BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig21
         (859 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|C86186|C86186 hypothetical protein [imported] - Arabidopsis ...   318   6e-86   Arabidopsis thaliana [mouse-ear cress]
gb:AC092556_1735454 Oryza sativa chromosome 3 BAC OSJNBa0047E24 ...   315   5e-85   
gb:AC135225_1742091 Oryza sativa chromosome 3 BAC OJ1112_G08 gen...   190   3e-47   
pir|AB2331|AB2331 50S ribosomal protein L6 [imported] - Nostoc s...   186   6e-46   Nostoc sp. PCC 7120
gb:BX572094_797170 Prochlorococcus marinus MED4 complete genome;...   179   8e-44   
gb:BA000039_725880 Thermosynechococcus elongatus BP-1 DNA, compl...   179   8e-44   
sp|O24703|RL6_SYNP6|RL6_SYNP6 50S ribosomal protein L6.>gb:AB000111_144 Sy...   177   2e-43   Synechococcus sp.
sp|P73306|RL6_SYNY3|RL6_SYNY3 50S ribosomal protein L6.>pir|S77488|S77488 ...   177   2e-43   Synechocystis sp.
sp|P95067|RL6_MYCTU|RL6_MYCTU 50S ribosomal protein L6.>pir|B70644|B70644 ...   176   5e-43   Mycobacterium tuberculosis
gb:BX572100_799088 Prochlorococcus marinus MIT9313 complete geno...   174   1e-42   
gb:BX569694_776983 Synechococcus sp. WH8102 complete genome; seg...   174   1e-42   
sp|P49548|RK6_ODOSI|RK6_ODOSI Chloroplast 50S ribosomal protein L6.>pir|S7...   174   1e-42   
gb:AE017166_396153 Prochlorococcus marinus subsp. marinus str. C...   173   4e-42   
sp|P51300|RK6_PORPU|RK6_PORPU Chloroplast 50S ribosomal protein L6.>pir|S7...   172   6e-42   Porphyra purpurea
gb:BA000040_733645 Bradyrhizobium japonicum USDA 110 DNA, comple...   172   7e-42   
gb:BX908798_829982 Parachlamydia-related symbiont UWE25, complet...   172   1e-41   
gb:AE015945_321607 Clostridium tetani E88, section 10 of 10 of t...   171   1e-41   
gb:AE016822_340962 Leifsonia xyli subsp. xyli str. CTCB07, compl...   171   2e-41   
gb:BA000028_694521 Oceanobacillus iheyensis HTE831 DNA, complete...   170   3e-41   
gb:BA000016_675430 Clostridium perfringens str. 13 DNA, complete...   170   3e-41   
gb:AE017283_431604 Propionibacterium acnes KPA171202, complete g...   170   3e-41   
gb:BA000030_702828 Streptomyces avermitilis MA-4680 genomic DNA,...   169   5e-41   
pir|AF3348|AF3348 LSU ribosomal protein L6P [imported] - Brucell...   169   5e-41   Brucella melitensis
sp|P46786|RL6_STRCO|RL6_STRCO 50S ribosomal protein L6.>gb:SCO939121_17838...   169   5e-41   
sp|Q9Z9J9|RL6_BACHD|RL6_BACHD 50S ribosomal protein L6.>pir|T44398|T44398 ...   169   8e-41   Bacillus halodurans
gb:AP006618_557183 Nocardia farcinica IFM 10152 DNA, complete ge...   168   1e-40   
gb:AE014291_308650 Brucella suis 1330 chromosome I, complete seq...   168   1e-40   
gb:BX572603_802848 Rhodopseudomonas palustris CGA009 complete ge...   168   1e-40   
sp|Q50303|RL6_MYCPN|RL6_MYCPN 50S ribosomal protein L6.>pir|S62827|S62827 ...   168   1e-40   Mycoplasma pneumoniae
gb:CP000029_82407 Staphylococcus epidermidis RP62A, complete gen...   167   2e-40   
sp|P14808|RK6_CYAPA|RK6_CYAPA Cyanelle 50S ribosomal protein L6.>pir|S1221...   167   2e-40   Cyanophora paradoxa
gb:AE017242_414887 Mycobacterium avium subsp. paratuberculosis s...   167   3e-40   
pir|AI1401|AI1401 ribosomal protein L6 [imported] - Listeria mon...   167   3e-40   Listeria monocytogenes
sp|O32998|RL6_MYCLE|RL6_MYCLE 50S ribosomal protein L6.>pir|T45381|T45381 ...   167   3e-40   Mycobacterium leprae
gb:BX897700_829031 Bartonella quintana str. Toulouse, complete g...   166   4e-40   
sp|Q9XD21|RL6_LEPIN|RL6_LEPIN 50S ribosomal protein L6.>gb:AE011262_270992...   166   5e-40   
gb:AE008692_240269 Zymomonas mobilis subsp. mobilis ZM4, complet...   166   7e-40   
pir|H87405|H87405 ribosomal protein L6 [imported] - Caulobacter ...   166   7e-40   Caulobacter vibrioides
pir|AH1777|AH1777 ribosomal protein L6 [imported] - Listeria inn...   166   7e-40   Listeria innocua
gb:AY673996_1621437 Gracilaria tenuistipitata var. liui chloropl...   165   1e-39   
gb:AE017331_445006 Listeria monocytogenes str. 4b F2365, section...   165   1e-39   
gb:BX248355_761818 Corynebacterium diphtheriae gravis NCTC13129,...   164   2e-39   
gb:BA000043_736698 Geobacillus kaustophilus HTA426 DNA, complete...   164   2e-39   
pir|S50001|S50001 ribosomal protein L6 - Streptomyces coelicolor...   164   2e-39   Streptomyces coelicolor
sp|P02391|RL6_BACST|RL6_BACST 50S ribosomal protein L6 (BL10).>pir|A02766|...   164   2e-39   Geobacillus stearothermophilus
gb:BX897699_827645 Bartonella henselae strain Houston-1, complet...   164   3e-39   
sp|P47412|RL6_MYCGE|RL6_MYCGE 50S ribosomal protein L6.>pir|D64218|D64218 ...   163   3e-39   Mycoplasma genitalium
gb:AE017340_457655 Idiomarina loihiensis L2TR, complete genome.       163   4e-39   
gb:AE016775_329913 Pseudomonas putida KT2440 section 2 of 21 of ...   163   4e-39   
gb:BACRGB_746182 B.stearothermophilus ribosomal protein L6 gene,...   162   6e-39   
gb:AE016947_364351 Enterococcus faecalis V583, section 1 of 11 o...   162   8e-39   
pir|F83114|F83114 50S ribosomal protein L6 PA4248 [imported] - P...   162   8e-39   Pseudomonas aeruginosa
gb:AE017180_401132 Geobacter sulfurreducens PCA, complete genome.     161   2e-38   
gb:AE016924_359132 Chromobacterium violaceum ATCC 12472 section ...   161   2e-38   
gb:BA000035_715335 Corynebacterium efficiens YS-314 DNA, complet...   160   3e-38   
pir|F97283|F97283 ribosomal protein L6 [imported] - Clostridium ...   160   3e-38   Clostridium acetobutylicum
gb:BA000045_743987 Gloeobacter violaceus PCC 7421 DNA, complete ...   160   4e-38   
pir|F90020|F90020 50S ribosomal protein L6 [imported] - Staphylo...   160   4e-38   Staphylococcus aureus subsp. aureus N315
gb:AF036708_471588 Mycoplasma gallisepticum strain A5969var.B ri...   159   5e-38   
gb:BA000036_718265 Corynebacterium glutamicum ATCC 13032 DNA, co...   159   6e-38   
gb:CP000002_855906 Bacillus licheniformis ATCC 14580, complete g...   159   8e-38   
gb:AE017333_446084 Bacillus licheniformis DSM 13, complete genome.    159   8e-38   
pir|AI2813|AI2813 50S ribosomal protein L6 [imported] - Agrobact...   159   8e-38   Agrobacterium fabrum str. C58
gb:AE016858_350095 Pseudomonas syringae pv. tomato str. DC3000 s...   158   1e-37   
sp|O46908|RK6_GUITH|RK6_GUITH Chloroplast 50S ribosomal protein L6.>gb:AF0...   158   1e-37   Guillardia theta
gb:AY372454_614043 Uncultured marine gamma proteobacterium EB000...   157   2e-37   
gb:AP006840_570246 Symbiobacterium thermophilum DNA, complete ge...   157   2e-37   
sp|O52347|RL6_MYCGA|RL6_MYCGA 50S ribosomal protein L6.>gb:AE016967_369335...   157   2e-37   
gb:AY552545_627862 Uncultured marine gamma proteobacterium EBAC2...   157   3e-37   
pir|B69695|B69695 ribosomal protein L6 (BL8) rplF - Bacillus sub...   157   3e-37   Bacillus subtilis
sp|P46898|RL6_BACSU|RL6_BACSU 50S ribosomal protein L6 (BL10).                  157   3e-37   Bacillus subtilis
gb:AE017313_439569 Desulfovibrio vulgaris subsp. vulgaris str. H...   156   4e-37   
gb:AE016827_343662 Mannheimia succiniciproducens MBEL55E, comple...   156   4e-37   
gb:AE006177_216288 Pasteurella multocida subsp. multocida str. P...   156   4e-37   
gb:AL935254_550932 Lactobacillus plantarum strain WCFS1 complete...   155   7e-37   
gb:AE017201_403729 Lactobacillus johnsonii NCC 533, section 2 of...   155   7e-37   
gb:SME591787_185389 Sinorhizobium meliloti 1021 complete chromos...   155   9e-37   
sp|P46181|RL6_BUCAK|RL6_BUCAK 50S ribosomal protein L6.>pir|JC2281|JC2281 ...   154   2e-36   
gb:AE016998_375183 Bacillus cereus ATCC 14579 section 1 of 18 of...   154   2e-36   
gb:CR543861_104984 Acinetobacter sp. ADP1 complete genome.            154   2e-36   
gb:CR378663_93751 Photobacterium profundum SS9; segment 1/12.         154   3e-36   
gb:AB045221_6815 Lactobacillus gasseri lecLA2-20 gene for lectin...   154   3e-36   
gb:BX640423_808300 Bordetella parapertussis strain 12822, comple...   153   4e-36   
pir|A37315|A37315 ribosomal protein L6 - Chlamydia trachomatis>g...   153   4e-36   Chlamydia trachomatis
pir|G81232|G81232 50S ribosomal protein L6 NMB0157 [imported] - ...   153   4e-36   Neisseria meningitidis serogroup B
gb:BX640422_808016 Bordetella pertussis strain Tohama I, complet...   152   6e-36   
gb:BA000012_666208 Mesorhizobium loti MAFF303099 DNA, complete g...   152   6e-36   
gb:AE017248_415830 Treponema denticola ATCC 35405, section 3 of ...   152   6e-36   
gb:TARIBPROT_197308 Thermus aquaticus rps8, rpl6, rpl18, rps5, r...   152   6e-36   
gb:CP000033_88613 Lactobacillus acidophilus NCFM, complete genome.    152   6e-36   
pir|H82003|H82003 50S ribosomal protein L6 NMA0114 [imported] - ...   152   6e-36   Neisseria meningitidis serogroup A
sp|P24316|RL6_THETH|RL6_THETH 50S ribosomal protein L6.                         152   6e-36   Thermus thermophilus
gb:CR555306_107578 Azoarcus sp. EbN1 complete genome.                 152   8e-36   
gb:AE004969_61474 Neisseria gonorrhoeae FA 1090, complete genome.     152   1e-35   
pir|H81266|H81266 50S ribosomal protein L6 Cj1692c [imported] - ...   152   1e-35   Campylobacter jejuni
sp|P25056|RL6_CHLTR|RL6_CHLTR 50S ribosomal protein L6.>gb:AE001323_34451 ...   152   1e-35   Chlamydia trachomatis
sp|Q9PJM8|RL6_CHLMU|RL6_CHLMU 50S ribosomal protein L6.>pir|A81664|A81664 ...   152   1e-35   Chlamydia muridarum [agent of mouse pneumonitis]
gb:CP000020_870428 Vibrio fischeri ES114 chromosome I, complete ...   151   1e-35   
pir|B64094|B64094 ribosomal protein L6 - Haemophilus influenzae ...   151   1e-35   Haemophilus influenzae
pir|B75314|B75314 ribosomal protein L6 - Deinococcus radiodurans...   151   1e-35   Deinococcus radiodurans
sp|P44347|RL6_HAEIN|RL6_HAEIN 50S ribosomal protein L6.                         151   1e-35   Haemophilus influenzae
sp|Q9RSL3|RL6_DEIRA|RL6_DEIRA 50S ribosomal protein L6.                         151   1e-35   Deinococcus radiodurans
gb:BX950851_842750 Erwinia carotovora subsp. atroseptica SCRI104...   151   2e-35   
gb:AP006627_562492 Bacillus clausii KSM-K16 DNA, complete genome.     151   2e-35   
gb:CP000031_84560 Silicibacter pomeroyi DSS-3, complete genome.       150   2e-35   
gb:AE010470_263445 Fusobacterium nucleatum subsp. nucleatum ATCC...   150   4e-35   
sp|O83234|RL6_TREPA|RL6_TREPA 50S ribosomal protein L6.>pir|F71356|F71356 ...   150   4e-35   Treponema pallidum
sp|Q9Z7S1|RL6_CHLPN|RL6_CHLPN 50S ribosomal protein L6.>pir|F86569|F86569 ...   150   4e-35   Chlamydia pneumoniae
gb:BX571661_778984 Wolinella succinogenes, complete genome; segm...   149   5e-35   
gb:BA000031_705732 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...   149   5e-35   
gb:AP006628_566650 Onion yellows phytoplasma OY-M DNA, complete ...   149   5e-35   
gb:CP000027_79494 Dehalococcoides ethenogenes 195, complete genome.   149   7e-35   
gb:CP000009_862392 Gluconobacter oxydans 621H, complete genome.       149   9e-35   
gb:AE017282_429070 Methylococcus capsulatus str. Bath, complete ...   149   9e-35   
gb:AE016994_374174 Chlamydophila caviae GPIC section 1 of 4 of t...   149   9e-35   
gb:AE013171_289845 Thermoanaerobacter tengcongensis MB4, section...   149   9e-35   
pir|D90583|D90583 50S ribosomal protein L6 [imported] - Mycoplas...   148   1e-34   Mycoplasma pulmonis
gb:CP000013_869724 Borrelia garinii PBi, complete genome.             148   1e-34   
gb:BA000026_694348 Mycoplasma penetrans HF-2 DNA, complete genome.    148   1e-34   
gb:AL646073_547932 Ralstonia solanacearum GMI1000 chromosome, co...   148   1e-34   
pir|AI0027|AI0027 50S ribosomal protein L6 [imported] - Yersinia...   148   1e-34   Yersinia pestis
sp|Q9ZAE4|RL6_THEMA|RL6_THEMA 50S ribosomal protein L6.>pir|E72248|E72248 ...   148   1e-34   Thermotoga maritima
gb:BX842654_825765 Bdellovibrio bacteriovorus complete genome, s...   147   2e-34   
gb:TMRIBPRSA_197859 Thermotoga maritima DNA for spc operon.           147   2e-34   
gb:AE016799_335507 Vibrio vulnificus CMCP6 chromosome I section ...   147   3e-34   
gb:AE013598_297269 Xanthomonas oryzae pv. oryzae KACC10331, comp...   147   3e-34   
gb:AE012965_287632 Chlorobium tepidum TLS section 186 of 194 of ...   147   3e-34   
gb:AE017148_391146 Helicobacter hepaticus ATCC 51449 section 5 o...   146   4e-34   
gb:BX571965_792997 Burkholderia pseudomallei strain K96243, chro...   146   6e-34   
gb:BX251410_764425 Tropheryma whipplei TW08/27, complete genome;...   146   6e-34   
gb:AE016852_349064 Tropheryma whipplei str. Twist, section 3 of ...   146   6e-34   
sp|Q9KNZ9|RL6_VIBCH|RL6_VIBCH 50S ribosomal protein L6.>pir|G82057|G82057 ...   146   6e-34   
gb:BX571874_789566 Photorhabdus luminescens subsp. laumondii TTO...   145   1e-33   
gb:AE012189_280176 Xanthomonas campestris pv. campestris str. AT...   145   1e-33   
gb:AE011728_275941 Xanthomonas axonopodis pv. citri str. 306, se...   145   1e-33   
pir|D65123|R5EC6 ribosomal protein L6 [validated] - Escherichia ...   144   2e-33   
sp|P02390|RL6_ECOLI|RL6_ECOLI 50S ribosomal protein L6.                         144   2e-33   Escherichia coli [E. coli]
gb:AE016960_367501 Coxiella burnetii strain RSA 493, section 1 o...   144   2e-33   
gb:AE015473_314670 Shewanella oneidensis MR-1 section 22 of 457 ...   144   2e-33   
gb:AE012554_283879 Xylella fastidiosa Temecula1, section 2 of 9 ...   144   2e-33   
pir|AH1007|AH1007 50S ribosomal chain protein L6 [imported] - Sa...   144   2e-33   Salmonella enterica subsp. enterica serovar Typhi
sp|Q8XFL6|RL6_SALTY|RL6_SALTY 50S ribosomal protein L6.                         144   2e-33   Salmonella enterica subsp. enterica serovar Typhimurium
gb:BX294146_769410 Pirellula sp. strain 1 complete genome; segme...   144   3e-33   
gb:AE014295_312254 Bifidobacterium longum NCC2705, complete genome.   143   4e-33   
gb:BX842644_822732 Mycoplasma mycoides subsp. mycoides SC genomi...   143   5e-33   
gb:AE017156_393285 Haemophilus ducreyi strain 35000HP section 6 ...   143   5e-33   
pir|S29886|S29886 ribosomal protein L6 - Micrococcus luteus>gb:M...   142   6e-33   Micrococcus luteus
sp|P04448|RL6_MYCCA|RL6_MYCCA 50S ribosomal protein L6.>pir|S02846|R5YM6 r...   142   6e-33   Mycoplasma capricolum
sp|P33099|RL6_MICLU|RL6_MICLU 50S ribosomal protein L6.                         142   6e-33   Micrococcus luteus
gb:ECSPC_132779 Escherichia coli spc ribosomal protein operon.        142   1e-32   
sp|O51446|RL6_BORBU|RL6_BORBU 50S ribosomal protein L6.>pir|D70161|D70161 ...   142   1e-32   Borreliella burgdorferi
gb:AE015024_314288 Streptococcus mutans UA159 section 172 of 185...   141   1e-32   
gb:AF022186_1761937 Cyanidium caldarium strain RK1 chloroplast, ...   141   2e-32   
gb:AE017263_420690 Mesoplasma florum L1 complete genome.              141   2e-32   
pir|C86885|C86885 50S ribosomal protein L6 [imported] - Lactococ...   140   2e-32   Lactococcus lactis subsp. lactis
gb:AJ749949_530797 Francisella tularensis subsp. tularensis comp...   140   3e-32   
gb:AY774332_2149045 Synthetic construct Francisella tularensis c...   139   5e-32   
pir|H82713|H82713 50S ribosomal protein L6 XF1167 [imported] - X...   139   5e-32   Xylella fastidiosa
sp|P56034|RL6_HELPY|RL6_HELPY 50S ribosomal protein L6.>pir|H64682|H64682 ...   139   9e-32   Helicobacter pylori
gb:AE017332_445463 Mycoplasma hyopneumoniae 232, complete genome.     138   2e-31   
pir|D97897|D97897 50S ribosomal protein L6 [imported] - Streptoc...   138   2e-31   Streptococcus pneumoniae R6
pir|G97823|G97823 50S ribosomal protein L6 [imported] - Ricketts...   137   2e-31   Rickettsia conorii
gb:AY198133_596877 Spiroplasma kunkelii strain CR2-3x partial ge...   137   3e-31   
gb:AE017197_402604 Rickettsia typhi str. Wilmington complete gen...   137   3e-31   
gb:AE017178_398044 Porphyromonas gingivalis W83 section 7 of 8 o...   137   3e-31   
sp|Q9ZCS0|RL6_RICPR|RL6_RICPR 50S ribosomal protein L6.>pir|B71670|B71670 ...   137   3e-31   Rickettsia prowazekii
pir|E97592|E97592 50S ribosomal protein L6 nmb0157 [imported] - ...   137   3e-31   Agrobacterium fabrum str. C58
gb:CP000023_875765 Streptococcus thermophilus LMG 18311, complet...   135   8e-31   
gb:AE016937_362079 Bacteroides thetaiotaomicron VPI-5482, sectio...   135   1e-30   
gb:AB002583_1508869 Cyanidioschyzon merolae chloroplast DNA, com...   135   1e-30   
pir|D95026|D95026 ribosomal protein L6 [imported] - Streptococcu...   134   2e-30   Streptococcus pneumoniae
sp|Q9ZJS6|RL6_HELPJ|RL6_HELPJ 50S ribosomal protein L6.>pir|H71833|H71833 ...   134   2e-30   Helicobacter pylori
gb:BX321857_772744 Nitrosomonas europaea ATCC 19718, complete ge...   134   2e-30   
gb:AE017308_437872 Mycoplasma mobile 163K complete genome.            134   2e-30   
pir|G82916|G82916 ribosomal protein L6 UU246 [imported] - Ureapl...   133   4e-30   Ureaplasma urealyticum
gb:AP006841_574686 Bacteroides fragilis YCH46 DNA, complete genome.   132   1e-29   
gb:AE006478_219322 Streptococcus pyogenes M1 GAS, section 7 of 1...   132   1e-29   
pir|B84989|B84989 50S ribosomal protein L6 [imported] - Buchnera...   130   2e-29   Buchnera sp.
sp|P57576|RL6_BUCAI|RL6_BUCAI 50S ribosomal protein L6.                         130   2e-29   
gb:SAG766843_169601 Streptococcus agalactiae NEM316 complete gen...   130   3e-29   
gb:AE014194_305415 Streptococcus agalactiae 2603V/R section 4 of...   129   7e-29   
gb:AY191298_596055 Aster yellows phytoplasma clone A448 genomic ...   129   9e-29   
gb:CR628336_110521 Legionella pneumophila str. Paris complete ge...   127   4e-28   
sp|O21255|RM06_RECAM|RM06_RECAM Mitochondrial 60S ribosomal protein L6.>pir...   127   4e-28   Reclinomonas americana
gb:AE014124_303393 Buchnera aphidicola str. Sg (Schizaphis grami...   125   1e-27   
sp|Q8K964|RL6_BUCAP|RL6_BUCAP 50S ribosomal protein L6.                         124   2e-27   
gb:AY744382_644921 Buchnera aphidicola (Cinara cedri) genomic se...   123   4e-27   
gb:BA000021_687304 Wigglesworthia glossinidia endosymbiont of Gl...   122   9e-27   
sp|Q89A80|RL6_BUCBP|RL6_BUCBP 50S ribosomal protein L6.>gb:AE014017_302842...   121   1e-26   
gb:CR382132_1665362 Yarrowia lipolytica chromosome F of strain C...   121   2e-26   
gb:AF295546_1259614 Malawimonas jakobiformis mitochondrial DNA, ...   119   6e-26   
sp|O67565|RL6_AQUAE|RL6_AQUAE 50S ribosomal protein L6.>pir|D70442|D70442 ...   119   6e-26   Aquifex aeolicus
gb:AE017347_1757957 Cryptococcus neoformans var. neoformans JEC2...   119   1e-25   
gb:AY268081_604346 Candidatus Portiera aleyrodidarum, partial ge...   116   6e-25   
gb:TASPCOP_197332 T.aquaticus spc operon for ribosomal proteins ...   115   1e-24   
pir|S15442|S15442 ribosomal protein L6 - Thermus aquaticus (frag...   115   1e-24   Thermus thermophilus
sp|Q09865|RM06_SCHPO|RM06_SCHPO Putative 60S ribosomal protein L6, mitochon...   110   4e-23   Schizosaccharomyces pombe
sp|Q9ZI38|RL6_AQUPY|RL6_AQUPY 50S ribosomal protein L6.>gb:AF040101_472195...   108   1e-22   Aquifex pyrophilus
gb:BX248584_763823 Blochmannia floridanus complete genome; segme...   106   5e-22   
sp|P32904|RM06_YEAST|RM06_YEAST 60S ribosomal protein L6, mitochondrial pre...   105   1e-21   Saccharomyces cerevisiae [brewer's yeast]
gb:CR522870_99985 Desulfotalea psychrophila LSv54 chromosome.         103   4e-21   
gb:CP000030_83740 Anaplasma marginale str. St. Maries, complete ...   101   2e-20   
gb:SCMTRPL6_1708807 S.cerevisiae gene for mitochondrial ribosoma...   100   4e-20   
gb:CR925677_117874 Ehrlichia ruminantium str. Gardel, complete g...    99   1e-19   
gb:AF110138_1768729 Nephroselmis olivacea mitochondrion, complet...    98   2e-19   
gb:CR767821_116956 Ehrlichia ruminantium strain Welgevonden, com...    97   3e-19   
gb:CR380955_1651592 Candida glabrata strain CBS138 chromosome I ...    97   5e-19   
gb:AE017258_418417 Wolbachia endosymbiont of Drosophila melanoga...    94   3e-18   
gb:CR382125_1657933 Kluyveromyces lactis strain NRRL Y-1140 chro...    92   1e-17   
sp|P46748|RM06_PROWI|RM06_PROWI Mitochondrial 60S ribosomal protein L6.>pir...    92   1e-17   Prototheca wickerhamii
gb:CR382134_1667063 Debaryomyces hansenii chromosome B of strain...    91   2e-17   
gb:AC006439_1534287 Arabidopsis thaliana chromosome 2 clone T30D...    90   6e-17   
gb:AE017321_441959 Wolbachia endosymbiont strain TRS of Brugia m...    90   6e-17   
pir|H84563|H84563 probable ribosomal protein L6 [imported] - Ara...    90   6e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AY534144_1612200 Saprolegnia ferax strain ATCC 36051 mitochon...    89   1e-16   
gb:AE016817_1747254 Ashbya gossypii (= Eremothecium gossypii) AT...    84   3e-15   
gb:AC135228_1742179 Oryza sativa chromosome 3 BAC OSJNBb0122C16 ...    77   5e-13   
gb:U17009_1726280 Phytophthora infestans mitochondrion, complete...    76   9e-13   
gb:AY267353_1593888 Chara vulgaris mitochondrion, complete genome.     75   2e-12   
gb:AP005918_1860106 Oryza sativa (japonica cultivar-group) genom...    74   4e-12   
gb:AF494279_1805291 Chaetosphaeridium globosum mitochondrial DNA...    74   5e-12   
sp|P26861|RM06_MARPO|RM06_MARPO Mitochondrial 60S ribosomal protein L6.>pir...    72   1e-11   Marchantia polymorpha
gb:LDI344328_1684118 Laminaria digitata complete mitochondrial g...    72   2e-11   
gb:AP006878_576677 Thermococcus kodakaraensis strain KOD1 DNA, c...    71   3e-11   
gb:AF193903_1775596 Cafeteria roenbergensis mitochondrial DNA, c...    67   6e-10   
sp|Q9V1V1|RL6_PYRAB|RL6_PYRAB 50S ribosomal protein L6P.>pir|H75145|H75145...    66   7e-10   Pyrococcus abyssi
gb:PLI277126_1700584 Pilayella littoralis complete mitochondrial...    64   3e-09   
gb:AE013454_292470 Methanosarcina mazei strain Goe1, section 236...    64   3e-09   
gb:AE010278_261375 Pyrococcus furiosus DSM 3638, section 153 of ...    64   5e-09   
pir|F71185|F71185 probable ribosomal protein L6 - Pyrococcus hor...    64   5e-09   Pyrococcus horikoshii
sp|O59433|RL6_PYRHO|RL6_PYRHO 50S ribosomal protein L6P.                         64   5e-09   Pyrococcus horikoshii
gb:MC388_143094 M.capricolum DNA for CONTIG MC388.                     63   6e-09   
sp|P54042|RL6_METJA|RL6_METJA 50S ribosomal protein L6P.>pir|G64358|G64358...    63   8e-09   Methanocaldococcus jannaschii
gb:AY714814_1188353 Uncultured archaeon GZfos10C7 clone GZfos10C...    61   2e-08   
gb:AE017261_419673 Picrophilus torridus DSM 9790, complete genome.     61   2e-08   
gb:AE009873_256774 Pyrobaculum aerophilum strain IM2 section 128...    61   2e-08   
sp|P14030|RL6_METVA|RL6_METVA 50S ribosomal protein L6P.>pir|S05620|R5MX6 ...    61   3e-08   Methanococcus vannielii
gb:AF370037_505423 Azospirillum sp. MI13 50S ribosomal protein L...    59   2e-07   
gb:AE017199_403072 Nanoarchaeum equitans Kin4-M, complete genome.      58   2e-07   
gb:CHTOMPD_846351 C.trachomatis outer membrane binding protein (...    57   3e-07   
gb:AF288090_1783348 Rhodomonas salina mitochondrial DNA, complet...    57   5e-07   
gb:BA000023_690987 Sulfolobus tokodaii str. 7 DNA, complete genome.    56   1e-06   
gb:BX957222_844668 Methanococcus maripaludis S2 complete genome;...    55   1e-06   
sp|O28370|RL6_ARCFU|RL6_ARCFU 50S ribosomal protein L6P.>pir|D69488|D69488...    54   4e-06   Archaeoglobus fulgidus
gb:AY534910_626214 Uncultured marine group II euryarchaeote Deep...    53   9e-06   
gb:AE016767_328043 Escherichia coli CFT073 section 13 of 18 of t...    53   9e-06   
sp|O21037|RM06_DICDI|RM06_DICDI Mitochondrial 60S ribosomal protein L6.>pir...    53   9e-06   Dictyostelium discoideum
gb:AF287134_1783244 Ochromonas danica mitochondrial DNA, complet...    52   2e-05   
sp|O26127|RL6_METTH|RL6_METTH 50S ribosomal protein L6P.>pir|E69120|E69120...    52   2e-05   Methanothermobacter thermautotrophicus
sp|Q9YF91|RL6_AERPE|RL6_AERPE 50S ribosomal protein L6P.>pir|E72726|E72726...    52   2e-05   Aeropyrum pernix
sp|Q9UX91|RL6_SULSO|RL6_SULSO 50S ribosomal protein L6P.>pir|D90218|D90218...    51   3e-05   Saccharolobus solfataricus
gb:AY700145_1346965 Polysphondylium pallidum mitochondrion DNA, ...    48   2e-04   
sp|O05637|RL6_SULAC|RL6_SULAC 50S ribosomal protein L6P.>gb:SSSPCOPER_1910...    48   2e-04   Sulfolobus acidocaldarius
gb:AY217738_1310240 Eimeria tenella chloroplast, complete genome.      48   3e-04   
gb:AF353999_1790638 Mesostigma viride mitochondrion, complete ge...    47   4e-04   
gb:CR380953_1650995 Candida glabrata strain CBS138 chromosome G ...    45   0.002   
gb:U87145_1406552 Toxoplasma gondii chloroplast, complete genome.      45   0.002   
sp|P51401|RL9B_YEAST|RL9B_YEAST 60S ribosomal protein L9-B (L8) (YL11) (RP2...    45   0.002   Saccharomyces cerevisiae [brewer's yeast]
sp|P05738|RL9A_YEAST|RL9A_YEAST 60S ribosomal protein L9-A (L8) (YL11) (RP2...    45   0.002   Saccharomyces cerevisiae [brewer's yeast]
pir|S16538|R5HS6L ribosomal protein L6 [validated] - Haloarcula ...    44   0.004   
sp|P14135|RL6_HALMA|RL6_HALMA 50S ribosomal protein L6P (Hmal6) (Hl10).          44   0.004   Haloarcula marismortui
gb:CR380951_1650150 Candida glabrata strain CBS138 chromosome E ...    44   0.005   
gb:PCA9693_1391774 Podocoryne carnea ribosomal protein L9, partial.    43   0.009   
gb:AY648736_2541564 Danio rerio 60S ribosomal protein L9 mRNA, c...    42   0.011   
gb:CR382125_1657623 Kluyveromyces lactis strain NRRL Y-1140 chro...    42   0.015   
gb:AY190735_2518053 Pagrus major ribosomal protein L9 mRNA, comp...    42   0.020   
gb:CCPRIBA_1645907 Cyanophora paradoxa cyanelle genes rpl5, rps8...    42   0.020   
gb:AY141976_2514899 Danio rerio ribosomal protein L9 mRNA, parti...    41   0.026   
sp|P46765|RM06_ACACA|RM06_ACACA Mitochondrial 60S ribosomal protein L6.>pir...    41   0.026   Acanthamoeba castellanii
gb:CR382138_1671506 Debaryomyces hansenii chromosome F of strain...    41   0.033   
gb:CR522870_99984 Desulfotalea psychrophila LSv54 chromosome.          40   0.044   
sp|P49209|RL9_ARATH|RL9_ARATH 60S ribosomal protein L9.>pir|F86455|F86455 ...    40   0.057   Arabidopsis thaliana [mouse-ear cress]
gb:AY086680_1571724 Arabidopsis thaliana clone 26744 mRNA, compl...    40   0.074   
gb:BC060589_2104074 Rattus norvegicus ribosomal protein L9, mRNA...    39   0.097   
sp|P17077|RL9_RAT|RL9_RAT 60S ribosomal protein L9.>pir|JH0222|R5RT9 rib...    39   0.097   Rattus norvegicus [brown rat]
sp|P51410|RL9_MOUSE|RL9_MOUSE 60S ribosomal protein L9.>gb:AK012331_115689...    39   0.097   Mus musculus [mouse]
sp|Q90YW0|RL9_ICTPU|RL9_ICTPU 60S ribosomal protein L9.>gb:AF401562_249198...    39   0.097   Ictalurus punctatus
gb:AE017341_1753865 Cryptococcus neoformans var. neoformans JEC2...    39   0.13    
gb:AE016817_1747094 Ashbya gossypii (= Eremothecium gossypii) AT...    39   0.13    
gb:CR382126_1658547 Kluyveromyces lactis strain NRRL Y-1140 chro...    39   0.13    
sp|Q10232|RL9A_SCHPO|RL9A_SCHPO 60S ribosomal protein L9-A.>pir|T38875|T388...    39   0.13    
gb:AY742820_1961617 Macaca fascicularis RPL9 mRNA, complete cds.       39   0.17    
gb:AB099048_1410371 Bos taurus mRNA for similar to ribosomal pro...    39   0.17    
pir|S65792|S65792 ribosomal protein L9, cytosolic - human>gb:HSU...    39   0.17    
sp|P32969|RL9_HUMAN|RL9_HUMAN 60S ribosomal protein L9.>gb:AY320412_117776...    39   0.17    
gb:AJ606308_1906848 Homo sapiens mRNA for secreted mucin MUC17 (...    38   0.22    
gb:AJ606307_1906847 Homo sapiens mRNA for membrane mucin MUC17 (...    38   0.22    
gb:AF430017_1901957 Homo sapiens intestinal membrane mucin MUC17...    38   0.22    
sp|Q963B7|RL9_SPOFR|RL9_SPOFR 60S ribosomal protein L9.>gb:AF391091_126740...    38   0.22    
gb:BC046581_2549640 Xenopus laevis ribosomal protein L9, mRNA (c...    38   0.28    
gb:BA000011_664787 Thermoplasma volcanium GSS1 DNA, complete gen...    38   0.28    
gb:AY769277_1350428 Bombyx mori ribosomal protein L9 (RpL9) mRNA...    37   0.37    
sp|O74905|RL9B_SCHPO|RL9B_SCHPO 60S ribosomal protein L9-B.>pir|T41472|T414...    37   0.37    
gb:PSRPL9PRT_1702390 Pisum sativum rpL9 gene for ribosomal prote...    37   0.48    
gb:CR859325_1183448 Pongo pygmaeus mRNA; cDNA DKFZp468P184 (from...    37   0.48    
sp|P30707|RL9_PEA|RL9_PEA 60S ribosomal protein L9 (Gibberellin-regulate...    37   0.48    
gb:CR382131_1664656 Yarrowia lipolytica chromosome E of strain C...    37   0.63    
gb:AY829770_1180169 Lonomia obliqua ribosomal protein 13 mRNA, c...    37   0.63    
gb:AY752832_1179975 Culicoides sonorensis clone CsRPL9 ribosomal...    37   0.63    
pir|H58930|H58930 ribosomal protein L6 - Cyanidioschyzon merolae...    37   0.63    
gb:CNS07EG9_1372834 chromosome II of strain GB-M1 of Encephalito...    36   0.82    
pir|S71255|S71255 ribosomal protein L9, cytosolic - Arabidopsis ...    36   0.82    
pir|H90106|H90106 60S ribosomal protein L9 [imported] - Guillard...    36   1.1     
gb:BC086937_2109862 Mus musculus cDNA clone MGC:107692 IMAGE:678...    35   1.4     
sp|O02376|RL9_HAECO|RL9_HAECO 60S ribosomal protein L9 (Fragment).>gb:HCRI...    35   1.4     
gb:TACID5_197009 Thermoplasma acidophilum complete genome; segme...    35   1.8     
pir|T04180|T04180 ribosomal protein L9.F7L13.30, cytosolic - Ara...    35   1.8     
sp|P53243|YG2A_YEAST|YG2A_YEAST Putative 91.0 kDa zinc finger protein in SP...    35   2.4     
gb:AP000383_1819904 Arabidopsis thaliana genomic DNA, chromosome...    34   3.1     
gb:AY017376_1424069 Bos taurus ribosomal protein L9-like protein...    34   4.1     
gb:AE017282_428080 Methylococcus capsulatus str. Bath, complete ...    34   4.1     
gb:BC080334_2561651 Xenopus tropicalis MGC79562 protein, mRNA (c...    29   5.2     
gb:AY130412_2514073 Petromyzon marinus ribosomal protein L9 mRNA...    33   5.3     
gb:BX640452_817657 Bordetella bronchiseptica strain RB50, comple...    33   7.0     
gb:BX640422_808249 Bordetella pertussis strain Tohama I, complet...    33   7.0     


