 284
           +WG+    + + GP HW +L P     + G  Q+PID+++       +L P+  +Y    
Sbjct: 4   DWGY----DGENGPEHWCKLHP----IANGNNQSPIDIKTSETKRDPSLKPLSISYNPAT 55

Query: 285 VATLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWHFPS------EHVVNGTRYD 434
              + N G+   +++        + G      Y  RQ H+H+ S      EH+V+G  + 
Sbjct: 56  AKEIVNVGHSFHVNFEDSDNRSVLKGGPLPESYRLRQFHFHWGSTDDCGSEHLVDGATFS 115

Query: 435 LEAHLVH------------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
            E HLVH             S    + V+ V+ ++G+  NP L  + D LK + +T   K
Sbjct: 116 AELHLVHWNSAKYPSFADAASQADGLVVVGVLMKVGQA-NPNLQKVLDALKTV-KTKNKK 173

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVA----LIRNA 746
                 DP++L      Y+ Y GSLT PP  E V W + +   SV+ +Q+A    L+ NA
Sbjct: 174 APFTNFDPSVLLPSCPDYWAYFGSLTHPPLHESVTWIIFKETISVSAEQLAQFRSLLANA 233

Query: 747 IHDES---KTNARPLQTINDRFVK 809
             D+    K N RP Q +  R VK
Sbjct: 234 EGDKEVCIKQNYRPPQPLKGRTVK 257



>gb:AY641852_2541416 Gekko japonicus GekBS031P mRNA, complete cds.
          Length = 260

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 80/264 (30%), Positives = 119/264 (45%), Gaps = 31/264 (11%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY--SNLGPIQNYYMRD 284
           EWG++ D N   GP HW EL P     + G  Q+PI+L +K + +  S L    +Y    
Sbjct: 4   EWGYA-DHN---GPDHWHELYP----IAKGDNQSPIELHTKDIKHDPSLLPWTASYDPGS 55

Query: 285 VATLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWHFPS------EHVVNGTRYD 434
             T+ N+G    + +        + G      Y  RQ H H+ S      EH V+G +Y 
Sbjct: 56  AKTILNNGKTCRVVFDDTYDRSMLRGGPLTAAYRLRQFHLHWGSSDDHGSEHTVDGVKYA 115

Query: 435 LEAHLVHVSN------------DGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
            E HLVH ++            DG +AV+ +  +IG        L+ D L K+ +T G +
Sbjct: 116 AELHLVHWNSKYNSFATALKHPDG-VAVVGIFLKIGREKGEF-QLVLDALDKI-KTKGKE 172

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE 758
                 +P+ L    R Y+ Y GS TTPPC E +VW +++   +V+  Q+A +R+     
Sbjct: 173 APFTNFNPSCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPITVSSDQMAKLRSLYSSA 232

Query: 759 SK-------TNARPLQTINDRFVK 809
                     N RP Q I  R VK
Sbjct: 233 ENEPPVPLVRNWRPPQPIKGRIVK 256



>gb:MUSCAIA_2125360 Mouse carbonic anhydrase I (CAI) mRNA, complete
           cds.>gb:MUSCAR108_2125386 Mus musculus carbonic
           anhydrase I (Car1) gene, exon 8.
          Length = 261

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 74/265 (27%), Positives = 119/265 (44%), Gaps = 32/265 (12%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQNYY---- 275
           +WG+     S+ GP  W +L P     + G  Q+PID+++    + S+L P+   Y    
Sbjct: 5   DWGYG----SENGPDQWSKLYP----IANGNNQSPIDIKTSEANHDSSLKPLSISYNPAT 56

Query: 276 MRDVATLENHGYGMMLSWPLGQRYL--GINGIRYLFRQVHWHFP------SEHVVNGTRY 431
            +++  +  H + ++      Q  L  G     Y   Q H+H+       SEH V+GTRY
Sbjct: 57  AKEIVNV-GHSFHVIFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGTRY 115

Query: 432 DLEAHLVH------------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV 575
             E HLVH            +S    +A+L V+ ++G   NP L  + D L  + +T G 
Sbjct: 116 SGELHLVHWNSAKYSSASEAISKADGLAILGVLMKVGPA-NPSLQKVLDALNSV-KTKGK 173

Query: 576 KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD 755
           +      DP+ L      Y+ Y GSLT PP  E V W + +   S++ +Q+A +R  +  
Sbjct: 174 RAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKDSISLSPEQLAQLRGLLSS 233

Query: 756 ES-------KTNARPLQTINDRFVK 809
                     +N RP Q +  R V+
Sbjct: 234 AEGESAVPVLSNHRPPQPLKGRTVR 258



>gb:AY789514_1433890 Sus scrofa carbonic anhydrase III (CA3) mRNA,
           complete cds.>gb:AY789645_1433891 Sus scrofa carbonic
           anhydrase-like protein mRNA, complete cds.
          Length = 260

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 80/264 (30%), Positives = 119/264 (45%), Gaps = 31/264 (11%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY--SNLGPIQNYYMRD 284
           EWG++ D N   GP HW EL P     + G  Q+PI+L +K + +  S L    +Y    
Sbjct: 4   EWGYA-DHN---GPDHWHELYP----IAKGDNQSPIELHTKDIKHDPSLLPWTASYDPGS 55

Query: 285 VATLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWHFPS------EHVVNGTRYD 434
             T+ N+G    + +        + G      Y  RQ H H+ S      EH V+G +Y 
Sbjct: 56  AKTILNNGKTCRVVFDDTYDRSMLRGGPLTAAYRLRQFHLHWGSSDDHGSEHTVDGVKYA 115

Query: 435 LEAHLVHVSN------------DGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
            E HLVH ++            DG +AV+ +  +IG        L+ D L K+ +T G +
Sbjct: 116 AELHLVHWNSKYNSFATALKHPDG-VAVVGIFLKIGREKGEF-QLVLDALDKI-KTKGKE 172

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE 758
                 +P+ L    R Y+ Y GS TTPPC E +VW +++   +V+  Q+A +R+     
Sbjct: 173 APFTNFNPSCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPITVSSDQMAKLRSLYSSA 232

Query: 759 SK-------TNARPLQTINDRFVK 809
                     N RP Q I  R VK
Sbjct: 233 ENEPPVPLVRNWRPPQPIKGRIVK 256



>gb:AK003066_1151624 Mus musculus adult male spleen cDNA, RIKEN
           full-length enriched library, clone:0910001D19
           product:carbonic anhydrase 1, full insert
           sequence.>gb:BC011223_2091323 Mus musculus carbonic
           anhydrase 1, mRNA (cDNA clone MGC:18584 IMAGE:4208180),
           complete cds.
          Length = 261

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 74/265 (27%), Positives = 119/265 (44%), Gaps = 32/265 (12%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQNYY---- 275
           +WG+     S+ GP  W +L P     + G  Q+PID+++    + S+L P+   Y    
Sbjct: 5   DWGYG----SENGPDQWSKLYP----IANGNNQSPIDIKTSEANHDSSLKPLSISYNPAT 56

Query: 276 MRDVATLENHGYGMMLSWPLGQRYL--GINGIRYLFRQVHWHFP------SEHVVNGTRY 431
            +++  +  H + ++      Q  L  G     Y   Q H+H+       SEH V+GTRY
Sbjct: 57  AKEIVNV-GHSFHVIFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGTRY 115

Query: 432 DLEAHLVH------------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV 575
             E HLVH            +S    +A+L V+ ++G   NP L  + D L  + +T G 
Sbjct: 116 SGELHLVHWNSAKYSSASEAISKADGLAILGVLMKVGPA-NPSLQKVLDALNSV-KTKGK 173

Query: 576 KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD 755
           +      DP+ L      Y+ Y GSLT PP  E V W + +   S++ +Q+A +R  +  
Sbjct: 174 RAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKDSISLSPEQLAQLRGLLSS 233

Query: 756 ES-------KTNARPLQTINDRFVK 809
                     +N RP Q +  R V+
Sbjct: 234 AEGEPAVPVLSNHRPPQPLKGRTVR 258



>pir|A26344|A26344 carbonate dehydratase (EC 4.2.1.1) I - mouse
          Length = 261

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 74/265 (27%), Positives = 119/265 (44%), Gaps = 32/265 (12%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQNYY---- 275
           +WG+     S+ GP  W +L P     + G  Q+PID+++    + S+L P+   Y    
Sbjct: 5   DWGYG----SENGPDQWSKLYP----IANGNNQSPIDIKTSEANHDSSLKPLSISYNPAT 56

Query: 276 MRDVATLENHGYGMMLSWPLGQRYL-GINGIRYLFRQVHWHFP-------SEHVVNGTRY 431
            +++  +  H + ++      Q  L G     Y   Q H+H+        SEH V+GTRY
Sbjct: 57  AKEIVNV-GHSFHVIFDDSSNQSVLKGPLADSYRLTQFHFHWGNSSNDHGSEHTVDGTRY 115

Query: 432 DLEAHLVH------------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV 575
             E HLVH            +S    +A+L V+ ++G   NP L  + D L  + +T G 
Sbjct: 116 SGELHLVHWNSAKYSSASEAISKADGLAILGVLMKVGPA-NPSLQKVLDALNSV-KTKGK 173

Query: 576 KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD 755
           +      DP+ L      Y+ Y GSLT PP  E V W + +   S++ +Q+A +R  +  
Sbjct: 174 RAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKDSISLSPEQLAQLRGLLSS 233

Query: 756 ES-------KTNARPLQTINDRFVK 809
                     +N RP Q +  R V+
Sbjct: 234 AEGESAVPVLSNHRPPQPLKGRTVR 258



>pir|T16772|T16772 hypothetical protein R173.1 - Caenorhabditis
           elegans
          Length = 334

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 83/279 (29%), Positives = 122/279 (43%), Gaps = 31/279 (11%)
 Frame = +3

Query: 66  LLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY 245
           LL    V+ S     + G+ YDEN+  GP  W        +C     Q+PID+ +  V Y
Sbjct: 33  LLVALLVVVSCGPGSDHGWGYDENN--GPDTWQG------KCQNHLKQSPIDIRAPDVDY 84

Query: 246 SNLGPIQ--NYYMRDVATLENHGYGMML-----SWPLGQRYLGINGI--RYLFRQVHWHF 398
           + L  +   NY M     L N G    +     SW   Q  +   G+  RY   Q H H+
Sbjct: 85  ALLHRMHFLNYDMDGKIELSNTGRTCDVCRRFESWQHKQPMIQGGGLKHRYKLAQFHLHW 144

Query: 399 P------SEHVVNGTRYDLEAHLVHV----------SNDGRIAVLAVMYQIGETPNPI-- 524
                  SEH +    Y  E HLVHV          S    +AV+ V   + +T +P+  
Sbjct: 145 GQNDAVGSEHAMGSLHYPAELHLVHVREGLTLKEALSRPDGLAVVGVF--LAKTNDPVAN 202

Query: 525 -LSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRT 701
             S I + L  L  +    +   +    +L      +YRY GSLTTP C+E V+WTV+  
Sbjct: 203 KFSPISERLHDLRHSGNKTELKNFRTKYVLPLDTEAFYRYEGSLTTPDCSEAVIWTVLAE 262

Query: 702 IRSVTKQQVALIRNAIHDE---SKTNARPLQTINDRFVK 809
             +++  Q+ L+R   + E   S  N RPLQ +N R ++
Sbjct: 263 PMAISSHQLHLLRQLHNKELVKSDKNYRPLQPLNGRRIQ 301



>sp|Q8N1Q1|CAHD_HUMAN Carbonic anhydrase XIII (EC 4.2.1.1)
           (Carbonate dehydratase XIII) (CA-
           XIII).>gb:AX817269_1475856 Sequence 17 from Patent
           WO02081517.>gb:AK095314_1914340 Homo sapiens cDNA
           FLJ37995 fis, clone CTONG2011825, moderately similar to
           CARBONIC ANHYDRASE (EC 4.2.1.1).>gb:BC052602_1984844
           Homo sapiens carbonic anhydrase XIII, mRNA (cDNA clone
           MGC:59868 IMAGE:6083105), complete cds.
          Length = 262

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 79/263 (30%), Positives = 115/263 (43%), Gaps = 31/263 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQ-NYYMRDV 287
           WG+        GP HW E  P     + G  Q+PI++++K V Y S+L P+   Y     
Sbjct: 6   WGY----REHNGPIHWKEFFP----IADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSA 57

Query: 288 ATLENHGYGMMLSWPLGQRYLGINGI----RYLFRQVHWHFPS------EHVVNGTRYDL 437
             + N G+   + +   +    + G      Y  RQVH H+ S      EH+V+G  Y  
Sbjct: 58  KIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAA 117

Query: 438 EAHLVHVSND------------GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK 581
           E H+VH ++D              +AVL V  QIGE PN  L  I D L  + E  G + 
Sbjct: 118 ELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGE-PNSQLQKITDTLDSIKEK-GKQT 175

Query: 582 GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES 761
                D   L      Y+ Y GSLT PP  E V W V++   +++ QQ+A  R+ +    
Sbjct: 176 RFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAE 235

Query: 762 -------KTNARPLQTINDRFVK 809
                   +N RP Q +  R V+
Sbjct: 236 GEAAAFLVSNHRPPQPLKGRKVR 258



>sp|P13634|CAH1_MOUSE Carbonic anhydrase I (EC 4.2.1.1) (Carbonate
           dehydratase I) (CA-I).
          Length = 260

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 74/265 (27%), Positives = 119/265 (44%), Gaps = 32/265 (12%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQNYY---- 275
           +WG+     S+ GP  W +L P     + G  Q+PID+++    + S+L P+   Y    
Sbjct: 4   DWGYG----SENGPDQWSKLYP----IANGNNQSPIDIKTSEANHDSSLKPLSISYNPAT 55

Query: 276 MRDVATLENHGYGMMLSWPLGQRYL--GINGIRYLFRQVHWHFP------SEHVVNGTRY 431
            +++  +  H + ++      Q  L  G     Y   Q H+H+       SEH V+GTRY
Sbjct: 56  AKEIVNV-GHSFHVIFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGTRY 114

Query: 432 DLEAHLVH------------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV 575
             E HLVH            +S    +A+L V+ ++G   NP L  + D L  + +T G 
Sbjct: 115 SGELHLVHWNSAKYSSASEAISKADGLAILGVLMKVGPA-NPSLQKVLDALNSV-KTKGK 172

Query: 576 KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD 755
           +      DP+ L      Y+ Y GSLT PP  E V W + +   S++ +Q+A +R  +  
Sbjct: 173 RAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKDSISLSPEQLAQLRGLLSS 232

Query: 756 ES-------KTNARPLQTINDRFVK 809
                     +N RP Q +  R V+
Sbjct: 233 AEGESAVPVLSNHRPPQPLKGRTVR 257



>gb:BC078387_2560960 Danio rerio cDNA clone IMAGE:7036975, partial
           cds.
          Length = 314

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 73/282 (25%), Positives = 124/282 (43%), Gaps = 26/282 (9%)
 Frame = +3

Query: 36  MLKLFSIAFLLLSVTHVIKSQEVDDEWGF----SYDENSDRGPSHWGELRPEWWQCSAGK 203
           ++++  + FL LS   ++       EW +    +   +S  GP  W  +      C   K
Sbjct: 5   LVQILRMNFLCLSTLAILCRLASSAEWCYQTQVTCSNHSCIGPDDWATVAAA---CGNNK 61

Query: 204 MQTPIDL-ESKPVVYSNLGPIQ--NYYMRDVATLENHGYGMMLSWPLGQRYLGIN-GIRY 371
            Q+PI++  +K    S L P+Q  +Y  R  A + N+G+ + ++ P   +  G N G  Y
Sbjct: 62  -QSPINIVTNKASTDSRLTPVQFTDYQERLNAVIVNNGHTVQINLPDRAKINGANLGSTY 120

Query: 372 LFRQVHWHFP------SEHVVNGTRYDLEAHLVHVSND-----------GRIAVLAVMYQ 500
             +Q+H H+       SEH ++G ++ +E H+VH+  +             +AVL   Y+
Sbjct: 121 KAQQLHLHWGKNGGPGSEHTIDGEKFPMELHVVHIKEEYNSLEQAVGDSSGVAVLGFFYE 180

Query: 501 IGETPNPILSLIEDDLKKLAETPG-VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEG 677
             E  N     I + L  +       + G   LD  +      +Y+RY GSLTTP C E 
Sbjct: 181 ESENANKNYDAIINSLTNITHPESNAELGAISLDMLIPNEDLDKYFRYEGSLTTPGCAEA 240

Query: 678 VVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRF 803
           VVWT+      ++K+Q++   N    +        + I  RF
Sbjct: 241 VVWTIFEKTIPLSKEQLSAFSNLTFSDGAAMVNTFRPIQLRF 282



>gb:AX817267_1475855 Sequence 15 from Patent WO02081517.
          Length = 262

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 78/263 (29%), Positives = 115/263 (43%), Gaps = 31/263 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQ-NYYMRDV 287
           WG+        GP HW E  P     + G  Q+PI++++K V Y S+L P+   Y     
Sbjct: 6   WGY----REHNGPIHWKEFFP----IADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSA 57

Query: 288 ATLENHGYGMMLSWPLGQRYLGINGI----RYLFRQVHWHFPS------EHVVNGTRYDL 437
             + N G+   + +   +    + G      Y  RQVH H+ S      EH+V+G  Y  
Sbjct: 58  KIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAA 117

Query: 438 EAHLVHVSND------------GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK 581
           E H+VH ++D              +AVL V  Q+GE PN  L  I D L  + E  G + 
Sbjct: 118 ELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQVGE-PNSQLQKITDTLDSIKEK-GKQT 175

Query: 582 GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES 761
                D   L      Y+ Y GSLT PP  E V W V++   +++ QQ+A  R+ +    
Sbjct: 176 RFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAE 235

Query: 762 -------KTNARPLQTINDRFVK 809
                   +N RP Q +  R V+
Sbjct: 236 GEAAAFLVSNHRPPQPLKGRKVR 258



>sp|P48283|CAH4_RABIT Carbonic anhydrase IV precursor (EC 4.2.1.1)
           (Carbonate dehydratase IV) (CA-IV).>gb:OCU58871_1442683
           Oryctolagus cuniculus carbonic anhydrase IV mRNA,
           complete cds.>gb:RABCAHIV_1443598 Oryctolagus cuniculus
           carbonic anhydrase IV mRNA, complete cds.
          Length = 308

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 81/252 (32%), Positives = 122/252 (48%), Gaps = 34/252 (13%)
 Frame = +3

Query: 153 SHWGELRPEWWQCSAGKM-QTPIDL-ESKPVVYSNLGPIQ--NYYMRDVATLENHGYGMM 320
           S++  L P+ WQ    K  Q+PI++  +K  V  +LG      Y  R+   +EN+G+ +M
Sbjct: 30  SNYSCLGPDKWQEDCQKSRQSPINIVTTKAEVDHSLGRFHFSGYDQREARLVENNGHSVM 89

Query: 321 LSWPLGQRYLGING----IRYLFRQVHWHFP------SEHVVNGTRYDLEAHLVHVS--- 461
           +S  LG   + I+G     RY   Q+H H+       SEH ++G R  +E H+VH     
Sbjct: 90  VS--LGDE-ISISGGGLPARYRATQLHLHWSQELDRGSEHSLDGERSAMEMHIVHQKETG 146

Query: 462 --------NDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDP-NLLQ 614
                   +D  IAVLA + + G T N     +   L  ++  PG    +      +LL 
Sbjct: 147 TSGNEVQDSDDSIAVLAFLVEAGPTMNEGFQPLVTALSAIS-IPGTNTTMAPSSLWDLLP 205

Query: 615 ARG--RRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES------KTN 770
           A    R Y+RYMGSLTTP C+E VVWTV +    + + Q+    + ++ +       K N
Sbjct: 206 AEEELRHYFRYMGSLTTPACSETVVWTVFQEPIRLHRDQILEFSSKLYYDQERKMNMKDN 265

Query: 771 ARPLQTINDRFV 806
            RPLQ + DR V
Sbjct: 266 VRPLQRLGDRSV 277



>pir|A01139|CRMQ1R carbonate dehydratase (EC 4.2.1.1) I - rhesus
           macaque  (tentative sequence)
          Length = 260

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 70/252 (27%), Positives = 117/252 (46%), Gaps = 24/252 (9%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQ-NYYMRD 284
           +WG+  D+N   GP  W +L P     + G  Q+P+D+++    + ++L PI  +Y    
Sbjct: 4   DWGYD-DKN---GPEQWSKLYP----IANGNNQSPVDIKTSEAKHDTSLKPISVSYNPAT 55

Query: 285 VATLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWH------FPSEHVVNGTRYD 434
              + N G+   +++        + G      Y   Q H+H      + SEH V+G +Y 
Sbjct: 56  AKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSSNEYGSEHTVDGVKYS 115

Query: 435 LEAHLVH------------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
            E H+VH            VS    +AV+ V+ ++GE  NP L  + D L  + +T G +
Sbjct: 116 SELHIVHWNSAKYSSLAEAVSKADGLAVIGVLMKVGEA-NPKLQKVLDALHAI-KTKGKR 173

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE 758
                 DP+ L      ++ Y GSLT PP  E V W + +   SV+ +Q+A  R+ + + 
Sbjct: 174 APFTNFDPSTLLPSSLDFWTYSGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNV 233

Query: 759 SKTNARPLQTIN 794
             +N  P+Q  N
Sbjct: 234 EGSNPVPIQRNN 245



>pir|A37917|CRHU6 carbonate dehydratase (EC 4.2.1.1) VI precursor -
           human
          Length = 308

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 79/272 (29%), Positives = 132/272 (48%), Gaps = 32/272 (11%)
 Frame = +3

Query: 90  KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQN 269
           ++Q V D   ++Y E +    +HW    P+ +    G+ Q+PI+L+   V Y+    ++ 
Sbjct: 16  QAQHVSD---WTYSEGA-LDEAHW----PQHYPACGGQRQSPINLQRTKVRYNP--SLKG 65

Query: 270 YYMRDVAT------LENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP--------SE 407
             M    T      + N+G+ + +  P   R    +GI Y+ +Q+H+H+         SE
Sbjct: 66  LNMTGYETQAGEFPMVNNGHTVQIGLPSTMRMTVADGIVYIAQQMHFHWGGASSEISGSE 125

Query: 408 HVVNGTRYDLEAHLVHVSN------------DGRIAVLAVMYQIGETP-NPILSLIEDDL 548
           H V+G R+ +E H+VH ++            DG +AVLA   ++   P N   S     L
Sbjct: 126 HTVDGIRHVIEIHIVHYNSKYKTYDIAQDAPDG-LAVLAAFVEVKNYPENTYYSNFISHL 184

Query: 549 KKLAETPGVKKGIGYLD-PNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQ 725
             + + PG +  +  LD  ++L    + YY Y GSLTTPPCTE V W V+     +++ Q
Sbjct: 185 ANI-KYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQ 243

Query: 726 VALIRNAIHD-ESKT---NARPLQTINDRFVK 809
           V  + N++ D  +KT   + R  Q +N R V+
Sbjct: 244 VWKLENSLLDHRNKTIHNDYRRTQPLNHRVVE 275



>sp|P00916|CAH1_MACMU Carbonic anhydrase I (EC 4.2.1.1) (Carbonate
           dehydratase I) (CA-I).
          Length = 260

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 70/252 (27%), Positives = 117/252 (46%), Gaps = 24/252 (9%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQ-NYYMRD 284
           +WG+  D+N   GP  W +L P     + G  Q+P+D+++    + ++L PI  +Y    
Sbjct: 4   DWGYD-DKN---GPEQWSKLYP----IANGNNQSPVDIKTSEAKHDTSLKPISVSYNPAT 55

Query: 285 VATLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWH------FPSEHVVNGTRYD 434
              + N G+   +++        + G      Y   Q H+H      + SEH V+G +Y 
Sbjct: 56  AKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSSNEYGSEHTVDGVKYS 115

Query: 435 LEAHLVH------------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
            E H+VH            VS    +AV+ V+ ++GE  NP L  + D L  + +T G +
Sbjct: 116 SELHIVHWNSAKYSSLAEAVSKADGLAVIGVLMKVGEA-NPKLQKVLDALHAI-KTKGKR 173

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE 758
                 DP+ L      ++ Y GSLT PP  E V W + +   SV+ +Q+A  R+ + + 
Sbjct: 174 APFTNFDPSTLLPSSLDFWTYSGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNV 233

Query: 759 SKTNARPLQTIN 794
             +N  P+Q  N
Sbjct: 234 EGSNPVPIQRNN 245



>gb:MACCAANI_2038715 Macaca nemestrina carbonic anhydrase I mRNA,
           complete cds.
          Length = 261

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 73/264 (27%), Positives = 121/264 (45%), Gaps = 31/264 (11%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQ-NYYMRD 284
           +WG+  D+N   GP  W +L P     + G  Q+P+D+++    + ++L PI  +Y    
Sbjct: 5   DWGYD-DKN---GPEQWSKLYP----IANGNNQSPVDIKTSEAKHDTSLKPISVSYNPAT 56

Query: 285 VATLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWH------FPSEHVVNGTRYD 434
              + N G+   +++        + G      Y   Q H+H      + SEH V+G +Y 
Sbjct: 57  AKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSSNEYGSEHTVDGVKYS 116

Query: 435 LEAHLVH------------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
            E H+VH            VS    +AV+ V+ ++GE  NP L  + D L  + +T G +
Sbjct: 117 SELHIVHWNSAKYSSLAEAVSKADGLAVIGVLMKVGEA-NPKLQKVLDALHAI-KTKGKR 174

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD- 755
                 DP+ L      ++ Y GSLT PP  E V W + +   SV+ +Q+A  R+ + + 
Sbjct: 175 APFTNFDPSTLLPSSLDFWTYSGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNV 234

Query: 756 ------ESKTNARPLQTINDRFVK 809
                  S+ N RP Q +  R V+
Sbjct: 235 EGDNPVPSQRNNRPTQPLKGRTVR 258



>gb:AL139415_1920752 Human DNA sequence from clone RP3-477M7 on
           chromosome 1 Contains the ENO1 gene for enolase 1
           (alpha), two novel genes, a novel pseudogene, a
           pseudogene similar to part of a Zinc finger protein, a
           pseudogene similar to part of cytochrome oxidase subunit
           II, the CA6 gene for carbonic anhydrase VI and a CpG
           island, complete sequence.
          Length = 308

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 79/272 (29%), Positives = 132/272 (48%), Gaps = 32/272 (11%)
 Frame = +3

Query: 90  KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQN 269
           ++Q V D   ++Y E +    +HW    P+ +    G+ Q+PI+L+   V Y+    ++ 
Sbjct: 16  QAQHVSD---WTYSEGA-LDEAHW----PQHYPACGGQRQSPINLQRTKVRYNP--SLKG 65

Query: 270 YYMRDVAT------LENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP--------SE 407
             M    T      + N+G+ + +S P   R    +G  Y+ +Q+H+H+         SE
Sbjct: 66  LNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSE 125

Query: 408 HVVNGTRYDLEAHLVHVSN------------DGRIAVLAVMYQIGETP-NPILSLIEDDL 548
           H V+G R+ +E H+VH ++            DG +AVLA   ++   P N   S     L
Sbjct: 126 HTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDG-LAVLAAFVEVKNYPENTYYSNFISHL 184

Query: 549 KKLAETPGVKKGIGYLD-PNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQ 725
             + + PG +  +  LD  ++L    + YY Y GSLTTPPCTE V W V+     +++ Q
Sbjct: 185 ANI-KYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQ 243

Query: 726 VALIRNAIHD-ESKT---NARPLQTINDRFVK 809
           V  + N++ D  +KT   + R  Q +N R V+
Sbjct: 244 VWKLENSLLDHRNKTIHNDYRRTQPLNHRVVE 275



>gb:AB102863_1873518 Homo sapiens CA6 mRNA for carbonic anhydrase VI
           nirs variant 1, complete cds.
          Length = 313

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 79/272 (29%), Positives = 132/272 (48%), Gaps = 32/272 (11%)
 Frame = +3

Query: 90  KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQN 269
           ++Q V D   ++Y E +    +HW    P+ +    G+ Q+PI+L+   V Y+    ++ 
Sbjct: 16  QAQHVSD---WTYSEGA-LDEAHW----PQHYPACGGQRQSPINLQRTKVRYNP--SLKG 65

Query: 270 YYMRDVAT------LENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP--------SE 407
             M    T      + N+G+ + +S P   R    +G  Y+ +Q+H+H+         SE
Sbjct: 66  LNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSE 125

Query: 408 HVVNGTRYDLEAHLVHVSN------------DGRIAVLAVMYQIGETP-NPILSLIEDDL 548
           H V+G R+ +E H+VH ++            DG +AVLA   ++   P N   S     L
Sbjct: 126 HTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDG-LAVLAAFVEVKNYPENTYYSNFISHL 184

Query: 549 KKLAETPGVKKGIGYLD-PNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQ 725
             + + PG +  +  LD  ++L    + YY Y GSLTTPPCTE V W V+     +++ Q
Sbjct: 185 ANI-KYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQ 243

Query: 726 VALIRNAIHD-ESKT---NARPLQTINDRFVK 809
           V  + N++ D  +KT   + R  Q +N R V+
Sbjct: 244 VWKLENSLLDHRNKTIHNDYRRTQPLNHRVVE 275



>sp|P35217|CAH1_MACNE Carbonic anhydrase I (EC 4.2.1.1) (Carbonate
           dehydratase I) (CA-I).
          Length = 260

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 73/264 (27%), Positives = 121/264 (45%), Gaps = 31/264 (11%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQ-NYYMRD 284
           +WG+  D+N   GP  W +L P     + G  Q+P+D+++    + ++L PI  +Y    
Sbjct: 4   DWGYD-DKN---GPEQWSKLYP----IANGNNQSPVDIKTSEAKHDTSLKPISVSYNPAT 55

Query: 285 VATLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWH------FPSEHVVNGTRYD 434
              + N G+   +++        + G      Y   Q H+H      + SEH V+G +Y 
Sbjct: 56  AKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSSNEYGSEHTVDGVKYS 115

Query: 435 LEAHLVH------------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
            E H+VH            VS    +AV+ V+ ++GE  NP L  + D L  + +T G +
Sbjct: 116 SELHIVHWNSAKYSSLAEAVSKADGLAVIGVLMKVGEA-NPKLQKVLDALHAI-KTKGKR 173

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD- 755
                 DP+ L      ++ Y GSLT PP  E V W + +   SV+ +Q+A  R+ + + 
Sbjct: 174 APFTNFDPSTLLPSSLDFWTYSGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNV 233

Query: 756 ------ESKTNARPLQTINDRFVK 809
                  S+ N RP Q +  R V+
Sbjct: 234 EGDNPVPSQRNNRPTQPLKGRTVR 257



>gb:AL133410_1918494 Human DNA sequence from clone RP11-112J3 on
           chromosome 9p13.1-13.3 Contains the 3' end of the CA9
           gene for carbonic anhydrase IX (MN), the TPM2 gene for
           tropomyosin 2 (beta) (DA1, TMSB, AMCD1), the TLN1 gene
           for talin 1 (TLN, KIAA1027), the CREB3 gene for cAMP
           responsive element binding protein 3 (luman) (LZIP,
           LUMAN, MGC15333, MGC19782), the GBA2 gene for
           glucosidase, beta (bile acid) 2 (AD035, KIAA1605,
           MGC16895, DKFZp762K054), a novel gene (KIAA0258), five
           novel genes, the NPR2 gene for natriuretic peptide
           receptor B/guanylate cyclase B (atrionatriuretic peptide
           receptor B) (NPRB, ANPRB, GUC2B, NPRBi), the SPAG8 gene
           for sperm associated antigen 8 (SMP1, BS-84, HSD-1,
           hSMP-1, MGC26201), the HINT2 gene for Histidine triad
           nucleotide binding protein 2, the gene for NAG-5 protein
           (LOC51754), an olfactory receptor pseudogene, the gene
           for a novel seven transmembrane helix receptor, a NADH
           dehydrogenase (ubiquinone) 1 alpha subcomplex, 5,13kDa
           (B13, NUFM, UQOR13, FLJ12147, CI-13KD-B) (NDUFA5)
           pseudogene and six CpG islands, complete
           sequence.>gb:AL357874_1925077 Human DNA sequence from
           clone RP11-331F9 on chromosome 9 Contains a ribosomal
           protein S29 (RPS29) pseudogene, the TESK1 gene for
           testis-specific kinase 1, the CD72 gene for CD72 antigen
           (LYB2), two novel genes, the gene for SHP2 interacting
           transmembrane adaptor (SIT), a novel gene (MGC31967), a
           novel gene (FLJ14642), the 5' end of the CA9 gene for
           carbonic anhydrase IX (MN) and four CpG islands,
           complete sequence.
          Length = 459

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 71/251 (28%), Positives = 114/251 (45%), Gaps = 32/251 (12%)
 Frame = +3

Query: 153 SHW---GELRPEWWQCS---AGKMQTPIDLESKPVVYSN-LGPIQNYYMR----DVATLE 299
           SHW   G+  P W + S   AG+ Q+P+D+  +   +   L P++    +        L 
Sbjct: 139 SHWRYGGD--PPWPRVSPACAGRFQSPVDIRPQLAAFCPALRPLELLGFQLPPLPELRLR 196

Query: 300 NHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP------SEHVVNGTRYDLEAHLVHVS 461
           N+G+ + L+ P G       G  Y   Q+H H+       SEH V G R+  E H+VH+S
Sbjct: 197 NNGHSVQLTLPPGLEMALGPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLS 256

Query: 462 N-----------DGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNL 608
                        G +AVLA   + G   N     +   L+++AE     +  G     L
Sbjct: 257 TAFARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEIAEEGSETQVPGLDISAL 316

Query: 609 LQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI----HDESKTNAR 776
           L +   RY++Y GSLTTPPC +GV+WTV      ++ +Q+  + + +        + N R
Sbjct: 317 LPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVMLSAKQLHTLSDTLWGPGDSRLQLNFR 376

Query: 777 PLQTINDRFVK 809
             Q +N R ++
Sbjct: 377 ATQPLNGRVIE 387



>pir|JN0836|JN0836 carbonate dehydratase (EC 4.2.1.1) I - gorilla
          Length = 261

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 71/252 (28%), Positives = 116/252 (46%), Gaps = 24/252 (9%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQ-NYYMRD 284
           +WG+  D+N   GP  W +L P     + G  Q+P+D+++    + ++L PI  +Y    
Sbjct: 5   DWGYD-DKN---GPEQWSKLYP----IANGNNQSPVDIKTSETKHDTSLKPISVSYNPAT 56

Query: 285 VATLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWHFPS------EHVVNGTRYD 434
              + N G+   +++        + G      Y   Q H+H+ S      EH V+G +Y 
Sbjct: 57  AKEIINVGHSFHVTFEDNDNRSVLKGGPLSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYS 116

Query: 435 LEAHLVH------------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
            E HL H             S    +AV+ V+ ++GE  NP L  I D L+ + +T G +
Sbjct: 117 AELHLTHWNSAKYSSLAEAASKADGLAVIGVLMKVGEA-NPKLQKILDALQAI-KTKGKR 174

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE 758
                 DP+ L      ++ Y GSLT PP  E V W + +   SV+ +Q+A  R+ + + 
Sbjct: 175 APFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNV 234

Query: 759 SKTNARPLQTIN 794
              NA P+Q  N
Sbjct: 235 EGDNAVPMQHNN 246



>sp|Q16790|CAH9_HUMAN Carbonic anhydrase IX precursor (EC 4.2.1.1)
           (Carbonate dehydratase IX) (CA-IX) (CAIX) (Membrane
           antigen MN) (P54/58N) (Renal cell carcinoma-associated
           antigen G250) (RCC-associated antigen G250)
           (pMW1).>pir|I38013|I38013 p54/58N -
           human>gb:BC014950_1974851 Homo sapiens carbonic
           anhydrase IX, mRNA (cDNA clone MGC:22967 IMAGE:4865275),
           complete cds.>gb:HAJ10588_1996070 Homo sapiens mRNA for
           renal cell carcinoma associated antigen
           G250.>gb:HSMATUMN_2018646 H.sapiens MaTu MN mRNA for
           p54/58N protein.
          Length = 459

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 71/251 (28%), Positives = 114/251 (45%), Gaps = 32/251 (12%)
 Frame = +3

Query: 153 SHW---GELRPEWWQCS---AGKMQTPIDLESKPVVYSN-LGPIQNYYMR----DVATLE 299
           SHW   G+  P W + S   AG+ Q+P+D+  +   +   L P++    +        L 
Sbjct: 139 SHWRYGGD--PPWPRVSPACAGRFQSPVDIRPQLAAFCPALRPLELLGFQLPPLPELRLR 196

Query: 300 NHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP------SEHVVNGTRYDLEAHLVHVS 461
           N+G+ + L+ P G       G  Y   Q+H H+       SEH V G R+  E H+VH+S
Sbjct: 197 NNGHSVQLTLPPGLEMALGPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLS 256

Query: 462 N-----------DGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNL 608
                        G +AVLA   + G   N     +   L+++AE     +  G     L
Sbjct: 257 TAFARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEIAEEGSETQVPGLDISAL 316

Query: 609 LQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI----HDESKTNAR 776
           L +   RY++Y GSLTTPPC +GV+WTV      ++ +Q+  + + +        + N R
Sbjct: 317 LPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVMLSAKQLHTLSDTLWGPGDSRLQLNFR 376

Query: 777 PLQTINDRFVK 809
             Q +N R ++
Sbjct: 377 ATQPLNGRVIE 387



>sp|Q7M316|CAH1_GORGO Carbonic anhydrase I (EC 4.2.1.1) (Carbonate
           dehydratase I) (CA-I).
          Length = 260

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 71/252 (28%), Positives = 116/252 (46%), Gaps = 24/252 (9%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQ-NYYMRD 284
           +WG+  D+N   GP  W +L P     + G  Q+P+D+++    + ++L PI  +Y    
Sbjct: 4   DWGYD-DKN---GPEQWSKLYP----IANGNNQSPVDIKTSETKHDTSLKPISVSYNPAT 55

Query: 285 VATLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWHFPS------EHVVNGTRYD 434
              + N G+   +++        + G      Y   Q H+H+ S      EH V+G +Y 
Sbjct: 56  AKEIINVGHSFHVTFEDNDNRSVLKGGPLSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYS 115

Query: 435 LEAHLVH------------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
            E HL H             S    +AV+ V+ ++GE  NP L  I D L+ + +T G +
Sbjct: 116 AELHLTHWNSAKYSSLAEAASKADGLAVIGVLMKVGEA-NPKLQKILDALQAI-KTKGKR 173

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE 758
                 DP+ L      ++ Y GSLT PP  E V W + +   SV+ +Q+A  R+ + + 
Sbjct: 174 APFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNV 233

Query: 759 SKTNARPLQTIN 794
              NA P+Q  N
Sbjct: 234 EGDNAVPMQHNN 245



>gb:AB055617_2462722 Tribolodon hakonensis mRNA for carbonic
           anhydrase 2, complete cds.
          Length = 260

 Score = 87.4 bits (215), Expect = 5e-16
 Identities = 80/270 (29%), Positives = 119/270 (44%), Gaps = 39/270 (14%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY--------------SN 251
           WG++ D N   GP  W E  P     + G  Q+PID+++K   Y              ++
Sbjct: 5   WGYA-DHN---GPQKWCENFP----IANGPRQSPIDIQTKGASYDDTLKPLKLKYDPTTS 56

Query: 252 LGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP------SEHV 413
           L  + N +   V   +++   M+   P+  +Y          +Q H+H+       SEH 
Sbjct: 57  LDILNNGHSFQVTFADDNDSSMLTEGPISGKYR--------LKQFHFHWGASDGKGSEHT 108

Query: 414 VNGTRYDLEAHLVHVSN------------DGRIAVLAVMYQIGETPNPILSLIEDDLKKL 557
           V+G  Y  E HLVH +             DG +AV+ V  QIGE  NP L  I D +  +
Sbjct: 109 VDGKCYPAELHLVHWNTKYASFGEAANKPDG-LAVVGVFLQIGED-NPKLQKILDAMDAI 166

Query: 558 AETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALI 737
            ++ G +      DP  L  +   Y+ Y GSLTTPP  E V W V +   SV+ +Q+   
Sbjct: 167 -KSKGKQTSFTNFDPTCLLPKSLEYWTYPGSLTTPPLYESVTWIVCKQPISVSSEQMKKF 225

Query: 738 RNAIH--DESK-----TNARPLQTINDRFV 806
           R+ +   +E K      N RP Q + DR V
Sbjct: 226 RSLLFTAEEEKACCMVNNYRPPQPLKDRKV 255



>sp|Q9ERQ8|CAH7_MOUSE Carbonic anhydrase VII (EC 4.2.1.1) (Carbonate
           dehydratase VII) (CA- VII)
           (Fragment).>gb:AF291660_2061775 Mus musculus carbonic
           anhydrase VII (Car7) mRNA, partial cds.
          Length = 255

 Score = 87.4 bits (215), Expect = 5e-16
 Identities = 72/255 (28%), Positives = 123/255 (48%), Gaps = 32/255 (12%)
 Frame = +3

Query: 141 DRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQNYYMRDVA-TLENHGYG 314
           D GPS+W +L P     + G  Q+PI++ S   VYS +L P++ +Y   ++ ++ N+G+ 
Sbjct: 3   DDGPSNWHKLYP----IAQGDRQSPINIISSQAVYSPSLQPLELFYEACMSLSITNNGHS 58

Query: 315 MMLSWPLGQRYLGINGIR----YLFRQVHWHFP------SEHVVNGTRYDLEAHLVH--- 455
           + + +        ++G      Y  +Q+H+H+       SEH V+G  +  E HLVH   
Sbjct: 59  VQVDFNDSDDRTVVSGGPLEGPYRLKQLHFHWGKKRDMGSEHTVDGKSFPSELHLVHWNA 118

Query: 456 ----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPN 605
                      + DG +AV+ V  + G+  +P ++ + D L  +      K      +P 
Sbjct: 119 KKYSTFGEAAAAPDG-LAVVGVFLETGDE-HPSMNRLTDALY-MVRFKDTKAQFSCFNPK 175

Query: 606 LLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI---HDESK---- 764
            L    R Y+ Y GSLTTPP +E V W V+R    ++++Q+   R+ +    D+ +    
Sbjct: 176 CLLPTSRHYWTYPGSLTTPPLSESVTWIVLREPIRISERQMEKFRSLLFTSEDDERIHMV 235

Query: 765 TNARPLQTINDRFVK 809
            N RP Q +  R VK
Sbjct: 236 DNFRPPQPLKGRVVK 250



>sp|Q8UWA5|CAH2_TRIHK Carbonic anhydrase II (EC 4.2.1.1) (Carbonate
           dehydratase II) (CA-II).
          Length = 259

 Score = 87.4 bits (215), Expect = 5e-16
 Identities = 80/270 (29%), Positives = 119/270 (44%), Gaps = 39/270 (14%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY--------------SN 251
           WG++ D N   GP  W E  P     + G  Q+PID+++K   Y              ++
Sbjct: 4   WGYA-DHN---GPQKWCENFP----IANGPRQSPIDIQTKGASYDDTLKPLKLKYDPTTS 55

Query: 252 LGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP------SEHV 413
           L  + N +   V   +++   M+   P+  +Y          +Q H+H+       SEH 
Sbjct: 56  LDILNNGHSFQVTFADDNDSSMLTEGPISGKYR--------LKQFHFHWGASDGKGSEHT 107

Query: 414 VNGTRYDLEAHLVHVSN------------DGRIAVLAVMYQIGETPNPILSLIEDDLKKL 557
           V+G  Y  E HLVH +             DG +AV+ V  QIGE  NP L  I D +  +
Sbjct: 108 VDGKCYPAELHLVHWNTKYASFGEAANKPDG-LAVVGVFLQIGED-NPKLQKILDAMDAI 165

Query: 558 AETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALI 737
            ++ G +      DP  L  +   Y+ Y GSLTTPP  E V W V +   SV+ +Q+   
Sbjct: 166 -KSKGKQTSFTNFDPTCLLPKSLEYWTYPGSLTTPPLYESVTWIVCKQPISVSSEQMKKF 224

Query: 738 RNAIH--DESK-----TNARPLQTINDRFV 806
           R+ +   +E K      N RP Q + DR V
Sbjct: 225 RSLLFTAEEEKACCMVNNYRPPQPLKDRKV 254



>sp|Q8HY33|CAH1_MONDO Carbonic anhydrase I (EC 4.2.1.1) (Carbonate
           dehydratase I) (CA-I).>gb:MDO417908_1440936 Monodelphis
           domestica mRNA for carbonic anhydrase 1 (ca1 gene).
          Length = 262

 Score = 87.4 bits (215), Expect = 5e-16
 Identities = 65/233 (27%), Positives = 110/233 (47%), Gaps = 24/233 (10%)
 Frame = +3

Query: 123 SYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQ-NYYMRDVATL 296
           ++    + GP HW +L P     + G  Q+PID+++K V + ++L PI  +Y       +
Sbjct: 5   NWSYEGENGPEHWSKLYP----IANGDNQSPIDIKTKEVKHDASLKPISVSYNPATAKEI 60

Query: 297 ENHGYGMMLSWPLGQRYLGINGIRYL----FRQVHWHFP------SEHVVNGTRYDLEAH 446
            N  +   +++        + G  +      RQ H+H+       SEH V+G +Y  E H
Sbjct: 61  VNVSHNFQVNFEDKDNQSVLKGGPFTGSFRLRQFHFHWGTADDHGSEHTVDGVKYSSELH 120

Query: 447 LVHVSND------------GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIG 590
           +VH +++              +A++AV  + G+  NP L  + D L  + +T G K    
Sbjct: 121 IVHWNSEKYSSFSEAAEKPDGLAIIAVFIKAGQA-NPGLQKVIDALSSI-KTKGKKAPFA 178

Query: 591 YLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI 749
             DP+LL  +   Y+ Y GSLT PP  E V W + R   S + +Q+A  R+ +
Sbjct: 179 NFDPSLLIPQSSDYWSYHGSLTHPPLHESVTWIIYREPISASSEQLAKFRSLL 231



>sp|Q9WVT6|CAHE_MOUSE Carbonic anhydrase XIV precursor (EC 4.2.1.1)
           (Carbonate dehydratase XIV)
           (CA-XIV).>gb:AB005450_2043285 Mus musculus mRNA for CA
           XIV, complete cds.>gb:BC046995_2099442 Mus musculus
           carbonic anhydrase 14, mRNA (cDNA clone MGC:54680
           IMAGE:6491779), complete cds.
          Length = 337

 Score = 87.0 bits (214), Expect = 7e-16
 Identities = 72/268 (26%), Positives = 121/268 (45%), Gaps = 28/268 (10%)
 Frame = +3

Query: 63  LLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVV 242
           LLL VT ++ +     + G  +      G  HW    PE      G  Q+PI++++  V+
Sbjct: 6   LLLKVTWILAA-----DGGHHWTYEGPHGQDHWPTSYPE----CGGDAQSPINIQTDSVI 56

Query: 243 YS-NLGPIQNYYMRDVAT----LENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP-- 401
           +  +L  +Q +    + T    L N+G+ + LS P    +LG    +Y   Q+H H+   
Sbjct: 57  FDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLP-PTLHLGGLPRKYTAAQLHLHWGQR 115

Query: 402 -----SEHVVNGTRYDLEAHLVHVSNDGR------------IAVLAVMYQIGETPNP--- 521
                SEH +N      E H+VH  +               +AVL ++ ++GET NP   
Sbjct: 116 GSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYD 175

Query: 522 -ILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIR 698
            ILS + +   K  +T      +  L P  L+    +++RY GSLTTPPC + V+WTV  
Sbjct: 176 HILSRLHEIRYKDQKTSVPPFSVRELFPQQLE----QFFRYNGSLTTPPCYQSVLWTVFN 231

Query: 699 TIRSVTKQQVALIRNAIHDESKTNARPL 782
               ++  Q+  ++  +    +  + PL
Sbjct: 232 RRAQISMGQLEKLQETLSSTEEDPSEPL 259



>gb:BC072918_2556842 Xenopus laevis MGC80389 protein, mRNA (cDNA
           clone MGC:80389 IMAGE:5129763), complete cds.
          Length = 525

 Score = 86.7 bits (213), Expect = 9e-16
 Identities = 88/296 (29%), Positives = 138/296 (46%), Gaps = 38/296 (12%)
 Frame = +3

Query: 36  MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP 215
           +L L    F++LS  H+  S  V  EW +   E  +   ++WG+  P      A K Q+P
Sbjct: 4   LLHLGLYLFIVLSC-HLTNSHVV--EWTYQEGELDE---ANWGKKYPT----CAAKHQSP 53

Query: 216 IDLESKPVVYSNL----------GPIQNYYMRDVATLENHGYGMMLSWPLGQRYL-GING 362
           ID++ K V ++            GP+  ++      + N+G+ + +  P       G+N 
Sbjct: 54  IDIQRKKVRHNPELTQLELIGYDGPLTGHFK-----VTNNGHSVQIDLPSTMTIKKGLNS 108

Query: 363 IRYLFRQVHWHFP--------SEHVVNGTRYDLEAHLVHVSNDGR------------IAV 482
           + Y   Q+H H+         SEH ++G RY  E H+VH ++               +AV
Sbjct: 109 L-YTAVQMHLHWGGLESETSGSEHTIDGMRYLAELHIVHYNSGAYKSFDEAKDKPNGLAV 167

Query: 483 LAVMYQIGETPNPILSLIEDDLKKLAET--PGVKKGIGYLDPN-LLQARGRRYYRYMGSL 653
           LA +Y  G   N   S   D + KLA+    G +  +  LD   +L      +YRY GSL
Sbjct: 168 LAFLYTTGNYENTYYS---DFISKLAKIRYAGQETEMHTLDVMAMLPENLVNFYRYDGSL 224

Query: 654 TTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD-ESKT---NARPLQTINDRFVK 809
           TTPPCTE V+WTV  +   ++K Q+ L+ N + D  +KT   + R  Q  +DR V+
Sbjct: 225 TTPPCTENVLWTVFDSPVFLSKTQIDLLENTLLDWHNKTLRNDYRHAQPWHDRTVE 280



>gb:HUMCA6_2029760 Human carbonic anhydrase isozyme VI (CA6) mRNA,
           complete cds.
          Length = 308

 Score = 86.7 bits (213), Expect = 9e-16
 Identities = 72/250 (28%), Positives = 121/250 (48%), Gaps = 28/250 (11%)
 Frame = +3

Query: 90  KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQN 269
           ++Q V D   ++Y E +    +HW    P+ +    G+ Q+PI+L+   V Y+    ++ 
Sbjct: 16  QAQHVSD---WTYSEGA-LDEAHW----PQHYPACGGQRQSPINLQRTKVRYNP--SLKG 65

Query: 270 YYMRDVAT------LENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP--------SE 407
             M    T      + N+G+ + +  P   R    +GI Y+ +Q+H+H+         SE
Sbjct: 66  LNMTGYETQAGEFPMVNNGHTVQIGLPSTMRMTVADGIVYIAQQMHFHWGGASSEISGSE 125

Query: 408 HVVNGTRYDLEAHLVHVSN------------DGRIAVLAVMYQIGETP-NPILSLIEDDL 548
           H V+G R+ +E H+VH ++            DG +AVLA   ++   P N   S     L
Sbjct: 126 HTVDGIRHVIEIHIVHYNSKYKTYDIAQDAPDG-LAVLAAFVEVKNYPENTYYSNFISHL 184

Query: 549 KKLAETPGVKKGIGYLD-PNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQ 725
             + + PG +  +  LD  ++L    + YY Y GSLTTPPCTE V W V+     +++ Q
Sbjct: 185 ANI-KYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQ 243

Query: 726 VALIRNAIHD 755
           V  + N++ D
Sbjct: 244 VWKLENSLLD 253



>pir|JN0835|JN0835 carbonate dehydratase (EC 4.2.1.1) I - chimpanzee
          Length = 261

 Score = 86.7 bits (213), Expect = 9e-16
 Identities = 69/252 (27%), Positives = 116/252 (46%), Gaps = 24/252 (9%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQ-NYYMRD 284
           +WG+  D+N   GP  W +L P     + G  Q+P+D+++    + ++L PI  +Y    
Sbjct: 5   DWGYD-DKN---GPEQWSKLYP----IANGNNQSPVDIKTSETKHDTSLKPISVSYNPAT 56

Query: 285 VATLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWHFPS------EHVVNGTRYD 434
              + N G+   +++        + G      Y   Q H+H+ S      EH V+G +Y 
Sbjct: 57  AKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYS 116

Query: 435 LEAHLVH------------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
            E H+ H             S    +AV+ V+ ++GE  NP L  + D L+ + +T G +
Sbjct: 117 AELHIAHWNSAKYSNLAEAASKADGLAVIGVLMKVGEA-NPKLQKVLDALQAI-KTKGKR 174

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE 758
                 DP+ L      ++ Y GSLT PP  E V W + +   SV+ +Q+A  R+ + + 
Sbjct: 175 APFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNV 234

Query: 759 SKTNARPLQTIN 794
              NA P+Q  N
Sbjct: 235 EGDNAVPMQHNN 246



>sp|P07450|CAH3_HORSE Carbonic anhydrase III (EC 4.2.1.1) (Carbonate
           dehydratase III) (CA- III).>pir|A22612|A22612 carbonate
           dehydratase (EC 4.2.1.1) III - horse
          Length = 259

 Score = 86.7 bits (213), Expect = 9e-16
 Identities = 78/263 (29%), Positives = 113/263 (42%), Gaps = 30/263 (11%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY--SNLGPIQNYYMRD 284
           EWG++ D N   GP HW E  P     + G  Q+PI+L +K + +  S      +Y    
Sbjct: 3   EWGYA-DHN---GPDHWHEFYP----IAKGDNQSPIELHTKDINHDPSLKAWTASYDPGS 54

Query: 285 VATLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWHFPS------EHVVNGTRYD 434
             T+ N+G    + +        + G      Y  RQ H H+ S      EH V+G +Y 
Sbjct: 55  AKTILNNGRTCRVVFDDTYDRSMLRGGPLTAPYRLRQFHLHWGSSDDHGSEHTVDGVKYA 114

Query: 435 LEAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK 581
            E HLVH           +     IAV+ V  +IG        L  D L K+ +T G + 
Sbjct: 115 AELHLVHWNPKYNTYGGALKQPDGIAVVGVFLKIGREKGEF-QLFLDALDKI-KTKGKEA 172

Query: 582 GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES 761
                DP+ L    R Y+ Y GS TTPPC E +VW +++   +V+  QVA +R+      
Sbjct: 173 PFTNFDPSCLFPTCRDYWTYRGSFTTPPCEECIVWLLLKEPITVSSDQVAKLRSLFSSAE 232

Query: 762 K-------TNARPLQTINDRFVK 809
                    N RP Q +  R V+
Sbjct: 233 NEPPVPLVRNWRPPQPLKGRVVR 255



>sp|Q7M317|CAH1_PANTR Carbonic anhydrase I (EC 4.2.1.1) (Carbonate
           dehydratase I) (CA-I).
          Length = 260

 Score = 86.7 bits (213), Expect = 9e-16
 Identities = 69/252 (27%), Positives = 116/252 (46%), Gaps = 24/252 (9%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQ-NYYMRD 284
           +WG+  D+N   GP  W +L P     + G  Q+P+D+++    + ++L PI  +Y    
Sbjct: 4   DWGYD-DKN---GPEQWSKLYP----IANGNNQSPVDIKTSETKHDTSLKPISVSYNPAT 55

Query: 285 VATLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWHFPS------EHVVNGTRYD 434
              + N G+   +++        + G      Y   Q H+H+ S      EH V+G +Y 
Sbjct: 56  AKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYS 115

Query: 435 LEAHLVH------------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
            E H+ H             S    +AV+ V+ ++GE  NP L  + D L+ + +T G +
Sbjct: 116 AELHIAHWNSAKYSNLAEAASKADGLAVIGVLMKVGEA-NPKLQKVLDALQAI-KTKGKR 173

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE 758
                 DP+ L      ++ Y GSLT PP  E V W + +   SV+ +Q+A  R+ + + 
Sbjct: 174 APFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNV 233

Query: 759 SKTNARPLQTIN 794
              NA P+Q  N
Sbjct: 234 EGDNAVPMQHNN 245



>pir|JQ0786|CRHU1 carbonate dehydratase (EC 4.2.1.1) I [validated] -
           human>gb:BC027890_1978990 Homo sapiens carbonic
           anhydrase I, mRNA (cDNA clone MGC:34628 IMAGE:5222602),
           complete cds.>gb:HSCAIR_2011228 Human cDNA for carbonic
           anhydrase I.>gb:HUMCAIX_2029791 Human carbonic anhydrase
           I (CAI) mRNA, complete cds.
          Length = 261

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 69/252 (27%), Positives = 116/252 (46%), Gaps = 24/252 (9%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQ-NYYMRD 284
           +WG+  D+N   GP  W +L P     + G  Q+P+D+++    + ++L PI  +Y    
Sbjct: 5   DWGYD-DKN---GPEQWSKLYP----IANGNNQSPVDIKTSETKHDTSLKPISVSYNPAT 56

Query: 285 VATLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWHFPS------EHVVNGTRYD 434
              + N G+   +++        + G      Y   Q H+H+ S      EH V+G +Y 
Sbjct: 57  AKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYS 116

Query: 435 LEAHLVH------------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
            E H+ H             S    +AV+ V+ ++GE  NP L  + D L+ + +T G +
Sbjct: 117 AELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEA-NPKLQKVLDALQAI-KTKGKR 174

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE 758
                 DP+ L      ++ Y GSLT PP  E V W + +   SV+ +Q+A  R+ + + 
Sbjct: 175 APFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNV 234

Query: 759 SKTNARPLQTIN 794
              NA P+Q  N
Sbjct: 235 EGDNAVPMQHNN 246



>sp|Q95323|CAH4_BOVIN Carbonic anhydrase IV precursor (EC 4.2.1.1)
           (Carbonate dehydratase IV) (CA-IV).>gb:BTU58870_1437686
           Bos taurus carbonic anhydrase IV mRNA, complete cds.
          Length = 312

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 72/251 (28%), Positives = 116/251 (46%), Gaps = 32/251 (12%)
 Frame = +3

Query: 150 PSHWGELRPEWWQCSA-GKMQTPIDL-ESKPVVYSNLG--PIQNYYMRDVATLENHGYGM 317
           PS++  L P+ W+ S     Q+P+++  +K  +  NLG      Y M+    ++N+G+ +
Sbjct: 31  PSNYTCLEPDEWEGSCQNNRQSPVNIVTAKTQLDPNLGRFSFSGYNMKHQWVVQNNGHTV 90

Query: 318 MLSWPLGQRYLGIN-GIRYLFRQVHWHFP------SEHVVNGTRYDLEAHLVHVSNDG-- 470
           M+         G     RY   Q+H H+       SEH  +G R+ +E H+VH    G  
Sbjct: 91  MVLLENKPSIAGGGLSTRYQATQLHLHWSRAMDRGSEHSFDGERFAMEMHIVHEKEKGLS 150

Query: 471 -----------RIAVLAVMYQIGETPNPILSLIE--DDLKKLAETPGVKKGIGYLDPNLL 611
                       IAVLA M + G        L+E   D+ +      +K+G+   D    
Sbjct: 151 GNASQNQFAEDEIAVLAFMVEDGSKNVNFQPLVEALSDIPRPNMNTTMKEGVSLFDLLPE 210

Query: 612 QARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQV-ALIRNAIHDESK-----TNA 773
           +   R Y+RY+GSLTTP C E VVWTV +    + + Q+ A  +   +D+ +      N 
Sbjct: 211 EESLRHYFRYLGSLTTPTCDEKVVWTVFQKPIQLHRDQILAFSQKLFYDDQQKVNMTDNV 270

Query: 774 RPLQTINDRFV 806
           RP+Q++  R V
Sbjct: 271 RPVQSLGQRQV 281



>sp|P00915|CAH1_HUMAN Carbonic anhydrase I (EC 4.2.1.1) (Carbonate
           dehydratase I) (CA-I) (Carbonic anhydrase B).
          Length = 260

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 69/252 (27%), Positives = 116/252 (46%), Gaps = 24/252 (9%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQ-NYYMRD 284
           +WG+  D+N   GP  W +L P     + G  Q+P+D+++    + ++L PI  +Y    
Sbjct: 4   DWGYD-DKN---GPEQWSKLYP----IANGNNQSPVDIKTSETKHDTSLKPISVSYNPAT 55

Query: 285 VATLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWHFPS------EHVVNGTRYD 434
              + N G+   +++        + G      Y   Q H+H+ S      EH V+G +Y 
Sbjct: 56  AKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYS 115

Query: 435 LEAHLVH------------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
            E H+ H             S    +AV+ V+ ++GE  NP L  + D L+ + +T G +
Sbjct: 116 AELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEA-NPKLQKVLDALQAI-KTKGKR 173

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE 758
                 DP+ L      ++ Y GSLT PP  E V W + +   SV+ +Q+A  R+ + + 
Sbjct: 174 APFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNV 233

Query: 759 SKTNARPLQTIN 794
              NA P+Q  N
Sbjct: 234 EGDNAVPMQHNN 245



>sp|P00917|CAH1_HORSE Carbonic anhydrase I (EC 4.2.1.1) (Carbonate
           dehydratase I) (CA-I).>pir|A01140|CRHO1D carbonate
           dehydratase (EC 4.2.1.1) I - horse
          Length = 260

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 74/255 (29%), Positives = 117/255 (45%), Gaps = 27/255 (10%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQNYYMRDV 287
           +WG+    +S  GP  W +L P     + G  Q+PID+++    + ++L P    Y  D 
Sbjct: 4   DWGY----DSPBGPZEWVKLYP----IABGBBQSPIDIKTSETKHDTSLKPFSVSY--DP 53

Query: 288 ATLEN-----HGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP--------SEHVVNGTR 428
           AT +      H + +       +  L    +   +R V +HF         SEH V+G +
Sbjct: 54  ATAKEIVNVGHSFQVKFEDSDNRSVLKDGPLPGSYRLVQFHFHWGSTDDYGSEHTVDGVK 113

Query: 429 YDLEAHLVHVSN-------------DGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETP 569
           Y  E HLVH ++             DG +A+L V+ ++GE  NP L  + D L ++ +T 
Sbjct: 114 YSAELHLVHWNSSKYSSFDEASSQADG-LAILGVLMKVGEA-NPKLQKVLDALNEV-KTK 170

Query: 570 GVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI 749
           G K      DP+ L      Y+ Y GSLT PP  E V W V +   S++ QQ++  R+ +
Sbjct: 171 GKKAPFKNFDPSSLLPSSPDYWTYSGSLTHPPLYESVTWIVCKENISISSQQLSQFRSLL 230

Query: 750 HDESKTNARPLQTIN 794
            +     A P+Q  N
Sbjct: 231 SNVEGGKAVPIQHNN 245



>pir|A01145|CRSH2 carbonate dehydratase (EC 4.2.1.1) II - sheep
           (tentative sequence)
          Length = 259

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 76/264 (28%), Positives = 118/264 (44%), Gaps = 31/264 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYYMRDVA 290
           WG+        GP HW +  P     + G+ Q+P+D+++K VV    L P+   Y +  +
Sbjct: 4   WGYG----EHNGPEHWHKDFP----IADGERQSPVDIDTKAVVPDPALKPLALLYEQAAS 55

Query: 291 T-LENHGYGMMLSWPLGQ--RYLGINGIRYLFRQVHWHFP--------SEHVVNGTRYDL 437
             + N+G+   + +   Q    L    +   +R V +HF         SEH V+  +Y  
Sbjct: 56  RRMVNNGHSFNVEFDDSQDKAVLKDGPLTGTYRLVQFHFHWGSSDDQGSEHTVDRKKYAA 115