>pir|C86186|C86186 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889541 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AY040077_1560574 Arabidopsis thaliana
           putative chloroplast 50S ribosomal protein L6
           (At1g05190) mRNA, complete cds.>gb:AY085715_1570782
           Arabidopsis thaliana clone 1730 mRNA, complete
           sequence.>gb:YUP8H12_1731286 Arabidopsis thaliana
           chromosome 1 YAC yUP8H12 complete
           sequence.>gb:AF360265_1791214 Arabidopsis thaliana
           putative chloroplast 50S ribosomal protein L6
           (At1g05190) mRNA, complete cds.
          Length = 223

 Score =  318 bits (816), Expect = 6e-86
 Identities = 153/203 (75%), Positives = 177/203 (87%)
 Frame = +3

Query: 138 RSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGP 317
           RS F+GD +  +      A+  +  KT+ECKESRIGKQPI VPSNVTI +EGQD KVKGP
Sbjct: 12  RSAFLGDRNVFKVSSTPFAQVGYSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKVKGP 71

Query: 318 LGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQ 497
           LGEL +TYPREV+L KEESG LRV+K +ETRRAN+MHGLFRTLTDNM+VGVSKGF+KKL 
Sbjct: 72  LGELALTYPREVELTKEESGFLRVKKTVETRRANQMHGLFRTLTDNMVVGVSKGFEKKLI 131

Query: 498 LVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASI 677
           LVGVGYRA V+GK++VLNLGFSHPV+M IPD L+VKVEENTRITVSGYDKS IGQFAA++
Sbjct: 132 LVGVGYRATVDGKELVLNLGFSHPVKMQIPDSLKVKVEENTRITVSGYDKSEIGQFAATV 191

Query: 678 RKWRPPEPYKGKGVKYADEVIRR 746
           RKWRPPEPYKGKGVKY+DE++RR
Sbjct: 192 RKWRPPEPYKGKGVKYSDEIVRR 214



>gb:AC092556_1735454 Oryza sativa chromosome 3 BAC OSJNBa0047E24
           genomic sequence, complete sequence.>gb:AF377947_1793308
           Oryza sativa (japonica cultivar-group) chromosome 3, BAC
           clone OSJNBa0032E21, complete sequence.
          Length = 226

 Score =  315 bits (808), Expect = 5e-85
 Identities = 153/205 (74%), Positives = 175/205 (85%)
 Frame = +3

Query: 132 NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK 311
           N R+ F+G   GI    +   R  FVRKT+ECKESRIGK+PI VPSNVT+ +E Q  K K
Sbjct: 13  NSRTGFLGKRQGICLHVIPAGRVGFVRKTIECKESRIGKKPIEVPSNVTLTLEEQFIKAK 72

Query: 312 GPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKK 491
           GPLGEL + YP EVK+ KEESG LRV K +ET+RAN+MHGLFRTLTDN+IVGVSKGFDKK
Sbjct: 73  GPLGELSLNYPGEVKVVKEESGKLRVSKTVETKRANQMHGLFRTLTDNIIVGVSKGFDKK 132

Query: 492 LQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAA 671
           LQLVGVGYRA VEGKD+V+NLGFSHPVRMA+P+GL+VKVEENTRI VSGYDKS IGQFAA
Sbjct: 133 LQLVGVGYRAAVEGKDLVMNLGFSHPVRMAVPEGLKVKVEENTRIIVSGYDKSEIGQFAA 192

Query: 672 SIRKWRPPEPYKGKGVKYADEVIRR 746
           SI+KWRPPEPYKGKG++YADEV+RR
Sbjct: 193 SIKKWRPPEPYKGKGIRYADEVVRR 217



>gb:AC135225_1742091 Oryza sativa chromosome 3 BAC OJ1112_G08
           genomic sequence, complete sequence.
          Length = 111

 Score =  190 bits (482), Expect = 3e-47
 Identities = 89/102 (87%), Positives = 99/102 (97%)
 Frame = +3

Query: 441 TLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENT 620
           TLTDN+IVGVSKGFDKKLQLVGVGYRA VEGKD+V+NLGFSHPVRMA+P+GL+VKVEENT
Sbjct: 1   TLTDNIIVGVSKGFDKKLQLVGVGYRAAVEGKDLVMNLGFSHPVRMAVPEGLKVKVEENT 60

Query: 621 RITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           RI VSGYDKS IGQFAASI+KWRPPEPYKGKG++YADEV+RR
Sbjct: 61  RIIVSGYDKSEIGQFAASIKKWRPPEPYKGKGIRYADEVVRR 102



>pir|AB2331|AB2331 50S ribosomal protein L6 [imported] - Nostoc sp.
           (strain PCC 7120)>gb:BA000019_685190 Nostoc sp. PCC 7120
           DNA, complete genome.
          Length = 182

 Score =  186 bits (471), Expect = 6e-46
 Identities = 89/171 (52%), Positives = 122/171 (71%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+PI VP+ V + ++G    VKGP GEL    P  V +  +E   L+V +  ETR 
Sbjct: 2   SRIGKRPITVPAKVQVTIDGTKVVVKGPKGELSRELPANVSVS-QEGETLQVTRRDETRT 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           + ++HGL RTL  NM+ GVS+GF ++L++ GVGYRA V+G+++VLN+G+SH V++  PDG
Sbjct: 61  SRQLHGLSRTLVANMVEGVSQGFQRRLEIQGVGYRAQVQGRNLVLNMGYSHQVQIEPPDG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +Q  VE NT + VSGYDK  +G  AA +R  RPPEPYKGKG++YA EV+RR
Sbjct: 121 IQFVVENNTNVIVSGYDKEIVGNTAAKVRAVRPPEPYKGKGIRYAGEVVRR 171



>gb:BX572094_797170 Prochlorococcus marinus MED4 complete genome;
           segment 5/5.
          Length = 179

 Score =  179 bits (453), Expect = 8e-44
 Identities = 88/171 (51%), Positives = 118/171 (69%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK P+ +P  V++ ++G    VKGP GEL    P  V  +++E+ ++ V  A   R 
Sbjct: 2   SRIGKSPVQIPEKVSVDIKGLSITVKGPKGELKRLMPEGVNFDQKENQIV-VTPATTKRY 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           + E HGL RTL  NM+ GV++G++KKL++VGVG RA V+GK++V++ G+SHPV M  PDG
Sbjct: 61  SRERHGLCRTLISNMVQGVTEGYEKKLEIVGVGSRAQVKGKNLVVSAGYSHPVEMTPPDG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +  KVE NT +TVSG DK  +G  AA IR  RPPEPYKGKG+KY DE I R
Sbjct: 121 ITYKVESNTNVTVSGIDKEIVGNEAAKIRSIRPPEPYKGKGIKYQDERIIR 171



>gb:BA000039_725880 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 187

 Score =  179 bits (453), Expect = 8e-44
 Identities = 87/179 (48%), Positives = 125/179 (69%), Gaps = 8/179 (4%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+PIP+P NVT+ ++GQ   VKGP G+L   +P EV + +E   ++ V++  ++R 
Sbjct: 2   SRIGKRPIPLPKNVTLTLDGQQVTVKGPKGQLSRVFPPEVNVVQEGEAIV-VKRRDDSRP 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A E HGL RTL  NM+ GVS+GF KKL++ GVGYRA ++GK +VL++G+SHPV +  P+G
Sbjct: 61  AKERHGLCRTLLANMVEGVSQGFTKKLEIQGVGYRAQLQGKTLVLSMGYSHPVEIVPPEG 120

Query: 594 LQVKVEEN--------TRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + +++E+N        T + VSG DK  +G  +A IR  RPPEPYKGKG++Y  E +RR
Sbjct: 121 ITLEIEDNQGKKVQQGTIVLVSGIDKELVGNTSARIRAVRPPEPYKGKGIRYMGEFVRR 179



>sp|O24703|RL6_SYNP6 50S ribosomal protein L6.>gb:AB000111_144
           Synechococcus sp. gene for ribosomal proteins, complete
           cds.>gb:AP008231_581574 Synechococcus elongatus PCC 6301
           DNA, complete genome.
          Length = 179

 Score =  177 bits (450), Expect = 2e-43
 Identities = 84/171 (49%), Positives = 121/171 (70%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+PIP+P+ V++ ++G+   VKGP GEL    P  V + +E+  ++ V +A E+R 
Sbjct: 2   SRIGKRPIPIPAKVSVAIDGRLVSVKGPKGELSRELPSGVVVTQEDGNII-VSRADESRL 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A + HGL RTL  N++ GV  GF K+L+++GVGYRA V+G  ++LN+G+S+PV++  P+G
Sbjct: 61  ARQRHGLSRTLVANLVEGVDSGFQKRLEIIGVGYRAQVQGTTLILNVGYSNPVQIEPPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +Q  VE NT + VSG  K  +G  AA IR  RPPEPYKGKG++YA EV+ R
Sbjct: 121 IQFVVENNTNVVVSGISKEVVGNTAARIRAVRPPEPYKGKGIRYAGEVVLR 171



>sp|P73306|RL6_SYNY3 50S ribosomal protein L6.>pir|S77488|S77488
           ribosomal protein L6 - Synechocystis sp. (strain PCC
           6803)>gb:BA000022_688114 Synechocystis sp. PCC 6803 DNA,
           complete genome.
          Length = 179

 Score =  177 bits (449), Expect = 2e-43
 Identities = 84/171 (49%), Positives = 118/171 (69%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+PIP+P+ V++ ++G    VKGP G L    P +V +  +E   + V +  E+R 
Sbjct: 2   SRIGKRPIPLPAKVSVDIQGSHLSVKGPKGSLERQLPEKV-IVAQEGETITVTRQDESRT 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A E HGL RTL  NM+ GV++GF+++L++ GVGYRA  +G  + LN+G+S PV M +P G
Sbjct: 61  ARERHGLVRTLVANMVDGVAQGFERRLEIQGVGYRAQAQGNKLTLNVGYSKPVEMTMPQG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           ++VKVE NT++ VSG DK  +G  AA IR  RPPEPYKGKG++Y  E +RR
Sbjct: 121 IEVKVENNTQVIVSGIDKELLGNTAAKIRAVRPPEPYKGKGIRYQGEYVRR 171



>sp|P95067|RL6_MYCTU 50S ribosomal protein L6.>pir|B70644|B70644
           probable ribosomal protein L6 rplF - Mycobacterium
           tuberculosis (strain H37RV)>gb:AE000516_20749
           Mycobacterium tuberculosis CDC1551, complete
           genome.>gb:BX248336_758097 Mycobacterium bovis subsp.
           bovis AF2122/97 complete genome; segment
           3/14.>gb:BX842574_818770 Mycobacterium tuberculosis
           H37Rv complete genome; segment 3/13.
          Length = 179

 Score =  176 bits (446), Expect = 5e-43
 Identities = 81/171 (47%), Positives = 116/171 (67%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGKQPIPVP+ V + +EGQ   VKGP G LG+T    +K+ + + G + V +  + RR
Sbjct: 2   SRIGKQPIPVPAGVDVTIEGQSISVKGPKGTLGLTVAEPIKVARNDDGAIVVTRPDDERR 61

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HGL RTL  N++ GV++G+  K+++ GVGYR  ++G ++   LG+SHPV +  P+G
Sbjct: 62  NRSLHGLSRTLVSNLVTGVTQGYTTKMEIFGVGYRVQLKGSNLEFALGYSHPVVIEAPEG 121

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +   V+  T+ TVSG DK  +GQ AA+IR+ R P+PYKGKGV+Y  E IRR
Sbjct: 122 ITFAVQAPTKFTVSGIDKQKVGQIAANIRRLRRPDPYKGKGVRYEGEQIRR 172



>gb:BX572100_799088 Prochlorococcus marinus MIT9313 complete genome;
           segment 6/7.
          Length = 179

 Score =  174 bits (442), Expect = 1e-42
 Identities = 87/171 (50%), Positives = 115/171 (67%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK PIP+P  V + ++G    VKGP GEL  T P  V + + E+ ++ V    + R+
Sbjct: 2   SRIGKNPIPIPDKVAVTLDGLAVSVKGPKGELSRTLPEGVSVSQVENTIV-VTPTSQKRK 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           + E HGL R+L  NM+ GVSKG+ +KL+L+GVG RA V+GK +V++ GFSHPV M  P+G
Sbjct: 61  SRERHGLCRSLVANMVEGVSKGYTRKLELIGVGSRAQVKGKKLVVSAGFSHPVEMDPPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +   VE NT +TVSG DK  +G  AA IR  RPPEPYKGKG++Y  E I R
Sbjct: 121 VTFAVENNTNVTVSGADKELVGNEAAKIRAIRPPEPYKGKGIRYEGERILR 171



>gb:BX569694_776983 Synechococcus sp. WH8102 complete genome;
           segment 6/7.
          Length = 179

 Score =  174 bits (442), Expect = 1e-42
 Identities = 87/171 (50%), Positives = 115/171 (67%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK P+PVP  VT+ ++G   KVKGP GEL  T P  V + ++ + ++ V  +   R 
Sbjct: 2   SRIGKNPVPVPDKVTVSLDGLTVKVKGPKGELERTLPDGVSVSQDNNCIV-VAPSTSKRF 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           + E HGL RTL  NMI GV+ G+ K L++VGVG RA V+GK +V++ G+SHPV M  P+G
Sbjct: 61  SRERHGLCRTLVANMIEGVNNGYSKSLEIVGVGSRAQVKGKTLVVSAGYSHPVEMEPPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +  KVE NT++ VSG DK  +G  AA +R  RPPEPYKGKG+KY  E I R
Sbjct: 121 ITFKVENNTKVIVSGIDKELVGNEAAKVRAIRPPEPYKGKGIKYEGERIMR 171



>sp|P49548|RK6_ODOSI Chloroplast 50S ribosomal protein
           L6.>pir|S78261|S78261 ribosomal protein L6, chloroplast
           - Odontella sinensis chloroplast>gb:OSCHLPLXX_1692846
           Odontella sinensis complete chloroplast genome.
          Length = 179

 Score =  174 bits (442), Expect = 1e-42
 Identities = 87/171 (50%), Positives = 112/171 (65%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK PI +P+NV I   G D  VKG  G L  T P  + +E E  G L V     TR 
Sbjct: 2   SRIGKLPIKIPANVDITCSGPDLTVKGKFGTLHNTIPDAIGIE-EIDGSLIVNVKDNTRS 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HGL+RTL +NM+ GVS+ F   L L GVGYRA V+G  I+LNLG+SHPV + IP+G
Sbjct: 61  NRALHGLYRTLINNMVTGVSEQFQLTLNLQGVGYRASVQGNSIILNLGYSHPVELVIPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + V+V +NT I +   DK  +G FA++IR WRPPEPYKGKG+ Y  E+++R
Sbjct: 121 ISVEVVQNTTINLKACDKGNLGLFASNIRSWRPPEPYKGKGILYKGEIVKR 171



>gb:AE017166_396153 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 6 of 6 of the complete
           genome.>gb:AE017126_1031822 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 179

 Score =  173 bits (438), Expect = 4e-42
 Identities = 88/171 (51%), Positives = 116/171 (67%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+PIPVP  V + ++G    VKGP GEL  T P  V +++ + G++ V    E R+
Sbjct: 2   SRIGKKPIPVPEKVAVTLDGLLVTVKGPKGELTRTLPEGVTIDQTD-GLIIVSADSEKRK 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           + E HGL RTL  NMI GV+ G+ K+L++VGVG RA V+GK +V++ G+SHPV +  P+G
Sbjct: 61  SRERHGLSRTLVANMIEGVNNGYSKQLEIVGVGSRAQVKGKTLVVSAGYSHPVEVIPPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +  KVE NT + VSG DK  +G  AA IR  RPPEPYKGKG+KY  E I R
Sbjct: 121 ITFKVENNTNVLVSGIDKELVGNEAAKIRAIRPPEPYKGKGIKYLGERILR 171



>sp|P51300|RK6_PORPU Chloroplast 50S ribosomal protein
           L6.>pir|S73221|S73221 ribosomal protein L6, chloroplast
           - red alga (Porphyra purpurea)
           chloroplast>gb:PPU38804_1701616 Porphyra purpurea
           chloroplast, complete genome.
          Length = 180

 Score =  172 bits (437), Expect = 6e-42
 Identities = 83/170 (48%), Positives = 119/170 (70%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+ + +P+N++ + +GQ   V GP G L  T P  + LE  + G + V+ +  ++R
Sbjct: 2   SRIGKKIVLLPTNISTQFDGQTITVNGPKGTLLRTLPEGITLEIND-GTILVQTSGNSKR 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           AN++HGL RTL  NMI GVS GF KKLQ+ GVGYR+ ++  +++L++G+SH V +  P  
Sbjct: 61  ANQLHGLSRTLISNMIEGVSTGFSKKLQIQGVGYRSQIDNNNLILSVGYSHVVTIQPPQN 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           +++KVE NT ITV G DK  +GQ A+SIR  RPPEPYKGKG++Y  EV+R
Sbjct: 121 IEIKVENNTSITVLGIDKEVVGQVASSIRSIRPPEPYKGKGIRYQGEVVR 170



>gb:BA000040_733645 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 177

 Score =  172 bits (436), Expect = 7e-42
 Identities = 85/171 (49%), Positives = 119/171 (69%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+GK+P+ VPS VT  ++GQ  K+KGP G+L      +V++ K ESG ++V+  +ET R
Sbjct: 2   SRVGKRPVAVPSGVTATVDGQTVKMKGPKGQLQFVVHDDVEV-KLESGQIKVKPRLETNR 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A  ++G  R    N++ GV+KGF+KKL++ GVGYRA ++GK++ L LG+SH V   IP+G
Sbjct: 61  ARALYGTARAQVANLVEGVTKGFEKKLEITGVGYRAAMQGKNLQLALGYSHDVIYTIPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + + V + T ITV+G D   +GQ AA IR +RPPEPYKGKGVKY  E I R
Sbjct: 121 ITITVPKPTEITVTGSDIQRVGQVAAEIRSYRPPEPYKGKGVKYVGEFIFR 171



>gb:BX908798_829982 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 182

 Score =  172 bits (435), Expect = 1e-41
 Identities = 86/171 (50%), Positives = 118/171 (69%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR GK PI +P+ V +K+   +  VKGP G L       V +  E + VL V  A E  +
Sbjct: 4   SRKGKLPISLPNGVEVKVSNTEVAVKGPKGALTQKLIPGVNVNVEGNEVL-VSLADEEAK 62

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
               HGL+RTL  NM+VG ++GF+KKL+++GVGYRA V+G  + L LGFSHP ++ IP G
Sbjct: 63  LAHFHGLYRTLIHNMVVGTTEGFEKKLEMIGVGYRAAVQGDLLDLQLGFSHPCKLPIPKG 122

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           L VKV++NT IT+SG+DK  +GQFAA++R  RPPEPY+GKG++YA E +R+
Sbjct: 123 LAVKVDKNTLITISGFDKHLVGQFAATVRSQRPPEPYQGKGIRYAGEFVRK 173



>gb:AE015945_321607 Clostridium tetani E88, section 10 of 10 of the
           complete genome.>gb:AE015927_964396 Clostridium tetani
           E88, complete genome.
          Length = 180

 Score =  171 bits (434), Expect = 1e-41
 Identities = 84/172 (48%), Positives = 121/172 (70%), Gaps = 1/172 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDF-KVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR 410
           SRIG+ PI +P+ VT+ +  ++   VKGP GEL  T    + +  EE+ V+  RK  E +
Sbjct: 2   SRIGRLPIAIPNGVTVTVSPENVVTVKGPKGELTKTMHPNIDIAIEENSVIVTRKNDE-K 60

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
           +   +HGL R+L +NM+VGV++G++KKL+LVGVGYRA ++GK +VLNLGFSHPV +   +
Sbjct: 61  QNRSLHGLTRSLVNNMVVGVTEGYEKKLELVGVGYRAQLQGKKLVLNLGFSHPVEIEAKE 120

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           G++ +++   +ITV G DK  +G  A+ IR WR PEPYKGKG+KY +E IRR
Sbjct: 121 GVEFQLDGTNKITVKGIDKELVGAVASDIRSWRKPEPYKGKGIKYENEAIRR 172



>gb:AE016822_340962 Leifsonia xyli subsp. xyli str. CTCB07, complete
           genome.
          Length = 178

 Score =  171 bits (433), Expect = 2e-41
 Identities = 86/171 (50%), Positives = 118/171 (69%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG+ PI VP+ V +K++GQ   VKGP GEL +T    ++++ EE  VL V +  + R 
Sbjct: 2   SRIGRLPIDVPAGVDVKIDGQAVTVKGPKGELSLTVASPIEVKLEEGQVL-VTRPDDERE 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           +  +HGL RTL +N IVGV++G+ K L++VG GYR   +G  +   LGFSHPV +  P G
Sbjct: 61  SRSLHGLTRTLLNNNIVGVTQGYSKGLEIVGTGYRVAQKGAGVEFALGFSHPVTVEPPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +   VE N ++TV+G DK A+G+ AA+IRK R PEPYKGKGV+YA EV+RR
Sbjct: 121 ITFTVEGNNKLTVAGIDKQAVGEVAANIRKIRKPEPYKGKGVRYAGEVVRR 171



>gb:BA000028_694521 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 178

 Score =  170 bits (431), Expect = 3e-41
 Identities = 78/171 (45%), Positives = 117/171 (68%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+G +P+ +P  V +K++     VKGP GEL      ++K+  E++ VL V +  + + 
Sbjct: 2   SRVGLKPVEIPEGVELKLDNNTVTVKGPKGELSRELHPDMKINIEDN-VLTVERPSDHKE 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HG  R+L +NM++GVSKGF+K L+++GVGYRA  +G   V+N G+SHPV +   DG
Sbjct: 61  HRALHGTTRSLINNMVIGVSKGFEKSLEIIGVGYRAQKQGDKTVINAGYSHPVELEAIDG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           ++++V +NT+ITV G DK  +G  AA+IR  RPPEPYKGKG++Y DE +RR
Sbjct: 121 IEIEVPKNTQITVKGIDKELVGAIAANIRAIRPPEPYKGKGIRYTDEYVRR 171



>gb:BA000016_675430 Clostridium perfringens str. 13 DNA, complete
           genome.
          Length = 179

 Score =  170 bits (431), Expect = 3e-41
 Identities = 82/172 (47%), Positives = 119/172 (69%), Gaps = 1/172 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDF-KVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR 410
           SR+GK PI +P+ VT+ +  ++   VKGP GEL     +++ +  E++ V+ V +  + +
Sbjct: 2   SRVGKMPIAIPAGVTVTVTPENVVTVKGPKGELVKAMHKDINIAVEDAQVV-VTRPSDVK 60

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
               +HGL R L +NM+VGVS+GF K L+L GVGYRA ++GK +V+NLG+SHPV +   D
Sbjct: 61  EHRALHGLTRALLNNMVVGVSQGFSKTLELNGVGYRAQLQGKKLVMNLGYSHPVEVEAVD 120

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           G+  K++  T++ V G DK  +G  AA+IR WR PEPYKGKG+KY+DEVIRR
Sbjct: 121 GVDFKLDGTTKVIVEGIDKEKVGAVAANIRSWRKPEPYKGKGIKYSDEVIRR 172



>gb:AE017283_431604 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 180

 Score =  170 bits (431), Expect = 3e-41
 Identities = 82/172 (47%), Positives = 116/172 (67%), Gaps = 1/172 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG+ PI VPS V +K++GQ  +VKGP G L  T    + + K + G + V +  + R 
Sbjct: 2   SRIGRLPIAVPSGVEVKLDGQYVEVKGPKGTLNFTVREPITVSKNDEGAILVERPDDERE 61

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEG-KDIVLNLGFSHPVRMAIPD 590
              +HGL RTL +NM++GV++G++KKL++ GVGYR + +G K +  NLGFSHPV +  P+
Sbjct: 62  NRSLHGLTRTLINNMVIGVTEGYEKKLEIQGVGYRVLSKGPKQLEFNLGFSHPVIVDAPE 121

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           G+   VE  T+ +V G DK  +G+ AA+IRK R PEPYKGKGV+Y  E +RR
Sbjct: 122 GITFAVENPTKFSVQGIDKQVVGETAANIRKIRKPEPYKGKGVRYEGENVRR 173



>gb:BA000030_702828 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 179

 Score =  169 bits (429), Expect = 5e-41
 Identities = 82/171 (47%), Positives = 115/171 (67%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK PI VP+ V + ++G+  +VKGP G L  T    +++ K E GVL V +  + R+
Sbjct: 2   SRIGKLPITVPAGVDVTIDGRTVQVKGPKGSLSHTIAAPIEIAKGEDGVLNVTRPNDERQ 61

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HGL RTL  NMI GV++G+ KKL++ GVGYR + +G ++  +LG+SH + +  P+G
Sbjct: 62  NKALHGLSRTLVANMITGVTQGYVKKLEISGVGYRVLAKGSNLEFSLGYSHSITVEAPEG 121

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +  KVE  TR +V G DK  +G+ AA+IRK R P+PYK KGVKY  EVIRR
Sbjct: 122 ITFKVEAPTRFSVEGIDKQKVGEVAANIRKLRKPDPYKAKGVKYEGEVIRR 172



>pir|AF3348|AF3348 LSU ribosomal protein L6P [imported] - Brucella
           melitensis  (strain 16M)>gb:AE009518_252690 Brucella
           melitensis 16M chromosome I, section 75 of 195 of the
           complete sequence.>gb:AE008917_978602 Brucella
           melitensis 16M chromosome I, complete sequence.
          Length = 177

 Score =  169 bits (429), Expect = 5e-41
 Identities = 89/171 (52%), Positives = 114/171 (66%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+P+PVP+ VT  +EGQ  K KG  GEL      EV L K E G +RV    ++R 
Sbjct: 2   SRIGKKPVPVPAGVTASVEGQTVKAKGAKGELSFVVHDEV-LVKMEDGAVRVDPRDQSRE 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A    G+ RT+  N+ VGV  GF+KKL++ GVGYRA ++GK++ L+LGFSH V   +P G
Sbjct: 61  ARSKWGMSRTMISNIFVGVKDGFEKKLEISGVGYRAAMQGKNLQLSLGFSHEVVYDVPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + V V + T I V+G DK  +GQ AA IR++R PEPYKGKGVKYA E I R
Sbjct: 121 ITVAVPKPTEIVVTGIDKQQVGQVAAEIREYRGPEPYKGKGVKYAGEKIVR 171



>sp|P46786|RL6_STRCO 50S ribosomal protein L6.>gb:SCO939121_178389
           Streptomyces coelicolor A3(2) complete genome; segment
           18/29.
          Length = 179

 Score =  169 bits (429), Expect = 5e-41
 Identities = 82/171 (47%), Positives = 114/171 (66%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK PI VP+ V + ++G+   VKGP G L  T    + + K E GVL V +  + R+
Sbjct: 2   SRIGKLPIAVPAGVDVTIDGRTVSVKGPKGSLTHTVVAPIDIAKGEDGVLNVTRPNDERQ 61

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           +  +HGL RTL  NMI GV++G+ KKL++ GVGYR + +G ++  +LG+SHP+ +  P+G
Sbjct: 62  SKALHGLSRTLVANMITGVTQGYVKKLEISGVGYRVLAKGSNLEFSLGYSHPILVEAPEG 121

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +  KVE  T  +V G DK  +G+ AA+IRK R P+PYK KGVKY  EVIRR
Sbjct: 122 ITFKVENPTHFSVEGIDKQKVGEVAANIRKLRKPDPYKAKGVKYEGEVIRR 172



>sp|Q9Z9J9|RL6_BACHD 50S ribosomal protein L6.>pir|T44398|T44398
           ribosomal protein L6 (BL8) rplF [imported] - Bacillus
           halodurans (strain C-125)>gb:AB017508_3263 Bacillus
           halodurans C-125 genomic DNA, 32 kb fragment, complete
           cds.>gb:BA000004_654095 Bacillus halodurans C-125 DNA,
           complete genome.
          Length = 178

 Score =  169 bits (427), Expect = 8e-41
 Identities = 80/171 (46%), Positives = 117/171 (68%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG +P+ +PS VT+ + G D  VKGP GEL  T+  E+ ++ E++ V+ V +  + + 
Sbjct: 2   SRIGNKPVEIPSGVTVTVNGADVTVKGPKGELKRTFNPEIVVKVEDNTVV-VERPSDKKE 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HG  R+L  NM+ GVSKGF+K L+LVGVGYRA   G+ +VLN+G+SHPV +    G
Sbjct: 61  HRALHGTTRSLISNMVEGVSKGFEKSLELVGVGYRAQKSGQKLVLNVGYSHPVEIVPEKG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           ++++V  NT++TV G DK  +G  A++IR  R PEPYKGKG++Y  E +RR
Sbjct: 121 IEIEVPSNTKVTVKGIDKERVGAVASNIRSVRLPEPYKGKGIRYEGEYVRR 171



>gb:AP006618_557183 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 179

 Score =  168 bits (426), Expect = 1e-40
 Identities = 82/171 (47%), Positives = 112/171 (65%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+PI VPS V I ++GQ   VKGP G L  T    + + + E G L V +  + RR
Sbjct: 2   SRIGKKPIAVPSGVEITIDGQHVSVKGPKGTLTHTVAEPITVTRGEDGQLEVTRPNDERR 61

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HGL RTL  NMI GV+KG++KK+++ GVGYR   +G ++   LG+SHPV +  P+G
Sbjct: 62  NRSLHGLTRTLIANMIEGVTKGYEKKMEIFGVGYRVQAKGSNLEFALGYSHPVPVEAPEG 121

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +   VE  T+ +VSG DK  +GQ +A I   R P+PYKGKG++YA EV+RR
Sbjct: 122 ITFAVESPTKFSVSGIDKQKVGQISAVIHGLRKPDPYKGKGIRYAGEVVRR 172



>gb:AE014291_308650 Brucella suis 1330 chromosome I, complete
           sequence.
          Length = 177

 Score =  168 bits (426), Expect = 1e-40
 Identities = 88/171 (51%), Positives = 114/171 (66%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+P+PVP+ VT  +EGQ  K KG  GEL      EV L K E G +RV    +++ 
Sbjct: 2   SRIGKKPVPVPAGVTASVEGQTVKAKGAKGELSFVVHDEV-LVKMEDGAVRVDPRDQSKE 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A    G+ RT+  N+ VGV  GF+KKL++ GVGYRA ++GK++ L+LGFSH V   +P G
Sbjct: 61  ARSKWGMSRTMISNIFVGVKDGFEKKLEISGVGYRAAMQGKNLQLSLGFSHEVVYDVPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + V V + T I V+G DK  +GQ AA IR++R PEPYKGKGVKYA E I R
Sbjct: 121 ITVAVPKPTEIVVTGIDKQQVGQVAAEIREYRGPEPYKGKGVKYAGEKIVR 171



>gb:BX572603_802848 Rhodopseudomonas palustris CGA009 complete
           genome; segment 11/16.
          Length = 177

 Score =  168 bits (425), Expect = 1e-40
 Identities = 85/171 (49%), Positives = 114/171 (66%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+GK+P+ VPS VT  +EGQ  K+KGP G+L      +V + K E G ++V    ET R
Sbjct: 2   SRVGKKPVTVPSGVTATVEGQTVKMKGPKGQLQFVVHDDVDV-KFEDGAVKVAPRHETNR 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A  ++G  R    N++ GV+KGF+KKL++ GVGYRA ++GK + L LG+SH V   IP+G
Sbjct: 61  ARALYGTARAQIANLVEGVTKGFEKKLEITGVGYRAAMQGKKLQLALGYSHDVLYDIPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + + V + T I V G D   +GQ AA IR +RPPEPYKGKGV+YADE I R
Sbjct: 121 ITITVPKPTEINVVGIDPQKVGQVAAEIRDYRPPEPYKGKGVRYADEFIFR 171



>sp|Q50303|RL6_MYCPN 50S ribosomal protein L6.>pir|S62827|S62827
           ribosomal protein L6 - Mycoplasma pneumoniae (strain
           ATCC 29342)>gb:AE000061_19547 Mycoplasma pneumoniae M129
           section 19 of 63 of the complete
           genome.>gb:MPU34795_149425 Mycoplasma pneumoniae cosmid
           pcosMPGT9 25kb EcoRI fragment.>gb:U00089_1101220
           Mycoplasma pneumoniae M129, complete genome.
          Length = 184

 Score =  168 bits (425), Expect = 1e-40
 Identities = 84/173 (48%), Positives = 117/173 (67%), Gaps = 2/173 (1%)
 Frame = +3

Query: 234 SRIGKQPIPV-PSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKE-ESGVLRVRKAMET 407
           S+IG + I + P+ V +  +     VKGPLG++ +  P  + L+ E +   L++ +  E 
Sbjct: 2   SKIGNRTITLDPAKVNLNFQKDHIAVKGPLGQIELKLPPNLPLKFELKDNNLQITRNNEL 61