Query: 438 EAHLVHVSN------------DGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK 581
           E HLVH +             DG +AV+ V  ++G+  NP L  + D L  + +T G   
Sbjct: 116 ELHLVHWNTKYGDFGTAAQQPDG-LAVVGVFLKVGDA-NPALQKVLDVLDSI-KTKGKSA 172

Query: 582 GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES 761
                DP+ L  R   Y+ Y GSLT PP  E V W V++   SV+ QQ+   R+   +  
Sbjct: 173 DFPNFDPSSLLKRALNYWTYPGSLTNPPLLESVTWVVLKEPTSVSSQQMLKFRSLNFNAE 232

Query: 762 -------KTNARPLQTINDRFVKV 812
                    N RP Q + +R V+V
Sbjct: 233 GEPELLMLANWRPAQPLKNRQVRV 256



>sp|Q9MZ30|CAHC_RABIT Carbonic anhydrase XII precursor (EC 4.2.1.1)
           (Carbonate dehydratase XII)
           (CA-XII).>gb:AF263367_1417085 Oryctolagus cuniculus
           carbonic anhydrase XII mRNA, complete cds.
          Length = 355

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 65/224 (29%), Positives = 106/224 (47%), Gaps = 24/224 (10%)
 Frame = +3

Query: 198 GKMQTPIDLESKPVVY-SNLGPIQ----NYYMRDVATLENHGYGMMLSWPLGQRYLGING 362
           G++Q+PIDL    + Y ++L P++    N        L N G+ + L+ P      G+  
Sbjct: 52  GRLQSPIDLHGDTLQYDASLTPLEFQGYNVSADKQFNLTNDGHSVRLNLPPDMYLQGLPS 111

Query: 363 IRYLFRQVHWH-------FPSEHVVNGTRYDLEAHLVHVSNDGR------------IAVL 485
            RY   Q+H H       + SEH V G ++  E H+VH ++D              +AVL
Sbjct: 112 -RYTATQLHLHWGNRNDPYGSEHTVGGKQFAAELHIVHYNSDSYPDISTASNKSEGLAVL 170

Query: 486 AVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPP 665
           AV+ + G   NP    I   L+ +       +   +    LL  +   YYRY GSLTTPP
Sbjct: 171 AVLIEKGYF-NPYYDRIFSFLRYVKYKGQNVRIPTFNIEELLPEKPAEYYRYRGSLTTPP 229

Query: 666 CTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTIND 797
           C   V+WTV R   +++++Q+  ++ A++     +  P + IN+
Sbjct: 230 CYPSVLWTVFRNPVTISQEQLLALQTALYFTRADDPAPREMINN 273



>sp|P00922|CAH2_SHEEP Carbonic anhydrase II (EC 4.2.1.1) (Carbonate
           dehydratase II) (CA-II).
          Length = 259

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 76/264 (28%), Positives = 118/264 (44%), Gaps = 31/264 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYYMRDVA 290
           WG+        GP HW +  P     + G+ Q+P+D+++K VV    L P+   Y +  +
Sbjct: 4   WGYG----EHNGPEHWHKDFP----IADGERQSPVDIDTKAVVPDPALKPLALLYEQAAS 55

Query: 291 T-LENHGYGMMLSWPLGQ--RYLGINGIRYLFRQVHWHFP--------SEHVVNGTRYDL 437
             + N+G+   + +   Q    L    +   +R V +HF         SEH V+  +Y  
Sbjct: 56  RRMVNNGHSFNVEFDDSQDKAVLKDGPLTGTYRLVQFHFHWGSSDDQGSEHTVDRKKYAA 115

Query: 438 EAHLVHVSN------------DGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK 581
           E HLVH +             DG +AV+ V  ++G+  NP L  + D L  + +T G   
Sbjct: 116 ELHLVHWNTKYGDFGTAAQQPDG-LAVVGVFLKVGDA-NPALQKVLDVLDSI-KTKGKSA 172

Query: 582 GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES 761
                DP+ L  R   Y+ Y GSLT PP  E V W V++   SV+ QQ+   R+   +  
Sbjct: 173 DFPNFDPSSLLKRALNYWTYPGSLTNPPLLESVTWVVLKEPTSVSSQQMLKFRSLNFNAE 232

Query: 762 -------KTNARPLQTINDRFVKV 812
                    N RP Q + +R V+V
Sbjct: 233 GEPELLMLANWRPAQPLKNRQVRV 256



>gb:BC041213_2547851 Xenopus laevis similar to carbonic anhydrase
           II, mRNA (cDNA clone MGC:52685 IMAGE:4682561), complete
           cds.
          Length = 260

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 76/262 (29%), Positives = 121/262 (46%), Gaps = 30/262 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQNYYMRDVA 290
           WG+      D GPS W    P     + G+ Q+PI++      Y  +L PI   Y    A
Sbjct: 5   WGYG----PDNGPSTWHHAFP----LANGEYQSPINIVPAEAKYDQHLKPISIKYDPSTA 56

Query: 291 -TLENHGYGMMLSWPLGQRYLGINGIR----YLFRQVHWHFPS------EHVVNGTRYDL 437
             + N+G+   + +   +    ++G      Y  +Q H+H+ S      EH VNG + + 
Sbjct: 57  KVILNNGHAFNVEFDDSENRSVLSGGALSEPYRLKQFHFHWGSCEGHGSEHTVNGVKCEA 116

Query: 438 EAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG 584
           E HLVH           V +   +AV+ V  ++GE  +P L  + D LK L    G +  
Sbjct: 117 ELHLVHWNTKYGSMAEAVKHCDGLAVVGVFLKVGEA-HPGLQKVLDALK-LIPNKGNEAH 174

Query: 585 IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD-ES 761
               DP++L      ++ Y GSLTTPP  + V+W V++   +V+KQQ++ +R+   + E 
Sbjct: 175 FSDFDPSVLLPNSLDFWTYKGSLTTPPLLQCVLWHVLKEPIAVSKQQLSQLRSLFFNAEG 234

Query: 762 KT------NARPLQTINDRFVK 809
            T      N RP Q +  R V+
Sbjct: 235 DTPCSMVDNFRPAQPLKGRDVR 256



>sp|Q9ULX7|CAHE_HUMAN Carbonic anhydrase XIV precursor (EC 4.2.1.1)
           (Carbonate dehydratase XIV) (CA-XIV)
           (UNQ690/PRO1335).>gb:AB025904_1865673 Homo sapiens mRNA
           for carbonic anhydrase 14, complete
           cds.>gb:AL138795_1919941 Human DNA sequence from clone
           RP4-790G17 on chromosome 1q21.1-21.3 Contains the ANP32E
           gene for acidic (leucine-rich) nuclear phosphoprotein 32
           family, member E, the CA14 gene for carbonic anhydrase
           XIV, the gene for a likely ortholog of C. elegans
           anterior pharynx defective 1A (APH-1A), the gene for a
           novel protein (FLJ23221), a novel gene and the MRPS21
           gene for mitochondrial ribosomal protein S21, complete
           sequence.>gb:AY358689_1947568 Homo sapiens clone
           DNA62812 CA14 (UNQ690) mRNA, complete
           cds.>gb:BC034412_1981268 Homo sapiens carbonic anhydrase
           XIV, mRNA (cDNA clone MGC:34392 IMAGE:5175251), complete
           cds.>gb:BT020054_1991371 Homo sapiens carbonic anhydrase
           XIV mRNA, complete cds.
          Length = 337

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 74/279 (26%), Positives = 119/279 (42%), Gaps = 31/279 (11%)
 Frame = +3

Query: 63  LLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVV 242
           LLL V  ++ +     + G  +      G  HW    PE         Q+PID+++  V 
Sbjct: 6   LLLEVIWILAA-----DGGQHWTYEGPHGQDHWPASYPE----CGNNAQSPIDIQTDSVT 56

Query: 243 YS-NLGPIQNYYMRDVAT----LENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP-- 401
           +  +L  +Q +      T    L N+G+ + LS P    YLG    +Y+  Q+H H+   
Sbjct: 57  FDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLP-STLYLGGLPRKYVAAQLHLHWGQK 115

Query: 402 -----SEHVVNGTRYDLEAHLVHVSNDGR------------IAVLAVMYQIGETPNPILS 530
                SEH +N      E H+VH  +D              +AVL ++ ++GET N    
Sbjct: 116 GSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYE 175

Query: 531 LIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRS 710
            I   L ++           +    LL  +  +Y+RY GSLTTPPC + V+WTV      
Sbjct: 176 HILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQ 235

Query: 711 VTKQQVALIRNAIHDESK-------TNARPLQTINDRFV 806
           ++ +Q+  ++  +    +        N R LQ +N R V
Sbjct: 236 ISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMV 274



>gb:BC042287_2548107 Xenopus laevis carbonic anhydrase II, mRNA
           (cDNA clone MGC:53534 IMAGE:5572784), complete cds.
          Length = 260

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 71/262 (27%), Positives = 120/262 (45%), Gaps = 30/262 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQ-NYYMRDV 287
           WG+      D GPS W    P     + G+ Q+PI++ +    + + L PI   Y     
Sbjct: 5   WGYG----PDNGPSTWHHAFP----LAKGEYQSPINIVTAEAKHDHHLKPISIKYDPSTT 56

Query: 288 ATLENHGYGMMLSWPLGQRYLGINGIR----YLFRQVHWHFPS------EHVVNGTRYDL 437
             + N+G+   + +   +    + G      Y  +Q H+H+ S      EH VNG +Y+ 
Sbjct: 57  KVILNNGHAFNVEFDDSENKSVLTGGALTEPYRLKQFHFHWGSCDGHGSEHTVNGVKYEA 116

Query: 438 EAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG 584
           E HLVH           V +   +AV+ V  ++GE  +P L  + D L ++    G +  
Sbjct: 117 ELHLVHWNTKYGSMAEAVKHCDGLAVVGVFLKVGEA-HPGLQKVLDTLNQIPNK-GNEAA 174

Query: 585 IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD-ES 761
               DP++L  +   ++ Y GSLTTPP  + V+W V++   +V+ QQ+  +R+   + E 
Sbjct: 175 FNDFDPSVLLPKSLDFWTYKGSLTTPPLLQCVMWHVLKEPITVSNQQLTQLRSLFFNAEG 234

Query: 762 KT------NARPLQTINDRFVK 809
            T      N RP Q +  R ++
Sbjct: 235 DTPCSMVDNFRPTQPLKGRHIR 256



>gb:AE014298_1124987 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003448_1210169 Drosophila melanogaster
           chromosome X, section 32 of 74 of the complete
           sequence.>gb:AY051620_1290214 Drosophila melanogaster
           GH26663 full length cDNA.
          Length = 327

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 79/301 (26%), Positives = 135/301 (44%), Gaps = 39/301 (12%)
 Frame = +3

Query: 30  MDMLK-LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKM 206
           M++L+ L     LLL+   V+ +   +D W  +YD  S  GP+ WG + PEW  C+ G+ 
Sbjct: 1   MELLQALCCTLLLLLARMQVLLAVSWEDWW--TYDGIS--GPAFWGLINPEWSLCNKGRR 56

Query: 207 QTPIDLESKPVVYS-NLGPIQNYYMRDVATLENHGYGMML--------SWPLGQRYLGIN 359
           Q+P++LE + +++  NL P+     R    + N G+ ++         ++   Q  + I+
Sbjct: 57  QSPVNLEPQRLLFDPNLRPMHIDKHRISGLITNTGHSVIFTAGNDTVANYDGMQTPVNIS 116

Query: 360 G----IRYLFRQVHWH------FPSEHVVNGTRYDLEAHLVHVSND------------GR 473
           G     RY F ++H H      F SEH V G  +  E  +   ++               
Sbjct: 117 GGPLSYRYRFHEIHMHYGLNDQFGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALNRAQG 176

Query: 474 IAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSL 653
           I  ++++ Q+G+  N  L ++ D L+++    G +  +  L    L      Y  Y GS 
Sbjct: 177 IVGVSILLQLGDLSNAELRMLTDQLERI-RYGGDEAFVKRLSIRGLLPDTDHYMTYDGST 235

Query: 654 TTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH---DESK----TNARPLQTINDRFVKV 812
           T P C E V W V+     +TKQQ+  +R  +    D  K     N RP Q +  R ++ 
Sbjct: 236 TAPACHETVTWVVLNKPIYITKQQLHALRRLMQGSPDHPKAPLGNNYRPPQPLLHRPIRT 295

Query: 813 D 815
           +
Sbjct: 296 N 296



>gb:BC089661_2566210 Xenopus tropicalis cDNA clone MGC:107879
           IMAGE:7023062, complete cds.
          Length = 260

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 76/262 (29%), Positives = 121/262 (46%), Gaps = 30/262 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYYMRDVA 290
           WG+      D GP+ W    P     + G  Q+PI++ S    Y + L PI   Y    A
Sbjct: 5   WGYG----PDNGPATWHHAFP----IAHGDHQSPINIVSAEAKYDHHLKPISIKYDPSTA 56

Query: 291 -TLENHGYGMMLSWPLGQRYLGINGIR----YLFRQVHWHFPS------EHVVNGTRYDL 437
             + N+G+   + +   +    ++G      Y  +Q H+H+ S      EH V+G +Y+ 
Sbjct: 57  KVILNNGHAFNVEFDDSEDKSVLSGGAVSHPYRLKQFHFHWGSCDGHGSEHTVDGVKYEA 116

Query: 438 EAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG 584
           E HLVH           V +   +AV+ V  ++GE  +P L  + D LK L    G +  
Sbjct: 117 ELHLVHWNTKYASMAEAVKHCDGLAVVGVFLKVGEA-HPGLQKVLDALK-LIPNKGNEAP 174

Query: 585 IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD-ES 761
               DP++L      ++ Y GSLTTPP  + V+W V+R   +V+ QQ++ +R+   + E 
Sbjct: 175 FTDYDPSVLLPNSLDFWNYKGSLTTPPLLQCVLWHVLREPIAVSNQQLSQLRSLFFNAEG 234

Query: 762 KT------NARPLQTINDRFVK 809
            T      N RP Q +  R V+
Sbjct: 235 DTPCCMVDNFRPPQPLKSRHVR 256



>sp|P23280|CAH6_HUMAN Carbonic anhydrase VI precursor (EC 4.2.1.1)
           (Carbonate dehydratase VI) (CA-VI) (Secreted carbonic
           anhydrase) (Salivary carbonic
           anhydrase).>gb:AF128411S8_1885288 Homo sapiens carbonic
           anhydrase VI gene, exon 8 and complete cds.
          Length = 308

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 71/250 (28%), Positives = 120/250 (48%), Gaps = 28/250 (11%)
 Frame = +3

Query: 90  KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQN 269
           ++Q V D   ++Y E +    +HW    P+ +    G+ Q+PI+L+   V Y+    ++ 
Sbjct: 16  QAQHVSD---WTYSEGA-LDEAHW----PQHYPACGGQRQSPINLQRTKVRYNP--SLKG 65

Query: 270 YYMRDVAT------LENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP--------SE 407
             M    T      + N+G+ + +  P   R    +G  Y+ +Q+H+H+         SE
Sbjct: 66  LNMTGYETQAGEFPMVNNGHTVQIGLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSE 125

Query: 408 HVVNGTRYDLEAHLVHVSN------------DGRIAVLAVMYQIGETP-NPILSLIEDDL 548
           H V+G R+ +E H+VH ++            DG +AVLA   ++   P N   S     L
Sbjct: 126 HTVDGIRHVIEIHIVHYNSKYKTYDIAQDAPDG-LAVLAAFVEVKNYPENTYYSNFISHL 184

Query: 549 KKLAETPGVKKGIGYLD-PNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQ 725
             + + PG +  +  LD  ++L    + YY Y GSLTTPPCTE V W V+     +++ Q
Sbjct: 185 ANI-KYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQ 243

Query: 726 VALIRNAIHD 755
           V  + N++ D
Sbjct: 244 VWKLENSLLD 253



>gb:AB080972_1409229 Canis familiaris CA6 mRNA for carbonic
           anhydrase VI, complete cds.
          Length = 320

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 74/248 (29%), Positives = 119/248 (47%), Gaps = 30/248 (12%)
 Frame = +3

Query: 156 HWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQ-NYYMRDVATLE--NHGYGMML 323
           HW    P  +    G  Q+PIDL+ + V Y+ +L  ++   Y   V      N+G+ + +
Sbjct: 34  HW----PREYPTCGGTRQSPIDLQRRKVQYNPSLKALKLTGYRIQVGEFPMINNGHTVQI 89

Query: 324 SWPLGQRYLGINGIRYLFRQVHWHFP--------SEHVVNGTRYDLEAHLVHVSN----- 464
           S P   R +  +G  Y+ +Q+H+H+         SEH ++G R+  E H+VH ++     
Sbjct: 90  SLPPTMRMMASDGTEYIAQQMHFHWGGASSEISGSEHTIDGIRFVAEIHIVHYNSKYKSY 149

Query: 465 -------DGRIAVLAVMYQIGET-PNPILSLIEDDLKKLAETPGVKKGIGYLD-PNLLQA 617
                  DG +AVLA + ++ +   N   S     L  +   PG    +  LD  ++L  
Sbjct: 150 DIAQHEPDG-LAVLAALVKVEDYGENTYYSNFISHLNNI-RYPGQSTVLSGLDIEDMLPE 207

Query: 618 RGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD-ESKT---NARPLQ 785
               YY Y GSLTTPPCTE V W V+     ++  Q   + N+I D ++KT   + R +Q
Sbjct: 208 NTHHYYTYRGSLTTPPCTENVHWFVLVHHVRLSSIQTWKLENSILDHQNKTLHSDYRRIQ 267

Query: 786 TINDRFVK 809
            +N R V+
Sbjct: 268 PLNGRVVE 275



>gb:CQ782700_1452104 Sequence 2840 from Patent
           EP1396543.>gb:AK074765_1912677 Homo sapiens cDNA
           FLJ90284 fis, clone NT2RP1000613, weakly similar to
           CARBONIC ANHYDRASE VI (EC 4.2.1.1).
          Length = 337

 Score = 84.0 bits (206), Expect = 6e-15
 Identities = 73/279 (26%), Positives = 118/279 (42%), Gaps = 31/279 (11%)
 Frame = +3

Query: 63  LLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVV 242
           LLL V  ++ +     + G  +      G  HW    PE         Q+PID+++  V 
Sbjct: 6   LLLEVIWILAA-----DGGQHWTYEGPHGQDHWPASYPE----CGNNAQSPIDIQTDSVT 56

Query: 243 YS-NLGPIQNYYMRDVAT----LENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP-- 401
           +  +L  +Q +      T    L N+G+ + LS P    YLG    +Y+  Q+H H+   
Sbjct: 57  FDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLP-STLYLGGLPRKYVAAQLHLHWGQK 115

Query: 402 -----SEHVVNGTRYDLEAHLVHVSNDGR------------IAVLAVMYQIGETPNPILS 530
                SEH +N      E H+VH  +D              +AVL ++ ++GET N    
Sbjct: 116 GSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYE 175

Query: 531 LIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRS 710
            I   L ++           +    LL  +  +Y+RY GSLTTPPC + V+WT       
Sbjct: 176 HILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTAFYRRSQ 235

Query: 711 VTKQQVALIRNAIHDESK-------TNARPLQTINDRFV 806
           ++ +Q+  ++  +    +        N R LQ +N R V
Sbjct: 236 ISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMV 274



>pir|T08466|T08466 carbonate dehydratase (EC 4.2.1.1) - green alga
           (Dunaliella salina)>gb:DSU53811_1676173 Dunaliella
           salina carbonic anhydrase (dca) mRNA, complete cds.
          Length = 589

 Score = 84.0 bits (206), Expect = 6e-15
 Identities = 61/167 (36%), Positives = 89/167 (53%), Gaps = 14/167 (8%)
 Frame = +3

Query: 348 LGINGIRYLFR--QVHWH-FPSEHVVNGTRYDLEAHLVHVS-NDG--RIAVLAVMYQIGE 509
           L I G+ + F+  Q+H+H F SEH ++G  Y LEAH+V  S NDG  ++AV+ +MY+ GE
Sbjct: 147 LTIGGVVHTFKPVQIHFHHFASEHAIDGQLYPLEAHMVMASQNDGSDQLAVIGIMYKYGE 206

Query: 510 TPNPILSLIEDDLKKLAETPGVKKGIGYLDPN----LLQARGRRYYRYMGSLTTPPCTEG 677
             +P L  +++  +   E       +     N    LL      YY Y GSLTTP C E 
Sbjct: 207 E-DPFLKRLQETAQSNGEAADKNVELNSFSINVARDLLPESDLTYYGYDGSLTTPGCDER 265

Query: 678 VVWTVIRTIRSVTKQQVAL---IRNAIHDESK-TNARPLQTINDRFV 806
           V W V +  R+V+  Q+ +   +  A H E+  TN R +Q +N R V
Sbjct: 266 VKWHVFKEARTVSVAQLKVFSEVTLAAHPEATVTNNRVIQPLNGRKV 312



 Score = 80.9 bits (198), Expect = 5e-14
 Identities = 75/256 (29%), Positives = 117/256 (45%), Gaps = 39/256 (15%)
 Frame = +3

Query: 156  HWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVAT--------LENHG 308
            H  + R       AG +Q+PID+ +  +   S+   + +  + D+ T          N G
Sbjct: 328  HGFDWRDNGLDSCAGDVQSPIDIVTSTLQAGSSRSDVSSVNLNDLNTDAFTLTGNTVNIG 387

Query: 309  YGMMLSW---PLGQR---YLGINGIRYLFRQVHWHF-PSEHVVNGTRYDLEAHLVHVSND 467
             GM +++   P G      +G   + +   QVHWHF  SEH V+G  Y LEAH+V   ND
Sbjct: 388  QGMQINFGDPPAGDLPVIRIGTRDVTFRPLQVHWHFFLSEHTVDGVHYPLEAHIVMKDND 447

Query: 468  ------GRIAVLAVMYQIGETPNPILSL---IEDDLKKLAETPGVKKGIGYLDP------ 602
                  G++AV+ +MY+ G+    I  +   + D +   A T G + G+   +P      
Sbjct: 448  NLGDSAGQLAVIGIMYKYGDADPFITDMQKRVSDKIASGAITYG-QSGVSLNNPDDPFNV 506

Query: 603  ----NLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIR----NAIHDE 758
                N L +    Y  Y GSLTTPPC+E V W V    R+V+ +Q+ +      N+    
Sbjct: 507  NIKNNFLPSE-LGYAGYDGSLTTPPCSEIVKWHVFLEPRTVSVEQMEVFADVTLNSNPGA 565

Query: 759  SKTNARPLQTINDRFV 806
            + T  R +Q +  R V
Sbjct: 566  TVTTNRMIQPLEGRTV 581



>sp|P22748|CAH4_HUMAN Carbonic anhydrase IV precursor (EC 4.2.1.1)
           (Carbonate dehydratase IV) (CA-IV).>pir|A45745|CRHU4
           carbonate dehydratase (EC 4.2.1.1) IV precursor
           [validated] - human>gb:BC057792_1985441 Homo sapiens
           carbonic anhydrase IV, mRNA (cDNA clone MGC:71638
           IMAGE:30331755), complete cds.>gb:BC069649_1988247 Homo
           sapiens carbonic anhydrase IV, mRNA (cDNA clone
           MGC:97195 IMAGE:7262441), complete
           cds.>gb:BC074768_1989268 Homo sapiens carbonic anhydrase
           IV, mRNA (cDNA clone MGC:103808 IMAGE:30915189),
           complete cds.>gb:CR541766_1993994 Homo sapiens full open
           reading frame cDNA clone RZPDo834A0430D for gene CA4,
           carbonic anhydrase IV; complete cds, incl.
           stopcodon.>gb:HUMCAIVA_2029790 Human carbonic anhydrase
           IV mRNA, complete cds.
          Length = 312

 Score = 84.0 bits (206), Expect = 6e-15
 Identities = 79/284 (27%), Positives = 127/284 (44%), Gaps = 37/284 (13%)
 Frame = +3

Query: 66  LLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGK-MQTPIDL-ESKPV 239
           LL+++    S   +  W +     S   P     L P  W  +  K  Q+PI++  +K  
Sbjct: 7   LLALSAARPSASAESHWCYEVQAESSNYPC----LVPVKWGGNCQKDRQSPINIVTTKAK 62

Query: 240 VYSNLGPI--QNYYMRDVATLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWHFP 401
           V   LG      Y  +   T++N+G+ +M+   L +    I+G      Y  +Q+H H+ 
Sbjct: 63  VDKKLGRFFFSGYDKKQTWTVQNNGHSVMM---LLENKASISGGGLPAPYQAKQLHLHWS 119

Query: 402 ------SEHVVNGTRYDLEAHLVHVSNDG-------------RIAVLAVMYQIGETPN-- 518
                 SEH ++G  + +E H+VH    G              IAVLA + + G   N  
Sbjct: 120 DLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEG 179

Query: 519 --PILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTV 692
             P++  + +  K    T   +  +  L P   + + R Y+RY+GSLTTP C E VVWTV
Sbjct: 180 FQPLVEALSNIPKPEMSTTMAESSLLDLLPK--EEKLRHYFRYLGSLTTPTCDEKVVWTV 237

Query: 693 IRTIRSVTKQQV-ALIRNAIHDESKT-----NARPLQTINDRFV 806
            R    + ++Q+ A  +   +D+ +T     N RPLQ +  R V
Sbjct: 238 FREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTV 281



>gb:AY119174_1300896 Drosophila melanogaster RH54112 full insert
           cDNA.
          Length = 225

 Score = 83.6 bits (205), Expect = 8e-15
 Identities = 64/213 (30%), Positives = 98/213 (46%), Gaps = 22/213 (10%)
 Frame = +3

Query: 108 DEWGF-SYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPI--QNY-- 272
           +EWG+   D N D     WG L      C +GK Q+PI+L  K  +      +  +NY  
Sbjct: 20  NEWGYPDLDNNQDEPFPKWGGL------CDSGKKQSPINLHVKGALKGEFDALKFENYDE 73

Query: 273 YMRDVATLENHGYGMMLSWPLGQRYLGINGIR--YLFRQVHWHFPSEHVVNGTRYDLEAH 446
           + +++  + N+G+ + LS    +  L    +   ++  Q+H H+ SEH +N  RY LE H
Sbjct: 74  HQKNLRMV-NNGHSIQLSGFDHELTLSGGALLQDFVVEQIHMHWWSEHTINDIRYPLEVH 132

Query: 447 LVHVSN------------DGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIG 590
           +VH +N            DG I V+ V+Y +  TPN  +  I   L  +     + K + 
Sbjct: 133 IVHRNNIYPNMTMAANFKDG-IVVIGVLYHVSNTPNEAIGSIIKSLGAVKSYDSMNKPVL 191

Query: 591 YLDP---NLLQARGRRYYRYMGSLTTPPCTEGV 680
             D    + L      Y+ Y GSLTTP C E V
Sbjct: 192 VADSLAVDDLVPSVENYFTYAGSLTTPTCAEAV 224



>gb:AE014296_1135978 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003542_1214720 Drosophila melanogaster
           chromosome 3L, section 43 of 83 of the complete
           sequence.>gb:AY095036_1298186 Drosophila melanogaster
           LD26647 full insert cDNA.
          Length = 335

 Score = 83.6 bits (205), Expect = 8e-15
 Identities = 70/256 (27%), Positives = 116/256 (45%), Gaps = 38/256 (14%)
 Frame = +3

Query: 147 GPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQNYYMR---DVATLENHGYGM 317
           GP HW E   ++ +CS GK Q+PI+++    V      ++ +  +   D   + N+G+ +
Sbjct: 35  GPEHWSE---DYARCS-GKHQSPINIDQVSAVEKKFPKLEFFNFKVVPDNLQMTNNGHTV 90

Query: 318 MLSWPLGQRYL-GING--------IRYLFRQVHWHFP------SEHVVNGTRYDLEAHLV 452
           ++     +  +  + G        + Y F Q H+H+       SE ++N   Y  E H+V
Sbjct: 91  LVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHVV 150

Query: 453 -----------HVSNDGRIAVLAVMYQIGETPNP-------ILSLIEDDLKKLAETPGVK 578
                       +  D  IAV+A  +Q+G+           +LS I+   K +  T  + 
Sbjct: 151 LRNLEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKSVNMTNPLP 210

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIR--NAIH 752
            G  Y+  ++       Y+ Y GSLTTPPC+E V W    T   +T++Q+   R   A  
Sbjct: 211 LG-EYISKSV-----ESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLTAND 264

Query: 753 DESKTNARPLQTINDR 800
           D  K N RP+Q +NDR
Sbjct: 265 DHLKNNFRPIQPLNDR 280



>sp|P54212|CAH_DUNSA Carbonic anhydrase (EC 4.2.1.1) (Carbonate
           dehydratase).
          Length = 589

 Score = 83.6 bits (205), Expect = 8e-15
 Identities = 61/167 (36%), Positives = 89/167 (53%), Gaps = 14/167 (8%)
 Frame = +3

Query: 348 LGINGIRYLFR--QVHWH-FPSEHVVNGTRYDLEAHLVHVS-NDG--RIAVLAVMYQIGE 509
           L I G+ + F+  Q+H+H F SEH ++G  Y LEAH+V  S NDG  ++AV+ +MY+ GE
Sbjct: 147 LTIGGVVHTFKPVQIHFHHFASEHAIDGQLYPLEAHMVMASQNDGSDQLAVIGIMYKYGE 206

Query: 510 TPNPILSLIEDDLKKLAETPGVKKGIGYLDPN----LLQARGRRYYRYMGSLTTPPCTEG 677
             +P L  +++  +   E       +     N    LL      YY Y GSLTTP C E 
Sbjct: 207 E-DPFLKRLQETAQSNGEAGDKNVELNSFSINVARDLLPESDLTYYGYDGSLTTPGCDER 265

Query: 678 VVWTVIRTIRSVTKQQVAL---IRNAIHDESK-TNARPLQTINDRFV 806
           V W V +  R+V+  Q+ +   +  A H E+  TN R +Q +N R V
Sbjct: 266 VKWHVFKEARTVSVAQLKVFSEVTLAAHPEATVTNNRVIQPLNGRKV 312



 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 77/256 (30%), Positives = 114/256 (44%), Gaps = 39/256 (15%)
 Frame = +3

Query: 156  HWGELRPEWWQCSAGKMQTPIDL--------ESKPVVYS-NLGPIQNYYMRDVATLENHG 308
            H  + R       AG +Q+PID+         S+  V S NL  +            N G
Sbjct: 328  HGFDWRDNGLDSCAGDVQSPIDIVTSTLQAGSSRSDVSSVNLMTLNTDAFTLTGNTVNIG 387

Query: 309  YGMMLSW---PLGQR---YLGINGIRYLFRQVHWHF-PSEHVVNGTRYDLEAHLVHVSND 467
             GM +++   P G      +G   + +   QVHWHF  SEH V+G  Y LEAH+V   ND
Sbjct: 388  QGMQINFGDPPAGDLPVIRIGTRDVTFRPLQVHWHFFLSEHTVDGVHYPLEAHIVMKDND 447

Query: 468  ------GRIAVLAVMYQIGETPNPILSL---IEDDLKKLAETPGVKKGIGYLDP------ 602
                  G++AV+ +MY+ G+    I  +   + D +   A T G + G+   +P      
Sbjct: 448  NLGDSAGQLAVIGIMYKYGDADPFITDMQKRVSDKIASGAITYG-QSGVSLNNPDDPFNV 506

Query: 603  ----NLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIR----NAIHDE 758
                N L +    Y  Y GSLTTPPC+E V W V    R+V+ +Q+ +      N+    
Sbjct: 507  NIKNNFLPSE-LGYAGYDGSLTTPPCSEIVKWHVFLEPRTVSVEQMEVFADVTLNSNPGA 565

Query: 759  SKTNARPLQTINDRFV 806
            + T  R +Q +  R V
Sbjct: 566  TVTTNRMIQPLEGRTV 581



>gb:BC054242_2550892 Xenopus laevis hypothetical protein MGC64443,
           mRNA (cDNA clone MGC:64443 IMAGE:6880490), complete cds.
          Length = 312

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 73/294 (24%), Positives = 126/294 (42%), Gaps = 35/294 (11%)
 Frame = +3

Query: 36  MLKLFSIAFLLLSVTHVIKSQEV----DDEWGFSYDENSDRG--PSHWGELRPEWWQCSA 197
           M+K FS+  LL+S++ +  S       +  W +      D G  P  W        +   
Sbjct: 1   MMKCFSLT-LLVSLSFIKNSAAAAAAAEGHWCYEIQACQDPGCGPRFWNNANTFCGE--- 56

Query: 198 GKMQTPIDLESKPVVYSNLGPIQNYYMRDVAT------LENHGYGMMLSWPLGQRYLGIN 359
            K Q+PI++ +K  V+  +  ++ + ++          + N+G+   +  P G    G  
Sbjct: 57  -KEQSPINILTKKAVF--MESLKEFDLKSYGVSIRQLNVTNNGHSAQVDLPPGIEISG-G 112

Query: 360 GIRYLFRQVHWHFP--------SEHVVNGTRYDLEAHLVHVSNDGR----------IAVL 485
           G+   +  + +HF         SEH ++G +Y +E H+VH     +          +AVL
Sbjct: 113 GLSGTYDAIQFHFHWGSEEFPGSEHTIDGEKYPMELHIVHRRKTAKADTGGTGSRDLAVL 172

Query: 486 AVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRR-YYRYMGSLTTP 662
              Y+   T N     + + L+ +     VK     L   +      + YYRY GSLTTP
Sbjct: 173 GFFYEETSTNNTDYEPLINSLEAIRTKGAVKNFSANLTKLIPDKEELKVYYRYNGSLTTP 232

Query: 663 PCTEGVVWTVIRTIRSVTKQQVALIRNAI----HDESKTNARPLQTINDRFVKV 812
           PC E V WT+  T   +++QQ+    N++    +     N RP+Q + DR V +
Sbjct: 233 PCNETVTWTLFNTTIKLSQQQLRAFYNSLNFTENQRMVENFRPVQRLGDRTVYI 286



>gb:BC046495_2099254 Mus musculus carbonic anhydrase 6, mRNA (cDNA
           clone IMAGE:4190426), partial cds.
          Length = 251

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 63/200 (31%), Positives = 95/200 (47%), Gaps = 25/200 (12%)
 Frame = +3

Query: 291 TLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP--------SEHVVNGTRYDLEAH 446
           T+ N+G+ + +  P        +G  ++ +  H+H+         SEH ++G R  +EAH
Sbjct: 12  TMTNNGHTVSIDLPPSMYLETSDGTEFISKAFHFHWGGRDWELSGSEHTIDGIRSIMEAH 71

Query: 447 LVHVSND-----------GRIAVLAVMYQIGE-TPNPILSLIEDDLKKLAETPGVKKGIG 590
            VH + +             +AVLAV+++I E   N   S I   LK + E PG    + 
Sbjct: 72  FVHFNKEYGTYENAKDQKNGLAVLAVLFKIDEYAENTYYSDIISALKNI-EKPGETTTLK 130

Query: 591 YLD-PNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES-- 761
                NLL      YY Y GSLTTPPCTE V W V+R   +++K QV  I N++ D +  
Sbjct: 131 DTTIRNLLPKDVHHYYTYPGSLTTPPCTENVQWFVLRDKVTLSKAQVVTIENSVMDHNNN 190

Query: 762 --KTNARPLQTINDRFVKVD 815
             +   R  Q  N R V+ +
Sbjct: 191 TIQNGYRSTQPNNHRVVEAN 210



>sp|P23589|CAH5_MOUSE Carbonic anhydrase VA, mitochondrial precursor
           (EC 4.2.1.1) (Carbonate dehydratase VA) (CA-VA) (CA
           Y).>gb:BC030174_2096715 Mus musculus carbonic anhydrase
           5a, mitochondrial, mRNA (cDNA clone MGC:29144
           IMAGE:5051543), complete cds.
          Length = 299

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 68/232 (29%), Positives = 102/232 (43%), Gaps = 31/232 (13%)
 Frame = +3

Query: 198 GKMQTPIDLESKPVVYS-NLGPIQ-NYYMRDVATLENHGYGMMLSWPLGQRYLGING--- 362
           G  Q+PI+++ K  VY   L P++ +Y       L N GY   + +       GI+G   
Sbjct: 55  GTRQSPINIQWKDSVYDPQLAPLRVSYDAASCRYLWNTGYFFQVEFDDSCEDSGISGGPL 114

Query: 363 -IRYLFRQVHWHFP------SEHVVNGTRYDLEAHLVHVSN------------DGRIAVL 485
              Y  +Q H+H+       SEH V+G  Y  E HLVH ++            +  +AV+
Sbjct: 115 GNHYRLKQFHFHWGATDEWGSEHAVDGHTYPAELHLVHWNSTKYENYKKASVGENGLAVI 174

Query: 486 AVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPP 665
            V  ++G     +  L+  D+         +  +G  DP+ L    R Y+ Y GSLTTPP
Sbjct: 175 GVFLKLGAHHQALQKLV--DVLPEVRHKDTQVAMGPFDPSCLLPACRDYWTYPGSLTTPP 232

Query: 666 CTEGVVWTVIRTIRSVTKQQVALIRNAI-------HDESKTNARPLQTINDR 800
             E V W V +T   V+  Q++  R  +        D    N RPLQ + DR
Sbjct: 233 LAESVTWIVQKTPVEVSPSQLSTFRTLLFSGRGEEEDVMVNNYRPLQPLRDR 284



>gb:GGCAII12_2572960 G.gallus carbonic anhydrase II gene exons 1-2
           (EC 4.2.1.1) and joined CDS.
          Length = 260

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 70/262 (26%), Positives = 115/262 (43%), Gaps = 30/262 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYYMRDVA 290
           WG+    +S  GP+HW E  P     + G+ Q+PI + +K   Y   L P+   Y    A
Sbjct: 5   WGY----DSHNGPAHWHEHFP----IANGERQSPIAISTKAARYDPALKPLSFSYDAGTA 56

Query: 291 -TLENHGYGMMLSWPLGQRYLGING--IRYLFRQVHWHFP--------SEHVVNGTRYDL 437
             + N+G+   + +        + G  +  ++R V +H          SEH V+G +YD 
Sbjct: 57  KAIVNNGHSFNVEFDDSSDKSVLQGGALDGVYRLVQFHIHWGSCEGQGSEHTVDGVKYDA 116

Query: 438 EAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG 584
           E H+VH           + +   +AV+ +  ++G    P +  + D L  + +T G +  
Sbjct: 117 ELHIVHWNVKYGKFAEALKHPDGLAVVGIFMKVGNA-KPEIQKVVDALNSI-QTKGKQAS 174

Query: 585 IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK 764
               DP  L    R Y+ Y GSLTTPP  E V+W V++   +V+ +Q+  +R        
Sbjct: 175 FTNFDPTGLLPPCRDYWTYPGSLTTPPLHECVIWHVLKEPITVSSEQMCKLRGLCFSAEN 234

Query: 765 -------TNARPLQTINDRFVK 809
                   N RP Q +  R V+
Sbjct: 235 EPVCRMVDNWRPCQPVKSREVR 256



>pir|JC2580|JC2580 carbonate dehydratase (EC 4.2.1.1) II -
           chicken>gb:GDCARANH_2572516 G.domesticus mRNA for
           carbonic anhydrase.
          Length = 260

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 70/262 (26%), Positives = 115/262 (43%), Gaps = 30/262 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYYMRDVA 290
           WG+    +S  GP+HW E  P     + G+ Q+PI + +K   Y   L P+   Y    A
Sbjct: 5   WGY----DSHNGPAHWHEHFP----IANGERQSPIAISTKAARYDPALKPLSFSYDAGTA 56

Query: 291 -TLENHGYGMMLSWPLGQRYLGING--IRYLFRQVHWHFP--------SEHVVNGTRYDL 437
             + N+G+   + +        + G  +  ++R V +H          SEH V+G +YD 
Sbjct: 57  KAIVNNGHSFNVEFDDSSDKSVLQGGALDGVYRLVQFHIHWGSCEGQGSEHTVDGVKYDA 116

Query: 438 EAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG 584
           E H+VH           + +   +AV+ +  ++G    P +  + D L  + +T G +  
Sbjct: 117 ELHIVHWNVKYGKFAEALKHPDGLAVVGIFMKVGNA-KPEIQKVVDALNSI-QTKGKQAS 174

Query: 585 IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK 764
               DP  L    R Y+ Y GSLTTPP  E V+W V++   +V+ +Q+  +R        
Sbjct: 175 FTNFDPTGLLPPCRDYWTYPGSLTTPPLHECVIWHVLKEPITVSSEQMCKLRGLCFSAEN 234

Query: 765 -------TNARPLQTINDRFVK 809
                   N RP Q +  R V+
Sbjct: 235 EPVCRMVDNWRPCQPLKSREVR 256



>sp|P07630|CAH2_CHICK Carbonic anhydrase II (EC 4.2.1.1) (Carbonate
           dehydratase II) (CA-II).
          Length = 259

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 70/262 (26%), Positives = 115/262 (43%), Gaps = 30/262 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYYMRDVA 290
           WG+    +S  GP+HW E  P     + G+ Q+PI + +K   Y   L P+   Y    A
Sbjct: 4   WGY----DSHNGPAHWHEHFP----IANGERQSPIAISTKAARYDPALKPLSFSYDAGTA 55

Query: 291 -TLENHGYGMMLSWPLGQRYLGING--IRYLFRQVHWHFP--------SEHVVNGTRYDL 437
             + N+G+   + +        + G  +  ++R V +H          SEH V+G +YD 
Sbjct: 56  KAIVNNGHSFNVEFDDSSDKSVLQGGALDGVYRLVQFHIHWGSCEGQGSEHTVDGVKYDA 115

Query: 438 EAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG 584
           E H+VH           + +   +AV+ +  ++G    P +  + D L  + +T G +  
Sbjct: 116 ELHIVHWNVKYGKFAEALKHPDGLAVVGIFMKVGNA-KPEIQKVVDALNSI-QTKGKQAS 173

Query: 585 IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK 764
               DP  L    R Y+ Y GSLTTPP  E V+W V++   +V+ +Q+  +R        
Sbjct: 174 FTNFDPTGLLPPCRDYWTYPGSLTTPPLHECVIWHVLKEPITVSSEQMCKLRGLCFSAEN 233

Query: 765 -------TNARPLQTINDRFVK 809
                   N RP Q +  R V+
Sbjct: 234 EPVCRMVDNWRPCQPLKSREVR 255



>gb:AF079834_2053716 Mus musculus stress-inducible intra-cellular
           carbonic anhydrase isozyme VI mRNA, complete cds.
          Length = 261

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 61/203 (30%), Positives = 99/203 (48%), Gaps = 28/203 (13%)
 Frame = +3

Query: 291 TLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP--------SEHVVNGTRYDLEAH 446
           T+ N+G+ + +  P        +G  ++ +  H+H+         SEH ++G R  +EAH
Sbjct: 22  TMTNNGHTVSIDLPPSMYLETSDGTEFISKAFHFHWGGRDWELSGSEHTIDGIRSIMEAH 81

Query: 447 LVHVSND-----------GRIAVLAVMYQIGETP-----NPILSLIEDDLKKLAETPGVK 578
            VH + +             +AVLAV+++I E       + I+S ++D ++K  ET  +K
Sbjct: 82  FVHFNKEYGTYENAKDQKNGLAVLAVLFKIDEYAENTYYSDIISALKD-IEKPGETTTLK 140

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE 758
                   +LL      YY Y GSLTTPPCTE V W V+R   +++K QV  I N++ D 
Sbjct: 141 DTT---IRDLLPKDVHHYYTYPGSLTTPPCTENVQWFVLRDRVTLSKAQVVTIENSVMDH 197

Query: 759 S----KTNARPLQTINDRFVKVD 815
           +    +   R  Q  N R V+ +
Sbjct: 198 NNNTIQNGYRSTQPNNHRVVEAN 220



>gb:AF170173_1774245 Acetabularia acetabulum putative carbonic
           anhydrase 2 (CA2) mRNA, complete cds.
          Length = 325

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 69/200 (34%), Positives = 96/200 (48%), Gaps = 19/200 (9%)
 Frame = +3

Query: 258 PIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDL 437
           PIQ   +  V      G G   ++  GQ    I  ++  F   H H P EH+ NG    L
Sbjct: 125 PIQGGKLDGVLHPITKGQGRTSNFMGGQ----IEYVQARFVNFHVHSPGEHMYNGYLAPL 180

Query: 438 EAHLVHVSND---------GRIAVLAVMYQ--IGETPNPILSLIEDDLKKLAETPGVKKG 584
           E H V   +          G +AV++V +Q  + +TPN     I+D L+ +     V+ G
Sbjct: 181 EGHFVMNIDQADLDTCPEAGCLAVVSVHFQHSLDDTPN---QFIQDTLELIGGEWPVQIG 237

Query: 585 I-----GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI 749
                 G L+ + L  +   Y  Y GSLTTPPCTEGV+W VI+    V+  QVA ++NAI
Sbjct: 238 ASMEANGSLNFDQLLPQNPHYMLYSGSLTTPPCTEGVLWHVIQESVPVSIAQVAALQNAI 297

Query: 750 ---HDESKTNARPLQTINDR 800
              HD    N R +Q IN+R
Sbjct: 298 GYSHDGIVRNNRRIQPINNR 317



>gb:AY240020_1427672 Bos taurus carbonic anhydrase II mRNA, complete
           cds.
          Length = 260

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 75/263 (28%), Positives = 114/263 (43%), Gaps = 31/263 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYYMRDVA 290
           WG+        GP HW +  P     + G+ Q+P+D+++K VV    L P+   Y    +
Sbjct: 5   WGYG----KHNGPEHWHKDFP----IANGERQSPVDIDTKAVVQDPALKPLALVYGEATS 56

Query: 291 T-LENHGYGMMLSWPLGQ--RYLGINGIRYLFRQVHWHFP--------SEHVVNGTRYDL 437
             + N+G+   + +   Q    L    +   +R V +HF         SEH V+  +Y  
Sbjct: 57  RRMVNNGHSFNVEYDDSQDKAVLKDGPLTGTYRLVQFHFHWGSSDDQGSEHTVDRKKYAA 116

Query: 438 EAHLVHVSN------------DGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK 581
           E HLVH +             DG +AV+ V  ++G+  NP L  + D L  + +T G   
Sbjct: 117 ELHLVHWNTKYGDFGTAAQQPDG-LAVVGVFLKVGDA-NPALQKVLDALDSI-KTKGKST 173

Query: 582 GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES 761
                DP  L      Y+ Y GSLTTPP  E V W V++   SV+ QQ+   R    +  
Sbjct: 174 DFPNFDPGSLLPNVLDYWTYPGSLTTPPLLESVTWIVLKEPISVSSQQMLKFRTLNFNAE 233

Query: 762 -------KTNARPLQTINDRFVK 809
                    N RP Q + +R V+
Sbjct: 234 GEPELLMLANWRPAQPLKNRQVR 256



>sp|Q99N23|CAHF_MOUSE Carbonic anhydrase XV precursor (EC 4.2.1.1)
           (Carbonate dehydratase XV) (CA-XV).>gb:AF231122_2060041
           Mus musculus carbonic anhydrase XV (Car15) mRNA,
           complete cds.>gb:BC019975_2093178 Mus musculus carbonic
           anhydrase 15, mRNA (cDNA clone MGC:28637 IMAGE:4223351),
           complete cds.
          Length = 324

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 87/292 (29%), Positives = 129/292 (44%), Gaps = 41/292 (14%)
 Frame = +3

Query: 48  FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDR-GPSHWGELRPEWWQCSAGKMQTPIDL 224
           F ++FLL+ +     + +VD    + YD    + GP+HW EL P       G  Q+PI++
Sbjct: 6   FLLSFLLIQL-----AAQVDSSGTWCYDSQDPKCGPAHWKELAP----ACGGPTQSPINI 56

Query: 225 ESKPVVYS-NLGPI--QNYYM--RDVATLENHGYGMMLSWPLGQ------RYLGINGIRY 371
           + + V     L P   Q Y    +D   LEN G+ ++L     Q      R  G+    Y
Sbjct: 57  DLRLVQRDYTLKPFIFQGYDSAPQDPWVLENDGHTVLLRVNSCQQNCPAIRGAGLPSPEY 116

Query: 372 LFRQVHWHFPS------EHVVNGTRYDLEAHLVHVSN------DGR-----IAVLAVMYQ 500
              Q+H+H+ S      EH ++     +E H+VH++       D R      A+LAV+  
Sbjct: 117 RLLQLHFHWGSPGHQGSEHSLDEKHGSMEMHMVHMNTKYQSMEDARSQPDGFAILAVLLV 176

Query: 501 IGETPNPILSLIEDDLKKLAETPGVKKGIG--YLDPNLLQARGR--RYYRYMGSLTTPPC 668
             +  N   S I   LK L+ +PGV   +   +   +LL +  R  RYYRY GSLTTP C
Sbjct: 177 EEDRDNTNFSAIVSGLKNLS-SPGVAVNLTSTFALASLLPSALRLLRYYRYSGSLTTPGC 235

Query: 669 TEGVVWTVIRTIRSVTKQQVALIR-------NAIHDESKT-NARPLQTINDR 800
              V+WTV      +   QV   +         +H    T N RP Q +  R
Sbjct: 236 EPAVLWTVFENTVPIGHAQVVQFQAVLQTGPPGLHPRPLTSNFRPQQPLGGR 287



>sp|P00921|CAH2_BOVIN Carbonic anhydrase II (EC 4.2.1.1) (Carbonate
           dehydratase II) (CA-II).
          Length = 259

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 75/263 (28%), Positives = 114/263 (43%), Gaps = 31/263 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYYMRDVA 290
           WG+        GP HW +  P     + G+ Q+P+D+++K VV    L P+   Y    +
Sbjct: 4   WGYG----KHNGPEHWHKDFP----IANGERQSPVDIDTKAVVQDPALKPLALVYGEATS 55

Query: 291 T-LENHGYGMMLSWPLGQ--RYLGINGIRYLFRQVHWHFP--------SEHVVNGTRYDL 437
             + N+G+   + +   Q    L    +   +R V +HF         SEH V+  +Y  
Sbjct: 56  RRMVNNGHSFNVEYDDSQDKAVLKDGPLTGTYRLVQFHFHWGSSDDQGSEHTVDRKKYAA 115

Query: 438 EAHLVHVSN------------DGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK 581
           E HLVH +             DG +AV+ V  ++G+  NP L  + D L  + +T G   
Sbjct: 116 ELHLVHWNTKYGDFGTAAQQPDG-LAVVGVFLKVGDA-NPALQKVLDALDSI-KTKGKST 172

Query: 582 GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES 761
                DP  L      Y+ Y GSLTTPP  E V W V++   SV+ QQ+   R    +  
Sbjct: 173 DFPNFDPGSLLPNVLDYWTYPGSLTTPPLLESVTWIVLKEPISVSSQQMLKFRTLNFNAE 232

Query: 762 -------KTNARPLQTINDRFVK 809
                    N RP Q + +R V+
Sbjct: 233 GEPELLMLANWRPAQPLKNRQVR 255



>gb:GGCAIIR_2572962 Chicken mRNA for carbonic anhydrase II CA-II
           (EC4.2.1.1).
          Length = 256

 Score = 80.5 bits (197), Expect = 7e-14
 Identities = 68/255 (26%), Positives = 112/255 (43%), Gaps = 30/255 (11%)
 Frame = +3

Query: 135 NSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYYMRDVA-TLENHG 308
           +S  GP+HW E  P     + G+ Q+PI + +K   Y   L P+   Y    A  + N+G
Sbjct: 4   DSHNGPAHWHEHFP----IANGERQSPIAISTKAARYDPALKPLSFSYDAGTAKAIVNNG 59

Query: 309 YGMMLSWPLGQRYLGING--IRYLFRQVHWHFP--------SEHVVNGTRYDLEAHLVH- 455
           +   + +        + G  +  ++R V +H          SEH V+G +YD E H+VH 
Sbjct: 60  HSFNVEFDDSSDKSVLQGGALDGVYRLVQFHIHWGSCEGQGSEHTVDGVKYDAELHIVHW 119

Query: 456 ----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPN 605
                     + +   +AV+ +  ++G    P +  + D L  + +T G +      DP 
Sbjct: 120 NVKYGKFAEALKHPDGLAVVGIFMKVGNA-KPEIQKVVDALNSI-QTKGKQASFTNFDPT 177

Query: 606 LLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK------- 764
            L    R Y+ Y GSLTTPP  E V+W V++   +V+ +Q+  +R               
Sbjct: 178 GLLPPCRDYWTYPGSLTTPPLHECVIWHVLKEPITVSSEQMCKLRGLCFSAENEPVCRMV 237

Query: 765 TNARPLQTINDRFVK 809
            N RP Q +  R V+
Sbjct: 238 DNWRPCQPLKSREVR 252



>gb:GCAIIR_2572428 Chicken mRNA for carbonic anhydrase II.
          Length = 252

 Score = 80.5 bits (197), Expect = 7e-14
 Identities = 68/254 (26%), Positives = 111/254 (43%), Gaps = 30/254 (11%)
 Frame = +3

Query: 138 SDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYYMRDVA-TLENHGY 311
           S  GP+HW E  P     + G+ Q+PI + +K   Y   L P+   Y    A  + N+G+
Sbjct: 1   SHNGPAHWHEHFP----IANGERQSPIAISTKAARYDPALKPLSFSYDAGTAKAIVNNGH 56

Query: 312 GMMLSWPLGQRYLGING--IRYLFRQVHWHFP--------SEHVVNGTRYDLEAHLVH-- 455
              + +        + G  +  ++R V +H          SEH V+G +YD E H+VH  
Sbjct: 57  SFNVEFDDSSDKSVLQGGALDGVYRLVQFHIHWGSCEGQGSEHTVDGVKYDAELHIVHWN 116

Query: 456 ---------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNL 608
                    + +   +AV+ +  ++G    P +  + D L  + +T G +      DP  
Sbjct: 117 VKYGKFAEALKHPDGLAVVGIFMKVGNA-KPEIQKVVDALNSI-QTKGKQASFTNFDPTG 174

Query: 609 LQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK-------T 767
           L    R Y+ Y GSLTTPP  E V+W V++   +V+ +Q+  +R                
Sbjct: 175 LLPPCRDYWTYPGSLTTPPLHECVIWHVLKEPITVSSEQMCKLRGLCFSAENEPVCRMVD 234

Query: 768 NARPLQTINDRFVK 809
           N RP Q +  R V+
Sbjct: 235 NWRPCQPVKSREVR 248



>pir|A22962|A22962 carbonate dehydratase (EC 4.2.1.1) I - rabbit
           (fragment)
          Length = 235

 Score = 80.1 bits (196), Expect = 9e-14
 Identities = 65/234 (27%), Positives = 106/234 (45%), Gaps = 30/234 (12%)
 Frame = +3

Query: 198 GKMQTPIDLESKPVVY-SNLGPIQ-NYYMRDVATLENHGYGMMLSWPLGQRYL---GING 362
           G  Q+P+D++S  V + ++L P   +Y       + N G+   +++    + +   G   
Sbjct: 1   GNKQSPVDIKSSEVKHDTSLKPFSVSYNPASAKEIINVGHSFHVNFEDDSQSVLKGGPLS 60

Query: 363 IRYLFRQVHWH------FPSEHVVNGTRYDLEAHLVH------------VSNDGRIAVLA 488
             Y   Q H+H      + SEH V+G ++  E HLVH            VS    +A++A
Sbjct: 61  DNYRLSQFHFHWGKTDDYGSEHTVDGAKFSAELHLVHWNSGKYPNIADSVSKADGLAIVA 120

Query: 489 VMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPC 668
           V  ++G+  NP L  + D L  + +T G K      DP+ L      Y+ Y GSLT PP 
Sbjct: 121 VFLKVGQA-NPKLQKVLDALSAV-KTKGKKASFTNFDPSTLLPPSLDYWTYSGSLTHPPL 178

Query: 669 TEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT-------NARPLQTINDRFVK 809
            E V W + +   S++ +Q+A  R+ + +           N RP Q +  R VK
Sbjct: 179 HESVTWLICKDSISISSEQLAQFRSLLSNAEGEAAVPILHNNRPPQPLKGRTVK 232



>sp|P07452|CAH1_RABIT Carbonic anhydrase I (EC 4.2.1.1) (Carbonate
           dehydratase I) (CA-I) (Fragment).
          Length = 235

 Score = 80.1 bits (196), Expect = 9e-14
 Identities = 65/234 (27%), Positives = 106/234 (45%), Gaps = 30/234 (12%)
 Frame = +3

Query: 198 GKMQTPIDLESKPVVY-SNLGPIQ-NYYMRDVATLENHGYGMMLSWPLGQRYL---GING 362
           G  Q+P+D++S  V + ++L P   +Y       + N G+   +++    + +   G   
Sbjct: 1   GNKQSPVDIKSSEVKHDTSLKPFSVSYNPASAKEIINVGHSFHVNFEDDSQSVLKGGPLS 60

Query: 363 IRYLFRQVHWH------FPSEHVVNGTRYDLEAHLVH------------VSNDGRIAVLA 488
             Y   Q H+H      + SEH V+G ++  E HLVH            VS    +A++A
Sbjct: 61  DNYRLSQFHFHWGKTDDYGSEHTVDGAKFSAELHLVHWNSGKYPNIADSVSKADGLAIVA 120

Query: 489 VMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPC 668
           V  ++G+  NP L  + D L  + +T G K      DP+ L      Y+ Y GSLT PP 
Sbjct: 121 VFLKVGQA-NPKLQKVLDALSAV-KTKGKKASFTNFDPSTLLPPSLDYWTYSGSLTHPPL 178

Query: 669 TEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT-------NARPLQTINDRFVK 809
            E V W + +   S++ +Q+A  R+ + +           N RP Q +  R VK
Sbjct: 179 HESVTWLICKDSISISSEQLAQFRSLLSNAEGEAAVPILHNNRPPQPLKGRTVK 232



>gb:HUMCA405_2029757 Human carbonic anhydrase IV gene, exon 7.
          Length = 294

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 69/236 (29%), Positives = 111/236 (47%), Gaps = 36/236 (15%)
 Frame = +3

Query: 207 QTPIDL-ESKPVVYSNLGPI--QNYYMRDVATLENHGYGMMLSWPLGQRYLGING----I 365
           Q+PI++  +K  V   LG      Y  +   T++N+G+ +M+   L +    I+G     
Sbjct: 33  QSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMM---LLENKASISGGGLPA 89

Query: 366 RYLFRQVHWHFP------SEHVVNGTRYDLEAHLVHVSNDG-------------RIAVLA 488
            Y  +Q+H H+       SEH ++G  + +E H+VH    G              IAVLA
Sbjct: 90  PYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLA 149

Query: 489 VMYQIGETPN----PILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLT 656
            + + G   N    P++  + +  K    T   +  +  L P   + + R Y+RY+GSLT
Sbjct: 150 FLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPK--EEKLRHYFRYLGSLT 207

Query: 657 TPPCTEGVVWTVIRTIRSVTKQQV-ALIRNAIHDESKT-----NARPLQTINDRFV 806
           TP C E VVWTV R    + ++Q+ A  +   +D+ +T     N RPLQ +  R V
Sbjct: 208 TPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTV 263



>gb:RABCAI_1443599 Rabbit erythrocyte carbonic anhydrase I mRNA,
           partial cds.
          Length = 235

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 65/234 (27%), Positives = 106/234 (45%), Gaps = 30/234 (12%)
 Frame = +3

Query: 198 GKMQTPIDLESKPVVY-SNLGPIQ-NYYMRDVATLENHGYGMMLSWPLGQRYL---GING 362
           G  Q+P+D++S  V + ++L P   +Y       + N G+   +++    + +   G   
Sbjct: 1   GXKQSPVDIKSSEVKHDTSLKPFSVSYNPASAKEIINVGHSFHVNFEDDSQSVLKGGPLS 60

Query: 363 IRYLFRQVHWH------FPSEHVVNGTRYDLEAHLVH------------VSNDGRIAVLA 488
             Y   Q H+H      + SEH V+G ++  E HLVH            VS    +A++A
Sbjct: 61  DNYRLSQFHFHWGKTDDYGSEHTVDGAKFSAELHLVHWNSGKYPNIADSVSKADGLAIVA 120

Query: 489 VMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPC 668
           V  ++G+  NP L  + D L  + +T G K      DP+ L      Y+ Y GSLT PP 
Sbjct: 121 VFLKVGQA-NPKLQKVLDALSAV-KTKGKKASFTNFDPSTLLPPSLDYWTYSGSLTHPPL 178

Query: 669 TEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT-------NARPLQTINDRFVK 809
            E V W + +   S++ +Q+A  R+ + +           N RP Q +  R VK
Sbjct: 179 HESVTWLICKDSISISSEQLAQFRSLLSNAEGEAAVPILHNNRPPQPLKGRTVK 232



>sp|P00919|CAH2_RABIT Carbonic anhydrase II (EC 4.2.1.1) (Carbonate
           dehydratase II) (CA-II).
          Length = 259

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 70/262 (26%), Positives = 109/262 (41%), Gaps = 30/262 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQNYYMRDVA 290
           WG+        GP HW +  P     + G+ Q+PID+++    +  +L P++  Y   ++
Sbjct: 4   WGYG----KHNGPEHWHKDFP----IANGERQSPIDIDTNAAKHDPSLKPLRVCYEHPIS 55

Query: 291 TL---ENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP--------SEHVVNGTRYDL 437
                  H + +       +  L    +   +R + +HF         SEH VN  +Y  
Sbjct: 56  RRIINNGHSFNVEFDDSHDKTVLKEGPLEGTYRLIQFHFHWGSSDGQGSEHTVNKKKYAA 115

Query: 438 EAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG 584
           E HLVH           V +   +AVL +  +IG    P L  + D L  + +T G    
Sbjct: 116 ELHLVHWNTKYGDFGKAVKHPDGLAVLGIFLKIGSA-TPGLQKVVDTLSSI-KTKGKSVD 173

Query: 585 IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK 764
               DP  L      Y+ Y GSLTTPP  E V W V++   +V+ +Q+   RN   ++  
Sbjct: 174 FTDFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPITVSSEQMLKFRNLNFNKEA 233

Query: 765 -------TNARPLQTINDRFVK 809
                   N RP Q +  R VK
Sbjct: 234 EPEEPMVDNWRPTQPLKGRQVK 255



>pir|A27175|CRHU2 carbonate dehydratase (EC 4.2.1.1) II [validated]
           - human>gb:CR536526_1993819 Homo sapiens full open
           reading frame cDNA clone RZPDo834C0222D for gene CA2,
           carbonic anhydrase II; complete cds, incl.
           stopcodon.>gb:CR541875_1994102 Homo sapiens full open
           reading frame cDNA clone RZPDo834B0233D for gene CA2,
           carbonic anhydrase II; complete cds, without
           stopcodon.>gb:HSCA2_2011205 Human mRNA for carbonic
           anhydrase II (EC 4.2.1.1).>gb:HUMCAIIA_2029787 Human
           carbonic anhydrase II mRNA, complete
           cds.>gb:HUMCAIIA06_2029788 H.sapiens carbonic anhydrase
           II (CAII) gene, exon 7, and complete
           cds.>gb:HUMCAIZ_2029792 Human carbonic anhydrase II
           mRNA, complete cds.
          Length = 260

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 74/264 (28%), Positives = 114/264 (43%), Gaps = 32/264 (12%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQNYYMRDVA 290
           WG+        GP HW +  P     + G+ Q+P+D+++    Y  +L P+   Y  D A
Sbjct: 5   WGYG----KHNGPEHWHKDFP----IAKGERQSPVDIDTHTAKYDPSLKPLSVSY--DQA 54

Query: 291 T---LENHGYGMMLSWPLGQRYLGING--IRYLFRQVHWHFP--------SEHVVNGTRY 431
           T   + N+G+   + +   Q    + G  +   +R + +HF         SEH V+  +Y
Sbjct: 55  TSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKY 114

Query: 432 DLEAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
             E HLVH           V     +AVL +  ++G    P L  + D L  + +T G  
Sbjct: 115 AAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSA-KPGLQKVVDVLDSI-KTKGKS 172