Query: 408 RRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIP 587
           +++   HG +  L  N I+GV++GF+KKL+LVGVGYRA VEG+ + L LG+SHP++  IP
Sbjct: 62  KQSKIFHGTYNALITNAIIGVTQGFEKKLRLVGVGYRANVEGETLNLQLGYSHPIKEKIP 121

Query: 588 DGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
            GL VKVE+NT IT+SG  K  +GQFA  +RKWR PEPYKGKGV Y DEVI R
Sbjct: 122 KGLTVKVEKNTEITISGISKELVGQFATEVRKWRKPEPYKGKGVLYFDEVIVR 174



>gb:CP000029_82407 Staphylococcus epidermidis RP62A, complete
           genome.>gb:AE016750_323458 Staphylococcus epidermidis
           ATCC 12228, section 7 of 9 of the complete
           genome.>gb:AE015929_1148127 Staphylococcus epidermidis
           ATCC 12228, complete genome.
          Length = 178

 Score =  167 bits (423), Expect = 2e-40
 Identities = 81/171 (47%), Positives = 118/171 (69%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+GK+ I +PS+VT+  +G    VKGP GEL  T    +  ++EE+ V  VR + +++ 
Sbjct: 2   SRVGKKIIDIPSDVTVTFDGSHVTVKGPKGELERTLNERMTFKQEENTVEVVRPS-DSKE 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
               HG  R L +NM++GVS+G++K L+LVGVGYRA ++GKD+VLN+G+SHPV +   +G
Sbjct: 61  DRTDHGTTRALLNNMVLGVSQGYEKTLELVGVGYRAQMQGKDLVLNVGYSHPVEIKAEEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +   VE+NT + VSG  K  +G  A++IR  RPPEPYKGKG++Y  E +RR
Sbjct: 121 ITFAVEKNTTVKVSGVSKEQVGAIASNIRSVRPPEPYKGKGIRYQGEYVRR 171



>sp|P14808|RK6_CYAPA Cyanelle 50S ribosomal protein
           L6.>pir|S12218|R5KT6 ribosomal protein L6 - Cyanophora
           paradoxa cyanelle>gb:CPACYRP_1648526 Cyanophora paradoxa
           ribosomal protein l22 (rpl22) gene, partial cds;
           ribosomal protein s3 (rps3), ribosomal protein l16
           (rpl16), ribosomal protein l7 (rpl7), ribosomal protein
           l14 (rpl14), ribosomal protein l5 (rpl5), ribosomal
           protein s8 (rps8), ribosomal protein l6 (rpl6),
           ribosomal protein l18 (rpl18), ribosomal protein s5
           (rps5), and ribosomal protein secY (secY) genes,
           complete cds; and ORF gene, partial
           cds.>gb:CPU30821_1648789 Cyanophora paradoxa cyanelle,
           complete genome.
          Length = 179

 Score =  167 bits (423), Expect = 2e-40
 Identities = 80/171 (46%), Positives = 119/171 (69%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+ I +PS VT+ ++ Q F VKGP GEL    P  +++ ++   ++ V +  E+  
Sbjct: 2   SRIGKRLINIPSQVTVSIKDQVFSVKGPKGELSKQIPYGIQVVQQNDHLV-VERVAESLL 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A ++HGL RTL  N++ GV +GF+++L++ GVGYRA ++GK +VLN+GFSHPV +  P  
Sbjct: 61  ARKLHGLCRTLVSNLVQGVFQGFERRLEIQGVGYRAQMDGKKLVLNIGFSHPVVIEPPTE 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +Q++VE NT I + G DK  +G+ AA IR  RPPEPYKGKG++Y  E ++R
Sbjct: 121 IQLQVENNTNIIIKGIDKELVGKLAAEIRAVRPPEPYKGKGIRYLGENVKR 171



>gb:AE017242_414887 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 16 of 16 of the complete
           genome.>gb:AE016958_1058291 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 179

 Score =  167 bits (422), Expect = 3e-40
 Identities = 74/171 (43%), Positives = 114/171 (66%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGKQP+PVP+ V + ++GQ   VKGP G L +T    + + + + G + V +  + RR
Sbjct: 2   SRIGKQPVPVPAGVDVTIDGQKVSVKGPKGTLDLTVAEPITVSRNDDGAIVVTRPNDERR 61

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HGL RTL  N++ GV++G+  K+++ GVGYR  ++G ++   LG+SHPV +  P+G
Sbjct: 62  NRSLHGLSRTLVSNLVTGVTQGYTTKMEIFGVGYRVQLKGSNLEFALGYSHPVVIEAPEG 121

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +   V+  T+ ++SG DK  +GQ +A+IR+ R P+PYKGKGV+Y  E IRR
Sbjct: 122 ITFAVQSPTKFSISGIDKQKVGQISANIRRLRRPDPYKGKGVRYEGEQIRR 172



>pir|AI1401|AI1401 ribosomal protein L6 [imported] - Listeria
           monocytogenes  (strain EGD-e)>gb:AL591983_537108
           Listeria monocytogenes strain EGD, complete genome
           segment 11/12.
          Length = 178

 Score =  167 bits (422), Expect = 3e-40
 Identities = 78/171 (45%), Positives = 115/171 (67%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+ I +P+ VT+ + G    VKGP GEL   +  E+ + K E   + V +  + + 
Sbjct: 2   SRIGKKTIVIPAGVTVTLNGSTATVKGPKGELVKEFNPEITI-KIEGNEINVSRPTDNKN 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HG  R + +NM+VGVS+G++KKL+L+GVGYRA  +G  +VLN+G+SHPV    P G
Sbjct: 61  HRALHGTTRAILNNMVVGVSEGYEKKLELIGVGYRAQKQGDKLVLNVGYSHPVEFVAPKG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + ++V  NT++ V GY+K  +G+ AA+IR  RPPEPYKGKG++Y  E +RR
Sbjct: 121 VDIEVPANTQVIVKGYNKEHVGELAANIRAVRPPEPYKGKGIRYEGEHVRR 171



>sp|O32998|RL6_MYCLE 50S ribosomal protein L6.>pir|T45381|T45381
           ribosomal protein L6 [imported] - Mycobacterium
           leprae>gb:MLCB2492_144885 Mycobacterium leprae cosmid
           B2492.>gb:MLEPRTN7_147647 Mycobacterium leprae strain TN
           complete genome; segment 7/10.
          Length = 179

 Score =  167 bits (422), Expect = 3e-40
 Identities = 77/171 (45%), Positives = 114/171 (66%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGKQPIPVP+ V I ++GQ+  VKGP G L +T    + L + + G + V +    RR
Sbjct: 2   SRIGKQPIPVPAGVDITIDGQNVLVKGPKGTLDLTVAEPIMLARNDEGAIVVTRPDNERR 61

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HGL RTL  N++ GV++G+   +++ GVGYRA ++G ++   LG+SHPV +  P+G
Sbjct: 62  NRSLHGLSRTLVSNLVTGVTQGYTVSMEIFGVGYRAQLKGSNLEFALGYSHPVVIEAPEG 121

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +   V+  T+ T++G DK  +GQ +A+IR+ R P+PYKGKGV+Y  E IRR
Sbjct: 122 ITFAVQSPTKFTITGIDKQKVGQISANIRRLRRPDPYKGKGVRYEGEQIRR 172



>gb:BX897700_829031 Bartonella quintana str. Toulouse, complete
           genome.
          Length = 177

 Score =  166 bits (421), Expect = 4e-40
 Identities = 88/171 (51%), Positives = 114/171 (66%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+PI VPS VT  +EGQ  K KGP GEL      EV L K E  V+ V    +++ 
Sbjct: 2   SRIGKKPISVPSGVTATVEGQLVKAKGPKGELSYIVNDEV-LVKFEGNVISVSPRDQSKD 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A    G+ R++ +N+  GV  GF+KKL++ GVGYRA ++GKD+ L+LGFSH V   +P G
Sbjct: 61  ARSKWGMSRSMIENIFCGVKNGFEKKLEINGVGYRAALQGKDVQLSLGFSHDVIYKVPPG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + V V + T I +SG DK  +GQ AA IR++R PEPYKGKGVK+ADE I R
Sbjct: 121 ITVTVPKPTEIVISGIDKQQVGQVAAEIREYRRPEPYKGKGVKHADECIFR 171



>sp|Q9XD21|RL6_LEPIN 50S ribosomal protein L6.>gb:AE011262_270992
           Leptospira interrogans serovar lai str. 56601 chromosome
           I, section 71 of 397 of the complete
           sequence.>gb:AE017298_435020 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           section 12 of 14 of the complete
           sequence.>gb:AF115283_480083 Leptospira interrogans
           S10-spc-alpha locus, complete
           sequence.>gb:AE010300_1004391 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete
           sequence.>gb:AE016823_1068031 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           complete sequence.
          Length = 179

 Score =  166 bits (420), Expect = 5e-40
 Identities = 81/171 (47%), Positives = 116/171 (67%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK  I +P  V +K E  + KVKGPLGEL       + + K E+G++++ ++ E ++
Sbjct: 2   SRIGKAEIKLPDKVEVKQENANIKVKGPLGELFTPIFEGISV-KTENGIVKLERSNEDQK 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HGL R L  N + GVS+G++K L++ GVGYRA   G+D+V++LGFSH V    P G
Sbjct: 61  VVALHGLTRALLMNCVKGVSQGWEKNLEITGVGYRAQKRGEDLVMSLGFSHEVVYKAPKG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +++ V+E  +I VSG DK  +GQ AA IR  RPPEPYKGKG+KYA+E I++
Sbjct: 121 IKIDVQEQLKIKVSGIDKQLVGQVAADIRSKRPPEPYKGKGIKYAEEFIKK 171



>gb:AE008692_240269 Zymomonas mobilis subsp. mobilis ZM4, complete
           genome.
          Length = 177

 Score =  166 bits (419), Expect = 7e-40
 Identities = 82/171 (47%), Positives = 111/171 (64%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+P+ +P+ VT  +      VKGP GEL +    EV    E+ G L V+   +T+R
Sbjct: 2   SRIGKKPVAIPTGVTANIADGVLSVKGPKGELSMPLSSEVTYSLED-GQLSVQPVNDTKR 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A    G+ RTL  N+I GV++G+ K LQ+ GVGYRA  +GK + L LG+SH +  AIP+G
Sbjct: 61  ARSFWGMQRTLVQNLIDGVTQGYSKTLQITGVGYRAASQGKTLKLQLGYSHDIDFAIPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + ++  E T + +SG DK  +GQ AA IR+WR PEPYKGKG+KYA E I R
Sbjct: 121 ITIQTPEPTTVNISGIDKQKVGQVAAEIRRWRRPEPYKGKGIKYAGEFIFR 171



>pir|H87405|H87405 ribosomal protein L6 [imported] - Caulobacter
           crescentus>gb:AE005801_212407 Caulobacter crescentus
           CB15 section 127 of 359 of the complete
           genome.>gb:AE005673_922306 Caulobacter crescentus CB15
           complete genome.
          Length = 177

 Score =  166 bits (419), Expect = 7e-40
 Identities = 85/171 (49%), Positives = 116/171 (67%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+ + +PS V + + GQ   VKGP G+L  T   EV++ K+E   L +   ++T+R
Sbjct: 2   SRIGKKAVAIPSGVQVTLAGQTVTVKGPKGQLSWTIADEVEV-KQEGAELLLAPRVDTKR 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A  M GL RTL  NM+ GV+ GF++ L+LVGVGYRA ++G  + L LGFSH V +A P G
Sbjct: 61  AKGMWGLSRTLVANMVHGVTVGFEESLELVGVGYRAAMKGTALSLQLGFSHDVDVAAPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +   V + T I ++G DK A+G+ AA IR+ RPPEPYKGKGV+YA E +RR
Sbjct: 121 VTFAVPKQTEIKIAGIDKQAVGEIAAKIRRIRPPEPYKGKGVRYAGEKVRR 171



>pir|AH1777|AH1777 ribosomal protein L6 [imported] - Listeria
           innocua (strain Clip11262)>gb:AL596173_540106 Listeria
           innocua Clip11262 complete genome, segment 11/12.
          Length = 178

 Score =  166 bits (419), Expect = 7e-40
 Identities = 77/171 (45%), Positives = 116/171 (67%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+ I +P+ VT+ + G    VKGP GEL   +  E+ +  E + +  V +  + + 
Sbjct: 2   SRIGKKTIVIPAGVTVTLNGSTATVKGPKGELVKEFNPEITINIEGNEI-NVSRPTDNKN 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HG  R + +NM+VGVS+G++KKL+L+GVGYRA  +G  +VLN+G+SHPV    P G
Sbjct: 61  HRALHGTTRAILNNMVVGVSEGYEKKLELIGVGYRAQKQGDKLVLNVGYSHPVEFVAPKG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           ++++V  NT++ V GY+K  +G+ AA+IR  RPPEPYKGKG++Y  E +RR
Sbjct: 121 VEIEVPANTQVIVKGYNKEHVGELAANIRAVRPPEPYKGKGIRYEGEHVRR 171



>gb:AY673996_1621437 Gracilaria tenuistipitata var. liui
           chloroplast, complete genome.
          Length = 180

 Score =  165 bits (417), Expect = 1e-39
 Identities = 76/170 (44%), Positives = 122/170 (71%), Gaps = 1/170 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKE-ESGVLRVRKAMETR 410
           SRIGK+PI +P N+ I +   + +++GP GEL    P+ ++++++ ++  L + K  + +
Sbjct: 2   SRIGKKPINLPQNINITIIENNVQIQGPKGELSYKIPKLIQIKQDTKNNKLFLYKTEDNK 61

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
            A ++HGL RTL +NMI+GVS+GF+KKLQ+ GVGYR+ ++G +++LN+G+SH V +  P 
Sbjct: 62  EAQKLHGLCRTLINNMIIGVSQGFEKKLQIQGVGYRSQLDGDNLLLNVGYSHTVIVKPPK 121

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI 740
            + ++VE NT IT+ G  K  +G+ AA IR+ RPPEPYKGKG++Y +E I
Sbjct: 122 NIILEVENNTSITIKGIQKEQVGEIAAQIRRIRPPEPYKGKGIRYLNETI 171



>gb:AE017331_445006 Listeria monocytogenes str. 4b F2365, section 10
           of 10 of the complete genome.>gb:AE017262_1077362
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 178

 Score =  165 bits (417), Expect = 1e-39
 Identities = 77/171 (45%), Positives = 115/171 (67%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+ I +P+ VT+ + G    VKGP GEL   +  E+ +  E + +  V +  + + 
Sbjct: 2   SRIGKKTIVIPAGVTVTLNGSTATVKGPKGELVKEFNPEITINIEGNEI-NVSRPTDNKN 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HG  R + +NM+VGVS+G++KKL+L+GVGYRA  +G  +VLN+G+SHPV    P G
Sbjct: 61  HRALHGTTRAILNNMVVGVSEGYEKKLELIGVGYRAQKQGDKLVLNVGYSHPVEFVAPKG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + ++V  NT++ V GY+K  +G+ AA+IR  RPPEPYKGKG++Y  E +RR
Sbjct: 121 VDIEVPANTQVIVKGYNKEHVGELAANIRAVRPPEPYKGKGIRYEGEHVRR 171



>gb:BX248355_761818 Corynebacterium diphtheriae gravis NCTC13129,
           complete genome; segment 2/8.
          Length = 178

 Score =  164 bits (415), Expect = 2e-39
 Identities = 77/171 (45%), Positives = 118/171 (69%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+GK PI +PS V +K++GQ  +VKGP G L +T P  + +   E G + V +  + R+
Sbjct: 2   SRVGKAPIAIPSGVDVKIDGQHVEVKGPKGTLDLTIPEPI-VASIEDGQISVVRPDDHRK 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HGL R+L +NM+VGV++G+  K+++ GVGYR  ++GK++  +LG+SHPV +  P+G
Sbjct: 61  NRSLHGLSRSLVNNMVVGVTEGYTIKMEIFGVGYRVALKGKNLEFSLGYSHPVLIEAPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +   V+ NT+++VSG DK  +GQ AA IR+ R  +PYKGKG++Y  E IRR
Sbjct: 121 ITFAVDGNTKLSVSGIDKQKVGQIAAIIRRLRKDDPYKGKGIRYEGEQIRR 171



>gb:BA000043_736698 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 178

 Score =  164 bits (415), Expect = 2e-39
 Identities = 78/170 (45%), Positives = 116/170 (68%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+GK+PI +P+ VT+ + G    VKGP GEL  T+  ++ +  E   V+ V +  + + 
Sbjct: 2   SRVGKKPIEIPAGVTVTVNGNTVTVKGPKGELTRTFHPDMTITVE-GNVITVTRPSDEKH 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HG  R+L  NM+ GVSKG++K L+LVGVGYRA  +GK +VL++G+SHPV +   +G
Sbjct: 61  HRALHGTTRSLLANMVEGVSKGYEKALELVGVGYRASKQGKKLVLSVGYSHPVEIEPEEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           L+++V   T+I V G DK  +G+ AA+IR  RPPEPYKGKG++Y  E++R
Sbjct: 121 LEIEVPSQTKIIVKGADKQRVGELAANIRAVRPPEPYKGKGIRYEGELVR 170



>pir|S50001|S50001 ribosomal protein L6 - Streptomyces
           coelicolor>gb:SCSECYDNA_181616 S.coelicolor secY locus
           DNA.
          Length = 179

 Score =  164 bits (415), Expect = 2e-39
 Identities = 80/171 (46%), Positives = 112/171 (65%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK P  VP+ V + ++G+   VKGP G L  T    + + K E GVL V +  + R+
Sbjct: 2   SRIGKLPHRVPAGVDVTIDGRTVSVKGPKGSLTHTVVAPIDIAKGEDGVLNVTRPNDERQ 61

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           +  +HGL RTL  NMI GV++G+ KKL++ GVGYR + +G ++  +LG+SHP+ +  P+G
Sbjct: 62  SKALHGLSRTLVANMITGVTQGYVKKLEISGVGYRVLAKGSNLEFSLGYSHPILVEAPEG 121

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +  KVE  T  +V G DK  +G+ AA+IR  R P+PYK KGVKY  EVIRR
Sbjct: 122 ITFKVENPTHFSVEGIDKQKVGEVAANIRNVRKPDPYKAKGVKYEGEVIRR 172



>sp|P02391|RL6_BACST 50S ribosomal protein L6
           (BL10).>pir|A02766|R5BS0F ribosomal protein L6 -
           Bacillus stearothermophilus
          Length = 177

 Score =  164 bits (415), Expect = 2e-39
 Identities = 78/170 (45%), Positives = 116/170 (68%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+GK+PI +P+ VT+ + G    VKGP GEL  T+  ++ +  E   V+ V +  + + 
Sbjct: 1   SRVGKKPIEIPAGVTVTVNGNTVTVKGPKGELTRTFHPDMTITVE-GNVITVTRPSDEKH 59

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HG  R+L  NM+ GVSKG++K L+LVGVGYRA  +GK +VL++G+SHPV +   +G
Sbjct: 60  HRALHGTTRSLLANMVEGVSKGYEKALELVGVGYRASKQGKKLVLSVGYSHPVEIEPEEG 119

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           L+++V   T+I V G DK  +G+ AA+IR  RPPEPYKGKG++Y  E++R
Sbjct: 120 LEIEVPSQTKIIVKGADKQRVGELAANIRAVRPPEPYKGKGIRYEGELVR 169



>gb:BX897699_827645 Bartonella henselae strain Houston-1, complete
           genome.
          Length = 177

 Score =  164 bits (414), Expect = 3e-39
 Identities = 86/171 (50%), Positives = 115/171 (67%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+PI VPS VT  +EGQ  K KGP GEL      EV ++ EES  + V    +++ 
Sbjct: 2   SRIGKKPISVPSGVTATVEGQLVKAKGPKGELSYLVNDEVLVKLEES-FISVSPRDQSKD 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A    G+ R++ +N+  GV  GF+K+L++ GVGYRA ++GKDI L+LGFSH V   +P G
Sbjct: 61  ARSKWGMSRSMIENIFCGVKDGFEKRLEINGVGYRAALQGKDIQLSLGFSHDVIYKVPSG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + V + + T I VSG DK  +GQ AA IR++R PEPYKGKG+K+ADE I R
Sbjct: 121 VTVSIPKPTEIVVSGIDKQQVGQVAAEIREYRRPEPYKGKGIKHADERIFR 171



>sp|P47412|RL6_MYCGE 50S ribosomal protein L6.>pir|D64218|D64218
           ribosomal protein L6 - Mycoplasma
           genitalium>gb:U39696_205577 Mycoplasma genitalium G-37
           section 18 of 51 of the complete
           genome.>gb:L43967_1100729 Mycoplasma genitalium G-37,
           complete genome.
          Length = 184

 Score =  163 bits (413), Expect = 3e-39
 Identities = 85/173 (49%), Positives = 115/173 (66%), Gaps = 2/173 (1%)
 Frame = +3

Query: 234 SRIGKQPIPV-PSNVTIKMEGQDFKVKGPLGELGITYPREVKLE-KEESGVLRVRKAMET 407
           S+IG + I + PS V++        +KGPLGE  I  P+ + L+   E+  ++V      
Sbjct: 2   SKIGNRSIKIDPSKVSLMQTTTLLTIKGPLGENTIKLPKNLPLKFVVENDTIKVTNNNNL 61

Query: 408 RRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIP 587
           ++   +HG F  L +N ++GV+KGF+KKL LVGVGYRA VEG+ + L LG+SHP++  IP
Sbjct: 62  KQTKILHGTFNALVNNAVIGVTKGFEKKLILVGVGYRANVEGQFLNLQLGYSHPIKELIP 121

Query: 588 DGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + L VKVE+NT IT+SG  K  +GQFA  IRKWR PEPYKGKGV Y +EVI R
Sbjct: 122 NQLTVKVEKNTEITISGIKKELVGQFATEIRKWRKPEPYKGKGVLYFNEVIVR 174



>gb:AE017340_457655 Idiomarina loihiensis L2TR, complete genome.
          Length = 177

 Score =  163 bits (412), Expect = 4e-39
 Identities = 81/171 (47%), Positives = 107/171 (62%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K PI +P+ V + + GQ+  +KG  G L       V+L K+ES  LR         
Sbjct: 2   SRVAKAPIEIPAGVEVTLNGQEVTIKGAQGSLSRVVNDAVELVKDESE-LRTNAREGVAN 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           +    G  R L  NM+VGV+KGF++KLQL+GVGYRA  +GK + L LGFSHPV   IP+G
Sbjct: 61  STAQAGTARALLQNMVVGVTKGFERKLQLIGVGYRAQAQGKKLNLTLGFSHPVEFEIPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + +     T + V G DK  +GQ AA+IR +R PEPYKGKGV+YADE +RR
Sbjct: 121 ITIDTPTQTEVVVKGADKQLVGQVAANIRAYRKPEPYKGKGVRYADEQVRR 171



>gb:AE016775_329913 Pseudomonas putida KT2440 section 2 of 21 of the
           complete genome.>gb:AE015451_944990 Pseudomonas putida
           KT2440 complete genome.
          Length = 177

 Score =  163 bits (412), Expect = 4e-39
 Identities = 84/171 (49%), Positives = 109/171 (63%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K P+ +PS V +K  GQ   VKG  G L +     V++  EESG LR       ++
Sbjct: 2   SRVAKNPVKLPSGVEVKFAGQQLSVKGAKGTLELNVHSSVEVT-EESGELRFVARNGDQQ 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A  M G  R L +NM+ GVS+GF++KLQLVGVGY+A  +G  + L LGFSHPV   +P G
Sbjct: 61  ARAMAGTTRALVNNMVQGVSQGFERKLQLVGVGYKAQAKGTVLNLALGFSHPVDYELPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +  +    T I + G DK  +GQ AA IR +RPPEPYKGKGV+YADEV+RR
Sbjct: 121 ITAETPSQTDILIKGIDKQLVGQVAAEIRDFRPPEPYKGKGVRYADEVVRR 171