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNA-IHD 755
                 DP  L      Y+ Y GSLTTPP  E V W V++   SV+ +QV   R    + 
Sbjct: 173 ADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNG 232

Query: 756 ESK------TNARPLQTINDRFVK 809
           E +       N RP Q + +R +K
Sbjct: 233 EGEPEELMVDNWRPAQPLKNRQIK 256



>pir|A01144|CRBO2 carbonate dehydratase (EC 4.2.1.1) II - bovine
           (tentative sequence)
          Length = 259

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 74/263 (28%), Positives = 115/263 (43%), Gaps = 31/263 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYYMRDVA 290
           WG+   +    GP HW +  P     + G+ Q+P+++++K VV    L P+   Y    +
Sbjct: 4   WGYGKHB----GPZHWHKDFP----IANGERQSPVNIDTKAVVQDPALKPLALVYGEATS 55

Query: 291 T-LENHGYGMMLSWPLGQ--RYLGINGIRYLFRQVHWHFP--------SEHVVNGTRYDL 437
             + N+G+   + +   Q    L    +   +R V +HF         SEH V+  +Y  
Sbjct: 56  RRMVNNGHSFNVEYDDSQDKAVLKDGPLTGTYRLVQFHFHWGSSBBQGSEHTVDRKKYAA 115

Query: 438 EAHLVHVSN------------DGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK 581
           E HLVH +             DG +AV+ V  ++G+  NP L  + D L  + +T G   
Sbjct: 116 ELHLVHWNTKYGDFGTAAQQPDG-LAVVGVFLKVGDA-NPALQKVLDALDSI-KTKGKST 172

Query: 582 GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES 761
                DP  L      Y+ Y GSLTTPP  E V W V++   SV+ QQ+   R    +  
Sbjct: 173 DFPNFDPGSLLPNVLDYWTYPGSLTTPPLLESVTWIVLKEPISVSSQQMLKFRTLNFNAE 232

Query: 762 -------KTNARPLQTINDRFVK 809
                    N RP Q + +R V+
Sbjct: 233 GEPELLMLANWRPAQPLKNRQVR 255



>sp|P00918|CAH2_HUMAN Carbonic anhydrase II (EC 4.2.1.1) (Carbonate
           dehydratase II) (CA-II) (Carbonic anhydrase C).
          Length = 259

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 74/264 (28%), Positives = 114/264 (43%), Gaps = 32/264 (12%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQNYYMRDVA 290
           WG+        GP HW +  P     + G+ Q+P+D+++    Y  +L P+   Y  D A
Sbjct: 4   WGYG----KHNGPEHWHKDFP----IAKGERQSPVDIDTHTAKYDPSLKPLSVSY--DQA 53

Query: 291 T---LENHGYGMMLSWPLGQRYLGING--IRYLFRQVHWHFP--------SEHVVNGTRY 431
           T   + N+G+   + +   Q    + G  +   +R + +HF         SEH V+  +Y
Sbjct: 54  TSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKY 113

Query: 432 DLEAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
             E HLVH           V     +AVL +  ++G    P L  + D L  + +T G  
Sbjct: 114 AAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSA-KPGLQKVVDVLDSI-KTKGKS 171

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNA-IHD 755
                 DP  L      Y+ Y GSLTTPP  E V W V++   SV+ +QV   R    + 
Sbjct: 172 ADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNG 231

Query: 756 ESK------TNARPLQTINDRFVK 809
           E +       N RP Q + +R +K
Sbjct: 232 EGEPEELMVDNWRPAQPLKNRQIK 255



>gb:AY125007_2513955 Lepisosteus osseus erythrocyte carbonic
           anhydrase mRNA, complete cds.
          Length = 261

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 78/272 (28%), Positives = 122/272 (44%), Gaps = 40/272 (14%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL---------ESKP--VVY---SN 251
           WG++    ++ GP  W E  P     + G  Q+PID+         + KP  +VY   ++
Sbjct: 5   WGYA----ANNGPDKWHEKFP----IAQGPRQSPIDIVPSQAQHDPDLKPLRIVYDPSTS 56

Query: 252 LGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP------SEHV 413
            G + N +   V   + +    +   P       I+G+ Y  RQ H+H+       SEH 
Sbjct: 57  KGILNNGHSFQVDFADENDSSTLQGGP-------ISGV-YRLRQFHFHWGASDERGSEHT 108

Query: 414 VNGTRYDLEAHLVHVSNDGR-------------IAVLAVMYQIGETPNPILSLIEDDLKK 554
           V G +Y  E HLVH  N G+             +AV+ V  +IG   +P L  + D L  
Sbjct: 109 VGGVKYAAELHLVHW-NAGKYASFGDAAKAPDGLAVVGVFLKIGAA-SPNLQKVLDALDA 166

Query: 555 LAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVAL 734
           + +T G +      DP +L      ++ Y GSLTTPP  E V W V++   +V+ +Q+A 
Sbjct: 167 I-KTKGKQTPFPQFDPKILLPSSLDFWTYEGSLTTPPLLESVTWIVLKEPITVSSEQMAK 225

Query: 735 IRNAIHD-ESKT------NARPLQTINDRFVK 809
            R+ +   E +T      N RP Q +  R V+
Sbjct: 226 FRSLLFTAEGETACCMVDNYRPPQPLKGRKVR 257



>pir|S12579|S12579 carbonate dehydratase (EC 4.2.1.1), hepatic -
           mouse>gb:MMCARBAN_2114405 Mouse mRNA for carbonic
           anhydrase.
          Length = 298

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 67/231 (29%), Positives = 99/231 (42%), Gaps = 30/231 (12%)
 Frame = +3

Query: 198 GKMQTPIDLESKPVVYS-NLGPIQ-NYYMRDVATLENHGYGMMLSWPLGQRYLGING--- 362
           G  Q+PI+++ K  VY   L P++ +Y       L N GY   + +       GI+G   
Sbjct: 55  GTRQSPINIQWKDSVYDPQLAPLRVSYDAASCRYLWNTGYFFQVEFDDSCEDSGISGGPL 114

Query: 363 -IRYLFRQVHWHFP------SEHVVNGTRYDLEAHLVHVSN-----------DGRIAVLA 488
              Y  +Q H+H+       SEH V+G  Y  E HL   S            +  +AV+ 
Sbjct: 115 GNHYRLKQFHFHWGATDEWGSEHAVDGHTYPAELHLFMNSTKYENYKKASVGENGLAVIG 174

Query: 489 VMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPC 668
           V  ++G     +  L+  D+         +  +G  DP+ L    R Y+ Y GSLTTPP 
Sbjct: 175 VFLKLGAHHQALQKLV--DVLPEVRHKDTQVAMGPFDPSCLLPACRDYWTYPGSLTTPPL 232

Query: 669 TEGVVWTVIRTIRSVTKQQVALIRNAI-------HDESKTNARPLQTINDR 800
            E V W V +T   V+  Q++  R  +        D    N RPLQ + DR
Sbjct: 233 AESVTWIVQKTPVEVSPSQLSTFRTLLFSGRGEEEDVMVNNYRPLQPLRDR 283



>pir|A01142|CRRB2 carbonate dehydratase (EC 4.2.1.1) II - rabbit
           (tentative sequence)
          Length = 259

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 69/262 (26%), Positives = 109/262 (41%), Gaps = 30/262 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQNYYMRDVA 290
           WG+        GP HW +  P     + G+ Q+PID+++    +  +L P++  Y   ++
Sbjct: 4   WGYG----KHNGPEHWHKDFP----IADGERQSPIDIDTDAAKHDPSLKPLRVSYEHPIS 55

Query: 291 TL---ENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP--------SEHVVNGTRYDL 437
                  H + +       +  L    +   +R + +HF         SEH VN  +Y  
Sbjct: 56  RRIINNGHSFNVEFDDSHDKSVLKEGPLEGTYRLIQFHFHWGSSDGEGSEHTVNKKKYAA 115

Query: 438 EAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG 584
           E HLVH           V +   +AVL +  +IG    P L  + D L  + +T G    
Sbjct: 116 ELHLVHWNTKYGDFGKAVKHPDGLAVLGIFLKIGSA-TPGLQKVVDTLSSI-KTKGKSVD 173

Query: 585 IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK 764
               DP  L      Y+ Y GSLTTPP  + V W V++   +V+ +Q+   RN   ++  
Sbjct: 174 FTNFDPRGLLPESLDYWTYPGSLTTPPLLQCVTWIVLKEPITVSSEQMLKFRNLNFNKEA 233

Query: 765 -------TNARPLQTINDRFVK 809
                   N RP Q +  R VK
Sbjct: 234 EPEEPMVDNWRPTQPLKGRQVK 255



>gb:BT009901_2151289 Synthetic construct Homo sapiens carbonic
           anhydrase XI mRNA, partial cds.
          Length = 329

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 72/287 (25%), Positives = 120/287 (41%), Gaps = 41/287 (14%)
 Frame = +3

Query: 72  SVTHVIKSQEVDDEWGF--SYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY 245
           +  H+  + + +D W +  +   N   GP  WG +   W  C+ GK Q+P+D+E K V+Y
Sbjct: 21  AAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLY 80

Query: 246 SNLGP---IQNYYMRDVATLENHGYGMMLSWPLGQRYLGING-----------IRYLFRQ 383
               P   +     +   TL N G  +    P  +  + ++G           +R LF  
Sbjct: 81  DPFLPPLRLSTGGEKLRGTLYNTGRHVSFL-PAPRPVVNVSGGPLLYSHRLSELRLLFG- 138

Query: 384 VHWHFPSEHVVNGTRYDLEAHLVHVSND------------GRIAVLAVMYQIGETPNPIL 527
                 SEH +N   +  E  L+H + +              +A+L++   +  T NP L
Sbjct: 139 ARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFL 198

Query: 528 S--LIEDDLKKLAETPGVKKGIGY----LDPNLLQARGRRYYRYMGSLTTPPCTEGVVWT 689
           S  L  D + +++      K   Y    L   LL      +  Y GSL+TPPC+E V W 
Sbjct: 199 SRLLNRDTITRISY-----KNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWI 253

Query: 690 VIRTIRSVTKQQVALIR-------NAIHDESKTNARPLQTINDRFVK 809
           +I    ++T  Q+  +R       + I      N+RPLQ +  R ++
Sbjct: 254 LIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALR 300



>gb:RPA439711_1396461 Riftia pachyptila mRNA for carbonic anhydrase
           (ca1 gene).
          Length = 243

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 72/228 (31%), Positives = 98/228 (42%), Gaps = 21/228 (9%)
 Frame = +3

Query: 120 FSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGP-IQNYYMRDVATL 296
           + Y+ N   GP+ W +  P     +AGK Q+PID++   V   +    + +Y      TL
Sbjct: 4   WDYEAN---GPATWAKSFP----LAAGKKQSPIDIDPASVSKKSTSALVASYNPAASNTL 56

Query: 297 ENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP------SEHVVNGTRYDLEAHLVH- 455
            N G    +S   G    G  G  Y     H+H+       SEH V G  Y  EAH+VH 
Sbjct: 57  TNTGLSFQVSVD-GTLSGGPLGNEYKAASFHFHWSKTSAEGSEHTVAGKAYAAEAHIVHY 115

Query: 456 -----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI--GYL 596
                      V  D  +AVLA   Q G T   +  +I  DL     T G    I  G+ 
Sbjct: 116 NAAKYASFQDAVKADDGLAVLATFIQPGATNAGVQKII--DLLPSVPTKGDTATIPGGFD 173

Query: 597 DPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIR 740
              LL     +Y+ Y GSLTTPPC E V W V +    + + Q+A +R
Sbjct: 174 VACLLPGDQSKYWYYPGSLTTPPCFESVTWIVYKDPIQLCENQLAALR 221



>pir|JE0375|JE0375 carbonic anhydrase-related protein -
           human>gb:AF067662_1880559 Homo sapiens carbonic
           anhydrase-related protein 2 (CARP2) mRNA, complete cds.
          Length = 328

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 72/287 (25%), Positives = 120/287 (41%), Gaps = 41/287 (14%)
 Frame = +3

Query: 72  SVTHVIKSQEVDDEWGF--SYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY 245
           +  H+  + + +D W +  +   N   GP  WG +   W  C+ GK Q+P+D+E K V+Y
Sbjct: 21  AAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVEVKRVLY 80

Query: 246 SNLGP---IQNYYMRDVATLENHGYGMMLSWPLGQRYLGING-----------IRYLFRQ 383
               P   +     +   TL N G  +    P  +  + ++G           +R LF  
Sbjct: 81  DPFLPPLRLSTGGEKLRGTLYNTGRHVSFL-PAPRPVVNVSGGPLLYSHRLSELRLLFG- 138

Query: 384 VHWHFPSEHVVNGTRYDLEAHLVHVSND------------GRIAVLAVMYQIGETPNPIL 527
                 SEH +N   +  E  L+H + +              +A+L++   +  T NP L
Sbjct: 139 ARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFL 198

Query: 528 S--LIEDDLKKLAETPGVKKGIGY----LDPNLLQARGRRYYRYMGSLTTPPCTEGVVWT 689
           S  L  D + +++      K   Y    L   LL      +  Y GSL+TPPC+E V W 
Sbjct: 199 SRLLNRDTITRISY-----KNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWI 253

Query: 690 VIRTIRSVTKQQVALIR-------NAIHDESKTNARPLQTINDRFVK 809
           +I    ++T  Q+  +R       + I      N+RPLQ +  R ++
Sbjct: 254 LIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALR 300



>sp|O75493|CAHB_HUMAN Carbonic anhydrase-related protein 2 precursor
           (CARP-2) (CA-RP II) (CA-XI) (Carbonic anhydrase-related
           protein 11) (CARP XI) (CA-RP XI)
           (UNQ211/PRO237).>gb:AY358967_1947846 Homo sapiens clone
           DNA34353 CA11 (UNQ211) mRNA, complete
           cds.>gb:BC002662_1968299 Homo sapiens carbonic anhydrase
           XI, mRNA (cDNA clone MGC:3799 IMAGE:3613247), complete
           cds.>gb:BT007265_1990703 Homo sapiens carbonic anhydrase
           XI mRNA, complete cds.>gb:CR541772_1994000 Homo sapiens
           full open reading frame cDNA clone RZPDo834C0730D for
           gene CA11, carbonic anhydrase XI; complete cds, incl.
           stopcodon.
          Length = 328

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 72/287 (25%), Positives = 120/287 (41%), Gaps = 41/287 (14%)
 Frame = +3

Query: 72  SVTHVIKSQEVDDEWGF--SYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY 245
           +  H+  + + +D W +  +   N   GP  WG +   W  C+ GK Q+P+D+E K V+Y
Sbjct: 21  AAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLY 80

Query: 246 SNLGP---IQNYYMRDVATLENHGYGMMLSWPLGQRYLGING-----------IRYLFRQ 383
               P   +     +   TL N G  +    P  +  + ++G           +R LF  
Sbjct: 81  DPFLPPLRLSTGGEKLRGTLYNTGRHVSFL-PAPRPVVNVSGGPLLYSHRLSELRLLFG- 138

Query: 384 VHWHFPSEHVVNGTRYDLEAHLVHVSND------------GRIAVLAVMYQIGETPNPIL 527
                 SEH +N   +  E  L+H + +              +A+L++   +  T NP L
Sbjct: 139 ARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFL 198

Query: 528 S--LIEDDLKKLAETPGVKKGIGY----LDPNLLQARGRRYYRYMGSLTTPPCTEGVVWT 689
           S  L  D + +++      K   Y    L   LL      +  Y GSL+TPPC+E V W 
Sbjct: 199 SRLLNRDTITRISY-----KNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWI 253

Query: 690 VIRTIRSVTKQQVALIR-------NAIHDESKTNARPLQTINDRFVK 809
           +I    ++T  Q+  +R       + I      N+RPLQ +  R ++
Sbjct: 254 LIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALR 300



>gb:AF541981_1809975 Dunaliella salina strain UTEX 1644 duplicated
           carbonic anhydrase (DCA1) gene, complete cds.
          Length = 555

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 58/164 (35%), Positives = 80/164 (48%), Gaps = 18/164 (10%)
 Frame = +3

Query: 354 INGIRYLFR--QVHWH-FPSEHVVNGTRYDLEAHLV---HVSNDGRIAVLAVMYQIGETP 515
           I+G   LF+  Q+H+H F SEH +NG  Y LEAHLV      N  ++AVL +MYQ GE P
Sbjct: 129 IDGSDMLFKPVQLHFHHFLSEHAINGAHYPLEAHLVMGDASGNTNQLAVLGIMYQYGEQP 188

Query: 516 NPILSLIE----DDLKKLAETPGVKKGIGYLDPNL----LQARGRRYYRYMGSLTTPPCT 671
           +  +  ++    D++       G    +  L  N+    L      Y  Y GSLTTPPC 
Sbjct: 189 DDFVRRLQTKTIDEIATNGAGYGETVNVTDLSVNIMKDVLPPTHHNYVGYDGSLTTPPCD 248

Query: 672 EGVVWTVIRTIRSVTKQQ----VALIRNAIHDESKTNARPLQTI 791
           E V W V    R++T  Q    + + +    D   TN R +Q I
Sbjct: 249 ERVKWHVFTEPRTITTGQLEKFLMITKRGHTDAIVTNNRIVQPI 292



 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 70/227 (30%), Positives = 102/227 (44%), Gaps = 25/227 (11%)
 Frame = +3

Query: 195  AGKMQTPI-----DLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYL--- 350
            AG  Q+PI     DL+   V   +L  +++          N    M +S+      L   
Sbjct: 324  AGDRQSPINIDTTDLQPGAVSGISLNGLESQSFTFTDAYVNLEQDMKVSFTAPTNNLPTV 383

Query: 351  GINGIRYLFR--QVHWH-FPSEHVVNGTRYDLEAHLVHVS---NDGRIAVLAVMYQIGET 512
             I+G    FR  Q+H+H F SEH V+G  Y LEAHLV  S   N  ++AV+A+ YQ G  
Sbjct: 384  NIDGNDESFRPIQLHFHHFSSEHTVDGMIYPLEAHLVMASQAENSNQLAVIAIFYQYGSE 443

Query: 513  PNPILSLIEDDLKKLAETPGVKKGIGYLDPNL-------LQARGRRYYRYMGSLTTPPCT 671
             +  L+ +  +    A+      G   +  NL       L      ++ Y GSLTTPPC 
Sbjct: 444  ADDFLTRLHTEAIS-AQQGNANWGDNNVPINLPITFATDLMPSSTEHWAYEGSLTTPPCD 502

Query: 672  EGVVWTVIRTIRSVTKQQVALIR----NAIHDESKTNARPLQTINDR 800
            E V W V++  R+ T +Q+   +    NA +     N R +Q  N R
Sbjct: 503  ERVRWIVMKEPRTTTAEQMETFKTATVNAHYAAEIANNRAIQERNSR 549



>gb:AF183939_1775001 Dunaliella salina duplicated carbonic anhydrase
           (DCA1) mRNA, complete cds.
          Length = 555

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 58/164 (35%), Positives = 80/164 (48%), Gaps = 18/164 (10%)
 Frame = +3

Query: 354 INGIRYLFR--QVHWH-FPSEHVVNGTRYDLEAHLV---HVSNDGRIAVLAVMYQIGETP 515
           I+G   LF+  Q+H+H F SEH +NG  Y LEAHLV      N  ++AVL +MYQ GE P
Sbjct: 129 IDGSDMLFKPVQLHFHHFLSEHAINGAHYPLEAHLVMGDASGNTNQLAVLGIMYQYGEQP 188

Query: 516 NPILSLIE----DDLKKLAETPGVKKGIGYLDPNL----LQARGRRYYRYMGSLTTPPCT 671
           +  +  ++    D++       G    +  L  N+    L      Y  Y GSLTTPPC 
Sbjct: 189 DDFVRRLQTKTIDEIATNGAGYGETVNVTDLSVNIMKDVLPPTHHNYVGYDGSLTTPPCD 248

Query: 672 EGVVWTVIRTIRSVTKQQ----VALIRNAIHDESKTNARPLQTI 791
           E V W V    R++T  Q    + + +    D   TN R +Q I
Sbjct: 249 ERVKWHVFTEPRTITTGQLEKFLMITKRGHTDAIVTNNRIVQPI 292



 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 70/227 (30%), Positives = 102/227 (44%), Gaps = 25/227 (11%)
 Frame = +3

Query: 195  AGKMQTPI-----DLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYL--- 350
            AG  Q+PI     DL+   V   +L  +++          N    M +S+      L   
Sbjct: 324  AGDRQSPINIDTTDLQPGAVSGISLNGLESQSFTFTDAYVNLEQDMKVSFTAPTNNLPTV 383

Query: 351  GINGIRYLFR--QVHWH-FPSEHVVNGTRYDLEAHLVHVS---NDGRIAVLAVMYQIGET 512
             I+G    FR  Q+H+H F SEH V+G  Y LEAHLV  S   N  ++AV+A+ YQ G  
Sbjct: 384  NIDGNDESFRPIQLHFHHFSSEHTVDGMIYPLEAHLVMASQAENSNQLAVIAIFYQYGSE 443

Query: 513  PNPILSLIEDDLKKLAETPGVKKGIGYLDPNL-------LQARGRRYYRYMGSLTTPPCT 671
             +  L+ +  +    A+      G   +  NL       L      ++ Y GSLTTPPC 
Sbjct: 444  ADDFLTRLHTEAIS-AQQGNANWGDNNVPINLPITFATDLMPSSTEHWAYEGSLTTPPCD 502

Query: 672  EGVVWTVIRTIRSVTKQQVALIR----NAIHDESKTNARPLQTINDR 800
            E V W V++  R+ T +Q+   +    NA +     N R +Q  N R
Sbjct: 503  ERVRWIVMKEPRTTTAEQMETFKTATVNAHYAAEIVNNRAIQERNSR 549



>gb:AE014134_1129089 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003641_1219196 Drosophila melanogaster
           chromosome 2L, section 50 of 83 of the complete
           sequence.>gb:AY058327_1291481 Drosophila melanogaster
           GH09688 full length cDNA.>gb:DROSADH01_1382697
           Drosophila melanogaster, chromosome 2L, region 34C4-36A7
           (Adh region), section 1 of 10 of the complete sequence.
          Length = 270

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 70/246 (28%), Positives = 108/246 (43%), Gaps = 36/246 (14%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL---ESKPVVYSNLGPIQ-NYYMR 281
           WG++     + GP+HW +  P+    ++G  Q+P+D+    +K     N+ P++  Y   
Sbjct: 5   WGYT----EENGPAHWAKEYPQ----ASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPE 56

Query: 282 DVATLENHGY----------GMMLSWPLGQRYLGINGIRYLFRQVHWHFP------SEHV 413
              +L N GY            +   PLG +        +   Q H H+       SEH 
Sbjct: 57  HTKSLVNPGYCWRVDVNGADSELTGGPLGDQI-------FKLEQFHCHWGCTDSKGSEHT 109

Query: 414 VNGTRYDLEAHLVH-------------VSNDGRIAVLAVMYQIGETP---NPILSLIEDD 545
           V+G  Y  E HLVH              + DG +AVL V  + G      + + SL++  
Sbjct: 110 VDGVSYSGELHLVHWNTTKYKSFGEAAAAPDG-LAVLGVFLKAGNHHAELDKVTSLLQFV 168

Query: 546 LKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQ 725
           L K  +   + +G    DP  L      Y+ Y GSLTTPPC+E V+W V +T   V+  Q
Sbjct: 169 LHK-GDRVTLPQGC---DPGQLLPDVHTYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQ 224

Query: 726 VALIRN 743
           +  +RN
Sbjct: 225 LNAMRN 230



>gb:CR860631_1184690 Pongo pygmaeus mRNA; cDNA DKFZp459D0724 (from
           clone DKFZp459D0724).
          Length = 328

 Score = 77.4 bits (189), Expect = 6e-13
 Identities = 72/287 (25%), Positives = 120/287 (41%), Gaps = 41/287 (14%)
 Frame = +3

Query: 72  SVTHVIKSQEVDDEWGF--SYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY 245
           +  H+  + + +D W +  +   N   GP  WG +   W  C+ GK Q+P+D+E K V+Y
Sbjct: 21  AAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLY 80

Query: 246 SNLGP---IQNYYMRDVATLENHGYGMMLSWPLGQRYLGING-----------IRYLFRQ 383
               P   +     +   TL N G  +    P  +  + ++G           +R LF  
Sbjct: 81  DPFLPPLRLSTGGEKLRGTLYNTGRHVSFL-PAPRPVVNVSGGPLLYSHRLSELRLLFG- 138

Query: 384 VHWHFPSEHVVNGTRYDLEAHLVHVSND------------GRIAVLAVMYQIGETPNPIL 527
                 SEH +N   +  E  L+H + +              +A+L++   +  T NP L
Sbjct: 139 ARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFL 198

Query: 528 S--LIEDDLKKLAETPGVKKGIGY----LDPNLLQARGRRYYRYMGSLTTPPCTEGVVWT 689
           S  L  D + +++      K   Y    L   LL      +  Y GSL+TPPC+E V W 
Sbjct: 199 SRLLNRDTITRISY-----KNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWI 253

Query: 690 VIRTIRSVTKQQVALIR-------NAIHDESKTNARPLQTINDRFVK 809
           +I    ++T  Q+  +R       + I      N+RPLQ +  R ++
Sbjct: 254 LIDRALNITSLQMHSLRLLSQNPPSQIFRSLSGNSRPLQPLAHRALR 300



>gb:AY075025_2075854 Rattus norvegicus carbonic anhydrase-related XI
           protein mRNA, complete cds.>gb:BC086972_2109880 Rattus
           norvegicus carbonic anhydrase-related XI protein, mRNA
           (cDNA clone MGC:93050 IMAGE:7190978), complete cds.
          Length = 328

 Score = 77.0 bits (188), Expect = 7e-13
 Identities = 74/289 (25%), Positives = 120/289 (41%), Gaps = 43/289 (14%)
 Frame = +3

Query: 72  SVTHVIKSQEVDDEWGFSYDENSDR----GPSHWGELRPEWWQCSAGKMQTPIDLESKPV 239
           +  H+  + + +D W  SY EN       GP  WG +   W  C+ GK Q+P+D+E K V
Sbjct: 21  AAAHIGPAPDPEDWW--SYKENLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRV 78

Query: 240 VYSNLGP---IQNYYMRDVATLENHGYGMMLSWPLGQRYLGING-----------IRYLF 377
           +Y    P   +     +   TL N G  +    P  +  + ++G           +R LF
Sbjct: 79  LYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFL-PASRPVVNVSGGPLLYSHRLSELRLLF 137

Query: 378 RQVHWHFPSEHVVNGTRYDLEAHLVHVSND------------GRIAVLAVMYQIGETPNP 521
                   SEH +N   +  E  L+H + +              +A+L++   +  + NP
Sbjct: 138 G-ARDGAGSEHQINHQGFSAEVQLIHFNQELYGNLSAASRGPNGLAILSLFVNVAGSSNP 196

Query: 522 ILS--LIEDDLKKLAETPGVKKGIGY----LDPNLLQARGRRYYRYMGSLTTPPCTEGVV 683
            LS  L  D + +++      K   Y    L   LL      +  Y GSL+TPPC+E V 
Sbjct: 197 FLSRLLNRDTITRISY-----KNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVT 251

Query: 684 WTVIRTIRSVTKQQVALIR-------NAIHDESKTNARPLQTINDRFVK 809
           W +I    ++T  Q+  +R       + I      N RPLQ +  R ++
Sbjct: 252 WILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNGRPLQPLAHRALR 300



>sp|O70354|CAHB_MOUSE Carbonic anhydrase-related protein 2 precursor
           (CARP-2) (CA-RP II) (CA-XI) (Carbonic anhydrase-related
           protein 11) (CARP XI) (CA-RP XI).>gb:AB079601_2047670
           Mus musculus m CA-RP XI mRNA for carbonic
           anhydrase-related protein XI, complete
           cds.>gb:AY075026_2075855 Mus musculus carbonic
           anhydrase-related 11 protein mRNA, complete
           cds.>gb:BC019393_2092882 Mus musculus carbonic anhydrase
           11, mRNA (cDNA clone MGC:25553 IMAGE:3968862), complete
           cds.
          Length = 328

 Score = 77.0 bits (188), Expect = 7e-13
 Identities = 74/289 (25%), Positives = 120/289 (41%), Gaps = 43/289 (14%)
 Frame = +3

Query: 72  SVTHVIKSQEVDDEWGFSYDENSDR----GPSHWGELRPEWWQCSAGKMQTPIDLESKPV 239
           +  H+  + + +D W  SY EN       GP  WG +   W  C+ GK Q+P+D+E K V
Sbjct: 21  AAAHIGPAPDPEDWW--SYKENLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRV 78

Query: 240 VYSNLGP---IQNYYMRDVATLENHGYGMMLSWPLGQRYLGING-----------IRYLF 377
           +Y    P   +     +   TL N G  +    P  +  + ++G           +R LF
Sbjct: 79  LYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFL-PASRPVVNVSGGPLLYSHRLSELRLLF 137

Query: 378 RQVHWHFPSEHVVNGTRYDLEAHLVHVSND------------GRIAVLAVMYQIGETPNP 521
                   SEH +N   +  E  L+H + +              +A+L++   +  + NP
Sbjct: 138 G-ARDGAGSEHQINHEGFSAEVQLIHFNQELYGNLSAASRGPNGLAILSLFVNVAGSSNP 196

Query: 522 ILS--LIEDDLKKLAETPGVKKGIGY----LDPNLLQARGRRYYRYMGSLTTPPCTEGVV 683
            LS  L  D + +++      K   Y    L   LL      +  Y GSL+TPPC+E V 
Sbjct: 197 FLSRLLNRDTITRISY-----KNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVT 251

Query: 684 WTVIRTIRSVTKQQVALIR-------NAIHDESKTNARPLQTINDRFVK 809
           W +I    ++T  Q+  +R       + I      N RPLQ +  R ++
Sbjct: 252 WILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNGRPLQPLAHRALR 300



>sp|P43165|CAH5_RAT Carbonic anhydrase VA, mitochondrial precursor
           (EC 4.2.1.1) (Carbonate dehydratase VA)
           (CA-VA).>pir|I59261|I59261 carbonate dehydratase (EC
           4.2.1.1) V - rat>gb:BC088147_2110349 Rattus norvegicus
           carbonic anhydrase 5, mRNA (cDNA clone MGC:108708
           IMAGE:7323596), complete cds.>gb:RNU12268_2136865 Rattus
           norvegicus carbonic anhydrase V mRNA, complete cds.
          Length = 304

 Score = 77.0 bits (188), Expect = 7e-13
 Identities = 67/235 (28%), Positives = 102/235 (43%), Gaps = 31/235 (13%)
 Frame = +3

Query: 198 GKMQTPIDLESKPVVYS-NLGPIQ-NYYMRDVATLENHGYGMMLSWPLGQRYLGING--- 362
           G  Q+PI+++    VY   L P++ +Y       L N GY   + +       GI+G   
Sbjct: 60  GTQQSPINIQWTDSVYDPKLAPLRVSYDAASCRYLWNTGYFFQVEFDDSCEESGISGGPL 119

Query: 363 -IRYLFRQVHWHFP------SEHVVNGTRYDLEAHLVH------------VSNDGRIAVL 485
              Y  +Q H+H+       SEH+V+G  Y  E HLVH             + +  +AV+
Sbjct: 120 GNHYRLKQFHFHWGATDEWGSEHMVDGHAYPAELHLVHWNSMKYENYKKATTGENGLAVI 179

Query: 486 AVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPP 665
            V  ++G     +  L+  D+         +  +G  DP+ L    R Y+ Y GSLTTPP
Sbjct: 180 GVFLKLGAHHEALQRLV--DILPEVRHKDTQVTMGPFDPSCLLPACRDYWTYPGSLTTPP 237

Query: 666 CTEGVVWTVIRTIRSVTKQQVALIRNAI-----HDES--KTNARPLQTINDRFVK 809
             E V W V +    V+  Q++  R  +      DE     N RPLQ +  R V+
Sbjct: 238 LAESVTWIVHKMPIEVSPSQLSTFRTLLFSGRGEDEEVMVNNFRPLQPLRGRNVR 292



>sp|P35218|CAH5_HUMAN Carbonic anhydrase VA, mitochondrial precursor
           (EC 4.2.1.1) (Carbonate dehydratase VA)
           (CA-VA).>pir|A47745|CRHU5 carbonate dehydratase (EC
           4.2.1.1) V precursor [validated] -
           human>gb:HSU25134_2022974 Human carbonic anhydrase V
           (CA-V) gene, nuclear gene encoding mitochondrial
           protein, complete cds.>gb:HUMCARBANH_2029850 Human
           nuclear-encoded mitochondrial carbonic anhydrase (CA5)
           mRNA, complete cds.>gb:S80175S7_2041900 CA V=carbonic
           anhydrase V [human, lung fibroblast, Genomic/mRNA, 421
           nt, segment 7 of 7].
          Length = 305

 Score = 77.0 bits (188), Expect = 7e-13
 Identities = 72/265 (27%), Positives = 110/265 (41%), Gaps = 46/265 (17%)
 Frame = +3

Query: 150 PSHWGELRPEWWQCS---------------AGKMQTPIDLESKPVVYS-NLGPIQ-NYYM 278
           P  W   R   WQ S                G  Q+PI+++ +  VY   L P++ +Y  
Sbjct: 30  PGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEA 89

Query: 279 RDVATLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWHFP------SEHVVNGTR 428
                + N GY   + +       GI+G      Y  +Q H+H+       SEH V+G  
Sbjct: 90  ASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHA 149

Query: 429 YDLEAHLVH------------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG 572
           Y  E HLVH            V  +  +AV+ V  ++G     +  L+  D+    +   
Sbjct: 150 YPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLV--DILPEIKHKD 207

Query: 573 VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIR---- 740
            +  +   DP+ L      Y+ Y GSLTTPP TE V W + +    V   Q++  R    
Sbjct: 208 ARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLF 267

Query: 741 NAIHDESK---TNARPLQTINDRFV 806
           +A+ +E K    N RPLQ + +R V
Sbjct: 268 SALGEEEKMMVNNYRPLQPLMNRKV 292



>sp|Q92051|CAHZ_BRARE Carbonic anhydrase (EC 4.2.1.1) (Carbonate
           dehydratase).>pir|T08463|T08463 carbonate dehydratase
           (EC 4.2.1.1) - zebra fish>gb:BC065611_2554060 Danio
           rerio carbonic anhydrase, mRNA (cDNA clone MGC:77128
           IMAGE:6960975), complete cds.>gb:DRU55177_2571335 Danio
           rerio carbonic anhydrase homolog CAH-Z mRNA, complete
           cds.
          Length = 260

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 79/265 (29%), Positives = 116/265 (43%), Gaps = 33/265 (12%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQNYYMRDVA 290
           WG+   +    GP  W E  P     + G  Q+PID+      +  +L  ++  Y  D A
Sbjct: 5   WGYGPAD----GPESWAESFP----IANGPRQSPIDIVPTQAQHDPSLKHLKLKY--DPA 54

Query: 291 TLE---NHGYGMMLSW---PLGQRYLG--INGIRYLFRQVHWHFPS------EHVVNGTR 428
           T +   N+G+   + +          G  I GI Y  RQ H+H+ S      EH + GT+
Sbjct: 55  TTKSILNNGHSFQVDFVDDDNSSTLAGGPITGI-YRLRQFHFHWGSSDDKGSEHTIAGTK 113

Query: 429 YDLEAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV 575
           +  E HLVH            S    +AV+ V  +IG   NP L  + D L  + ++ G 
Sbjct: 114 FPCELHLVHWNTKYPNFGEAASKPDGLAVVGVFLKIGAA-NPRLQKVLDALDDI-KSKGR 171

Query: 576 KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI-H 752
           +      DP  L      Y+ Y GSLTTPP  E V W V++   SV+  Q+A  R+ +  
Sbjct: 172 QTTFANFDPKTLLPASLDYWTYEGSLTTPPLLESVTWIVLKEPISVSPAQMAKFRSLLFS 231

Query: 753 DESKT------NARPLQTINDRFVK 809
            E +T      N RP Q +  R V+
Sbjct: 232 SEGETPCCMVDNYRPPQPLKGRKVR 256



>gb:AB018195_1864894 Homo sapiens ca xi mRNA for carbonic
           anhydrase-related protein XI, complete cds.
          Length = 328

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 73/278 (26%), Positives = 116/278 (41%), Gaps = 43/278 (15%)
 Frame = +3

Query: 105 DDEWGFSYDENSDR----GPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGP---I 263
           D E  +SY +N       GP  WG +   W  C+ GK Q+P+D+E K V+Y    P   +
Sbjct: 30  DPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLRL 89

Query: 264 QNYYMRDVATLENHGYGMMLSWPLGQRYLGING-----------IRYLFRQVHWHFPSEH 410
                +   TL N G  +    P  +  + ++G           +R LF        SEH
Sbjct: 90  STGGEKLRGTLYNTGRHVSFL-PAPRPVVNVSGGPLLYSHRLSELRLLFG-ARDGAGSEH 147

Query: 411 VVNGTRYDLEAHLVHVSND------------GRIAVLAVMYQIGETPNPILS--LIEDDL 548
            +N   +  E  L+H + +              +A+L++   +  T NP LS  L  D +
Sbjct: 148 QINHQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRDTI 207

Query: 549 KKLAETPGVKKGIGY----LDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVT 716
            +++      K   Y    L   LL      +  Y GSL+TPPC+E V W +I    ++T
Sbjct: 208 TRISY-----KNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNIT 262

Query: 717 KQQVALIR-------NAIHDESKTNARPLQTINDRFVK 809
             Q+  +R       + I      N+RPLQ +  R ++
Sbjct: 263 SLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALR 300



>gb:BC059693_2552665 Danio rerio carbonic anhydrase VII, mRNA (cDNA
           clone MGC:73385 IMAGE:4201504), complete cds.
          Length = 263

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 72/265 (27%), Positives = 114/265 (43%), Gaps = 33/265 (12%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQNYYMRDVA 290
           WG+      D GPS W +  P     + G  Q+PID+     V+ S L PI   Y    +
Sbjct: 6   WGYG----EDNGPSAWHKDYP----IAEGNRQSPIDIVPSEAVFDSKLSPISLSYNNCTS 57

Query: 291 -TLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWHFPS------EHVVNGTRYDL 437
            ++ N+G+ +++ +        I G      Y  +Q H+H+ S      EH V G  +  
Sbjct: 58  LSISNNGHSVVVEFVDTDERSVITGGPLENMYRLKQFHFHWGSKGCCGSEHTVAGKTFVS 117

Query: 438 EAHLVH-------------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
           E HLVH              + DG +AVL +  + G+  +  L  I D L  +     + 
Sbjct: 118 ELHLVHWNANKYKSFSEAAAAPDG-LAVLGIFLETGDE-HRALHQITDALYMVRFKGSLA 175

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI--- 749
           +  G+ +P  L      Y+ Y GSLTTPP  E V W V++    V+++Q+   R  +   
Sbjct: 176 EFKGF-NPKCLLPNSLEYWTYPGSLTTPPLYESVTWIVLKEPIYVSEKQMGKFRTLLFNG 234

Query: 750 -----HDESKTNARPLQTINDRFVK 809
                 +  + N RP Q +  R V+
Sbjct: 235 EEEEDRNRMENNYRPPQPLKGRMVR 259



>gb:BC049309_2550167 Danio rerio carbonic anhydrase VII, mRNA (cDNA
           clone IMAGE:5604897), partial cds.
          Length = 306

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 72/265 (27%), Positives = 115/265 (43%), Gaps = 33/265 (12%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQNYYMRDVA 290
           WG+      D GPS W +  P     + G  Q+PID+     V+ + L PI   Y    +
Sbjct: 49  WGYG----EDNGPSAWHKDYP----IAEGNRQSPIDIVPSEAVFDAKLSPIALSYNNCTS 100

Query: 291 -TLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWHFPS------EHVVNGTRYDL 437
            ++ N+G+ +++ +        I G      Y  +Q H+H+ S      EH V G  +  
Sbjct: 101 LSISNNGHSVVVEFVDTDERSVITGGPLENMYRLKQFHFHWGSKGCCGSEHTVAGKTFVS 160

Query: 438 EAHLVH-------------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
           E HLVH             V+ DG +AVL +  + G+  +  L  I D L  +     + 
Sbjct: 161 ELHLVHWNANKYKSFSEAAVAPDG-LAVLGIFLETGDE-HRALHQITDALYMVRFKGSLA 218

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI--- 749
           +  G+ +P  L      Y+ Y GSLTTPP  E V W V++    V+++Q+   R  +   
Sbjct: 219 EFKGF-NPKCLLPNSLEYWTYPGSLTTPPLYESVTWIVLKEPIYVSEKQMGKFRTLLFNG 277

Query: 750 -----HDESKTNARPLQTINDRFVK 809
                 +  + N RP Q +  R V+
Sbjct: 278 EEEEDRNRMENNYRPPQPLKGRMVR 302



>gb:AB103091_1873559 Homo sapiens CA6 mRNA for carbonic anhydrase VI
           nirs variant 3, complete cds.
          Length = 248

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 54/171 (31%), Positives = 85/171 (49%), Gaps = 22/171 (12%)
 Frame = +3

Query: 309 YGMMLSWPLGQRYLGINGIRYLFRQVHWHFP--------SEHVVNGTRYDLEAHLVHVSN 464
           Y + +  P   R    +GI Y+ +Q+H+H+         SEH V+G R+ +E H+VH ++
Sbjct: 25  YSVQIGLPSTMRMTVADGIVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNS 84

Query: 465 ------------DGRIAVLAVMYQIGETP-NPILSLIEDDLKKLAETPGVKKGIGYLD-P 602
                       DG +AVLA   ++   P N   S     L  + + PG +  +  LD  
Sbjct: 85  KYKTYDIAQDAPDG-LAVLAAFVEVKNYPENTYYSNFISHLANI-KYPGQRTTLTGLDVQ 142

Query: 603 NLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD 755
           ++L    + YY Y GSLTTPPCTE V W V+     +++ QV  + N++ D
Sbjct: 143 DMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLD 193



>gb:RABCARANH_1443605 Rabbit carbonic anhydrase II mRNA, partial
           cds.
          Length = 232

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 61/222 (27%), Positives = 96/222 (43%), Gaps = 23/222 (10%)
 Frame = +3

Query: 147 GPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQNYYMRDVATL---ENHGYG 314
           GP HW +  P     + G+ Q+PID+++    +  +L P++  Y   ++       H + 
Sbjct: 5   GPEHWHKDFP----IANGERQSPIDIDTNAAKHDPSLKPLRVCYEHPISRRIINNGHSFN 60

Query: 315 MMLSWPLGQRYLGINGIRYLFRQVHWHFP--------SEHVVNGTRYDLEAHLVH----- 455
           +       +  L    +   +R + +HF         SEH VN  +Y  E HLVH     
Sbjct: 61  VEFDDSHDKTVLKEGPLEGTYRLIQFHFHWGSSDGQGSEHTVNKKKYAAELHLVHWNTKY 120

Query: 456 ------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQA 617
                 V +   +AVL +  +IG    P L  + D L  + +T G        DP  L  
Sbjct: 121 GDFGKAVKHPDGLAVLGIFLKIGSA-TPGLQKVVDTLSSI-KTKGKSVDFTDFDPRGLLP 178

Query: 618 RGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRN 743
               Y+ Y GSLTTPP  E V W V++   +V+ +Q+   RN
Sbjct: 179 ESLDYWTYPGSLTTPPLLECVTWIVLKEPITVSSEQMLKFRN 220



>gb:AK002333_1151128 Mus musculus adult male kidney cDNA, RIKEN
           full-length enriched library, clone:0610008G16
           product:carbonic anhydrase 2, full insert
           sequence.>gb:BC083984_2563393 Xenopus laevis
           hypothetical LOC494966, mRNA (cDNA clone MGC:98066
           IMAGE:7199403), complete cds.
          Length = 260

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 69/262 (26%), Positives = 111/262 (42%), Gaps = 30/262 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYYMRDVA 290
           WG+S       GP +W +  P     + G  Q+P+D+++    +   L P+   Y +  +
Sbjct: 5   WGYS----KHNGPENWHKDFP----IANGDRQSPVDIDTATAQHDPALQPLLISYDKAAS 56

Query: 291 -TLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWHFPS------EHVVNGTRYDL 437
            ++ N+G+   + +   Q    + G      Y   Q H+H+ S      EH VN  +Y  
Sbjct: 57  KSIVNNGHSFNVEFDDSQDNAVLKGGPLSDSYRLIQFHFHWGSSDGQGSEHTVNKKKYAA 116

Query: 438 EAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG 584
           E HLVH           V     +AVL +  +IG     +  ++E       +T G +  
Sbjct: 117 ELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKIGPASQGLQKVLE--ALHSIKTKGKRAA 174

Query: 585 IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES- 761
               DP  L      Y+ Y GSLTTPP  E V W V+R   +V+ +Q++  R    +E  
Sbjct: 175 FANFDPCSLLPGNLDYWTYPGSLTTPPLLECVTWIVLREPITVSSEQMSHFRTLNFNEEG 234

Query: 762 ------KTNARPLQTINDRFVK 809
                   N RP Q + +R +K
Sbjct: 235 DAEEAMVDNWRPAQPLKNRKIK 256



>gb:BC055291_2101959 Mus musculus carbonic anhydrase 2, mRNA (cDNA
           clone MGC:62540 IMAGE:6479187), complete cds.
          Length = 260

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 69/262 (26%), Positives = 111/262 (42%), Gaps = 30/262 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYYMRDVA 290
           WG+S       GP +W +  P     + G  Q+P+D+++    +   L P+   Y +  +
Sbjct: 5   WGYS----KHNGPENWHKDFP----IANGDRQSPVDIDTATAHHDPALQPLLISYDKAAS 56

Query: 291 -TLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWHFPS------EHVVNGTRYDL 437
            ++ N+G+   + +   Q    + G      Y   Q H+H+ S      EH VN  +Y  
Sbjct: 57  KSIVNNGHSFNVEFDDSQDNAVLKGGPLSDSYRLIQFHFHWGSSDGQGSEHTVNKKKYAA 116

Query: 438 EAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG 584
           E HLVH           V     +AVL +  +IG     +  ++E       +T G +  
Sbjct: 117 ELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKIGPASQGLQKVLE--ALHSIKTKGKRAA 174

Query: 585 IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES- 761
               DP  L      Y+ Y GSLTTPP  E V W V+R   +V+ +Q++  R    +E  
Sbjct: 175 FANFDPCSLLPGNLDYWTYPGSLTTPPLLECVTWIVLREPITVSSEQMSHFRTLNFNEEG 234

Query: 762 ------KTNARPLQTINDRFVK 809
                   N RP Q + +R +K
Sbjct: 235 DAEEAMVDNWRPAQPLKNRKIK 256



>gb:AF170175_1774247 Acetabularia acetabulum putative carbonic
           anhydrase 1 (CA1) gene, complete cds.
          Length = 315

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 62/168 (36%), Positives = 83/168 (49%), Gaps = 19/168 (11%)
 Frame = +3

Query: 354 INGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSND---------GRIAVLAVMYQ-- 500
           I  ++  F   H H  SEH+ NG    LE H V   +          G +AV+ V +Q  
Sbjct: 143 IEVVQARFINFHVHSVSEHMFNGFLAPLEGHFVMQIDQADLQSCPEAGCLAVVGVHFQHS 202

Query: 501 IGETPNPILSLIEDDLK----KLAETPGVK-KGIGYLDPNLLQARGRRYYRYMGSLTTPP 665
           I +TPN     I+D L+    K  +T G      G L+ + L      Y  Y GSLTTPP
Sbjct: 203 IDDTPN---QFIQDTLQLIGGKWPDTNGQSIPASGSLNFDQLVPHNPSYMLYSGSLTTPP 259

Query: 666 CTEGVVWTVIRTIRSVTKQQVALIRNAI---HDESKTNARPLQTINDR 800
           CTEGV+W VI+   +V+  QVA ++NAI    D    N R +Q IN+R
Sbjct: 260 CTEGVLWHVIQQPMTVSIAQVAELQNAIGFERDGLVRNNRRIQPINNR 307



>gb:AF170174_1774246 Acetabularia acetabulum putative carbonic
           anhydrase 1 (CA1) mRNA, complete cds.
          Length = 315

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 62/168 (36%), Positives = 83/168 (49%), Gaps = 19/168 (11%)
 Frame = +3

Query: 354 INGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSND---------GRIAVLAVMYQ-- 500
           I  ++  F   H H  SEH+ NG    LE H V   +          G +AV+ V +Q  
Sbjct: 143 IEVVQARFINFHVHSVSEHMFNGFLAPLEGHFVMQIDQADLQSCPEAGCLAVVGVHFQHS 202

Query: 501 IGETPNPILSLIEDDLK----KLAETPGVK-KGIGYLDPNLLQARGRRYYRYMGSLTTPP 665
           I +TPN     I+D L+    K  +T G      G L+ + L      Y  Y GSLTTPP
Sbjct: 203 IDDTPN---QFIQDTLQLIGGKWPDTNGQSIPASGSLNFDQLVPHNPSYMLYSGSLTTPP 259

Query: 666 CTEGVVWTVIRTIRSVTKQQVALIRNAI---HDESKTNARPLQTINDR 800
           CTEGV+W VI+   +V+  QVA ++NAI    D    N R +Q IN+R
Sbjct: 260 CTEGVLWHVIQQPMTVSIAQVAELQNAIGFERDGLVRNNRRIQPINNR 307



>gb:AY075024_1424713 Sus scrofa carbonic anhydrase-related XI
           protein mRNA, complete cds.
          Length = 331

 Score = 74.3 bits (181), Expect = 5e-12
 Identities = 70/287 (24%), Positives = 117/287 (40%), Gaps = 38/287 (13%)
 Frame = +3

Query: 63  LLLSVTHVIKSQEVDDEWGF--SYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKP 236
           +L +  H+  + + +D W +  +   N   GP  WG +   W  C+ GK Q+P+D+E K 
Sbjct: 18  VLGAAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKR 77

Query: 237 VVYSNLGP---IQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQ-------- 383
           V+Y    P   +     +   TL N G  +    P  +  + ++G   L+          
Sbjct: 78  VLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSF-LPAPRPVVNVSGGPLLYSHRLSELLLL 136

Query: 384 --VHWHFPSEHVVNGTRYDLEAHLVHVSND------------GRIAVLAV---MYQIGET 512
              H    SEH +N   +  E  L+H + +              +A+L++   + Q+   
Sbjct: 137 FGAHDGAGSEHQINHQGFSAEVQLIHFNQELYGNLSAASRGPNGLAILSLFVNVSQVAGN 196

Query: 513 PNPILS-LIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWT 689
            NP LS L+  D             +  L   LL      +  Y GSL+TPPC+E V W 
Sbjct: 197 SNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWI 256

Query: 690 VIRTIRSVTKQQVALIR-------NAIHDESKTNARPLQTINDRFVK 809
           +I    ++T  Q+  +R       + I      N RPLQ +  R ++
Sbjct: 257 LIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNGRPLQPLAHRALR 303



>gb:AY075023_1424712 Bos taurus carbonic anhydrase-related XI
           protein mRNA, complete cds.
          Length = 328

 Score = 74.3 bits (181), Expect = 5e-12
 Identities = 71/287 (24%), Positives = 118/287 (41%), Gaps = 41/287 (14%)
 Frame = +3

Query: 72  SVTHVIKSQEVDDEWGF--SYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY 245
           +  H+  + + +D W +  +   N   GP  WG +   W  C  GK Q+P+D+E K V+Y
Sbjct: 21  AAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCVVGKRQSPVDVELKRVLY 80

Query: 246 SNLGP---IQNYYMRDVATLENHGYGMMLSWPLGQRYLGING-----------IRYLFRQ 383
               P   +     +   TL N G  +    P  +  + ++G           +R LF  
Sbjct: 81  DPFLPPLRLSTGGEKLRGTLYNTGRHVSFL-PAPRPVVNVSGGPLLYSHRLSELRLLFG- 138

Query: 384 VHWHFPSEHVVNGTRYDLEAHLVHVSND------------GRIAVLAVMYQIGETPNPIL 527
                 SEH +N   +  E  L+H + +              +A+L++   +  + NP L
Sbjct: 139 ARDGAGSEHQINHQGFSAEVQLIHFNQELYGNLSAATRGPNGLAILSLFVNVAGSSNPFL 198

Query: 528 S--LIEDDLKKLAETPGVKKGIGY----LDPNLLQARGRRYYRYMGSLTTPPCTEGVVWT 689
           S  L  D + +++      K   Y    L   LL      +  Y GSL+TPPC+E V W 
Sbjct: 199 SRLLNRDTITRISY-----KNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWI 253

Query: 690 VIRTIRSVTKQQVALIR-------NAIHDESKTNARPLQTINDRFVK 809
           +I    ++T  Q+  +R       + I      N RPLQ +  R ++
Sbjct: 254 LIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNGRPLQPLAHRALR 300



>gb:AF140537_1244303 Anthopleura elegantissima carbonic anhydrase
           mRNA, complete cds.
          Length = 261

 Score = 74.3 bits (181), Expect = 5e-12
 Identities = 64/238 (26%), Positives = 105/238 (44%), Gaps = 27/238 (11%)
 Frame = +3

Query: 111 EWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQ----NYYM 278
           +WG+      + GPS W +  P     +AG  Q+PID+++    + +   I+     Y  
Sbjct: 5   KWGYG----PNNGPSKWAKDFP----AAAGARQSPIDIKTHDAQHDSALKIKPLKIQYSQ 56

Query: 279 RDVATLENHGYGMMLSWPLGQRYLGINGI---RYLFRQVHWHFP------SEHVVNGTRY 431
            +   + N+GY +++S    +      G     Y F Q H+H+       SEH+++G  +
Sbjct: 57  GNDFNVTNNGYSLVISRKTSEGTNLSGGPLEHNYRFEQFHFHWGKTSGSGSEHLLDGKAF 116

Query: 432 DLEAHLVHVSND------------GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV 575
             E HLVH + D              +AVL    QIG     + ++   DL    +  G 
Sbjct: 117 PAELHLVHWNTDLFSSFGEAASSKNGLAVLGAFVQIGGESAGLKTIT--DLIPQVQNIGD 174

Query: 576 KKG--IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRN 743
           K+   + +   +LL +    Y+ Y GSLTTPPC E V W V +     T+ Q+   R+
Sbjct: 175 KQDLKVPFNLSSLLPSNTNDYWTYSGSLTTPPCYESVSWFVFKEPIHATENQMQQFRS 232



>sp|Q95203|CAHB_SHEEP Carbonic anhydrase-related protein 2 precursor
           (CARP 2) (CA-RP II) (CA-XI).>gb:OACALP_1441499 Ovis
           aries mRNA for carbonic anhydrase-like protein.
          Length = 328

 Score = 74.3 bits (181), Expect = 5e-12
 Identities = 70/287 (24%), Positives = 119/287 (41%), Gaps = 41/287 (14%)
 Frame = +3

Query: 72  SVTHVIKSQEVDDEWGF--SYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY 245
           +  H+  + + +D W +  +   N   GP  WG +   W  C+ GK Q+P+D++ K V+Y
Sbjct: 21  AAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVDLKRVLY 80

Query: 246 SNLGP---IQNYYMRDVATLENHGYGMMLSWPLGQRYLGING-----------IRYLFRQ 383
               P   +     +   TL N G  +    P  +  + ++G           +R LF  
Sbjct: 81  DPFLPPLRLSTGGEKLRGTLYNTGRHVSFL-PAPRPVVNVSGGPLLYSHRLSELRLLFG- 138

Query: 384 VHWHFPSEHVVNGTRYDLEAHLVHVSND------------GRIAVLAVMYQIGETPNPIL 527
                 SEH +N   +  E  L+H + +              +A+L++   +  + NP L
Sbjct: 139 ARDGAGSEHQINHQGFSAEVQLIHFNQELYGNLSAATRGPNGLAILSLFVNVAGSSNPFL 198

Query: 528 S--LIEDDLKKLAETPGVKKGIGY----LDPNLLQARGRRYYRYMGSLTTPPCTEGVVWT 689
           S  L  D + +++      K   Y    L   LL      +  Y GSL+TPPC+E V W 
Sbjct: 199 SRLLNRDTITRISY-----KNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWI 253

Query: 690 VIRTIRSVTKQQVALIR-------NAIHDESKTNARPLQTINDRFVK 809
           +I    ++T  Q+  +R       + I      N RPLQ +  R ++
Sbjct: 254 LIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNGRPLQPLAHRALR 300



>gb:MUSCAIIN7_2125363 Mouse carbonic anhydrase II gene, exon 7.
          Length = 260

 Score = 73.9 bits (180), Expect = 6e-12
 Identities = 69/262 (26%), Positives = 110/262 (41%), Gaps = 30/262 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYYMRDVA 290
           WG+S       GP +W +  P     + G  Q+P+D+++    +   L P+   Y +  +
Sbjct: 5   WGYS----KHNGPENWHKDFP----IANGDRQSPVDIDTATAQHDPALQPLLISYDKAAS 56

Query: 291 -TLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWHFPS------EHVVNGTRYDL 437
            ++ N+G+   + +   Q    + G      Y   Q H+H+ S      EH VN  +Y  
Sbjct: 57  KSIVNNGHSFNVEFDDSQDNAVLKGGPLSDSYRLIQFHFHWGSSDGQGSEHTVNKKKYAA 116

Query: 438 EAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG 584
           E HLVH           V     +AVL    +IG     +  ++E       +T G +  
Sbjct: 117 ELHLVHWNTKYGDFGKAVQQPDGLAVLGYFLKIGPASQGLQKVLE--ALHSIKTKGKRAA 174

Query: 585 IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES- 761
               DP  L      Y+ Y GSLTTPP  E V W V+R   +V+ +Q++  R    +E  
Sbjct: 175 FANFDPCSLLPGNLDYWTYPGSLTTPPLLECVTWIVLRDPITVSSEQMSHFRTLNFNEEG 234

Query: 762 ------KTNARPLQTINDRFVK 809
                   N RP Q + +R +K
Sbjct: 235 DAEEAMVDNWRPAQPLKNRKIK 256



>pir|A23900|CRMS2 carbonate dehydratase (EC 4.2.1.1) II - mouse
          Length = 260

 Score = 73.9 bits (180), Expect = 6e-12
 Identities = 69/262 (26%), Positives = 110/262 (41%), Gaps = 30/262 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYYMRDVA 290
           WG+S       GP +W +  P     + G  Q+P+D+++    +   L P+   Y +  +
Sbjct: 5   WGYS----KHNGPENWHKDFP----IANGDRQSPVDIDTATAQHDPALQPLLISYDKAAS 56

Query: 291 -TLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWHFPS------EHVVNGTRYDL 437
            ++ N+G+   + +   Q    + G      Y   Q H+H+ S      EH VN  +Y  
Sbjct: 57  KSIVNNGHSFNVEFDDSQDNAVLKGGPLSDSYRLIQFHFHWGSSDGQGSEHTVNKKKYAA 116

Query: 438 EAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG 584
           E HLVH           V     +AVL    +IG     +  ++E       +T G +  
Sbjct: 117 ELHLVHWNTKYGDFGKAVQQPDGLAVLGYFLKIGPASQGLQKVLE--ALHSIKTKGKRAA 174

Query: 585 IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES- 761
               DP  L      Y+ Y GSLTTPP  E V W V+R   +V+ +Q++  R    +E  
Sbjct: 175 FANFDPCSLLPGNLDYWTYPGSLTTPPLLECVTWIVLREPITVSSEQMSHFRTLNFNEEG 234

Query: 762 ------KTNARPLQTINDRFVK 809
                   N RP Q + +R +K
Sbjct: 235 DAEEAMVDNWRPAQPLKNRKIK 256



>gb:MUSCAIIM_2125362 Mouse carbonic anhydrase isozyme II mRNA,
           complete cds.
          Length = 260

 Score = 73.6 bits (179), Expect = 8e-12
 Identities = 69/262 (26%), Positives = 110/262 (41%), Gaps = 30/262 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYYMRDVA 290
           WG+S       GP +W +  P     + G  Q+P+D+++    +   L P+   Y +  +
Sbjct: 5   WGYS----KHNGPENWHKDFP----IANGDRQSPVDIDTATAHHDPALQPLLISYDKAAS 56

Query: 291 -TLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWHFPS------EHVVNGTRYDL 437
            ++ N+G+   + +   Q    + G      Y   Q H+H+ S      EH VN  +Y  
Sbjct: 57  KSIVNNGHSFNVEFDDSQDNAVLKGGPLSDSYRLIQFHFHWGSSDGQGSEHTVNKKKYAA 116

Query: 438 EAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG 584
           E HLVH           V     +AVL    +IG     +  ++E       +T G +  
Sbjct: 117 ELHLVHWNTKYGDFGKAVQQPDGLAVLGYFLKIGPASQGLQKVLE--ALHSIKTKGKRAA 174

Query: 585 IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES- 761
               DP  L      Y+ Y GSLTTPP  E V W V+R   +V+ +Q++  R    +E  
Sbjct: 175 FANFDPCSLLPGNLDYWTYPGSLTTPPLLECVTWIVLREPITVSSEQMSHFRTLNFNEEG 234

Query: 762 ------KTNARPLQTINDRFVK 809
                   N RP Q + +R +K
Sbjct: 235 DAEEAMVDNWRPAQPLKNRKIK 256



>pir|JH0527|JH0527 carbonate dehydratase (EC 4.2.1.1) II -
           rat>gb:BC065577_2105606 Rattus norvegicus carbonic
           anhydrase 2, mRNA (cDNA clone MGC:72487 IMAGE:5623601),
           complete cds.>gb:RNCAII_2134553 R.norvegicus mRNA for
           carbonic anhydrase II.>gb:RNCAII8_2134556 Rattus
           norvegicus carbonic anhydrase II gene, exon 7 and
           partial cds.
          Length = 260

 Score = 73.6 bits (179), Expect = 8e-12
 Identities = 68/262 (25%), Positives = 113/262 (43%), Gaps = 30/262 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQNYYMRDVA 290
           WG+S       GP +W +  P     + G  Q+P+D+++    +  +L P+   Y +  +
Sbjct: 5   WGYS----KSNGPENWHKEFP----IANGDRQSPVDIDTGTAQHDPSLQPLLICYDKVAS 56

Query: 291 -TLENHGYGMMLSWPLGQRYL----GINGIRYLFRQVHWHFPS------EHVVNGTRYDL 437
            ++ N+G+   + +   Q +     G     Y   Q H+H+ S      EH VN  +Y  
Sbjct: 57  KSIVNNGHSFNVEFDDSQDFAVLKEGPLSGSYRLIQFHFHWGSSDGQGSEHTVNKKKYAA 116

Query: 438 EAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG 584
           E HLVH           V +   +AVL +  +IG     +  + E       +T G +  
Sbjct: 117 ELHLVHWNTKYGDFGKAVQHPDGLAVLGIFLKIGPASQGLQKITE--ALHSIKTKGKRAA 174

Query: 585 IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNA-IHDES 761
               DP  L      Y+ Y GSLTTPP  E V W V++   +V+ +Q++  R    + E 
Sbjct: 175 FANFDPCSLLPGNLDYWTYPGSLTTPPLLECVTWIVLKEPITVSSEQMSHFRKLNFNSEG 234

Query: 762 KT------NARPLQTINDRFVK 809
           +       N RP Q + +R +K
Sbjct: 235 EAEELMVDNWRPAQPLKNRKIK 256



>sp|P27139|CAH2_RAT Carbonic anhydrase II (EC 4.2.1.1) (Carbonate
           dehydratase II) (CA-II).
          Length = 259

 Score = 73.6 bits (179), Expect = 8e-12
 Identities = 68/262 (25%), Positives = 113/262 (43%), Gaps = 30/262 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQNYYMRDVA 290
           WG+S       GP +W +  P     + G  Q+P+D+++    +  +L P+   Y +  +
Sbjct: 4   WGYS----KSNGPENWHKEFP----IANGDRQSPVDIDTGTAQHDPSLQPLLICYDKVAS 55