>gb:BACRGB_746182 B.stearothermophilus ribosomal protein L6 gene,
           complete cds.
          Length = 178

 Score =  162 bits (411), Expect = 6e-39
 Identities = 77/169 (45%), Positives = 115/169 (68%)
 Frame = +3

Query: 237 RIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRA 416
           R+GK+PI +P+ VT+ + G    VKGP GEL  T+  ++ +  E   V+ V +  + +  
Sbjct: 3   RVGKKPIEIPAGVTVTVNGNTVTVKGPKGELTRTFHPDMTITVE-GNVITVTRPSDEKHH 61

Query: 417 NEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGL 596
             +HG  R+L  NM+ GVSKG++K L+LVGVGYRA  +GK +VL++G+SHPV +   +GL
Sbjct: 62  RALHGTTRSLLANMVEGVSKGYEKALELVGVGYRASKQGKKLVLSVGYSHPVEIEPEEGL 121

Query: 597 QVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           +++V   T+I V G DK  +G+ AA+IR  RPPEPYKGKG++Y  E++R
Sbjct: 122 EIEVPSQTKIIVKGADKQRVGELAANIRAVRPPEPYKGKGIRYEGELVR 170



>gb:AE016947_364351 Enterococcus faecalis V583, section 1 of 11 of
           the complete genome.>gb:AE016830_990839 Enterococcus
           faecalis V583, complete genome.
          Length = 178

 Score =  162 bits (410), Expect = 8e-39
 Identities = 77/171 (45%), Positives = 114/171 (66%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG + + +P+ V IK +G +  VKGP GEL   +  ++K+  E + V  +R   +++ 
Sbjct: 2   SRIGNKVVVLPAGVEIKQDGNNITVKGPKGELTREFSSDIKMNIEGNEVTFIRPN-DSKE 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HG  R   +NM+VGVS+GF K L+L+GVGYRA V+G  + LN+G+SHPV M  P+G
Sbjct: 61  MKTIHGTTRANFNNMVVGVSEGFQKALELIGVGYRAQVQGNKLTLNVGYSHPVEMTAPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +  +V  NT++ V G +K  +G+ AA+IR  RPPEPYKGKG++Y  E +RR
Sbjct: 121 VTFEVPANTQVIVKGINKEVVGELAANIRGVRPPEPYKGKGIRYVGEFVRR 171



>pir|F83114|F83114 50S ribosomal protein L6 PA4248 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004841_58483
           Pseudomonas aeruginosa PAO1, section 402 of 529 of the
           complete genome.>gb:AE004091_972583 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 177

 Score =  162 bits (410), Expect = 8e-39
 Identities = 81/171 (47%), Positives = 112/171 (65%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K P+ +P+ V IK+ GQ   +KG  G L +     V++  ++SG LR       ++
Sbjct: 2   SRVAKNPVKLPAGVEIKLAGQQLSIKGAKGALELKVHPSVEVI-QDSGELRFAARNGDQQ 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              M G  R L +NM+VGVS+GF++KLQLVGVGY+A  +G+ + L+LGFSHPV   +P G
Sbjct: 61  TRAMAGTTRALVNNMVVGVSQGFERKLQLVGVGYKAQAKGQVLSLSLGFSHPVDYELPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +  +    T I + G DK  +GQ AA IR +RPPEPYKGKGV+YADEV+RR
Sbjct: 121 IVAETPSQTDILIKGIDKQLVGQVAAEIRDFRPPEPYKGKGVRYADEVVRR 171



>gb:AE017180_401132 Geobacter sulfurreducens PCA, complete genome.
          Length = 179

 Score =  161 bits (407), Expect = 2e-38
 Identities = 81/171 (47%), Positives = 115/171 (67%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+PI +PS V ++       ++GP G+L       V LE   S +  V++A +  +
Sbjct: 2   SRIGKRPIEIPSGVKVEFSDSVLTIEGPKGKLSRQVMDGVSLEITPSSI-EVKRADDGLK 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A   HGL RTL +NM+VGV+KGF++ L++ GVGYRA  +G  + L+LG+SHP+  A+P G
Sbjct: 61  ARSAHGLTRTLVNNMVVGVTKGFERALEINGVGYRAEAKGDVLNLSLGYSHPINYALPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + V+V++ T++ V G DK  +GQ AA IR +R PEPYKGKG+KYADE I R
Sbjct: 121 IIVEVDKMTKLVVKGIDKELVGQTAAKIRSFRGPEPYKGKGIKYADEKILR 171



>gb:AE016924_359132 Chromobacterium violaceum ATCC 12472 section 15
           of 16 of the complete genome.>gb:AE016825_1044286
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 177

 Score =  161 bits (407), Expect = 2e-38
 Identities = 82/169 (48%), Positives = 109/169 (64%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K P+ +P+ V +K    D  VKG LG L      +V++ K ++G L      +++ 
Sbjct: 2   SRVAKNPVAIPAGVEVKFGAADVTVKGALGSLSTALCNDVEV-KLDNGQLTFAAKNDSKF 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A  M G  R L +NM+ GVSKGF+KKLQLVGVGYRA  +G  + L+LGFSHPV   +P G
Sbjct: 61  ARAMSGTLRALLNNMVNGVSKGFEKKLQLVGVGYRAQAQGDTLNLSLGFSHPVAHKMPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI 740
           ++V+    T I V G DK  +GQ AA IR +R PEPYKGKGV+YADEV+
Sbjct: 121 IKVETPTQTEILVKGADKQLVGQVAAEIRAYRSPEPYKGKGVRYADEVV 169



>gb:BA000035_715335 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 178

 Score =  160 bits (405), Expect = 3e-38
 Identities = 75/171 (43%), Positives = 116/171 (67%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK PI +PS V +K++G+   VKGP G L +T P  +    E + +L V +  + R 
Sbjct: 2   SRIGKNPIAIPSGVEVKIDGRLVDVKGPKGNLNVTLPEPITASIENNEIL-VTRPDDHRN 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           +  MHGL R+L +N++VGV++G+  K+++ GVGYR  ++GK++  +LG+SHPV +  P+G
Sbjct: 61  SRSMHGLSRSLVNNLVVGVTEGYTIKMEIFGVGYRVALKGKNLEFSLGYSHPVLIEAPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +   V+  T++++SG DK  +GQ AA IR+ R  +PYKGKG++Y  E IRR
Sbjct: 121 ITFAVDGTTKLSISGIDKQKVGQVAAVIRRLRKDDPYKGKGIRYEGEQIRR 171



>pir|F97283|F97283 ribosomal protein L6 [imported] - Clostridium
           acetobutylicum>gb:AE007808_230418 Clostridium
           acetobutylicum ATCC 824 section 296 of 356 of the
           complete genome.>gb:AE001437_1093373 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 179

 Score =  160 bits (405), Expect = 3e-38
 Identities = 76/172 (44%), Positives = 119/172 (69%), Gaps = 1/172 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDF-KVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR 410
           SR+GKQP+ +PS VT+ +   +   VKG  G+L     +++K+  E++ V+ V +  +++
Sbjct: 2   SRVGKQPVEIPSGVTVTVTPDNVVTVKGTKGQLEKAMHKDMKIAVEDNKVV-VTRPSDSK 60

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
               +HGL R L +NM++GV++GF K LQLVGVGY+A ++GK ++LNLG+SHP+ +A  +
Sbjct: 61  NHKALHGLTRALINNMVIGVTEGFSKTLQLVGVGYKAQLKGKSLILNLGYSHPIEVASIE 120

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           G+  ++ +   + V G +K  +G  AA IR +R PEPYKGKG+KY+DEVIRR
Sbjct: 121 GVTFEIPDANTVVVKGINKELVGSVAADIRTFRKPEPYKGKGIKYSDEVIRR 172



>gb:BA000045_743987 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 191

 Score =  160 bits (404), Expect = 4e-38
 Identities = 78/181 (43%), Positives = 112/181 (61%), Gaps = 12/181 (6%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK PI +P  V + ++G+   VKGP G L +T P  V++ +E+  +L  R+  E+RR
Sbjct: 2   SRIGKLPIAIPPKVEVTLDGRRVVVKGPKGTLDLTLPDSVEVVREDGRLLVTRRG-ESRR 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A E HGL RTL  NM+ GV+ GF K +Q+ GVGYR  + G+ + +N GFSHP+ + +P G
Sbjct: 61  AREQHGLGRTLVANMVTGVTTGFTKPMQIAGVGYRVALTGRKLTINAGFSHPIEIELPAG 120

Query: 594 LQVKV------------EENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEV 737
           + ++V            ++     + G+DK A+G  AA IR  RPPEPYKGKG++Y  E 
Sbjct: 121 IDIEVDPKASAIAGTRNQQGFNFVIKGFDKQAVGDLAAKIRDIRPPEPYKGKGIRYTAEK 180

Query: 738 I 740
           I
Sbjct: 181 I 181



>pir|F90020|F90020 50S ribosomal protein L6 [imported] -
           Staphylococcus aureus  (strain N315)>gb:CP000046_92313
           Staphylococcus aureus subsp. aureus COL, complete
           genome.>gb:BA000017_677920 Staphylococcus aureus subsp.
           aureus Mu50 DNA, complete genome.>gb:BA000018_680509
           Staphylococcus aureus subsp. aureus N315 genomic DNA,
           complete genome.>gb:BA000033_712446 Staphylococcus
           aureus subsp. aureus MW2 DNA, complete genome,
           strain:MW2.>gb:BX571856_781745 Staphylococcus aureus
           subsp. aureus strain MRSA252, complete
           genome.>gb:BX571857_784357 Staphylococcus aureus strain
           MSSA476, complete genome.
          Length = 178

 Score =  160 bits (404), Expect = 4e-38
 Identities = 77/171 (45%), Positives = 114/171 (66%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+GK+ I +PS+VT+  +G    VKGP GEL  T    +  ++EE+ +  VR + +++ 
Sbjct: 2   SRVGKKIIDIPSDVTVTFDGNHVTVKGPKGELSRTLNERMTFKQEENTIEVVRPS-DSKE 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
               HG  R L +NM+ GVS+G+ K L+LVGVGYRA ++GKD++LN+G+SHPV +   + 
Sbjct: 61  DRTNHGTTRALLNNMVQGVSQGYVKVLELVGVGYRAQMQGKDLILNVGYSHPVEIKAEEN 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +   VE+NT + V G  K  +G  A++IR  RPPEPYKGKG++Y  E +RR
Sbjct: 121 ITFSVEKNTVVKVEGISKEQVGALASNIRSVRPPEPYKGKGIRYQGEYVRR 171



>gb:AF036708_471588 Mycoplasma gallisepticum strain A5969var.B
           ribosomal proteins S10 (rps10), L3 (rpl3), L4 (rpl4),
           L23 (rpl23), L2 (rpl2), S19 (rps19), L22 (rpl22), S3
           (rps3), L16 (rpl16), L29 (rpl29), S17 (rps17), L14
           (rpl14), L24 (rpl24), L5 (rpl5), S14 (rps14), S8 (rps8),
           L6 (rpl6), L18 (rpl18), S5 (rps5), L15 (rpl15),
           secretion protein Y (secY), adenylate kinase (adk),
           methionine aminopeptidase (map), and lactate
           dehydrogenase (ldh) genes, complete cds; and rrn235
           operon consisting of 23S (rrl) and 5S (rrf) ribosomal
           RNA genes, complete sequence.
          Length = 183

 Score =  159 bits (403), Expect = 5e-38
 Identities = 81/172 (47%), Positives = 113/172 (65%), Gaps = 1/172 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKE-ESGVLRVRKAMETR 410
           SRIG + I VPSNV++    +   VKGPLG+L +      K++   E+  +R+ +  E +
Sbjct: 2   SRIGNRVITVPSNVSVNQTKELLTVKGPLGQLDLKLKEGSKIKVNVENNEIRLTRGDELK 61

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
           +   +HG +  L  N + GV+ GF K+L+LVGVGYRA ++G  + L LG+SHP+ + IP 
Sbjct: 62  QTKMLHGTYNALIKNALEGVTIGFKKELRLVGVGYRASLKGNVLNLQLGYSHPINLDIPK 121

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
            L+V V++NT ITVSG DK  +G+FA  IRKWR PEPYKGKGV Y +E I R
Sbjct: 122 DLKVTVDKNTEITVSGIDKQKVGEFAIQIRKWRMPEPYKGKGVLYLNEQIIR 173



>gb:BA000036_718265 Corynebacterium glutamicum ATCC 13032 DNA,
           complete genome.>gb:BX927149_832125 Corynebacterium
           glutamicum ATCC 13032, IS fingerprint type 4-5, complete
           genome; segment 2/10.
          Length = 178

 Score =  159 bits (402), Expect = 6e-38
 Identities = 76/171 (44%), Positives = 116/171 (67%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+PI +PS V  K++GQ  +VKGP G L +  P  + +  E+ G + V +  + R 
Sbjct: 2   SRIGKEPITIPSGVETKIDGQLVEVKGPKGTLNVNVPEPISVAVED-GKIVVTRPDDHRT 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HGL R+L +N++VGV++G+  K+++ GVGYR  ++GKD+  +LG+SHPV +   +G
Sbjct: 61  NRSLHGLSRSLVNNLVVGVTEGYTIKMEIFGVGYRVALKGKDLEFSLGYSHPVLIEASEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +   V+ NT+++VSG DK  +GQ AA IR+ R  +PYKGKG++Y  E IRR
Sbjct: 121 ITFAVDGNTKLSVSGIDKQKVGQVAAVIRRLRKDDPYKGKGIRYEGEQIRR 171



>gb:CP000002_855906 Bacillus licheniformis ATCC 14580, complete
           genome.
          Length = 183

 Score =  159 bits (401), Expect = 8e-38
 Identities = 76/171 (44%), Positives = 113/171 (66%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+GK+ + +PS VT+ +      VKGP GEL  T+  ++K+ K E  VL V +  + + 
Sbjct: 7   SRVGKKLLEIPSGVTVTLNDNTVTVKGPKGELTRTFHPDMKI-KIEDNVLTVERPSDNKE 65

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HG  R++  NM+ GVSKGF++ L+LVGVGYRA   G  +VLN+G+SHPV +   +G
Sbjct: 66  HRALHGTTRSIIGNMVEGVSKGFERGLELVGVGYRASKSGNKLVLNVGYSHPVEIVPENG 125

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           ++++V   T++ V G DK  +G  AA+IR  R PEPYKGKG++Y  E++RR
Sbjct: 126 IEIEVPSQTKVVVKGTDKERVGATAANIRAVRSPEPYKGKGIRYEGEMVRR 176



>gb:AE017333_446084 Bacillus licheniformis DSM 13, complete genome.
          Length = 178

 Score =  159 bits (401), Expect = 8e-38
 Identities = 76/171 (44%), Positives = 113/171 (66%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+GK+ + +PS VT+ +      VKGP GEL  T+  ++K+ K E  VL V +  + + 
Sbjct: 2   SRVGKKLLEIPSGVTVTLNDNTVTVKGPKGELTRTFHPDMKI-KIEDNVLTVERPSDNKE 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HG  R++  NM+ GVSKGF++ L+LVGVGYRA   G  +VLN+G+SHPV +   +G
Sbjct: 61  HRALHGTTRSIIGNMVEGVSKGFERGLELVGVGYRASKSGNKLVLNVGYSHPVEIVPENG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           ++++V   T++ V G DK  +G  AA+IR  R PEPYKGKG++Y  E++RR
Sbjct: 121 IEIEVPSQTKVVVKGTDKERVGATAANIRAVRSPEPYKGKGIRYEGEMVRR 171



>pir|AI2813|AI2813 50S ribosomal protein L6 [imported] -
           Agrobacterium tumefaciens (strain C58,
           Dupont)>gb:AE009146_248954 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 172 of 256 of the
           complete sequence.>gb:AE008688_1086797 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 177

 Score =  159 bits (401), Expect = 8e-38
 Identities = 82/171 (47%), Positives = 115/171 (67%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+P+PVP+ VT  ++GQ    KGP GEL      +++L+ E++GV  V  A  T+ 
Sbjct: 2   SRIGKKPVPVPAGVTANVDGQKVTAKGPKGELFFVANDDIQLKLEDNGV-SVTPANGTKE 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A    G+ RT+ +N+  GV  G+++KL++ GVGYRA ++GK++ L LGFSH V    P G
Sbjct: 61  ARSKWGMSRTMIENIFKGVKDGYERKLEINGVGYRAALQGKNLQLALGFSHDVVYEPPVG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + + V + T I VSG +K  +GQ AA IR++R PEPYKGKGVKYA+E I R
Sbjct: 121 ITIAVPKPTEIIVSGINKQQVGQVAAEIREYRGPEPYKGKGVKYAEERIVR 171



>gb:AE016858_350095 Pseudomonas syringae pv. tomato str. DC3000
           section 3 of 21 of the complete
           genome.>gb:AE016853_1035270 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 177

 Score =  158 bits (400), Expect = 1e-37
 Identities = 81/171 (47%), Positives = 109/171 (63%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K P+ +PS V +K+ GQ   VKG  G L +     V++  EE+G LR       ++
Sbjct: 2   SRVAKNPVKLPSGVEVKLVGQQLSVKGAKGTLELIIHSSVEIV-EEAGELRFAARNGDQQ 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              M G  R L +NM+ GVS+GF++KLQLVGVGY+A  +G  + L LGFSHPV   +P+G
Sbjct: 61  TRAMAGTTRALVNNMVQGVSQGFERKLQLVGVGYKAQAKGTVLNLALGFSHPVDYELPNG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +  +    T I + G DK  +GQ AA IR +R PEPYKGKGV+YADEV+RR
Sbjct: 121 ITAETPSQTDILIRGIDKQLVGQVAAEIRDFRRPEPYKGKGVRYADEVVRR 171



>sp|O46908|RK6_GUITH Chloroplast 50S ribosomal protein
           L6.>gb:AF041468_1763586 Guillardia theta complete
           plastid genome.
          Length = 179

 Score =  158 bits (399), Expect = 1e-37
 Identities = 73/171 (42%), Positives = 115/171 (67%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK P+     VT+K++  +  VKGP GEL +   + + +  E +  L V+   +  +
Sbjct: 2   SRIGKLPVKFSEKVTMKIDQDNIIVKGPKGELALGLSKNINITIENN-TLFVKPVTKEPQ 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
             ++ G +R + +NM+VGV+KGF+K+L+L GVGYRA ++GKD+ L++G+SHPV +  P G
Sbjct: 61  VLKLFGTYRAIINNMVVGVTKGFEKRLELQGVGYRAQLQGKDLSLSVGYSHPVVIKAPTG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + + VE NT + +SG  K  +GQ A++IR  +PPEPYKGKG++Y  E +R+
Sbjct: 121 INIAVENNTIVIISGISKELVGQIASNIRSIKPPEPYKGKGIRYVGEFVRK 171



>gb:AY372454_614043 Uncultured marine gamma proteobacterium
           EB000-45B06 fosmid clone.>gb:AY458644_619814 Uncultured
           bacterium 562 clone EBAC000-45B06 genomic sequence.
          Length = 180

 Score =  157 bits (397), Expect = 2e-37
 Identities = 76/171 (44%), Positives = 111/171 (64%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K PI +   V + +  +  +VKG +GE+    P  + LE  E+ ++ V+     ++
Sbjct: 2   SRVAKSPINIVDGVNVNVTNESIEVKGKIGEMSFDLPETISLEVIEN-IIHVKYDETKQQ 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           +  + G  R L +NMIVGVS+GF+KKL+L GVGYRA   GK + L LGFSHPV+  +PD 
Sbjct: 61  SIALAGTTRALVNNMIVGVSQGFEKKLELKGVGYRAKASGKLLELTLGFSHPVKYQLPDE 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           ++V+    T + +  Y+K  +GQ AA IR +RPPEPYKGKGV+Y+DE +RR
Sbjct: 121 VEVETPSQTEVVLKSYNKQILGQAAAEIRAFRPPEPYKGKGVRYSDENVRR 171



>gb:AP006840_570246 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 178

 Score =  157 bits (397), Expect = 2e-37
 Identities = 83/174 (47%), Positives = 109/174 (62%), Gaps = 3/174 (1%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKE---ESGVLRVRKAME 404
           SRIGK PI +P+ V + +EG   +VKGP GEL     RE+        E+G LRV +  +
Sbjct: 2   SRIGKAPIEIPAGVEVTVEGNLVRVKGPKGELS----REIHPAMSITIENGALRVSRPSD 57

Query: 405 TRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAI 584
            R    +HGL RTL  NM+ GV+KG+ K L+LVG GYRA   G  + L++G+SHPV    
Sbjct: 58  EREHKALHGLTRTLIANMVEGVTKGYSKTLELVGTGYRAAKTGNQLTLSVGYSHPVVFNP 117

Query: 585 PDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           P G++ +V    ++ V+G DK  +GQ AA IR  RPPEPY GKG+KYA E IRR
Sbjct: 118 PPGIEFQVPAPNQVIVAGIDKQLVGQVAADIRATRPPEPYLGKGIKYAGEHIRR 171



>sp|O52347|RL6_MYCGA 50S ribosomal protein L6.>gb:AE016967_369335
           Mycoplasma gallisepticum strain R section 1 of 4 of the
           complete genome.>gb:AE015450_1033984 Mycoplasma
           gallisepticum strain R complete genome.
          Length = 183

 Score =  157 bits (397), Expect = 2e-37
 Identities = 80/172 (46%), Positives = 112/172 (65%), Gaps = 1/172 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKE-ESGVLRVRKAMETR 410
           SRIG + I VPSNV++    +   VKGPLG+L +      K++   E+  +R+ +  E +
Sbjct: 2   SRIGNRVITVPSNVSVNQTKELLTVKGPLGQLDLKLKEGSKIKVNVENNEIRLTRGDELK 61

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
           +   +HG +  L  N + GV+ GF K+L+LVGVGYRA ++   + L LG+SHP+ + IP 
Sbjct: 62  QTKMLHGTYNALIKNALEGVTVGFKKELRLVGVGYRASLKDNVLNLQLGYSHPINLDIPK 121

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
            L+V V++NT ITVSG DK  +G+FA  IRKWR PEPYKGKGV Y +E I R
Sbjct: 122 DLKVTVDKNTEITVSGIDKQKVGEFAIQIRKWRMPEPYKGKGVLYLNEQIIR 173



>gb:AY552545_627862 Uncultured marine gamma proteobacterium
           EBAC20E09 clone EBAC20E09, complete sequence.
          Length = 182

 Score =  157 bits (396), Expect = 3e-37
 Identities = 75/171 (43%), Positives = 112/171 (65%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K PI +P NV + +      VKG  GEL    P  + L+  +  V+ ++   E ++
Sbjct: 2   SRVAKNPITIPENVDLSINENVVIVKGSKGELDFVLPDTISLDVADK-VITIKYDEENQQ 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           +  + G  R+L +NM++GVS+GF+KKL+L+GVGYRA   GK + L LGFSHPV+  +PD 
Sbjct: 61  SVALAGTSRSLINNMVIGVSEGFEKKLELIGVGYRAKASGKLLELTLGFSHPVKYQLPDE 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           ++V+    T + +  ++K  +GQ AA IR +RPPEPYKGKGV+YADE ++R
Sbjct: 121 VEVETPSQTEVVLKSHNKQILGQAAAEIRSFRPPEPYKGKGVRYADEHVKR 171