Query: 291 -TLENHGYGMMLSWPLGQRYL----GINGIRYLFRQVHWHFPS------EHVVNGTRYDL 437
            ++ N+G+   + +   Q +     G     Y   Q H+H+ S      EH VN  +Y  
Sbjct: 56  KSIVNNGHSFNVEFDDSQDFAVLKEGPLSGSYRLIQFHFHWGSSDGQGSEHTVNKKKYAA 115

Query: 438 EAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG 584
           E HLVH           V +   +AVL +  +IG     +  + E       +T G +  
Sbjct: 116 ELHLVHWNTKYGDFGKAVQHPDGLAVLGIFLKIGPASQGLQKITE--ALHSIKTKGKRAA 173

Query: 585 IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNA-IHDES 761
               DP  L      Y+ Y GSLTTPP  E V W V++   +V+ +Q++  R    + E 
Sbjct: 174 FANFDPCSLLPGNLDYWTYPGSLTTPPLLECVTWIVLKEPITVSSEQMSHFRKLNFNSEG 233

Query: 762 KT------NARPLQTINDRFVK 809
           +       N RP Q + +R +K
Sbjct: 234 EAEELMVDNWRPAQPLKNRKIK 255



>sp|P00920|CAH2_MOUSE Carbonic anhydrase II (EC 4.2.1.1) (Carbonate
           dehydratase II) (CA-II).
          Length = 259

 Score = 73.6 bits (179), Expect = 8e-12
 Identities = 69/262 (26%), Positives = 110/262 (41%), Gaps = 30/262 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYYMRDVA 290
           WG+S       GP +W +  P     + G  Q+P+D+++    +   L P+   Y +  +
Sbjct: 4   WGYS----KHNGPENWHKDFP----IANGDRQSPVDIDTATAHHDPALQPLLISYDKAAS 55

Query: 291 -TLENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWHFPS------EHVVNGTRYDL 437
            ++ N+G+   + +   Q    + G      Y   Q H+H+ S      EH VN  +Y  
Sbjct: 56  KSIVNNGHSFNVEFDDSQDNAVLKGGPLSDSYRLIQFHFHWGSSDGQGSEHTVNKKKYAA 115

Query: 438 EAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG 584
           E HLVH           V     +AVL    +IG     +  ++E       +T G +  
Sbjct: 116 ELHLVHWNTKYGDFGKAVQQPDGLAVLGYFLKIGPASQGLQKVLE--ALHSIKTKGKRAA 173

Query: 585 IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES- 761
               DP  L      Y+ Y GSLTTPP  E V W V+R   +V+ +Q++  R    +E  
Sbjct: 174 FANFDPCSLLPGNLDYWTYPGSLTTPPLLECVTWIVLREPITVSSEQMSHFRTLNFNEEG 233

Query: 762 ------KTNARPLQTINDRFVK 809
                   N RP Q + +R +K
Sbjct: 234 DAEEAMVDNWRPAQPLKNRKIK 255



>gb:HUMCA405_2029758 Human carbonic anhydrase IV gene, exon 7.
          Length = 222

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 54/175 (30%), Positives = 83/175 (47%), Gaps = 29/175 (16%)
 Frame = +3

Query: 369 YLFRQVHWHFP------SEHVVNGTRYDLEAHLVHVSNDG-------------RIAVLAV 491
           Y  +Q+H H+       SEH ++G  + +E H+VH    G              IAVLA 
Sbjct: 19  YQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAF 78

Query: 492 MYQIGETPN----PILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTT 659
           + + G   N    P++  + +  K    T   +  +  L P   + + R Y+RY+GSLTT
Sbjct: 79  LVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPK--EEKLRHYFRYLGSLTT 136

Query: 660 PPCTEGVVWTVIRTIRSVTKQQV-ALIRNAIHDESKT-----NARPLQTINDRFV 806
           P C E VVWTV R    + ++Q+ A  +   +D+ +T     N RPLQ +  R V
Sbjct: 137 PTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTV 191



>gb:AF050106_1879121 Homo sapiens carbonic anhydrase-related protein
           XI mRNA, partial cds.
          Length = 267

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 67/260 (25%), Positives = 109/260 (41%), Gaps = 39/260 (15%)
 Frame = +3

Query: 147 GPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGP---IQNYYMRDVATLENHGYGM 317
           GP  WG +   W  C+ GK Q+P+D+E K V+Y    P   +     +   TL N G  +
Sbjct: 1   GPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHV 60

Query: 318 MLSWPLGQRYLGING-----------IRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSN 464
               P  +  + ++G           +R LF        SEH +N   +  E  L+H + 
Sbjct: 61  SFL-PAPRPVVNVSGGPLLYSHRLSELRLLFG-ARDGAGSEHQINHQGFSAEVQLIHFNQ 118

Query: 465 D------------GRIAVLAVMYQIGETPNPILS--LIEDDLKKLAETPGVKKGIGY--- 593
           +              +A+L++   +  T NP LS  L  D + +++      K   Y   
Sbjct: 119 ELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRDTITRISY-----KNDAYFLQ 173

Query: 594 -LDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIR-------NAI 749
            L   LL      +  Y GSL+TPPC+E V W +I    ++T  Q+  +R       + +
Sbjct: 174 DLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQM 233

Query: 750 HDESKTNARPLQTINDRFVK 809
                 N+RPLQ +  R ++
Sbjct: 234 FQSLSGNSRPLQPLAHRALR 253



>gb:BC011949_1973331 Homo sapiens carbonic anhydrase II, mRNA (cDNA
           clone MGC:9006 IMAGE:3863603), complete cds.
          Length = 260

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 72/264 (27%), Positives = 112/264 (42%), Gaps = 32/264 (12%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQNYYMRDVA 290
           WG+        GP HW +  P     + G+ Q+P+D+++    Y  +L P+   Y  D A
Sbjct: 5   WGYG----KHNGPEHWHKDFP----IAKGERQSPVDIDTHTAKYDPSLKPLSVSY--DQA 54

Query: 291 T---LENHGYGMMLSWPLGQRYLGING--IRYLFRQVHWHFP--------SEHVVNGTRY 431
           T   + N+G+   + +   Q    + G  +   +R + +HF         SEH V+  +Y
Sbjct: 55  TSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKY 114

Query: 432 DLEAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK 578
             E HLVH           V     +AVL +  ++G    P L  + D L  + +T G  
Sbjct: 115 AAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSA-KPGLQKVVDVLDSI-KTKGKS 172

Query: 579 KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNA-IHD 755
                     L      Y+ Y GSLTTPP  E V W V++   SV+ +QV   R    + 
Sbjct: 173 ADFTNFAARGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNG 232

Query: 756 ESK------TNARPLQTINDRFVK 809
           E +       N RP Q + +R +K
Sbjct: 233 EGEPEELMVDNWRPAQPLKNRQIK 256



>sp|Q64444|CAH4_MOUSE Carbonic anhydrase IV precursor (EC 4.2.1.1)
           (Carbonate dehydratase IV) (CA-IV).>gb:AL669859_2072511
           Mouse DNA sequence from clone RP23-167D6 on chromosome
           11, complete sequence.>gb:BC012704_2091633 Mus musculus
           carbonic anhydrase 4, mRNA (cDNA clone MGC:13978
           IMAGE:4217743), complete cds.>gb:MMU37091_2121019 Mus
           musculus carbonic anhydrase IV gene, complete cds.
          Length = 305

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 75/276 (27%), Positives = 126/276 (45%), Gaps = 29/276 (10%)
 Frame = +3

Query: 66  LLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGK-MQTPIDL-ESKPV 239
           LL++ +V  S E D  W +       R       L PE W  +  +  Q+PI++  ++  
Sbjct: 7   LLALAYVAPSTE-DSGWCYEIQTKDPRSSC----LGPEKWPGACKENQQSPINIVTARTK 61

Query: 240 VYSNLGP--IQNYYMRDVATLENHGYGMMLSWPLGQRYLGIN-GIRYLFRQVHWHFP--- 401
           V   L P  +  Y  +    ++N+ + + ++   G   +G +   RY   Q+H H+    
Sbjct: 62  VNPRLTPFILVGYDQKQQWPIKNNQHTVEMTLGGGACIIGGDLPARYEAVQLHLHWSNGN 121

Query: 402 ---SEHVVNGTRYDLEAHLVHVS-------NDGRIAVLAVMYQIGETPNPILSLIEDDLK 551
              SEH ++G  + +E H+VH         +  + AVLA M ++G+  N     + + L 
Sbjct: 122 DNGSEHSIDGRHFAMEMHIVHKKLTSSKEDSKDKFAVLAFMIEVGDKVNKGFQPLVEALP 181

Query: 552 KLAE---TPGVKKGI--GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVT 716
            +++   T  V++      L P+    +   Y+RY GSLTTP C E V+WTV +    + 
Sbjct: 182 SISKPHSTSTVRESSLQDMLPPS---TKMYTYFRYNGSLTTPNCDETVIWTVYKQPIKIH 238

Query: 717 KQQ-VALIRNAIHDES-----KTNARPLQTINDRFV 806
           K Q +   +N  +DE      K N RPLQ +  R V
Sbjct: 239 KNQFLEFSKNLYYDEDQKLNMKDNVRPLQPLGKRQV 274



>gb:BC083999_2563407 Xenopus laevis hypothetical LOC494969, mRNA
           (cDNA clone MGC:98138 IMAGE:7200672), complete cds.
          Length = 305

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 75/276 (27%), Positives = 126/276 (45%), Gaps = 29/276 (10%)
 Frame = +3

Query: 66  LLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGK-MQTPIDL-ESKPV 239
           LL++ +V  S E D  W +       R       L PE W  +  +  Q+PI++  ++  
Sbjct: 7   LLALAYVAPSTE-DSGWCYEIQTKDPRSSC----LGPEKWPGACKENQQSPINIVTARTK 61

Query: 240 VYSNLGP--IQNYYMRDVATLENHGYGMMLSWPLGQRYLGIN-GIRYLFRQVHWHFP--- 401
           V   L P  +  Y  +    ++N+ + + ++   G   +G +   RY   Q+H H+    
Sbjct: 62  VNPRLTPFILVGYDQKQQWPIKNNQHTVEMTLGGGVCIIGGDLPARYEAVQLHLHWSNGN 121

Query: 402 ---SEHVVNGTRYDLEAHLVHVS-------NDGRIAVLAVMYQIGETPNPILSLIEDDLK 551
              SEH ++G  + +E H+VH         +  + AVLA M ++G+  N     + + L 
Sbjct: 122 DNGSEHSIDGRHFAMEMHIVHKKLTSSKEDSKDKFAVLAFMIEVGDKVNKGFQPLVEALP 181

Query: 552 KLAE---TPGVKKGI--GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVT 716
            +++   T  V++      L P+    +   Y+RY GSLTTP C E V+WTV +    + 
Sbjct: 182 SISKPHSTSTVRESSLQDMLPPS---TKMYTYFRYNGSLTTPNCDETVIWTVYKQPIKIH 238

Query: 717 KQQ-VALIRNAIHDES-----KTNARPLQTINDRFV 806
           K Q +   +N  +DE      K N RPLQ +  R V
Sbjct: 239 KNQFLEFSKNLYYDEDQKLNMKDNVRPLQPLGKRQV 274



>gb:AB117757_2465947 Oncorhynchus mykiss mRNA for carbonic anhydrase
           2, complete cds.
          Length = 260

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 69/262 (26%), Positives = 103/262 (39%), Gaps = 30/262 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNL--GPIQNYYMRDV 287
           WG++     D GP  W E  P     + G  Q+PID+      +          Y     
Sbjct: 5   WGYA----PDNGPDKWCEGFP----IANGPRQSPIDIVPGEAAFDAALKALTLKYDPSTS 56

Query: 288 ATLENHGYGMMLSWPLGQRYLGINGI----RYLFRQVHWHFP------SEHVVNGTRYDL 437
             + N+G+   +++        + G      Y  +Q H+H+       SEH V GT+Y  
Sbjct: 57  IDILNNGHSFQVTYTDDNDNSTLTGGPISGTYRLKQFHFHWGASDDRGSEHTVAGTKYAA 116

Query: 438 EAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG 584
           E HLVH            S    +AV+ V  Q+G   N  L  + D    + +  G +  
Sbjct: 117 ELHLVHWNTKYPSFGDAASKSDGLAVVGVFLQVGNE-NANLQKVLDAFDAI-KAKGKQTS 174

Query: 585 IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES- 761
               DP +L  +   Y+ Y GSLTTPP  E V W V +   SV+  Q+   R+ +     
Sbjct: 175 FENFDPTILLPKSLDYWTYDGSLTTPPLLESVTWIVCKESISVSPAQMGKFRSLLFSGEG 234

Query: 762 ------KTNARPLQTINDRFVK 809
                   N RP Q +  R V+
Sbjct: 235 EAACCMVDNYRPPQPLKGRAVR 256



>gb:AB117756_2465946 Oncorhynchus mykiss mRNA for carbonic anhydrase
           1, complete cds.>gb:AY307082_2526196 Oncorhynchus mykiss
           erythrocyte carbonic anhydrase mRNA, complete cds.
          Length = 260

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 74/266 (27%), Positives = 111/266 (41%), Gaps = 34/266 (12%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQNYYMRDVA 290
           WG+   +    GP  W +  P     + G  Q+PID+      Y S L P++  Y    +
Sbjct: 5   WGYGPSD----GPEKWCDGFP----VANGPRQSPIDIIPGQTSYDSTLKPLKLKYDPSNS 56

Query: 291 T-LENHGYGMMLSWP--------LGQRYLGINGIRYLFRQVHWHFP------SEHVVNGT 425
           T + N+G+   + +          G    GI    Y  +Q H+H+       SEH VNG 
Sbjct: 57  TDILNNGHSFQVGFVDDVDSSTLTGGPITGI----YRLKQFHFHWGASDDRGSEHTVNGI 112

Query: 426 RYDLEAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG 572
           ++  E HLVH            S    +AV+ V  +IG   NP L  + D L  + ++ G
Sbjct: 113 KFPCELHLVHWNTKYPSFGEAASEPDGLAVVGVFLKIGAA-NPRLQKVLDALGAI-KSKG 170

Query: 573 VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH 752
            +      D   L      Y+ Y GSLTTPP  E V W V++   SV+  Q+   R+ + 
Sbjct: 171 KQTTFSNFDAKTLLPCSLDYWTYDGSLTTPPLLESVTWIVLKEPISVSPTQMGKFRSLMF 230

Query: 753 DES-------KTNARPLQTINDRFVK 809
                     + N RP Q +  R V+
Sbjct: 231 SGDGEAPCCMQDNYRPPQPLKGRKVR 256



>gb:AP003616_1831458 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0490F09.
          Length = 158

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 2/85 (2%)
 Frame = +3

Query: 288 ATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVS-- 461
           A+L N G+ +M+ +      + ++G  Y  RQ+HWH PSEH V+G RYDLE H++H S  
Sbjct: 62  ASLVNRGHDIMVRFDGDAGGVVVDGETYALRQMHWHSPSEHAVDGRRYDLELHMLHQSET 121

Query: 462 NDGRIAVLAVMYQIGETPNPILSLI 536
            DGR AV+A ++ IG   +  L ++
Sbjct: 122 RDGRYAVVAQLFDIGHRRDATLDMV 146



>gb:BC068819_2555319 Xenopus laevis hypothetical protein MGC81428,
           mRNA (cDNA clone MGC:81428 IMAGE:6635531), complete cds.
          Length = 318

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 70/262 (26%), Positives = 109/262 (41%), Gaps = 32/262 (12%)
 Frame = +3

Query: 117 GFSYD-ENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQNYYMRDVA 290
           G SY   N D  P   GE+         G  Q+PI++  +  V+   L P+   Y  +  
Sbjct: 40  GCSYKLRNVDLHPLWKGEI-----DVPGGSRQSPINIRIRDSVFHPQLAPVHTQYDPNTC 94

Query: 291 T-LENHGYGMMLSWPLGQRYLGING----IRYLFRQVHWHFP------SEHVVNGTRYDL 437
             + N+GY   + +        ++G      +  +Q H+H+       SEH V+   +  
Sbjct: 95  LHIWNNGYSFFVEFDDSTDKSIVSGGPLENPFRLKQFHFHWGRNNDWGSEHTVDSRVFPA 154

Query: 438 EAHLVH------------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK 581
           E HLVH            +     +AV+ V  +IG+    +  L+  D+           
Sbjct: 155 ELHLVHWNCSKYRTFEEAIMEPNGLAVIGVFLKIGKQHEKLQKLV--DILPSVRYKDALT 212

Query: 582 GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRN----AI 749
              Y D + L      Y+ Y GSLTTPP TE V W +++    V   Q+A+ R+    A+
Sbjct: 213 EFNYFDASCLLPSCVDYWTYSGSLTTPPLTESVTWIIMKKPIEVDHSQLAVFRSLLFTAV 272

Query: 750 HDESK---TNARPLQTINDRFV 806
            +E K    N RPLQ I +R V
Sbjct: 273 GEEEKYMVDNFRPLQPIMNRTV 294



>gb:AY322477_2527179 Oreochromis mossambicus carbonic anhydrase
           mRNA, complete cds.
          Length = 258

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 79/266 (29%), Positives = 114/266 (42%), Gaps = 34/266 (12%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQNYYMRDVA 290
           WG+     ++ GP  W E  P     + G  Q+PID+      Y + L P+   Y  D +
Sbjct: 3   WGYK----ANNGPQKWVENFP----IADGVRQSPIDIVPGQASYDAGLKPLNLKY--DPS 52

Query: 291 T---LENHGYGMMLSWPL---GQRYLG--INGIRYLFRQVHWHFP------SEHVVNGTR 428
           T   + N+G+ + +++       R     I+G+ Y  +Q H+H+       SEH V GT+
Sbjct: 53  TCLDILNNGHSVQVTFADDTDSSRLTDGPISGL-YRLKQFHFHWGASDDKGSEHTVAGTK 111

Query: 429 YDLEAHLVH-----------VSNDGRIAVLAVMYQIG-ETPNPILSLIEDDLKKLAETPG 572
           Y  E HLVH            S    +AV+ V  +IG E PN    L   D  K   + G
Sbjct: 112 YPAELHLVHWNTKYASFSEAASKPDGLAVVGVFLKIGGENPNLQKLLKAFDTIK---SKG 168

Query: 573 VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIR---- 740
            +      DP+ L      Y+ Y GSLTTPP  E V W V +   + +  Q+A  R    
Sbjct: 169 KQTSFANFDPSTLLPGCLDYWTYDGSLTTPPLYESVTWIVCKEPITASSAQMAKFRTLLF 228

Query: 741 ---NAIHDESKTNARPLQTINDRFVK 809
               A  D    N RP Q +  R V+
Sbjct: 229 SADGAAPDCMVNNYRPPQPLKGRTVR 254



>gb:AP005393_1851013 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0488D02.>gb:AP005655_1855553 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, PAC
           clone:P0025H07.
          Length = 96

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 33/72 (45%), Positives = 48/72 (66%)
 Frame = +3

Query: 594 LDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNA 773
           +DP+    +   YYRY GSLTTPPCTEGV+WT++  I   +K+Q+ L++  +    + NA
Sbjct: 22  VDPSTWVDKTSGYYRYDGSLTTPPCTEGVIWTIMSKIGDASKEQIDLLK-TVATTVEPNA 80

Query: 774 RPLQTINDRFVK 809
           RP Q +NDR V+
Sbjct: 81  RPAQKLNDRIVR 92



>sp|P48284|CAH4_RAT Carbonic anhydrase IV precursor (EC 4.2.1.1)
           (Carbonate dehydratase IV) (CA-IV).>pir|I51900|I51900
           carbonic anhydrase IV - rat>gb:S68245_2138954 carbonic
           anhydrase IV [rats, Sprague-Dawley, lung, mRNA, 1205
           nt].
          Length = 309

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 77/279 (27%), Positives = 123/279 (44%), Gaps = 32/279 (11%)
 Frame = +3

Query: 66  LLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGK-MQTPIDL-ESKPV 239
           LL++ +V  S E D  W   Y+  +    SH     PE W     K  Q+PI++  SK  
Sbjct: 7   LLALAYVAPSTE-DSHW--CYEIQAKEPNSHCSG--PEQWTGDCKKNQQSPINIVTSKTK 61

Query: 240 VYSNLGPIQ--NYYMRDVATLENHGYGMMLSWPLGQRYLGING---IRYLFRQVHWHFP- 401
           +  +L P     Y  +    ++N+ + + +S  LG+      G    +Y   Q+H H+  
Sbjct: 62  LNPSLTPFTFVGYDQKKKWEVKNNQHSVEMS--LGEDIYIFGGDLPTQYKAIQLHLHWSE 119

Query: 402 -----SEHVVNGTRYDLEAHLVHVS-----------NDGRIAVLAVMYQIGETPNPILSL 533
                SEH ++G  + +E H+VH             +  +IAVLA M ++G   N     
Sbjct: 120 ESNKGSEHSIDGKHFAMEMHVVHKKMTTGDKVQDSDSKDKIAVLAFMVEVGNEVNEGFQP 179

Query: 534 IEDDLKKLAE--TPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIR 707
           + + L +L++  T          D    + +   Y+RY GSLTTP C E V+WTV     
Sbjct: 180 LVEALSRLSKPFTNSTVSESCLQDMLPEKKKLSAYFRYQGSLTTPGCDETVIWTVFEEPI 239

Query: 708 SVTKQQ-VALIRNAIHDES-----KTNARPLQTINDRFV 806
            + K Q +   +   +D+      K N RPLQ + +R V
Sbjct: 240 KIHKDQFLEFSKKLYYDQEQKLNMKDNVRPLQPLGNRQV 278



>gb:AY836578_2546837 Pseudopleuronectes americanus carbonic
           anhydrase mRNA, complete cds.
          Length = 258

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 71/263 (26%), Positives = 110/263 (41%), Gaps = 31/263 (11%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQ-NYYMRDV 287
           WG++    +D GP  W +  P     + G  Q+PID+      +   L P+   Y   + 
Sbjct: 3   WGYA----ADNGPDKWADNFP----VANGPRQSPIDILPGEASFDGALKPLSLKYDPSNC 54

Query: 288 ATLENHGYGMMLSW-----PLGQRYLGINGIRYLFRQVHWHFP------SEHVVNGTRYD 434
             + N+G+   +++         +   I+G+ Y  +Q H+H+       SEH V GT Y 
Sbjct: 55  LEILNNGHSFQVTFVDDTDSSTLKDGPISGV-YRLKQFHFHWGACDERGSEHTVAGTMYP 113

Query: 435 LEAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK 581
            E HLVH            S    +AV+ V  +IG   N  L  + D    + +  G + 
Sbjct: 114 AELHLVHWNTKYPSFGDAASKPDGLAVVGVFLKIG-AENANLQKVLDAFSSI-QAKGKQT 171

Query: 582 GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES 761
                DP  L      Y+ Y GSLTTPP  E V W V +   S++ +Q+A  R+ +    
Sbjct: 172 TFAGFDPASLLPGCLDYWTYDGSLTTPPLLESVTWIVCKEPISISAEQMAKFRSLLFSAE 231

Query: 762 -------KTNARPLQTINDRFVK 809
                    N RP Q +  R V+
Sbjct: 232 GEAECCMVDNYRPPQPLKGRTVR 254



>gb:CR749607_1181165 Homo sapiens mRNA; cDNA DKFZp686I20267 (from
           clone DKFZp686I20267).
          Length = 334

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 63/258 (24%), Positives = 116/258 (44%), Gaps = 36/258 (13%)
 Frame = +3

Query: 150 PSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQ-NYYMRDVA-TLENHGYGMM 320
           PS WG +   W  CS GK Q+P+++E+  +++   L P++ N   R V+ T+ N G  + 
Sbjct: 53  PSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVS 112

Query: 321 LSWPLGQRYLGING----IRYLFRQVHWHF------PSEHVVNGTRYDLEAHLVHVSND- 467
           L     +  + I+G      +   ++  HF       SEH++NG  +  E  L+H +++ 
Sbjct: 113 LRLD-KEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHEL 171

Query: 468 -----------GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNL-- 608
                        + V+++  ++ ++ NP L+ +   L +   T    K   YL   L  
Sbjct: 172 YTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRM---LNRDTITRITYKNDAYLLQGLNI 228

Query: 609 --LQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIR-------NAIHDES 761
             L      +  Y GS+T PPC E   W ++     +T+ Q+  +R       + I    
Sbjct: 229 EELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSM 288

Query: 762 KTNARPLQTINDRFVKVD 815
             N RP+Q +N+R ++ +
Sbjct: 289 SDNFRPVQPLNNRCIRTN 306



>gb:BX294140_767336 Pirellula sp. strain 1 complete genome; segment
           8/24.
          Length = 210

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 64/215 (29%), Positives = 106/215 (49%), Gaps = 13/215 (6%)
 Frame = +3

Query: 201 KMQTPIDLESKPVVYSNLGPIQNYYMRDV-ATLE-NHGYGMMLSWPLGQRYLGINGIRYL 374
           + Q+PI ++S PVV     P++  + + +  TL+ +HG   ++     +  +  +G  + 
Sbjct: 4   QQQSPIHIKS-PVVTKYARPLKIRWSKHLDGTLKPHHGKVQVVFSGDKKERISFDGRDFH 62

Query: 375 FRQVHWHFPSEHVVNGTRYDLEAHLVHVS---NDGRIAVLAVMYQIGETPNPILSLIE-- 539
             Q H+H  SEH +   ++ +E H+VH +   +DG++AVL +M +   +   +  LIE  
Sbjct: 63  IVQFHFHHKSEHWIEDKQFQMELHIVHQNCDPDDGKLAVLGIMIEADNSAKTVPGLIELM 122

Query: 540 -----DDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIR-T 701
                DD +K  +         +L PN      + +YRY GSLTTP   E V W V+R  
Sbjct: 123 ETMAKDDARKFMDFK--TNPHEWLPPNT-----QHFYRYEGSLTTPEYDEIVSWIVLREP 175

Query: 702 IRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV 806
           ++  +K+   LIR A        AR  Q +N RFV
Sbjct: 176 LKLPSKEINKLIRFAAEP-----ARLPQPLNRRFV 205



>sp|Q9NS85|CAHA_HUMAN Carbonic anhydrase-related protein 10
           (Carbonic anhydrase-related protein X) (CARP X) (CA-RP
           X) (Cerebral protein-15) (hucep-15)
           (UNQ533/PRO1076).>sp|P61215|CAHA_MOUSE Carbonic
           anhydrase-related protein 10 (Carbonic anhydrase-related
           protein X) (CARP X) (CA-RP X).>gb:CR861151_1185165 Pongo
           pygmaeus mRNA; cDNA DKFZp459M0214 (from clone
           DKFZp459M0214).>gb:HSM802510_1186726 Homo sapiens mRNA;
           cDNA DKFZp761E1416 (from clone
           DKFZp761E1416).>gb:AB001597_1863564 Homo sapiens
           hucep-15 mRNA for cerebral protein-15, complete
           cds.>gb:AB036836_1866432 Homo sapiens mRNA for Carbonic
           anhydrase-related protein 10, complete
           cds.>gb:AB046046_1867263 Macaca fascicularis brain cDNA,
           clone:QccE-11301.>gb:AF288385_1895090 Homo sapiens
           carbonic anhydrase-related protein X mRNA, complete
           cds.>gb:AY358509_1947388 Homo sapiens clone DNA57252
           CA10 (UNQ533) mRNA, complete cds.>gb:BC020577_1977072
           Homo sapiens carbonic anhydrase X, mRNA (cDNA clone
           MGC:21795 IMAGE:4181377), complete
           cds.>gb:BC047456_1983874 Homo sapiens carbonic anhydrase
           X, mRNA (cDNA clone MGC:50971 IMAGE:5276935), complete
           cds.>gb:BC068462_1987622 Homo sapiens carbonic anhydrase
           X, mRNA (cDNA clone MGC:87062 IMAGE:5260321), complete
           cds.>gb:AB080741_2047697 Mus musculus Car10 mRNA for
           carbonic anhydrase-related protein X, complete
           cds.>gb:AL683819_2072775 Mouse DNA sequence from clone
           RP23-126J10 on chromosome 11 Contains part of the Car10
           gene for carbonic anhydrase 10, complete
           sequence.>gb:AL713960_2072883 Mouse DNA sequence from
           clone RP23-448I9 on chromosome 11 Contains the 5' end of
           the Car10 gene for carbonic anhydrase 10 and one CpG
           island, complete sequence.>gb:AL731728_2072924 Mouse DNA
           sequence from clone RP24-531N10 on chromosome 11
           Contains part of the Car10 gene for carbonic anhydrase
           10, complete sequence.>gb:AL731849_2072935 Mouse DNA
           sequence from clone RP23-208A2 on chromosome 11 Contains
           part of the Car10 gene for carbonic anhydrase 10,
           complete sequence.>gb:AL954830_2073201 Mouse DNA
           sequence from clone RP23-12A10 on chromosome 11 Contains
           the 3' end of the Car10 gene for carbonic anhydrase 10,
           complete sequence.>gb:BC017606_2092504 Mus musculus
           carbonic anhydrase 10, mRNA (cDNA clone MGC:27641
           IMAGE:4507552), complete cds.
          Length = 328

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 63/258 (24%), Positives = 116/258 (44%), Gaps = 36/258 (13%)
 Frame = +3

Query: 150 PSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQ-NYYMRDVA-TLENHGYGMM 320
           PS WG +   W  CS GK Q+P+++E+  +++   L P++ N   R V+ T+ N G  + 
Sbjct: 47  PSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVS 106

Query: 321 LSWPLGQRYLGING----IRYLFRQVHWHF------PSEHVVNGTRYDLEAHLVHVSND- 467
           L     +  + I+G      +   ++  HF       SEH++NG  +  E  L+H +++ 
Sbjct: 107 LRLD-KEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHEL 165

Query: 468 -----------GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNL-- 608
                        + V+++  ++ ++ NP L+ +   L +   T    K   YL   L  
Sbjct: 166 YTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRM---LNRDTITRITYKNDAYLLQGLNI 222

Query: 609 --LQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIR-------NAIHDES 761
             L      +  Y GS+T PPC E   W ++     +T+ Q+  +R       + I    
Sbjct: 223 EELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSM 282

Query: 762 KTNARPLQTINDRFVKVD 815
             N RP+Q +N+R ++ +
Sbjct: 283 SDNFRPVQPLNNRCIRTN 300



>gb:AY514870_2535829 Oncorhynchus mykiss cytoplasmic carbonic
           anhydrase (CA2) mRNA, complete cds.
          Length = 259

 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 63/235 (26%), Positives = 95/235 (40%), Gaps = 23/235 (9%)
 Frame = +3

Query: 114 WGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNL--GPIQNYYMRDV 287
           WG++     D GP  W E  P     + G  Q+PID+      +          Y     
Sbjct: 5   WGYA----PDNGPDKWCEGFP----IANGPRQSPIDIVPGEAAFDAALKALTLKYDPSTS 56

Query: 288 ATLENHGYGMMLSWPLGQRYLGINGI----RYLFRQVHWHFP------SEHVVNGTRYDL 437
             + N+G+   +++        + G      Y  +Q H+H+       SEH V GT+Y  
Sbjct: 57  IDILNNGHSFQVTYTDDNDNSTLTGGPISGTYRLKQFHFHWGASDDRGSEHTVAGTKYAA 116

Query: 438 EAHLVH-----------VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG 584
           E HLVH            S    +AV+ V  Q+G   N  L  + D    + +  G +  
Sbjct: 117 ELHLVHWNTKYPSFGDAASKSDGLAVVGVFLQVGNE-NANLQKVLDAFDAI-KAKGKQTS 174

Query: 585 IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI 749
               DP +L  +   Y+ Y GSLTTPP  E V W V +   SV+  Q+   R+ +
Sbjct: 175 FENFDPTILLPKSLDYWTYDGSLTTPPLLESVTWIVCKESISVSPAQMGKFRSLL 229