>pir|B69695|B69695 ribosomal protein L6 (BL8) rplF - Bacillus
           subtilis>gb:D64125_120261 Bacillus subtilis genes for
           ribosomal protein S5, ribosomal protein L18, ribosomal
           protein L6 and ribosomal protein S8, complete and
           partial cds.>gb:BACRPLP_746221 Bacillus subtilis
           ribosomal protein (rplPNXEFROQ, rpmCDJ, rpsQNHEMK)
           genes, integral membrane protein (secY) gene, adenylate
           kinase (adk) gene, methionine aminopeptidase (map) gene,
           inititation factor 1 (infA) gene, RNA polymerase alpha
           (rpoA) gene.>gb:BSUB0001_752096 Bacillus subtilis
           complete genome (section 1 of 21): from 1 to 213080.
          Length = 179

 Score =  157 bits (396), Expect = 3e-37
 Identities = 77/172 (44%), Positives = 115/172 (66%), Gaps = 1/172 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKM-EGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR 410
           SR+GK+ + +PS+VT+ + +     VKGP GEL  T+  ++++ K E  VL V +  + +
Sbjct: 2   SRVGKKLLEIPSDVTVTLNDNNTVAVKGPKGELTRTFHPDMEI-KVEDNVLTVARPSDQK 60

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
               +HG  R+L  NM+ GVSKGF++ L+LVGVGYRA   G  +VLN+G+SHPV +   +
Sbjct: 61  EHRALHGTTRSLLGNMVEGVSKGFERGLELVGVGYRASKSGNKLVLNVGYSHPVEIVPEE 120

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           G++++V   T++ V G DK  +G  AA+IR  R PEPYKGKG++Y  EV+RR
Sbjct: 121 GIEIEVPSQTKVVVKGTDKERVGAIAANIRAVRSPEPYKGKGIRYEGEVVRR 172



>sp|P46898|RL6_BACSU 50S ribosomal protein L6 (BL10).
          Length = 178

 Score =  157 bits (396), Expect = 3e-37
 Identities = 77/172 (44%), Positives = 115/172 (66%), Gaps = 1/172 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKM-EGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR 410
           SR+GK+ + +PS+VT+ + +     VKGP GEL  T+  ++++ K E  VL V +  + +
Sbjct: 1   SRVGKKLLEIPSDVTVTLNDNNTVAVKGPKGELTRTFHPDMEI-KVEDNVLTVARPSDQK 59

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
               +HG  R+L  NM+ GVSKGF++ L+LVGVGYRA   G  +VLN+G+SHPV +   +
Sbjct: 60  EHRALHGTTRSLLGNMVEGVSKGFERGLELVGVGYRASKSGNKLVLNVGYSHPVEIVPEE 119

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           G++++V   T++ V G DK  +G  AA+IR  R PEPYKGKG++Y  EV+RR
Sbjct: 120 GIEIEVPSQTKVVVKGTDKERVGAIAANIRAVRSPEPYKGKGIRYEGEVVRR 171



>gb:AE017313_439569 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 5 of 12 of the complete
           genome.>gb:AE017285_1072730 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 179

 Score =  156 bits (395), Expect = 4e-37
 Identities = 82/171 (47%), Positives = 112/171 (65%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGKQPIP+PS V +K+     +VKGP G L       +  E  +  V+ + +  ETR+
Sbjct: 2   SRIGKQPIPIPSGVEVKIGNDVVEVKGPKGALTTPVCSVLSYEVTDGKVV-ITRLDETRQ 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
               HGL RTL  N I GVSKGF K L++VGVGY+  V+G  + L++G+SHPV + +P G
Sbjct: 61  TRAQHGLRRTLLANCIEGVSKGFSKTLEVVGVGYKVAVKGDVVDLSVGYSHPVLIDLPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +  K E N ++T+SG DK  +G+ AA +R+ R PEPYKGKG+KY +E IRR
Sbjct: 121 ISAKAEGN-KLTISGVDKELVGEVAAQMRRVRKPEPYKGKGIKYDNEQIRR 170



>gb:AE016827_343662 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 177

 Score =  156 bits (395), Expect = 4e-37
 Identities = 81/170 (47%), Positives = 109/170 (64%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K P+ VP+ V +K++GQ   VKG  GEL  T    V++ K+++  L      +   
Sbjct: 2   SRVAKAPVSVPAGVEVKLDGQLLTVKGKNGELTRTIHNFVEV-KQDNNELTFSPRNDGAE 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           AN   G  R L + M++GV++GF KKLQLVGVGYRA V+G  + L+LGFSHPV   +P G
Sbjct: 61  ANAQAGTTRALVNAMVIGVTEGFTKKLQLVGVGYRAQVKGNVVNLSLGFSHPVEHTLPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           +  +    T I + G DK  IGQ AA IR +R PEPYKGKGV+Y+DEV+R
Sbjct: 121 ITAECPSQTEIVLKGADKQLIGQVAADIRAYRSPEPYKGKGVRYSDEVVR 170



>gb:AE006177_216288 Pasteurella multocida subsp. multocida str. Pm70
           section 144 of 204 of the complete
           genome.>gb:AE004439_1119018 Pasteurella multocida subsp.
           multocida str. Pm70, complete genome.
          Length = 177

 Score =  156 bits (395), Expect = 4e-37
 Identities = 80/170 (47%), Positives = 109/170 (64%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K P+ +P+ V +K++GQ   VKG  GEL  T    V++ K+++  L          
Sbjct: 2   SRVAKAPVSIPAGVEVKLDGQLLTVKGKNGELSRTIHNAVEV-KQDNNELTFSPREGIVG 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A+   G  R L + M++GV++GF KKLQLVGVGYRA ++G  + L+LGFSHPV  A+P G
Sbjct: 61  ADAQAGTARALVNAMVIGVTEGFTKKLQLVGVGYRAQIKGNAVALSLGFSHPVEHALPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           +  +    T I + G DK  IGQ AA IR +R PEPYKGKGV+YADEV+R
Sbjct: 121 ITAECPSQTEIVLKGADKQLIGQVAADIRAYRRPEPYKGKGVRYADEVVR 170



>gb:AL935254_550932 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 3/11.
          Length = 178

 Score =  155 bits (393), Expect = 7e-37
 Identities = 78/171 (45%), Positives = 109/171 (63%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG + I +P+ V +   G+   VKGP G L      ++ +  E + V   R + +  +
Sbjct: 2   SRIGYKVIELPAGVEVSQAGEVVTVKGPKGTLTRNIASDITMTVEGNEVKFTRPS-DDYK 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HG  R   +NM+ GV+KGF K LQLVGVGYRA ++GK +VL++G+SHPV  A P+ 
Sbjct: 61  MKALHGTTRANVNNMVEGVTKGFTKNLQLVGVGYRAQLQGKKLVLSVGYSHPVEFATPEN 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           L V+V +NT I +SG  K A+G FAA +R  R PEPYKGKG++Y DE +RR
Sbjct: 121 LTVEVPDNTHINISGIGKQAVGDFAAEVRAVRSPEPYKGKGIRYVDEYVRR 171



>gb:AE017201_403729 Lactobacillus johnsonii NCC 533, section 2 of 7
           of the complete genome.>gb:AE017198_1122216
           Lactobacillus johnsonii NCC 533, complete genome.
          Length = 176

 Score =  155 bits (393), Expect = 7e-37
 Identities = 80/171 (46%), Positives = 107/171 (62%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG + I VP  VT+   G D  VKGP GEL   +   +  E+++ G +   ++ E  +
Sbjct: 2   SRIGLKVIEVPEKVTVTKNGDDITVKGPKGELTRYFDPRITFEQKD-GEIHFSRSSEADK 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A  +HG  R    +MI GV+ G+ KKL LVGVGYRA+ +GK + LN+G+SHPV    P+G
Sbjct: 61  A--LHGTERANLASMIEGVTDGYVKKLTLVGVGYRAVAQGKKLTLNVGYSHPVEFEAPEG 118

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + VK    T I + G  K  +GQFAA IR  RPPEPYKGKG++Y DE +RR
Sbjct: 119 ITVKTPSATSIEIEGISKQVVGQFAAEIRDVRPPEPYKGKGIRYEDEYVRR 169



>gb:SME591787_185389 Sinorhizobium meliloti 1021 complete
           chromosome; segment 6/12.
          Length = 177

 Score =  155 bits (392), Expect = 9e-37
 Identities = 80/171 (46%), Positives = 115/171 (67%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+P+ VP+ VT  ++GQ    KGP GEL      EV ++ E + V+ V+   E++ 
Sbjct: 2   SRIGKKPVQVPAGVTANVDGQKVTAKGPKGELFFVANDEVSVKLENNTVV-VQPLNESKD 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A    G+ RT+ +N++ GV  G+++KL++ GVGYRA ++GK++ L LGFSH V    P+G
Sbjct: 61  ARAKWGMSRTMIENILKGVKDGYERKLEINGVGYRASMQGKNLQLALGFSHDVVYQTPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + + V + T I VSG +K  +GQ AA IR++R PEPYKGKGVKYA+E I R
Sbjct: 121 ITIAVPKPTEIVVSGINKQQVGQVAAEIREYRGPEPYKGKGVKYAEERIVR 171



>sp|P46181|RL6_BUCAK 50S ribosomal protein L6.>pir|JC2281|JC2281
           ribosomal protein L6 - pea aphid symbiont
           bacterium>gb:AHSRPSC_521767 Acyrthosiphon kondoi
           endosymbiont S10 and spc ribosomal protein gene operons,
           complete and partial cds.
          Length = 177

 Score =  154 bits (390), Expect = 2e-36
 Identities = 80/170 (47%), Positives = 106/170 (62%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K P+ +P+ V +K+ GQ   +KG  GEL  T   +  + K+E+  L  R     R 
Sbjct: 2   SRVAKAPVVIPAGVEVKLNGQVISIKGKNGELTRTV-HDAVIVKQEANALNFRPREGFRN 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A    G  R L + M+VGV++GF KKLQLVGVGYRA V+G  + L LGFSHP+   +P G
Sbjct: 61  AWAQAGTTRALLNAMVVGVTEGFTKKLQLVGVGYRAAVKGNVVNLALGFSHPIEHQLPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           +  +    T I + G DK  IGQ AA +R +R PEPYKGKGV+YADEV+R
Sbjct: 121 ITAECPSQTEIVLKGVDKQVIGQAAADLRAYRRPEPYKGKGVRYADEVVR 170



>gb:AE016998_375183 Bacillus cereus ATCC 14579 section 1 of 18 of
           the complete genome.>gb:AE017024_380421 Bacillus
           anthracis str. Ames section 1 of 18 of the complete
           genome.>gb:AE017225_405538 Bacillus anthracis str.
           Sterne, complete genome.>gb:AE017264_421360 Bacillus
           cereus ATCC 10987, section 1 of 18 of the complete
           genome.>gb:AE017334_450270 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE017355_461453 Bacillus
           thuringiensis serovar konkukian str. 97-27, complete
           genome.>gb:CP000001_850756 Bacillus cereus ZK, complete
           genome.>gb:AE016879_1010126 Bacillus anthracis str. Ames
           complete genome.>gb:AE016877_1015433 Bacillus cereus
           ATCC 14579 complete genome.>gb:AE017194_1059779 Bacillus
           cereus ATCC 10987, complete genome.
          Length = 179

 Score =  154 bits (389), Expect = 2e-36
 Identities = 80/172 (46%), Positives = 114/172 (66%), Gaps = 1/172 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKM-EGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR 410
           SRIGK+ + +P+ VTI + E     VKGP GEL  T+  ++ ++ EE+  L V +  E +
Sbjct: 2   SRIGKKILEIPAGVTITVAEDNTVTVKGPKGELTRTFNADMLIKIEEN-TLTVERPSEQK 60

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
               +HG  R L  NM+ GV++GF + L+LVGVGYRA  +G  +VL++G+SHPV M    
Sbjct: 61  EHRALHGTTRALIGNMVEGVTEGFARGLELVGVGYRAQKQGDKLVLSVGYSHPVEMTPEA 120

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           GL+V+V   T+I + G DK  +G+FAA+IR  R PEPYKGKG++Y  EV+RR
Sbjct: 121 GLEVEVPAPTKIVIKGIDKQRVGEFAANIRAVRAPEPYKGKGIRYEGEVVRR 172



>gb:CR543861_104984 Acinetobacter sp. ADP1 complete genome.
          Length = 177

 Score =  154 bits (389), Expect = 2e-36
 Identities = 76/171 (44%), Positives = 112/171 (65%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K P+ VP+ V +   G+  +VKG  G L       V+L++EE G L++    E++ 
Sbjct: 2   SRVAKAPVTVPNGVAVTQNGRQVEVKGTKGTLSFNLHALVELKQEE-GKLQLAPVKESKD 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A    G  R + +N++ GVS+GF++KLQL+GVGY+A V+G  I LNLGFSHP+  ++P+G
Sbjct: 61  AWMQAGTARAVLNNLVKGVSEGFERKLQLIGVGYKAAVKGTSINLNLGFSHPIDYSLPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +  +    T I +   DK  +GQ A+ IR +RPPEPYKGKGV+Y+DEV+ R
Sbjct: 121 VTAETPTATEIILKSADKQLLGQVASEIRGYRPPEPYKGKGVRYSDEVVLR 171



>gb:CR378663_93751 Photobacterium profundum SS9; segment 1/12.
          Length = 177

 Score =  154 bits (388), Expect = 3e-36
 Identities = 81/171 (47%), Positives = 109/171 (63%), Gaps = 1/171 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGV-LRVRKAMETR 410
           SR+ K P+ + + V +K+ GQ+  VKGP GEL +     V L +EE+ +    R+  +  
Sbjct: 2   SRVAKAPVVLLAGVEVKLNGQEITVKGPKGELALVAHNAVVLTQEENTITFGPREGFD-- 59

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
           +A    G  R L +NM+VGV++GF KKL L GVGYRA V G  + L LGFSHPV   +P 
Sbjct: 60  KAWAQAGTVRALVNNMVVGVTEGFTKKLTLKGVGYRANVAGNTVNLTLGFSHPVAHELPT 119

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           G++ +    T I ++G DK  IGQ AA IR +R PEPYKGKGV+YADEV+R
Sbjct: 120 GVKAECPSQTEIVLTGTDKQVIGQVAADIRAYRSPEPYKGKGVRYADEVVR 170



>gb:AB045221_6815 Lactobacillus gasseri lecLA2-20 gene for
           lectin-like protein LA2-20, complete cds.
          Length = 176

 Score =  154 bits (388), Expect = 3e-36
 Identities = 80/171 (46%), Positives = 107/171 (62%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG + I VP  VT+   G D  VKGP GEL   +   +  E+++ G +   ++ E  +
Sbjct: 2   SRIGLKVIEVPEKVTVTKNGDDITVKGPKGELTRYFDPRITFEQKD-GEIHFSRSNEADK 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A  +HG  R    +MI GV+ G+ KKL LVGVGYRA+ +GK + LN+G+SHPV    P+G
Sbjct: 61  A--LHGTERANLASMIEGVTDGYVKKLTLVGVGYRAVAQGKKLTLNVGYSHPVVFEAPEG 118

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + VK    T I + G  K  +GQFAA IR  RPPEPYKGKG++Y DE +RR
Sbjct: 119 VTVKTPSATSIEIEGISKQVVGQFAAEIRDVRPPEPYKGKGIRYEDEYVRR 169



>gb:BX640423_808300 Bordetella parapertussis strain 12822, complete
           genome; segment 1/14.>gb:BX640437_812702 Bordetella
           bronchiseptica strain RB50, complete genome; segment
           1/16.
          Length = 177

 Score =  153 bits (387), Expect = 4e-36
 Identities = 79/167 (47%), Positives = 105/167 (62%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRI K P+ +P  V   ++     VKGPLG L  +   +V + +E+ G L    A ++R 
Sbjct: 2   SRIAKYPVELPKGVEASIQPDQITVKGPLGTLVQSLTGDVNVAQED-GKLTFVVANDSRH 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           AN M G  R L  NM+ GVSKGF++KL LVGVGYRA ++G  + L LGFSH V   +P G
Sbjct: 61  ANAMSGTLRALVANMVTGVSKGFERKLNLVGVGYRAQIQGDAVKLQLGFSHDVVHQLPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADE 734
           ++ +    T I + G +K  +GQ AA IRK+R PEPYKGKGV+YADE
Sbjct: 121 VKAECPTQTEIVIKGPNKQVVGQVAAEIRKYREPEPYKGKGVRYADE 167



>pir|A37315|A37315 ribosomal protein L6 - Chlamydia
           trachomatis>gb:CHTRGL6_846361 Chlamydia trachomatis
           ribosomal protein L6 gene, complete
           cds.>gb:CHTSPCOPER_846383 Chlamydia trachomatis spc
           operon encoding spc ribosomal protein genes (ctrL14e,
           ctrL24e, ctrL5e, ctrS8e, ctrL6e, ctrL18e, ctrS5e,
           ctrL15e, and ctrSecYe) and S10 ribosomal protein genes
           (ctrL16e, ctrL29e and ctrS17e).
          Length = 183

 Score =  153 bits (387), Expect = 4e-36
 Identities = 73/171 (42%), Positives = 109/171 (63%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR  + PI +P  V + ++  +  VKGP G L     +EV++  + + V     A    R
Sbjct: 2   SRKARDPIVLPQGVEVSIQNDEISVKGPKGSLTQVLAKEVEIAVKGNEVFVAPAAHVVDR 61

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              M GL+  L  NM+ GV  GF+K+L+++GVG+RA V+G  + L++G SHP +M IP G
Sbjct: 62  PGRMQGLYWALIANMVKGVHTGFEKRLEMIGVGFRAAVQGSLLDLSIGVSHPTKMPIPTG 121

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           L+V VE+NT I++ G +K  +G+FAA +R  RPPEPYKGKG++Y +E +RR
Sbjct: 122 LEVSVEKNTLISIKGINKQLVGEFAACVRAKRPPEPYKGKGIRYENEYVRR 172



>pir|G81232|G81232 50S ribosomal protein L6 NMB0157 [imported] -
           Neisseria meningitidis (strain MC58 serogroup
           B)>gb:AE002373_45638 Neisseria meningitidis serogroup B
           strain MC58 section 15 of 206 of the complete
           genome.>gb:AE002098_895751 Neisseria meningitidis
           serogroup B strain MC58 complete genome.
          Length = 177

 Score =  153 bits (387), Expect = 4e-36
 Identities = 76/169 (44%), Positives = 107/169 (63%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K P+ VP+ V +K   +   +KG  GEL      +V +E  + G L       +++
Sbjct: 2   SRVAKNPVTVPAGVEVKFGAEALVIKGKNGELSFPLHSDVAIEFND-GKLTFVANNSSKQ 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           AN M G  R L  NM+ GVS+GF+K+LQL+GVGYRA  +GK + L+LGFSHP+   +P+G
Sbjct: 61  ANAMSGTARALVSNMVKGVSEGFEKRLQLIGVGYRAQAQGKILNLSLGFSHPIVYEMPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI 740
           + V+    T I ++G DK  +GQ AA IR +R PEPYKGKGV+Y  EV+
Sbjct: 121 VSVQTPSQTEIVLTGSDKQVVGQVAAEIRAFRAPEPYKGKGVRYVGEVV 169



>gb:BX640422_808016 Bordetella pertussis strain Tohama I, complete
           genome; segment 12/12.
          Length = 177

 Score =  152 bits (385), Expect = 6e-36
 Identities = 79/167 (47%), Positives = 105/167 (62%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRI K P+ +P  V   ++     VKGPLG L  +   +V + +E+ G L    A ++R 
Sbjct: 2   SRIAKYPVELPKGVEASIQPDQITVKGPLGILVQSLTGDVNVAQED-GKLTFVVANDSRH 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           AN M G  R L  NM+ GVSKGF++KL LVGVGYRA ++G  + L LGFSH V   +P G
Sbjct: 61  ANAMSGTLRALVANMVTGVSKGFERKLNLVGVGYRAQIQGDAVKLQLGFSHDVVHQLPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADE 734
           ++ +    T I + G +K  +GQ AA IRK+R PEPYKGKGV+YADE
Sbjct: 121 VKAECPTQTEIVIKGPNKQVVGQVAAEIRKYREPEPYKGKGVRYADE 167



>gb:BA000012_666208 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 177

 Score =  152 bits (385), Expect = 6e-36
 Identities = 82/171 (47%), Positives = 108/171 (63%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+P+ +P  VT  + GQ    KGP GEL      EV L K E   + V+   +T+ 
Sbjct: 2   SRIGKKPVSLPQGVTATVNGQTVTAKGPKGELKFVVNDEV-LVKMEGSEIAVQPRDQTKT 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A    G+ RT   N++ GV  GF+KKL++ GVGYRA ++GK++ L LGFSH V    P G
Sbjct: 61  ARSKWGMSRTQIVNILHGVKDGFEKKLEITGVGYRAAMQGKNLQLALGFSHDVVYETPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + + V + T ITV+G DK  +GQ AA IR++R PEPYKGKGV+YA E I R
Sbjct: 121 VTIAVPKPTEITVTGIDKQQVGQVAAEIREYRGPEPYKGKGVRYAGEKIVR 171



>gb:AE017248_415830 Treponema denticola ATCC 35405, section 3 of 10
           of the complete genome.>gb:AE017226_1069426 Treponema
           denticola ATCC 35405, complete genome.
          Length = 179

 Score =  152 bits (385), Expect = 6e-36
 Identities = 75/171 (43%), Positives = 113/171 (66%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+GK P+ +P+ V + +    F V+GP G+L   Y  E    K E   + V +  +  +
Sbjct: 2   SRVGKMPVAIPAGVKVNVANGIFTVEGPKGKLSQDYHTEAVDFKIEGDHVLVTRKDDELQ 61

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
               HGL+R+L +NM+ GVS GF K L + GVGYRA V+GK +V+ LG+S+   + IP+G
Sbjct: 62  TRAYHGLYRSLLNNMVTGVSTGFTKTLVINGVGYRAEVQGKLLVMALGYSNDFSVIIPEG 121

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           ++VKV++  ++ +SG  K A+GQFA+ +RK R PEPYKGKG++Y DE+I+R
Sbjct: 122 IEVKVDQ-LKVIISGASKEAVGQFASQVRKLRGPEPYKGKGIRYEDEIIKR 171



>gb:TARIBPROT_197308 Thermus aquaticus rps8, rpl6, rpl18, rps5,
           rpl30, rpl15 genes.>gb:AE017305_436947 Thermus
           thermophilus HB27 section 5 of 7 of the complete
           genome.>gb:AP008226_579134 Thermus thermophilus HB8
           genomic DNA, complete genome.>gb:AE017221_1078925
           Thermus thermophilus HB27 complete genome.
          Length = 180

 Score =  152 bits (385), Expect = 6e-36
 Identities = 79/170 (46%), Positives = 111/170 (65%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG+ PIPVP  V++++     KVKGP GEL +    E+++  EE GV+RV +  + RR
Sbjct: 2   SRIGRLPIPVPKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEE-GVVRVERPSDERR 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HGL RTL  N + GVS+G+ K+L + G+GYRA + G+ + L +GFSHPV +  P+G
Sbjct: 61  HKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGRALELTVGFSHPVVVEPPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           +  +V E TR+ VSG DK  +GQ AA+IR  R P  Y  KG+ YA E +R
Sbjct: 121 ITFEVPEPTRVRVSGIDKQKVGQVAANIRAIRKPSAYHEKGIYYAGEPVR 170



>gb:CP000033_88613 Lactobacillus acidophilus NCFM, complete genome.
          Length = 176

 Score =  152 bits (385), Expect = 6e-36
 Identities = 78/171 (45%), Positives = 108/171 (63%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG + I VP +VT+  EG +  VKGP GEL   +  ++  E+ + G +   ++ E+ +
Sbjct: 2   SRIGLKTIEVPDSVTVTKEGDNITVKGPKGELTRYFDPKITFEQND-GEINFSRSSESDK 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A  +HG  R    +MI GV  G+ K L+L+GVGYRA  +G  I LN+G+SHPV +  P+G
Sbjct: 61  A--LHGTERANLASMIEGVLNGYKKTLKLIGVGYRAQAQGNKITLNVGYSHPVVLTAPEG 118

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + VK    T + V G  K  +GQFAA IR  RPPEPYKGKG++Y DE +RR
Sbjct: 119 VSVKATSATDVEVEGVSKQDVGQFAAEIRAVRPPEPYKGKGIRYVDEYVRR 169



>pir|H82003|H82003 50S ribosomal protein L6 NMA0114 [imported] -
           Neisseria meningitidis (strain Z2491 serogroup
           A)>gb:NMA1Z2491_153078 Neisseria meningitidis serogroup
           A strain Z2491 complete genome; segment 1/7.
          Length = 177

 Score =  152 bits (385), Expect = 6e-36
 Identities = 76/169 (44%), Positives = 107/169 (63%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K P+ VP+ V +K   +   +KG  GEL      +V +E  + G L       +++
Sbjct: 2   SRVAKNPVTVPAGVEVKFGTEALVIKGKNGELSFPLHSDVAIEFND-GKLTFVANNSSKQ 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           AN M G  R L  NM+ GVS+GF+K+LQL+GVGYRA  +GK + L+LGFSHP+   +P+G
Sbjct: 61  ANAMSGTARALVSNMVKGVSEGFEKRLQLIGVGYRAQAQGKILNLSLGFSHPIVYEMPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI 740
           + V+    T I ++G DK  +GQ AA IR +R PEPYKGKGV+Y  EV+
Sbjct: 121 VSVQTPSQTEIVLTGSDKQVVGQVAAEIRAFRAPEPYKGKGVRYVGEVV 169



>sp|P24316|RL6_THETH 50S ribosomal protein L6.
          Length = 179

 Score =  152 bits (385), Expect = 6e-36
 Identities = 79/170 (46%), Positives = 111/170 (65%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG+ PIPVP  V++++     KVKGP GEL +    E+++  EE GV+RV +  + RR
Sbjct: 1   SRIGRLPIPVPKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEE-GVVRVERPSDERR 59

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HGL RTL  N + GVS+G+ K+L + G+GYRA + G+ + L +GFSHPV +  P+G
Sbjct: 60  HKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGRALELTVGFSHPVVVEPPEG 119

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           +  +V E TR+ VSG DK  +GQ AA+IR  R P  Y  KG+ YA E +R
Sbjct: 120 ITFEVPEPTRVRVSGIDKQKVGQVAANIRAIRKPSAYHEKGIYYAGEPVR 169



>gb:CR555306_107578 Azoarcus sp. EbN1 complete genome.
          Length = 177

 Score =  152 bits (384), Expect = 8e-36
 Identities = 77/170 (45%), Positives = 108/170 (63%), Gaps = 1/170 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKE-ESGVLRVRKAMETR 410
           SR+ K P+ +P  V I +   +  VKGPLG +       V LE++ ++ V + R+ +   
Sbjct: 2   SRVAKNPVAIPQGVEITIGADEVSVKGPLGAVKQYIGNAVTLERDGDALVCKAREGVANS 61

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
           RA  M G  R L +NM+ GV+KGF++KL LVGVGYRA  +G  + L LGFSHPV   +P 
Sbjct: 62  RA--MSGTVRALVNNMVTGVTKGFERKLTLVGVGYRAQAQGDKLNLTLGFSHPVVHQMPA 119

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI 740
           G++V+    T I + G DK  +GQ AA +R +R PEPYKGKGV+Y+DEV+
Sbjct: 120 GVKVETPTQTEIVIKGIDKQQVGQVAAEVRAYREPEPYKGKGVRYSDEVV 169



>gb:AE004969_61474 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 177

 Score =  152 bits (383), Expect = 1e-35
 Identities = 76/169 (44%), Positives = 107/169 (63%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K P+ VP+ V +K   +   +KG  GEL      +V +E  + G L       +++
Sbjct: 2   SRVAKNPVTVPAGVEVKFGTEALVIKGKNGELSFPLHSDVAIEFND-GKLTFVANNSSKQ 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           AN M G  R L  NM+ GVS+GF+KKLQL+GVGYRA  +GK + L+LGFSHP+   +P+G
Sbjct: 61  ANAMSGTARALVSNMVKGVSEGFEKKLQLMGVGYRAQAQGKILNLSLGFSHPIVYEMPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI 740
           + V+    T I ++G DK  +GQ A+ IR +R PEPYKGKGV+Y  EV+
Sbjct: 121 VSVQTPSQTEIVLTGSDKQVVGQVASEIRAFRAPEPYKGKGVRYVGEVV 169



>pir|H81266|H81266 50S ribosomal protein L6 Cj1692c [imported] -
           Campylobacter jejuni (strain NCTC
           11168)>gb:CJ11168X6_848048 Campylobacter jejuni subsp.
           jejuni NCTC 11168 complete genome; segment
           6/6.>gb:CP000025_879583 Campylobacter jejuni RM1221,
           complete genome.
          Length = 178

 Score =  152 bits (383), Expect = 1e-35
 Identities = 79/171 (46%), Positives = 115/171 (67%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGKQPI +P+ V +K+EG   K K       +     V +E +++ +L   K  E R+
Sbjct: 2   SRIGKQPIAIPAGVEVKLEGNLLKFKKGNLAKELDTKANVNVEIKDNNILFSPKG-EDRQ 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           +    G +R L  N++VG+++GF K L++ GVGY+A ++GK + L+LGFSHP+   IP+G
Sbjct: 61  SRAYWGTYRALAYNIVVGLTQGFSKTLEINGVGYKAALKGKVLELSLGFSHPINYDIPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +++ V++NT I V G DK  +GQ AA IR++RPPEPYKGKGVKY+DE I R
Sbjct: 121 IEIVVDKNT-IAVKGSDKQVVGQVAAQIREFRPPEPYKGKGVKYSDERIIR 170



>sp|P25056|RL6_CHLTR 50S ribosomal protein L6.>gb:AE001323_34451
           Chlamydia trachomatis D/UW-3/CX section 50 of 87 of the
           complete genome.>gb:AE001273_1098477 Chlamydia
           trachomatis D/UW-3/CX, complete genome.
          Length = 183

 Score =  152 bits (383), Expect = 1e-35
 Identities = 72/171 (42%), Positives = 109/171 (63%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR  + PI +P  V + ++  +  VKGP G L     +EV++  + + V     A    R
Sbjct: 2   SRKARDPIVLPQGVEVSIQNDEISVKGPKGSLTQVLAKEVEIAVKGNEVFVTPAAHVVDR 61

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              + GL+  L  NM+ GV  GF+K+L+++GVG+RA V+G  + L++G SHP +M IP G
Sbjct: 62  PGRIQGLYWALIANMVKGVHTGFEKRLEMIGVGFRAAVQGSLLDLSIGVSHPTKMPIPTG 121

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           L+V VE+NT I++ G +K  +G+FAA +R  RPPEPYKGKG++Y +E +RR
Sbjct: 122 LEVSVEKNTLISIKGINKQLVGEFAACVRAKRPPEPYKGKGIRYENEYVRR 172



>sp|Q9PJM8|RL6_CHLMU 50S ribosomal protein L6.>pir|A81664|A81664
           ribosomal protein L6 TC0801 [imported] - Chlamydia
           muridarum (strain Nigg)>gb:AE002347_45383 Chlamydia
           muridarum Nigg section 75 of 85 of the complete
           genome.>gb:AE002160_1149523 Chlamydia muridarum Nigg,
           complete genome.
          Length = 183

 Score =  152 bits (383), Expect = 1e-35
 Identities = 73/171 (42%), Positives = 109/171 (63%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR  + PI +P  V + ++  +  VKGP G L     +EV++  + + V     A    R
Sbjct: 2   SRKARDPIVLPQGVEVSIQNDEISVKGPKGSLTQVLAKEVEIAVKGNEVFVSPAAHIIDR 61

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              M GL+  L  NM+ GV  GF+K+L+++GVG+RA V+G  + L++G SHP +M IP G
Sbjct: 62  PGRMQGLYWALIANMVKGVHLGFEKRLEMIGVGFRASVQGSFLDLSIGVSHPTKMPIPTG 121

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           L+V VE+NT I++ G +K  +G+FAA +R  RPPEPYKGKG++Y +E +RR
Sbjct: 122 LEVSVEKNTLISIKGINKQLVGEFAACVRAKRPPEPYKGKGIRYENEYVRR 172



>gb:CP000020_870428 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 177

 Score =  151 bits (382), Expect = 1e-35
 Identities = 75/170 (44%), Positives = 110/170 (64%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K P+ +P+ V +K+ GQ+  +KG  GEL       V + +E++ ++   +   T  
Sbjct: 2   SRVAKAPVVIPAGVEVKLNGQEITIKGGKGELTRVLNDAVVISQEDNTIVFGPREGVTN- 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A    G  R L +NM++GV++GF KKL L GVGYRA ++G  + L LGFSHPV  A+P+G
Sbjct: 61  AWAQAGTARALVNNMVIGVNEGFTKKLILKGVGYRAAMKGNAVGLTLGFSHPVEHALPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           ++ +    T I V+G DK  +GQ AA +R +R PEPYKGKGV+YADE++R
Sbjct: 121 IKAECPTQTEIVVTGCDKQLVGQVAADLRSYRQPEPYKGKGVRYADEIVR 170



>pir|B64094|B64094 ribosomal protein L6 - Haemophilus influenzae
           (strain Rd KW20)>gb:U32762_204465 Haemophilus influenzae
           Rd KW20 section 77 of 163 of the complete
           genome.>gb:L42023_1097014 Haemophilus influenzae Rd KW20
           complete genome.
          Length = 177

 Score =  151 bits (382), Expect = 1e-35
 Identities = 78/170 (45%), Positives = 106/170 (62%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K P+ +P+ V +K++GQ   VKG  GEL       V++ K+++G            
Sbjct: 2   SRVAKAPVNIPAGVEVKLDGQLLTVKGKNGELSRKIHESVEV-KQDNGQFTFTPREGFVE 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           AN   G  R L + M++GV++GF KKL LVGVGYRA ++G  I L+LG+SHPV   +P G
Sbjct: 61  ANAQSGTARALVNAMVIGVTEGFTKKLVLVGVGYRAQLKGNAIALSLGYSHPVEHTLPVG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           +  +    T I + G DK  IGQ AA IR +R PEPYKGKGV+YADEV+R
Sbjct: 121 ITAECPSQTEIVLKGADKQLIGQVAADIRAYRRPEPYKGKGVRYADEVVR 170



>pir|B75314|B75314 ribosomal protein L6 - Deinococcus radiodurans
           (strain R1)>gb:AE002046_42358 Deinococcus radiodurans R1
           section 183 of 229 of the complete chromosome
           1.>gb:AE000513_883253 Deinococcus radiodurans R1
           complete chromosome 1.
          Length = 212

 Score =  151 bits (382), Expect = 1e-35
 Identities = 79/169 (46%), Positives = 109/169 (64%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGKQPI VPS VT+  +   FKVKGP GEL + Y  E+ + +++   L V +  + ++
Sbjct: 29  SRIGKQPIAVPSGVTVNAQDGVFKVKGPKGELTVPYNTELTV-RQDGDQLLVERPSDAQK 87

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HGL RTL  N + GVS G+   L+L GVG+RA + GK + +N+G+SHPV +  P G
Sbjct: 88  HRALHGLTRTLVANAVKGVSDGYTINLELRGVGFRAKLTGKALEMNIGYSHPVIIEPPAG 147

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI 740
           +   V E TRI VSG DK  +GQ AA++RK R P+ Y GKGV++  E I
Sbjct: 148 VTFAVPEPTRIDVSGIDKQLVGQVAANVRKVRKPDAYHGKGVRFVGEQI 196



>sp|P44347|RL6_HAEIN 50S ribosomal protein L6.
          Length = 176

 Score =  151 bits (382), Expect = 1e-35
 Identities = 78/170 (45%), Positives = 106/170 (62%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K P+ +P+ V +K++GQ   VKG  GEL       V++ K+++G            
Sbjct: 1   SRVAKAPVNIPAGVEVKLDGQLLTVKGKNGELSRKIHESVEV-KQDNGQFTFTPREGFVE 59

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           AN   G  R L + M++GV++GF KKL LVGVGYRA ++G  I L+LG+SHPV   +P G
Sbjct: 60  ANAQSGTARALVNAMVIGVTEGFTKKLVLVGVGYRAQLKGNAIALSLGYSHPVEHTLPVG 119

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           +  +    T I + G DK  IGQ AA IR +R PEPYKGKGV+YADEV+R
Sbjct: 120 ITAECPSQTEIVLKGADKQLIGQVAADIRAYRRPEPYKGKGVRYADEVVR 169



>sp|Q9RSL3|RL6_DEIRA 50S ribosomal protein L6.
          Length = 185

 Score =  151 bits (382), Expect = 1e-35
 Identities = 79/169 (46%), Positives = 109/169 (64%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGKQPI VPS VT+  +   FKVKGP GEL + Y  E+ + +++   L V +  + ++
Sbjct: 2   SRIGKQPIAVPSGVTVNAQDGVFKVKGPKGELTVPYNTELTV-RQDGDQLLVERPSDAQK 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HGL RTL  N + GVS G+   L+L GVG+RA + GK + +N+G+SHPV +  P G
Sbjct: 61  HRALHGLTRTLVANAVKGVSDGYTINLELRGVGFRAKLTGKALEMNIGYSHPVIIEPPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI 740
           +   V E TRI VSG DK  +GQ AA++RK R P+ Y GKGV++  E I
Sbjct: 121 VTFAVPEPTRIDVSGIDKQLVGQVAANVRKVRKPDAYHGKGVRFVGEQI 169



>gb:BX950851_842750 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 177

 Score =  151 bits (381), Expect = 2e-35
 Identities = 78/171 (45%), Positives = 109/171 (63%), Gaps = 1/171 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGV-LRVRKAMETR 410
           SR+ K P+ +P+ V +K+ GQD  +KG  GEL       V++++ ++ +    R+     
Sbjct: 2   SRVAKAPVVIPAGVEVKLNGQDISIKGKNGELSRKIHNAVEVKQADNALTFAPREGFVDG 61

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
            A    G  R L + M++GV++GF KKLQLVGVGYRA V+G  + L+LGFSHPV  A+P 
Sbjct: 62  WAQA--GTTRALLNAMVIGVTEGFTKKLQLVGVGYRAAVKGNMVNLSLGFSHPVEHALPA 119

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           G+  +    T I + G DK  IGQ AA +R +R PEPYKGKGV+YADEV+R
Sbjct: 120 GITAECPSQTEIVLKGADKQVIGQVAAELRAYRRPEPYKGKGVRYADEVVR 170



>gb:AP006627_562492 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 178

 Score =  151 bits (381), Expect = 2e-35
 Identities = 72/171 (42%), Positives = 110/171 (64%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+GK+P+ +P  VT+  +G    VKGP GEL      ++K+  E + +   R + + + 
Sbjct: 2   SRVGKKPVIIPDGVTVTFDGNLCTVKGPKGELSRELHPDIKITVEGNEITFERPS-DHKE 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HG  R L +NM+ GV+KGF++ L+L GVGYRA   G  +VLN+G+SHPV +   +G
Sbjct: 61  HRALHGTMRALVNNMVEGVTKGFERALELNGVGYRASKSGNKLVLNVGYSHPVEITPEEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           L+++V  NT++ V G +K  +G  A++IR  R PEPYKGKG++Y  E +RR
Sbjct: 121 LEIEVPSNTKVVVKGINKERVGALASNIRAVRLPEPYKGKGIRYEGEYVRR 171



>gb:CP000031_84560 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 177

 Score =  150 bits (380), Expect = 2e-35
 Identities = 73/171 (42%), Positives = 108/171 (63%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+P+ +PS V+  + GQ  +VKGP G    T   +V +  + + V    + M ++R
Sbjct: 2   SRIGKKPVELPSGVSAAVSGQTIEVKGPKGARSFTATDDVTITVDGNVVSITPRGM-SKR 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A +  G+ RT+  N++ GV++GF K+L++ GVGYRA  +G  + LNLG+SH V   +P G
Sbjct: 61  ARQQWGMSRTMVANLVAGVTEGFKKELEITGVGYRANAQGNTLKLNLGYSHDVDFTVPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + V   + T I V G D+  +G+ AA IR+WR PEPYKGKG++Y  E I R
Sbjct: 121 VTVSTPKQTEIVVEGIDQQQVGEVAAKIREWRSPEPYKGKGIRYKGEFIFR 171



>gb:AE010470_263445 Fusobacterium nucleatum subsp. nucleatum ATCC
           25586, section 12 of 197 of the complete
           genome.>gb:AE009951_910613 Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586, complete genome.
          Length = 177

 Score =  150 bits (378), Expect = 4e-35
 Identities = 80/171 (46%), Positives = 107/171 (62%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+GK+PI VPS V   ++     VKGP G L   +   + + K E G + V +  +   
Sbjct: 2   SRVGKKPIAVPSGVDFSVKDNVVTVKGPKGTLTKEFNNNITI-KLEDGHITVERPNDEPF 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HG  R L +NM+ GV +G+ K L LVGVGYRA  +GK + ++LG+SHPV +    G
Sbjct: 61  MRAIHGTTRALINNMVKGVHEGYRKTLTLVGVGYRAATKGKGLEISLGYSHPVIIDEIPG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +   VE+NT I + G +K  +GQ AA+IR  RPPEPYKGKGVKYADE IRR
Sbjct: 121 ITFSVEKNTTIHIDGVEKELVGQVAANIRAKRPPEPYKGKGVKYADEHIRR 171



>sp|O83234|RL6_TREPA 50S ribosomal protein L6.>pir|F71356|F71356
           probable ribosomal protein L6 (rplF) - syphilis
           spirochete>gb:AE001202_33033 Treponema pallidum subsp.
           pallidum str. Nichols section 18 of 87 of the complete
           genome.>gb:AE000520_1049261 Treponema pallidum subsp.
           pallidum str. Nichols complete genome.
          Length = 179

 Score =  150 bits (378), Expect = 4e-35
 Identities = 75/171 (43%), Positives = 112/171 (65%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK P+ VP  V +++     +V+GP G L   +   V +  E+  V+ V +  +++R
Sbjct: 2   SRIGKVPVSVPGGVHVRVSSGVVEVEGPKGVLSCAFLPVVTVRVEQEYVI-VARCDDSKR 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A   HGL+R L  NM+VGVS+GF K L + G+GYRA V+G+ +V+ LG+S+   + IP G
Sbjct: 61  ARACHGLYRKLLSNMVVGVSEGFSKTLVITGIGYRAEVQGRVLVMALGYSNDFTVLIPSG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           ++V+VE +TR+ VSG  K  +G+FAA +R+ R PE YKGKG++Y  E I R
Sbjct: 121 IEVRVESSTRVIVSGVSKERVGEFAAQLRRLRLPEAYKGKGIRYDYETIVR 171



>sp|Q9Z7S1|RL6_CHLPN 50S ribosomal protein L6.>pir|F86569|F86569 L6
           ribosomal protein [imported] - Chlamydophila pneumoniae 
           (strain J138)>pir|C72054|C72054 ribosomal protein L6
           [imported] - Chlamydophila pneumoniae  (strains CWL029
           and AR39)>gb:AE001647_37484 Chlamydia pneumoniae section
           63 of 103 of the complete genome.>gb:AE002173_43601
           Chlamydophila pneumoniae AR39, section 9 of 94 of the
           complete genome.>gb:AE017159_394000 Chlamydophila
           pneumoniae TW-183, section 3 of 4 of the complete
           genome.>gb:BA000008_664003 Chlamydophila pneumoniae J138
           genomic DNA, complete sequence.>gb:AE002161_885726
           Chlamydophila pneumoniae AR39, complete
           genome.>gb:AE001363_942041 Chlamydia pneumoniae,
           complete genome.>gb:AE009440_1028262 Chlamydophila
           pneumoniae TW-183, complete genome.
          Length = 183

 Score =  150 bits (378), Expect = 4e-35
 Identities = 74/171 (43%), Positives = 110/171 (64%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR  ++PI +P  V + ++     VKGP G L     +EV++  +++ +          R
Sbjct: 2   SRKAREPILLPQGVEVSIQDDKIIVKGPKGSLTQKSVKEVEITLKDNSIFVHAAPHVVDR 61

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
            + M GL+  L  NM+ GV  GF+K+L+++GVG+RA V+G  + L++G SHP ++ IP  
Sbjct: 62  PSCMQGLYWALISNMVQGVHLGFEKRLEMIGVGFRASVQGAFLDLSIGVSHPTKIPIPST 121

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           LQV VE+NT I+V G DK  +G+FAASIR  RPPEPYKGKG++Y +E +RR
Sbjct: 122 LQVSVEKNTLISVKGLDKQLVGEFAASIRAKRPPEPYKGKGIRYENEYVRR 172



>gb:BX571661_778984 Wolinella succinogenes, complete genome; segment
           5/7.
          Length = 178

 Score =  149 bits (377), Expect = 5e-35
 Identities = 84/172 (48%), Positives = 115/172 (66%), Gaps = 1/172 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFK-VKGPLGELGITYPREVKLEKEESGVLRVRKAMETR 410
           SRIGK+PI +PS V  K+EG      KG   ++  TY R V LE   +G L ++   E  
Sbjct: 2   SRIGKRPISIPSGVDAKIEGSKIVFTKGKQEKVLETYGR-VGLEIA-NGELVLKLGGEDA 59

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
           ++    G +R L +N+++G+S GF K+L++ GVGY+A V+G  + L LGFSHPV   IP+
Sbjct: 60  QSKAYWGTYRALANNIVIGLSAGFTKQLEINGVGYKAAVKGSVLELALGFSHPVNYEIPE 119

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           G+++ VE+N  IT+ G DK  IGQ AA IR++RPPEPYKGKGVKY+DE I R
Sbjct: 120 GVEIAVEKNV-ITIKGSDKQQIGQIAAEIREFRPPEPYKGKGVKYSDETIIR 170



>gb:BA000031_705732 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 177

 Score =  149 bits (377), Expect = 5e-35
 Identities = 77/170 (45%), Positives = 105/170 (61%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K P+ +P+ V +K+ GQ+  VKG  GEL       V + +EE+ +    K      
Sbjct: 2   SRVAKAPVAIPAGVEVKLNGQEITVKGAKGELTRVLNDAVVIAQEENNLTFGPKE-GVAN 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A    G  R L +NM+VGV++GF KKL L GVGYRA ++G  + L LGFSHPV   +P G
Sbjct: 61  AWAQAGTARALVNNMVVGVTEGFTKKLTLKGVGYRAAIKGNAVGLTLGFSHPVEHELPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           ++ +    T I ++G DK  +GQ AA IR +R PEPYKGKGV+YADE +R
Sbjct: 121 IKAECPSQTEIVITGCDKQLVGQVAADIRSYRQPEPYKGKGVRYADENVR 170



>gb:AP006628_566650 Onion yellows phytoplasma OY-M DNA, complete
           genome.
          Length = 184

 Score =  149 bits (377), Expect = 5e-35
 Identities = 73/172 (42%), Positives = 112/172 (65%), Gaps = 1/172 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDF-KVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR 410
           SR+G + I VP+ V + ++ ++F  V+GP G+L   +   + +  E   V+ V++  +  
Sbjct: 2   SRVGNKAIEVPNAVKVDIKDRNFISVEGPKGKLEYQFNHRLTITNENK-VITVKRPNDEI 60