>gb:AY232669_1591668 Dunaliella salina carbonic anhydrase gene,
           complete cds.
          Length = 498

 Score = 70.5 bits (171), Expect = 7e-11
 Identities = 57/167 (34%), Positives = 86/167 (51%), Gaps = 18/167 (10%)
 Frame = +3

Query: 354 INGIRYLFR--QVHWH-FPSEHVVNGTRYDLEAHLVHVSND--GRIAVLAVMYQIGETPN 518
           I+G    F+  Q+H+H F SEH +NG  Y LEAHLV  S D   ++AV+  MY+ G   +
Sbjct: 153 IDGTEQRFQPIQLHFHHFASEHTINGQLYPLEAHLVMASLDDPNQLAVIGTMYKYGNGDD 212

Query: 519 PILSL---IEDDLKKLAETPGVKKGIGY---LDP--NLLQARGRRYYRYMGSLTTPPCTE 674
            +  L   +ED L++  +     K +     + P  ++L      Y  Y GSLTTPPC+E
Sbjct: 213 FLARLFGKVEDALEERDDVSYGSKEVPIDMEISPKDHVLPQSSLEYAGYDGSLTTPPCSE 272

Query: 675 GVVWTVIRTIRSVTKQQVALIR----NAIHDES-KTNARPLQTINDR 800
            V W V  + R+++  Q+        NA  +E+  TN R +Q +  R
Sbjct: 273 VVKWHVFTSPRTISIDQLKTFERVSLNAHPNEAIPTNNRVIQPLGTR 319



>gb:AX357595_1466181 Sequence 1 from Patent
           WO0190321.>gb:AX357597_1466182 Sequence 3 from Patent
           WO0190321.
          Length = 328

 Score = 70.5 bits (171), Expect = 7e-11
 Identities = 65/259 (25%), Positives = 118/259 (45%), Gaps = 37/259 (14%)
 Frame = +3

Query: 150 PSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQ-NYYMRDVA-TLENHGYGMM 320
           PS WG +   W  CS GK Q+P+++E+  +++   L P++ N   R V+ T+ N   G  
Sbjct: 47  PSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYN--TGRH 104

Query: 321 LSWPLGQRYL-GING----IRYLFRQVHWHF------PSEHVVNGTRYDLEAHLVHVSND 467
           +S  L + +L  I+G      +   ++  HF       SEH++NG  +  E  L+H +++
Sbjct: 105 VSPRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHE 164

Query: 468 ------------GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNL- 608
                         + V+++  ++ ++ NP L+ +   L +   T    K   YL   L 
Sbjct: 165 LYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRM---LNRDTITRITYKNDAYLLQGLN 221

Query: 609 ---LQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIR-------NAIHDE 758
              L      +  Y GS+T PPC E   W ++     +T+ Q+  +R       + I   
Sbjct: 222 IEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLS 281

Query: 759 SKTNARPLQTINDRFVKVD 815
              N RP+Q +N+R ++ +
Sbjct: 282 MSDNFRPVQPLNNRCIRTN 300



>gb:AY075020_1935955 Homo sapiens carbonic anhydrase VII short form
           mRNA, complete cds.
          Length = 208

 Score = 70.1 bits (170), Expect = 9e-11
 Identities = 51/172 (29%), Positives = 79/172 (45%), Gaps = 25/172 (14%)
 Frame = +3

Query: 369 YLFRQVHWHFP------SEHVVNGTRYDLEAHLVH------------VSNDGRIAVLAVM 494
           Y  +Q H+H+       SEH V+G  +  E HLVH             S    +AV+ V 
Sbjct: 34  YRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASAPDGLAVVGVF 93

Query: 495 YQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTE 674
            + G+  +P ++ + D L  +    G K      +P  L    R Y+ Y GSLTTPP +E
Sbjct: 94  LETGDE-HPSMNRLTDALY-MVRFKGTKAQFSCFNPKCLLPASRHYWTYPGSLTTPPLSE 151

Query: 675 GVVWTVIRTIRSVTKQQVALIRNAI---HDESK----TNARPLQTINDRFVK 809
            V W V+R    ++++Q+   R+ +    D+ +     N RP Q +  R VK
Sbjct: 152 SVTWIVLREPICISERQMGKFRSLLFTSEDDERIHMVNNFRPPQPLKGRVVK 203



>gb:AK004896_1152675 Mus musculus adult male liver cDNA, RIKEN
           full-length enriched library, clone:1300004E06
           product:carbonic anhydrase-like sequence 1, full insert
           sequence.
          Length = 291

 Score = 70.1 bits (170), Expect = 9e-11
 Identities = 75/287 (26%), Positives = 122/287 (42%), Gaps = 47/287 (16%)
 Frame = +3

Query: 90  KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS------N 251
           + +E   EWG  Y+E  +     WG + P+    + G+ Q+PI+L S+   Y        
Sbjct: 22  EEEEEGVEWG--YEEGVE-----WGLVFPD----ANGEYQSPINLNSREARYDPSLLDVR 70

Query: 252 LGPIQNYYMRDVATLENHGY---------GMMLSWPLGQRYLGINGIRYLFRQVHWHFP- 401
           L P  NY +     + N G+          ++   PL Q      G  +   +V +H+  
Sbjct: 71  LSP--NYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQ------GQEFELYEVRFHWGR 122

Query: 402 -----SEHVVNGTRYDLEAHLVH------------VSNDGRIAVLAVMYQIGETPNPILS 530
                SEH VN   + +E HL+H            V     IA++A+  QIG+    + +
Sbjct: 123 ENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKA 182

Query: 531 LIEDDLKKLAETPGVKKGIGYLDPNLLQARG--RRYYRYMGSLTTPPCTEGVVWTVIRTI 704
           + E  + +  +  G  K I   +PN L      R Y+ Y GSLT PPC+EGV W + R  
Sbjct: 183 VTE--ILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYP 240

Query: 705 RSVTKQQVALIRN-AIHDESK-----------TNARPLQTINDRFVK 809
            ++++ Q+   R    H +              N RP Q ++DR ++
Sbjct: 241 LTISQMQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRIIR 287



>gb:BC056289_2551732 Danio rerio zgc:77106, mRNA (cDNA clone
           MGC:65797 IMAGE:6791618), complete
           cds.>gb:BC067185_2554657 Danio rerio zgc:77106, mRNA
           (cDNA clone MGC:77106 IMAGE:6960677), complete cds.
          Length = 305

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 49/150 (32%), Positives = 76/150 (50%), Gaps = 15/150 (10%)
 Frame = +3

Query: 402 SEHVVNGTRYDLEAHLVH--VSNDG-RIAVLAVMYQIG-ETPNP----ILSLIEDDLKKL 557
           SEH VNG R+ +E H+V+  VSN    +AVL V  +   ET  P     L+     + K 
Sbjct: 114 SEHTVNGKRFPMELHIVNKPVSNTSDSLAVLGVFIEASNETGKPESWKTLTSYLTRIVKA 173

Query: 558 AETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALI 737
            +   + + +  +D  L      +YYRY+GSLTTP C EGV+WTV +    V++  + L 
Sbjct: 174 GDKANLFRNLS-MDDLLSGVDRTKYYRYLGSLTTPNCNEGVIWTVFKDPIRVSRDLIDLF 232

Query: 738 RNAIHDESKTNA-------RPLQTINDRFV 806
              ++  + +N+       R +Q +N R V
Sbjct: 233 STTVYINNSSNSPLMTNIFRSVQPVNGRIV 262



>gb:BC010773_2091105 Mus musculus carbonic anhydrase 8, mRNA (cDNA
           clone MGC:18643 IMAGE:4216498), complete cds.
          Length = 291

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 75/287 (26%), Positives = 122/287 (42%), Gaps = 47/287 (16%)
 Frame = +3

Query: 90  KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS------N 251
           + +E   EWG  Y+E  +     WG + P+    + G+ Q+PI+L S+   Y        
Sbjct: 22  EEEEEGVEWG--YEEGVE-----WGLVFPD----ANGEYQSPINLNSREARYDPSLLDVR 70

Query: 252 LGPIQNYYMRDVATLENHGY---------GMMLSWPLGQRYLGINGIRYLFRQVHWHFP- 401
           L P  NY +     + N G+          ++   PL Q      G  +   +V +H+  
Sbjct: 71  LSP--NYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQ------GQEFELYEVRFHWGR 122

Query: 402 -----SEHVVNGTRYDLEAHLVH------------VSNDGRIAVLAVMYQIGETPNPILS 530
                SEH VN   + +E HL+H            V     IA++A+  QIG+    + +
Sbjct: 123 ENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKA 182

Query: 531 LIEDDLKKLAETPGVKKGIGYLDPNLLQARG--RRYYRYMGSLTTPPCTEGVVWTVIRTI 704
           + E  + +  +  G  K I   +PN L      R Y+ Y GSLT PPC+EGV W + R  
Sbjct: 183 VTE--ILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYP 240

Query: 705 RSVTKQQVALIRN-AIHDESK-----------TNARPLQTINDRFVK 809
            ++++ Q+   R    H +              N RP Q ++DR ++
Sbjct: 241 LTISQMQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIR 287



>gb:AF192978_2058563 Mus musculus carbonic anhydrase VB mRNA,
           complete cds; nuclear gene for mitochondrial product.
          Length = 317

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 67/244 (27%), Positives = 104/244 (42%), Gaps = 39/244 (15%)
 Frame = +3

Query: 195 AGKMQTPIDLESKPVVYS-NLGPIQNYYMRDVAT---LENHGYGMMLSWPLGQRYLGING 362
           AG  Q+PI++  +  VY   L P+   Y  D AT   + N+GY  ++ +        + G
Sbjct: 60  AGDRQSPINIRWRDSVYDPGLKPLTISY--DPATCLHIWNNGYSFLVEFEDSTDKSVVEG 117

Query: 363 ----IRYLFRQVHWHFP------SEHVVNGTRYDLEAHLVHVS------------NDGRI 476
                 Y  +Q H+H+       SEH V+   Y  E HLVH +             +  +
Sbjct: 118 GPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCYPAELHLVHWNAVKFESFEDAALEENGL 177

Query: 477 AVLAVMYQIGETPNPILSLIEDDLKKLAET-PGVKKG-----IGYLDPNLLQARGRRYYR 638
           AV+ V  ++G+           +L+KL +T P +K        G  DP+ L      Y+ 
Sbjct: 178 AVIGVFLKLGKH--------HKELQKLVDTLPSIKHKDTLVEFGSFDPSCLMPTCPDYWT 229

Query: 639 YMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI-------HDESKTNARPLQTIND 797
           Y GSLTTPP +E V W + +    V + Q+   R  +             N RPLQ + +
Sbjct: 230 YSGSLTTPPLSESVTWIIKKQPVEVDRDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMN 289

Query: 798 RFVK 809
           R V+
Sbjct: 290 RTVR 293



>gb:AK085670_1174552 Mus musculus 10 days lactation, adult female
           mammary gland cDNA, RIKEN full-length enriched library,
           clone:D730005F19 product:carbonic anhydrase 5b,
           mitochondrial, full insert sequence.
          Length = 317

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 67/244 (27%), Positives = 104/244 (42%), Gaps = 39/244 (15%)
 Frame = +3

Query: 195 AGKMQTPIDLESKPVVYS-NLGPIQNYYMRDVAT---LENHGYGMMLSWPLGQRYLGING 362
           AG  Q+PI++  +  VY   L P+   Y  D AT   + N+GY  ++ +        + G
Sbjct: 60  AGDRQSPINIRWRDSVYDPGLKPLTISY--DPATCLHIWNNGYSFLVEFEDSTDKSVVEG 117

Query: 363 ----IRYLFRQVHWHFP------SEHVVNGTRYDLEAHLVHVS------------NDGRI 476
                 Y  +Q H+H+       SEH V+   Y  E HLVH +             +  +
Sbjct: 118 GPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCYPAELHLVHWNAVKFESFEDAALEENGL 177

Query: 477 AVLAVMYQIGETPNPILSLIEDDLKKLAET-PGVKKG-----IGYLDPNLLQARGRRYYR 638
           AV+ V  ++G+           +L+KL +T P +K        G  DP+ L      Y+ 
Sbjct: 178 AVIGVFLKLGKH--------HKELQKLVDTLPSIKHKDTLVEFGSFDPSCLMPTCPDYWT 229

Query: 639 YMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI-------HDESKTNARPLQTIND 797
           Y GSLTTPP +E V W + +    V + Q+   R  +             N RPLQ + +
Sbjct: 230 YSGSLTTPPLSESVTWIIKKQPVEVDRDQLEQFRTLLFTFEGEKEKRMVDNFRPLQPLMN 289

Query: 798 RFVK 809
           R V+
Sbjct: 290 RTVR 293



>sp|P28651|CAH8_MOUSE Carbonic anhydrase-related protein (CARP)
           (CA-VIII).
          Length = 290

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 75/287 (26%), Positives = 122/287 (42%), Gaps = 47/287 (16%)
 Frame = +3

Query: 90  KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS------N 251
           + +E   EWG  Y+E  +     WG + P+    + G+ Q+PI+L S+   Y        
Sbjct: 21  EEEEEGVEWG--YEEGVE-----WGLVFPD----ANGEYQSPINLNSREARYDPSLLDVR 69

Query: 252 LGPIQNYYMRDVATLENHGY---------GMMLSWPLGQRYLGINGIRYLFRQVHWHFP- 401
           L P  NY +     + N G+          ++   PL Q      G  +   +V +H+  
Sbjct: 70  LSP--NYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQ------GQEFELYEVRFHWGR 121

Query: 402 -----SEHVVNGTRYDLEAHLVH------------VSNDGRIAVLAVMYQIGETPNPILS 530
                SEH VN   + +E HL+H            V     IA++A+  QIG+    + +
Sbjct: 122 ENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKA 181

Query: 531 LIEDDLKKLAETPGVKKGIGYLDPNLLQARG--RRYYRYMGSLTTPPCTEGVVWTVIRTI 704
           + E  + +  +  G  K I   +PN L      R Y+ Y GSLT PPC+EGV W + R  
Sbjct: 182 VTE--ILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYP 239

Query: 705 RSVTKQQVALIRN-AIHDESK-----------TNARPLQTINDRFVK 809
            ++++ Q+   R    H +              N RP Q ++DR ++
Sbjct: 240 LTISQMQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIR 286



>sp|Q9QZA0|CA5B_MOUSE Carbonic anhydrase VB, mitochondrial precursor
           (EC 4.2.1.1) (Carbonate dehydratase VB)
           (CA-VB).>gb:BC034413_2097661 Mus musculus carbonic
           anhydrase 5b, mitochondrial, mRNA (cDNA clone MGC:35938
           IMAGE:4221296), complete cds.
          Length = 317

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 67/244 (27%), Positives = 104/244 (42%), Gaps = 39/244 (15%)
 Frame = +3

Query: 195 AGKMQTPIDLESKPVVYS-NLGPIQNYYMRDVAT---LENHGYGMMLSWPLGQRYLGING 362
           AG  Q+PI++  +  VY   L P+   Y  D AT   + N+GY  ++ +        + G
Sbjct: 60  AGDRQSPINIRWRDSVYDPGLKPLTISY--DPATCLHIWNNGYSFLVEFEDSTDKSVVEG 117

Query: 363 ----IRYLFRQVHWHFP------SEHVVNGTRYDLEAHLVHVS------------NDGRI 476
                 Y  +Q H+H+       SEH V+   Y  E HLVH +             +  +
Sbjct: 118 GPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCYPAELHLVHWNAVKFESFEDAALEENGL 177

Query: 477 AVLAVMYQIGETPNPILSLIEDDLKKLAET-PGVKKG-----IGYLDPNLLQARGRRYYR 638
           AV+ V  ++G+           +L+KL +T P +K        G  DP+ L      Y+ 
Sbjct: 178 AVIGVFLKLGKH--------HKELQKLVDTLPSIKHKDTLVEFGSFDPSCLMPTCPDYWT 229

Query: 639 YMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI-------HDESKTNARPLQTIND 797
           Y GSLTTPP +E V W + +    V + Q+   R  +             N RPLQ + +
Sbjct: 230 YSGSLTTPPLSESVTWIIKKQPVEVDRDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMN 289

Query: 798 RFVK 809
           R V+
Sbjct: 290 RTVR 293



>pir|B64668|B64668 carbonic anhydrase - Helicobacter pylori (strain
           26695)>gb:AE000624_25350 Helicobacter pylori 26695
           section 102 of 134 of the complete
           genome.>gb:AE000511_880789 Helicobacter pylori 26695
           complete genome.
          Length = 202

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 64/220 (29%), Positives = 98/220 (44%), Gaps = 24/220 (10%)
 Frame = +3

Query: 36  MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP 215
           M K F IA   L++T  +   E + +W +   +N + GP  W +L  ++  C +GK Q+P
Sbjct: 1   MKKTFLIA---LALTASLVGAE-NTKWDY---KNKENGPHRWDKLHKDFEVCKSGKSQSP 53

Query: 216 IDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLG--------------QRYLG 353
           I++E              Y+ +D A L+   +    S P                  ++ 
Sbjct: 54  INIE------------HYYHTQDKADLQ---FKYAASKPKAVFFTHHTLKASFEPTNHIN 98

Query: 354 INGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIG-ETPN--PI 524
             G  Y+   VH+H P E ++N     L AH VH    GR+ VLA+ ++ G E PN  PI
Sbjct: 99  YRGHDYVLDNVHFHAPMEFLINNKTRPLSAHFVHKDAKGRLLVLAIGFEEGKENPNLDPI 158

Query: 525 LSLIE--DDLKKLAETPGVKKGIGY-----LDPNLLQARG 623
           L  I+   + K++A    + K I Y     L P LL  RG
Sbjct: 159 LEGIQKKQNFKEVALDAFLPKSINYYHLTALSPLLLAQRG 198



>pir|S12867|S12867 carbonate dehydratase-related protein -
           mouse>gb:MMCARP_2114408 Mouse mRNA for carbonic
           anhydrase-related polypeptide.
          Length = 303

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 75/287 (26%), Positives = 122/287 (42%), Gaps = 47/287 (16%)
 Frame = +3

Query: 90  KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS------N 251
           + +E   EWG  Y+E  +     WG + P+    + G+ Q+PI+L S+   Y        
Sbjct: 22  EEEEEGVEWG--YEEGVE-----WGLVFPD----ANGEYQSPINLNSREARYDPSLLDVR 70

Query: 252 LGPIQNYYMRDVATLENHGY---------GMMLSWPLGQRYLGINGIRYLFRQVHWHFP- 401
           L P  NY +     + N G+          ++   PL Q      G  +   +V +H+  
Sbjct: 71  LSP--NYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQ------GQEFELYEVRFHWGR 122

Query: 402 -----SEHVVNGTRYDLEAHLVH------------VSNDGRIAVLAVMYQIGETPNPILS 530
                SEH VN   + +E HL+H            V     IA++A+  QIG+    + +
Sbjct: 123 ENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKA 182

Query: 531 LIEDDLKKLAETPGVKKGIGYLDPNLLQARG--RRYYRYMGSLTTPPCTEGVVWTVIRTI 704
           + E  + +  +  G  K I   +PN L      R Y+ Y GSLT PPC+EGV W + R  
Sbjct: 183 VTE--ILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYP 240

Query: 705 RSVTKQQVALIRN-AIHDES-----------KTNARPLQTINDRFVK 809
            ++++ Q+   R    H +              N RP Q ++DR ++
Sbjct: 241 LTISQMQIEEFRRLRTHVKGVELVEGCDGILGDNFRPTQPLSDRVIR 287



>sp|Q18932|CAH2_CAEEL Putative carbonic anhydrase like protein 2
           precursor.>gb:U23517_1402357 Caenorhabditis elegans
           cosmid D1022, complete sequence.
          Length = 337

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 64/281 (22%), Positives = 112/281 (39%), Gaps = 36/281 (12%)
 Frame = +3

Query: 147 GPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQNYYMRDVATLENHGYGMML 323
           GP  WG L  +W  C+AG+MQ+P++++   ++Y  +L PI        A  EN G   ++
Sbjct: 16  GPDFWGLLHGDWRMCTAGQMQSPVNIDPSQLLYDPHLMPINIEGNIVEAVFENTGQLPVV 75

Query: 324 SWP--LGQRYLGING-----IRYLFRQVHWHF--------PSEHVVNGTRYDLEAHL--- 449
           +      +  + I G      RY   Q+  HF         SEH V+  R+  E  L   
Sbjct: 76  TVKDLPNRPTINITGGPTMPYRYKLHQISVHFGRADEGEKGSEHTVDRVRFPAEIQLLAY 135

Query: 450 ---------VHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDP 602
                    V +++   +  ++V+  IG+T +  L  +    + +    G    +    P
Sbjct: 136 NSALYPNFSVAMTSPRGLLAVSVIVDIGKTTSVELRRLTVASQSI-NYKGQTTNLTDFQP 194

Query: 603 NLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNA--- 773
           + L  +   Y  Y GSLT P C E V W ++     +T   + +       E+K      
Sbjct: 195 SALLPKTSHYVTYEGSLTFPGCHETVTWVILNNPIYITNDDLQIWNEMQKTETKQPEPSY 254

Query: 774 -----RPLQTINDRFVKVDXXXXXXXXXXXXXXPPTIICQI 881
                RPL+++N R V+ +              P  +  ++
Sbjct: 255 MTPAYRPLKSLNGRLVRTNINVGSKQSTVSSSCPSNVYVEM 295



>gb:BC087769_2565422 Xenopus tropicalis hypothetical LOC496646, mRNA
           (cDNA clone MGC:108176 IMAGE:7007136), complete cds.
          Length = 282

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 75/291 (25%), Positives = 124/291 (42%), Gaps = 50/291 (17%)
 Frame = +3

Query: 87  IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS------ 248
           ++ ++ + EWG  Y+E  +     WG L PE    + G  Q+PI++ S+  +Y       
Sbjct: 12  VQGEKENQEWG--YEEGVE-----WGLLYPE----ANGDYQSPININSREAMYDPSLLEV 60

Query: 249 NLGPIQNYYMRDVATLENHGYGMML-----------SWPLGQRYLGINGIRYLFRQVHW- 392
            L P  +Y +     + N G+ + +             P G  Y  +N +R+     HW 
Sbjct: 61  RLTP--SYVVCRDCEVINDGHVVQILLKSKSVLKGGPLPRGHEY-ELNEVRF-----HWG 112

Query: 393 ---HFPSEHVVNGTRYDLEAHLVHVSND---------GR---IAVLAVMYQIGETP---N 518
                 SEH VN   + +E HL+H ++          G+   I ++++  QIG+      
Sbjct: 113 KENQRGSEHTVNFKAFPMELHLIHWNSTLYRSLEEAMGKVHGIVIISLFVQIGKENIGLK 172

Query: 519 PILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARG--RRYYRYMGSLTTPPCTEGVVWTV 692
            I  +++D   K     G  K I   +PN L      R Y+ Y GSLT PPC+EGV W +
Sbjct: 173 AITEVLQDIFYK-----GKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTMPPCSEGVTWIL 227

Query: 693 IRTIRSVTKQQVALIR------------NAIHDESKTNARPLQTINDRFVK 809
            R   +V++ Q+   R            +        N RP Q ++DR ++
Sbjct: 228 FRYPLTVSQTQIEEFRRLRTHIKGADLPDGCDGLMADNFRPTQPLSDRIIR 278



>gb:BC081872_2108118 Rattus norvegicus carbonic anhydrase VB,
           mitochondrial, mRNA (cDNA clone MGC:93720
           IMAGE:7106842), complete cds.
          Length = 317

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 66/238 (27%), Positives = 101/238 (42%), Gaps = 33/238 (13%)
 Frame = +3

Query: 195 AGKMQTPIDLESKPVVYS-NLGPIQNYYMRDVAT---LENHGYGMMLSWPLGQRYLGING 362
           AG  Q+PI++  +  VY   L P+   Y  D AT   + N+GY  ++ +        I G
Sbjct: 60  AGDRQSPINIRWRDSVYDPGLKPLTISY--DPATCLHIWNNGYSFLVEFEDTTDKSVIEG 117

Query: 363 ----IRYLFRQVHWHFP------SEHVVNGTRYDLEAHLVHVS------------NDGRI 476
                 Y  +Q H+H+       SEH V+   Y  E HLVH +             +  +
Sbjct: 118 GPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCYPAELHLVHWNAVKFESFEDAALEENGL 177

Query: 477 AVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLT 656
           AV+ V  ++G+    +  L+ D L  +     + K  G  DP+ L      Y+ Y GSLT
Sbjct: 178 AVIGVFLKLGKHHKELQKLV-DTLPSIKHKDTLVK-FGSFDPSCLMPTCPDYWTYSGSLT 235

Query: 657 TPPCTEGVVWTVIRTIRSVTKQQVALIRNAI-------HDESKTNARPLQTINDRFVK 809
           TPP +E V W + +    V   Q+   R  +             N RPLQ + +R V+
Sbjct: 236 TPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVR 293



>gb:BC066111_2105727 Mus musculus carbonic anhydrase 10, mRNA (cDNA
           clone MGC:90026 IMAGE:30360743), complete cds.
          Length = 304

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 58/252 (23%), Positives = 107/252 (42%), Gaps = 30/252 (11%)
 Frame = +3

Query: 150 PSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYYMRDVATLENHGYGMMLS 326
           PS WG +   W  CS GK Q+P+++E+  +++   L P++           N G      
Sbjct: 47  PSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLR----------INTG------ 90

Query: 327 WPLGQRYLGINGIRYLFRQVHWHF------PSEHVVNGTRYDLEAHLVHVSND------- 467
              G++  G     +   ++  HF       SEH++NG  +  E  L+H +++       
Sbjct: 91  ---GRKVSGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTE 147

Query: 468 -----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNL----LQAR 620
                  + V+++  ++ ++ NP L+ +   L +   T    K   YL   L    L   
Sbjct: 148 AAKSPNGLVVVSIFIKVSDSSNPFLNRM---LNRDTITRITYKNDAYLLQGLNIEELYPE 204

Query: 621 GRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIR-------NAIHDESKTNARP 779
              +  Y GS+T PPC E   W ++     +T+ Q+  +R       + I      N RP
Sbjct: 205 TSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRP 264

Query: 780 LQTINDRFVKVD 815
           +Q +N+R ++ +
Sbjct: 265 VQPLNNRCIRTN 276



>gb:AE014297_1142314 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003777_1224307 Drosophila melanogaster
           chromosome 3R, section 115 of 118 of the complete
           sequence.
          Length = 235

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 67/231 (29%), Positives = 102/231 (44%), Gaps = 25/231 (10%)
 Frame = +3

Query: 189 CSAGKMQTPIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIR 368
           CS+GK Q+PI L+S+ V  S   P+ +   +   T              G R  G    R
Sbjct: 16  CSSGKHQSPILLDSRTVSISLDIPVTSNGRKPFIT--------------GGRLKG----R 57

Query: 369 YLFRQVHWHFPS------EHVVNGTRYDLEAHLVHVSNDGR-----------IAVLAVMY 497
           Y    +H+H+ S      EH++N  R+D E H+VH +   R           +AV+A+M 
Sbjct: 58  YYADGLHFHWGSYKSRGSEHLINKRRFDAEIHIVHRNEKYRNIAQAVRQKDGLAVVAIMV 117

Query: 498 QIGETPN----PILSLIEDDLK-KLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTP 662
            I    N    P+  L+E  ++  + ++     G   LD  +     R ++ Y GSLTTP
Sbjct: 118 AIVRKDNAKSTPLSRLMEAVVRVPIEDSNATVFGQSSLDQLIGGVSHRDFFTYEGSLTTP 177

Query: 663 PCTEGVVWTVIRTIRSVTKQQVA---LIRNAIHDESKTNARPLQTINDRFV 806
            C E V W V     +VT   V+   L+R+        N R +Q +N+R V
Sbjct: 178 LCDETVTWIVFTETTTVTMSSVSKFWLLRDHWGHRLINNYRIVQDLNNRTV 228



>pir|JN0576|JN0576 carbonate dehydratase (EC 4.2.1.1) VIII -
           human>gb:AY075022_1935956 Homo sapiens carbonic
           anhydrase-related protein mRNA, complete
           cds.>gb:BC069744_1988316 Homo sapiens carbonic anhydrase
           VIII, mRNA (cDNA clone MGC:97291 IMAGE:7262540),
           complete cds.>gb:BC069794_1988350 Homo sapiens carbonic
           anhydrase VIII, mRNA (cDNA clone MGC:97303
           IMAGE:7262552), complete cds.>gb:BC082971_1989849 Homo
           sapiens cDNA clone MGC:99509 IMAGE:3939369, complete
           cds.
          Length = 290

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 75/287 (26%), Positives = 122/287 (42%), Gaps = 47/287 (16%)
 Frame = +3

Query: 90  KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS------N 251
           + +E   EWG  Y+E  +     WG + P+    + G+ Q+PI+L S+   Y        
Sbjct: 21  EEEEEGVEWG--YEEGVE-----WGLVFPD----ANGEYQSPINLNSREARYDPSLLDVR 69

Query: 252 LGPIQNYYMRDVATLENHGY---------GMMLSWPLGQRYLGINGIRYLFRQVHWHFP- 401
           L P  NY +     + N G+          ++   PL Q      G  +   +V +H+  
Sbjct: 70  LSP--NYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQ------GHEFELYEVRFHWGR 121

Query: 402 -----SEHVVNGTRYDLEAHLVH------------VSNDGRIAVLAVMYQIGETPNPILS 530
                SEH VN   + +E HL+H            V     IA++A+  QIG+    + +
Sbjct: 122 ENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKA 181

Query: 531 LIEDDLKKLAETPGVKKGIGYLDPNLLQARG--RRYYRYMGSLTTPPCTEGVVWTVIRTI 704
           + E  + +  +  G  K I   +PN L      R Y+ Y GSLT PPC+EGV W + R  
Sbjct: 182 VTE--ILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYP 239

Query: 705 RSVTKQQVALIRN-AIHDESK-----------TNARPLQTINDRFVK 809
            ++++ Q+   R    H +              N RP Q ++DR ++
Sbjct: 240 LTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIR 286



>sp|P35219|CAH8_HUMAN Carbonic anhydrase-related protein (CARP)
           (CA-VIII).>gb:HUMCARP_2029855 Homo sapiens carbonic
           anhydrase-related protein VIII (CA8) mRNA, partial cds.
          Length = 289

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 75/287 (26%), Positives = 122/287 (42%), Gaps = 47/287 (16%)
 Frame = +3

Query: 90  KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS------N 251
           + +E   EWG  Y+E  +     WG + P+    + G+ Q+PI+L S+   Y        
Sbjct: 20  EEEEEGVEWG--YEEGVE-----WGLVFPD----ANGEYQSPINLNSREARYDPSLLDVR 68

Query: 252 LGPIQNYYMRDVATLENHGY---------GMMLSWPLGQRYLGINGIRYLFRQVHWHFP- 401
           L P  NY +     + N G+          ++   PL Q      G  +   +V +H+  
Sbjct: 69  LSP--NYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQ------GHEFELYEVRFHWGR 120

Query: 402 -----SEHVVNGTRYDLEAHLVH------------VSNDGRIAVLAVMYQIGETPNPILS 530
                SEH VN   + +E HL+H            V     IA++A+  QIG+    + +
Sbjct: 121 ENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKA 180

Query: 531 LIEDDLKKLAETPGVKKGIGYLDPNLLQARG--RRYYRYMGSLTTPPCTEGVVWTVIRTI 704
           + E  + +  +  G  K I   +PN L      R Y+ Y GSLT PPC+EGV W + R  
Sbjct: 181 VTE--ILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYP 238

Query: 705 RSVTKQQVALIRN-AIHDESK-----------TNARPLQTINDRFVK 809
            ++++ Q+   R    H +              N RP Q ++DR ++
Sbjct: 239 LTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIR 285


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,250,721,580
Number of Sequences: 1806583
Number of extensions: 26380638
Number of successful extensions: 67609
Number of sequences better than 10.0: 332
Number of HSP's better than 10.0 without gapping: 63879
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 67150
length of database: 581,917,975
effective HSP length: 127
effective length of database: 352,481,934
effective search space used: 101514796992
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)