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
              ++HG  R L  NM+ GVSKGF K L++VG+ YRA ++ K ++L+LGFSHPV +AIPD
Sbjct: 61  FMKKIHGTTRALLSNMVEGVSKGFQKTLKIVGLAYRAQIKDKQLILSLGFSHPVSVAIPD 120

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
            L+V V +NT I + G DK  +G+FAA   K R PEPYKGKG++Y  + +R+
Sbjct: 121 NLEVVVNQNTEIVIKGIDKQLVGEFAAKNVKLRKPEPYKGKGIRYVGQYVRQ 172



>gb:CP000027_79494 Dehalococcoides ethenogenes 195, complete genome.
          Length = 182

 Score =  149 bits (376), Expect = 7e-35
 Identities = 78/170 (45%), Positives = 105/170 (61%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK PI VP  VT+ ++G D  VKGP G L  T+  EV + ++    L V      + 
Sbjct: 2   SRIGKMPIKVPPGVTVDIKGNDVTVKGPKGTLNRTFRPEVTITRD-GDYLVVAPVGTDKA 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A    GL RTL DNMIVGV  GFDK L++VGVG RA  +G +I+  +G+SH V +A P G
Sbjct: 61  ARSFFGLSRTLLDNMIVGVKDGFDKNLEIVGVGMRADKDGNNIIFKVGYSHTVTVAPPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           + + V+  T++ VSG +K  + Q AA IR  R P+ Y GKG++YA E +R
Sbjct: 121 ITLSVDGTTKVKVSGINKEEVSQMAAEIRSIRKPDHYMGKGIRYAGEYVR 170



>gb:CP000009_862392 Gluconobacter oxydans 621H, complete genome.
          Length = 178

 Score =  149 bits (375), Expect = 9e-35
 Identities = 77/171 (45%), Positives = 103/171 (60%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+GK P+ VP+ V + +    FK KG LGEL +   R V+++ E S V        +R 
Sbjct: 2   SRVGKYPVEVPAGVQVSVADGFFKAKGKLGELTVPVSRHVEVKIEGSNVSVAPVGRRSRE 61

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              M G  R L  N + GVS GF K L++ G G+RA V+G ++V+NLGFSH V   IP+G
Sbjct: 62  NWTMWGTTRALIANTVKGVSDGFSKGLEIQGTGFRAAVQGSNLVMNLGFSHDVVYPIPEG 121

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +++     T I V G DK  +GQ A  IR +R PEPYKGKGV+Y  EV+RR
Sbjct: 122 IKITTPRPTAIVVEGNDKQRVGQVALDIRSFRKPEPYKGKGVRYETEVLRR 172



>gb:AE017282_429070 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 177

 Score =  149 bits (375), Expect = 9e-35
 Identities = 80/171 (46%), Positives = 102/171 (59%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+   PI +P  V + +       KG  G L  T P E+ ++ E  G L +R     +R
Sbjct: 2   SRVANNPISIPKGVEVTIADGIVTAKGKNGLLSRTVPAELGVDLE-GGTLSIRYNKNDQR 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
            N + G  R    NMIVGVS GF++KL LVGVGYRA  +G  + L+LGFSHPV   +P G
Sbjct: 61  QNALAGTTRANLANMIVGVSNGFERKLSLVGVGYRAQAKGDVLSLSLGFSHPVEFKVPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + V+    T I V G D+  +GQ AA IR +R PEPYKGKGV+YADEVI R
Sbjct: 121 VVVETPSQTDIVVKGADRQVVGQVAADIRAFRAPEPYKGKGVRYADEVIIR 171



>gb:AE016994_374174 Chlamydophila caviae GPIC section 1 of 4 of the
           complete genome.>gb:AE015925_993853 Chlamydophila caviae
           GPIC complete genome.
          Length = 183

 Score =  149 bits (375), Expect = 9e-35
 Identities = 75/171 (43%), Positives = 108/171 (63%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR  + PI +P  V + ++  +  VKGP G L      EV ++ ++  V          R
Sbjct: 2   SRKARDPIVLPQGVEVSIQNNEILVKGPKGSLKQVLAPEVVVDIKDREVFVHAAPHVVDR 61

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
            + M GLF  L  NM+ GV+ GF+K+L+++GVG+RA V+G  + L++G SHP +M IP  
Sbjct: 62  PSRMQGLFWALISNMVQGVNTGFEKRLEMIGVGFRAAVQGSVLDLSIGVSHPTKMPIPAE 121

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           LQV VE+NT I+V G +K  +G+FAASIR  R PEPYKGKG++Y +E +RR
Sbjct: 122 LQVSVEKNTLISVKGINKQLVGEFAASIRAKRRPEPYKGKGIRYENEYVRR 172



>gb:AE013171_289845 Thermoanaerobacter tengcongensis MB4, section
           198 of 244 of the complete genome.>gb:AE008691_1111910
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 180

 Score =  149 bits (375), Expect = 9e-35
 Identities = 75/171 (43%), Positives = 110/171 (64%), Gaps = 1/171 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDF-KVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR 410
           SRIG+ PIP+P  V +K+   +   VKG  G L   +P  V +E  +  V+  RK  + +
Sbjct: 2   SRIGRLPIPIPKGVEVKVSPDNVVTVKGAKGTLEKKFPPIVNIEVRDGEVVVTRKG-DDK 60

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
               MHG  R +  NM+ GV++GF+K L++VGVGYRA  +GK ++LN+G+SHPV +    
Sbjct: 61  EERAMHGTTRAIIANMVKGVTEGFEKALEIVGVGYRAAKQGKKLILNVGYSHPVEIEEEP 120

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           G+++ VE N RI V G DK  +GQ AA+IR+ R P+ Y+GKG++Y  EV+R
Sbjct: 121 GIEIIVEGNNRIIVRGADKERVGQVAANIRRVREPDAYQGKGIRYVGEVVR 171



>pir|D90583|D90583 50S ribosomal protein L6 [imported] - Mycoplasma
           pulmonis  (strain UAB CTIP)>gb:MPULM03_150085 Mycoplasma
           pulmonis (strain UAB CTIP) complete genome; segment 3/3.
          Length = 179

 Score =  148 bits (374), Expect = 1e-34
 Identities = 72/171 (42%), Positives = 110/171 (64%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+GK+ I +PS   +K++G  F+VKG LG L   +   V + K E+  + V +  E + 
Sbjct: 2   SRVGKRIIQIPSGTEVKIDGSFFEVKGKLGSLSRLFSPFVNI-KHENNQISVERLNELKP 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
             ++HG    L  NM+ GVS+GF K+L++ GVGY+A ++G+++ L  G+SHPV + IP  
Sbjct: 61  TKQLHGTTNALIANMVKGVSEGFKKELKIEGVGYKATLKGQNLELAAGYSHPVSLVIPKD 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           L+V+V +   I +SG DK  +G+FAA +R  RPP  Y GKG++Y DE +RR
Sbjct: 121 LKVEVPKPVNIIISGIDKQVVGEFAAKVRGVRPPSVYSGKGIQYKDEKLRR 171



>gb:CP000013_869724 Borrelia garinii PBi, complete genome.
          Length = 180

 Score =  148 bits (373), Expect = 1e-34
 Identities = 75/171 (43%), Positives = 108/171 (63%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG+ PI +P  V I ++G    V+G  G+L       + + K E+G + V +A   ++
Sbjct: 2   SRIGRLPIKIPDTVKIDVKGNLVIVEGTRGKLVQDIKDSINV-KVENGSVIVNRAFNDKK 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
               HGL+R+L  NM+ GV++GF K L + G+GYR   +G  + LNLG+S      +PDG
Sbjct: 61  TKAYHGLYRSLIFNMVKGVTEGFSKSLTINGIGYRVEQQGNSLFLNLGYSTQFEYVVPDG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + VK++ NT+I+V G DK  +GQ AA IR  + PEPYKGKG+KY +EVIRR
Sbjct: 121 VSVKLDGNTKISVEGIDKFKVGQVAAEIRSLKKPEPYKGKGIKYDNEVIRR 171



>gb:BA000026_694348 Mycoplasma penetrans HF-2 DNA, complete genome.
          Length = 183

 Score =  148 bits (373), Expect = 1e-34
 Identities = 71/171 (41%), Positives = 108/171 (63%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+G + + +PS V +++E    K+ G LG L + +  +      +  ++ V++A + + 
Sbjct: 2   SRVGNRLLSIPSGVNVEVEKSLVKITGKLGTLSVPFDSKKLSVLNKDSMVIVKRANDEKE 61

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HG      +N ++GV+ G  KKL++VGVGY+A V G  I LNLG+SHP+ + IP G
Sbjct: 62  TKMLHGTTNANINNALIGVNSGHTKKLKIVGVGYKAAVNGNKINLNLGYSHPIDLEIPAG 121

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           L V   + T + ++G DK+ +GQFAA IR  RPPEPYKGKGV Y++EVI R
Sbjct: 122 LNVTCPQATEVVITGADKAVVGQFAAVIRSKRPPEPYKGKGVAYSNEVIIR 172



>gb:AL646073_547932 Ralstonia solanacearum GMI1000 chromosome,
           complete sequence; segment 17/19.
          Length = 177

 Score =  148 bits (373), Expect = 1e-34
 Identities = 76/167 (45%), Positives = 103/167 (61%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+GK PI +P    +   G    VKGPLG L       VK+  + +G +    A E+R 
Sbjct: 2   SRVGKAPIALPKGAEVNFAGGLLTVKGPLGTLTQAIHNLVKVVID-NGTITFSPADESRE 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           AN + G  R L  NM+ GV+ GF++KL LVGVGYRA ++G  + L LGFSH V   +P+G
Sbjct: 61  ANALQGTMRALVANMVKGVTTGFERKLTLVGVGYRASLQGAALKLQLGFSHDVIHEMPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADE 734
           ++ +    T I + G DK  +GQ AA +R +RPPEPYKGKGV+YA+E
Sbjct: 121 VKAETPTQTEIIIKGSDKQKVGQVAAEVRGYRPPEPYKGKGVRYANE 167



>pir|AI0027|AI0027 50S ribosomal protein L6 [imported] - Yersinia
           pestis  (strain CO92)>gb:AE014003_302290 Yersinia pestis
           KIM section 403 of 415 of the complete
           genome.>gb:AE017127_386075 Yersinia pestis biovar
           Medievalis str. 91001 section 1 of 16 of the complete
           genome.>gb:AJ414141_522077 Yersinia pestis strain CO92
           complete genome; segment 1/20.>gb:BX936398_838326
           Yersinia pseudotuberculosis IP32953 genome, complete
           sequence.>gb:AE009952_932473 Yersinia pestis KIM
           complete genome.>gb:AE017042_1142641 Yersinia pestis
           biovar Medievalis str. 91001 complete genome.
          Length = 177

 Score =  148 bits (373), Expect = 1e-34
 Identities = 79/171 (46%), Positives = 109/171 (63%), Gaps = 1/171 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGV-LRVRKAMETR 410
           SR+ K P+ +P+ V +K+ GQ   +KG  GEL  T    V++++EE+ +    R+     
Sbjct: 2   SRVAKAPVVIPAGVEVKLNGQVISIKGKNGELTRTVHSAVEVKQEENTLTFAPREGAVDG 61

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
            A    G  R L ++M++GV++GF KKLQLVGVGYRA V+G  + L LGFSHPV   +P 
Sbjct: 62  WAQA--GTTRALLNSMVIGVTEGFTKKLQLVGVGYRAAVKGNVVNLALGFSHPVDHELPA 119

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           G+  +    T I + G DK  IGQ AA +R +R PEPYKGKGV+YADEV+R
Sbjct: 120 GITAECPTQTEIVLKGADKQVIGQVAADLRAYRRPEPYKGKGVRYADEVVR 170



>sp|Q9ZAE4|RL6_THEMA 50S ribosomal protein L6.>pir|E72248|E72248
           ribosomal protein L6 - Thermotoga maritima (strain
           MSB8)>gb:AE001798_39380 Thermotoga maritima MSB8 section
           110 of 136 of the complete genome.>gb:AE000512_1113853
           Thermotoga maritima MSB8, complete genome.
          Length = 184

 Score =  148 bits (373), Expect = 1e-34
 Identities = 73/177 (41%), Positives = 114/177 (64%), Gaps = 6/177 (3%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVL------RVRK 395
           SR+ K+PI +P  VT++++    KVKGP GEL   +   VK+E E + V       ++ +
Sbjct: 2   SRLAKKPIVLPQGVTVEIKDNVVKVKGPKGELSQEFLPYVKIEVEGNEVWVRPNEEQIIR 61

Query: 396 AMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVR 575
             + R+     G + +L  NM+VGV++G+ K+L++VG+GYRA ++G  +V+NLG++HPV 
Sbjct: 62  KSDWRKVKMFQGTYWSLIRNMVVGVTEGYKKELEIVGIGYRAQLQGNTLVMNLGYAHPVV 121

Query: 576 MAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
             IP  ++++V    RI VSG DK  +GQ AA IR +RPP  Y GKG++Y  EV+R+
Sbjct: 122 YEIPSDVKIEVPAPNRIIVSGIDKQRVGQVAAEIRAFRPPNVYTGKGIRYVGEVVRQ 178



>gb:BX842654_825765 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 9/11.
          Length = 180

 Score =  147 bits (372), Expect = 2e-34
 Identities = 79/172 (45%), Positives = 108/172 (62%), Gaps = 1/172 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKME-GQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR 410
           SRIGK P+   + V + +    +  VKG    L I     V  + + + V+      +T+
Sbjct: 2   SRIGKAPVIFDNTVQVSVSPANEVVVKGAKSSLTIGMKPNVSAKIDGNKVVLTPND-DTK 60

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
            +  MHGL+R L  N + GV+KGF + L+L GVGYRA V GK + L+LGFSHPV   IP+
Sbjct: 61  ESRAMHGLYRALIQNAVTGVTKGFSRGLELQGVGYRANVAGKKLELSLGFSHPVIFDIPE 120

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           G+++KVE+ T +TV+G  K  +GQ AA IR +RPPEPY GKGV+YA E IRR
Sbjct: 121 GIEIKVEKQTSLTVNGPSKELVGQVAAKIRSFRPPEPYLGKGVRYAGEQIRR 172



>gb:TMRIBPRSA_197859 Thermotoga maritima DNA for spc operon.
          Length = 184

 Score =  147 bits (372), Expect = 2e-34
 Identities = 76/178 (42%), Positives = 116/178 (65%), Gaps = 7/178 (3%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKE-ESGVLR------VR 392
           SR+ K+PI +P  VT++++    KVKGP GEL   +   VK+E E   G +R      +R
Sbjct: 2   SRLAKKPIVLPQGVTVEIKDNVVKVKGPKGELSQEFLPYVKIEVEGNEGWVRPNEEQIIR 61

Query: 393 KAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPV 572
           K+ + R+     G + +L  NM+VGV++G+ K+L++VG+GYRA ++G  +V+NLG++HPV
Sbjct: 62  KS-DWRKVKMFQGTYWSLIRNMVVGVTEGYKKELEIVGIGYRAQLQGNTLVMNLGYAHPV 120

Query: 573 RMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
              IP  ++++V    RI VSG DK  +GQ AA IR +RPP  Y GKG++Y  EV+R+
Sbjct: 121 VYEIPSDVKIEVPAPNRIIVSGIDKQRVGQVAAEIRAFRPPNVYTGKGIRYVGEVVRQ 178



>gb:AE016799_335507 Vibrio vulnificus CMCP6 chromosome I section 3
           of 11 of the complete sequence.>gb:BA000037_721216
           Vibrio vulnificus YJ016 DNA, chromosome I, complete
           sequence.>gb:AE016795_1045231 Vibrio vulnificus CMCP6
           chromosome I complete sequence.
          Length = 177

 Score =  147 bits (371), Expect = 3e-34
 Identities = 76/170 (44%), Positives = 104/170 (61%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K P+ +P+ V +K+ GQ+  VKG  GEL       V + +EE+  L          
Sbjct: 2   SRVAKAPVAIPAGVEVKLNGQEITVKGAKGELSRVINNAVVIAQEENK-LTFGPREGVAN 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A    G  R L +NM+VGV++GF +KL L GVGYRA ++G  + L LGFSHPV   +P G
Sbjct: 61  AWAQAGTARALVNNMVVGVTEGFTRKLILKGVGYRAAIKGNAVGLTLGFSHPVEHELPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           ++ +    T I ++G DK  IGQ AA IR +R PEPYKGKG++YADE +R
Sbjct: 121 IKAECPSQTEIVLTGCDKQLIGQVAADIRAYRAPEPYKGKGIRYADENVR 170



>gb:AE013598_297269 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 175

 Score =  147 bits (370), Expect = 3e-34
 Identities = 77/171 (45%), Positives = 107/171 (62%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K+P+ +P  V + ++ +   VKGP G L  T P+   +E    G +    A +  +
Sbjct: 2   SRVAKKPVSLPKGVELNVQSELVSVKGPKGTL--TLPKPTGVEIAIDGDVATLSANDPSQ 59

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              + G  R +  NM+ GVS+GF++KL+LVGVGYRA ++GKD+ L LGFSHP+    P+G
Sbjct: 60  I-AITGTVRAILANMVKGVSEGFERKLELVGVGYRAAMQGKDLSLALGFSHPLVFVAPEG 118

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + +     T I V G DK  +G+ AA IR +RPPEPYKGKGVKYA EVI R
Sbjct: 119 ITLSTPTQTEILVQGADKQRVGEVAAKIRGFRPPEPYKGKGVKYAGEVIIR 169



>gb:AE012965_287632 Chlorobium tepidum TLS section 186 of 194 of the
           complete genome.>gb:AE006470_934800 Chlorobium tepidum
           TLS complete genome.
          Length = 179

 Score =  147 bits (370), Expect = 3e-34
 Identities = 74/171 (43%), Positives = 109/171 (63%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK PI +     ++++     V GP G L      EV +   + G + V++  +++R
Sbjct: 2   SRIGKMPIRLADQAQVEVKENMINVTGPKGALSQALVDEVIVSVAD-GAVTVQRKDDSKR 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A  MHGL+R L  NM+ GV+KGF +KL++ GVGYRA ++G  + L LG+SH +    P  
Sbjct: 61  ARAMHGLYRMLVSNMVEGVTKGFTRKLEMSGVGYRAELKGNLLALTLGYSHMIYFQPPAE 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           ++++V + T + VSG DK+ +GQ AA IR +R PEPY+GKG+KY  EVIRR
Sbjct: 121 IKIEVPDPTTVLVSGIDKALVGQIAAKIRSFRKPEPYRGKGIKYEGEVIRR 171



>gb:AE017148_391146 Helicobacter hepaticus ATCC 51449 section 5 of 6
           of the complete genome.>gb:AE017125_1025408 Helicobacter
           hepaticus ATCC 51449 complete genome.
          Length = 178

 Score =  146 bits (369), Expect = 4e-34
 Identities = 75/171 (43%), Positives = 111/171 (64%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+GK+PI +P  V + ++G     KG   +  +     V++  ++ G L         +
Sbjct: 2   SRVGKKPINIPKGVEVSVQGSKILFKGAKEQKELETYGRVQIHLQD-GTLSFACVDSQAQ 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           +    G +R L +N+IVG+S+GF K L++ GVGY+A + GK++ + LGFSHPV   IP G
Sbjct: 61  SRAYWGTYRALANNIIVGLSQGFTKVLEINGVGYKANISGKNLEMALGFSHPVIYPIPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +++ V++NT IT+ G DK  IGQ AA IRK+RPPEPYKGKG+KY+DE+I R
Sbjct: 121 VEMSVDKNT-ITIKGADKQQIGQIAAEIRKFRPPEPYKGKGIKYSDEMIVR 170



>gb:BX571965_792997 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.>gb:CP000010_866765
           Burkholderia mallei ATCC 23344 chromosome 1, complete
           sequence.
          Length = 176

 Score =  146 bits (368), Expect = 6e-34
 Identities = 74/169 (43%), Positives = 104/169 (61%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+GK PI +     +K+      VKGPLG +       V +   + G L +    ++R 
Sbjct: 2   SRVGKSPIAL-QGAEVKLADGAITVKGPLGTITQAVNPLVNVANND-GTLNLSPVDDSRE 59

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           AN + G  R +  N + GV+KGF++KL LVGVGYRA  +G  + L+LGFSHPV   +P+G
Sbjct: 60  ANALSGTMRAIIANAVHGVTKGFERKLTLVGVGYRAQAQGDKLNLSLGFSHPVVHQMPEG 119

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI 740
           ++ +    T I + G DK  +GQ AA +R +RPPEPYKGKGV+YADEV+
Sbjct: 120 IKAETPTQTEIVIKGIDKQKVGQVAAEVRGYRPPEPYKGKGVRYADEVV 168



>gb:BX251410_764425 Tropheryma whipplei TW08/27, complete genome;
           segment 1/3.
          Length = 181

 Score =  146 bits (368), Expect = 6e-34
 Identities = 74/171 (43%), Positives = 109/171 (63%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+GK PI +P  V + + G+   + GP G L +    ++ +   +  VL V ++ ++R 
Sbjct: 5   SRVGKLPIEIPVGVEVCVNGRTVSITGPKGSLYLDIAEQIGVSVSDGKVL-VSRSDDSRT 63

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A  +HGL R L  N + GV  G+ K L++VG GYR   +G+++ L LGFSHPV +    G
Sbjct: 64  ARALHGLTRALIANNVHGVLHGYTKTLEIVGTGYRVSKKGENLELALGFSHPVFVDPVPG 123

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +   VE N++I VSG DK A+G+ AASIRK   PEPYKGKG++Y+DE++RR
Sbjct: 124 VSFGVEGNSKIIVSGIDKQAVGEAAASIRKLSKPEPYKGKGIRYSDEIVRR 174



>gb:AE016852_349064 Tropheryma whipplei str. Twist, section 3 of 3
           of the complete genome.>gb:AE014184_1029260 Tropheryma
           whipplei str. Twist, complete genome.
          Length = 198

 Score =  146 bits (368), Expect = 6e-34
 Identities = 74/171 (43%), Positives = 109/171 (63%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+GK PI +P  V + + G+   + GP G L +    ++ +   +  VL V ++ ++R 
Sbjct: 22  SRVGKLPIEIPVGVEVCVNGRTVSITGPKGSLYLDIAEQIGVSVSDGKVL-VSRSDDSRT 80

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A  +HGL R L  N + GV  G+ K L++VG GYR   +G+++ L LGFSHPV +    G
Sbjct: 81  ARALHGLTRALIANNVHGVLHGYTKTLEIVGTGYRVSKKGENLELALGFSHPVFVDPVPG 140

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +   VE N++I VSG DK A+G+ AASIRK   PEPYKGKG++Y+DE++RR
Sbjct: 141 VSFGVEGNSKIIVSGIDKQAVGEAAASIRKLSKPEPYKGKGIRYSDEIVRR 191



>sp|Q9KNZ9|RL6_VIBCH 50S ribosomal protein L6.>pir|G82057|G82057
           ribosomal protein L6 VC2581 [imported] - Vibrio cholerae
            (strain N16961 serogroup O1)>gb:AE004326_52952 Vibrio
           cholerae O1 biovar eltor str. N16961 chromosome I,
           section 234 of 251 of the complete
           chromosome.>gb:AE003852_1053726 Vibrio cholerae O1
           biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 177

 Score =  146 bits (368), Expect = 6e-34
 Identities = 74/170 (43%), Positives = 104/170 (61%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K P+ +P+ V +K+ GQ+  +KG  GEL   +   V + +E++  L          
Sbjct: 2   SRVAKAPVAIPAGVEVKLNGQEITIKGAKGELTRVFHNGVVIAQEDNQ-LTFGPREGVAN 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A    G  R L  NM+VGV++GF KKL L GVGYRA ++G  + L LGFSHPV   +P G
Sbjct: 61  AWAQAGTARALVKNMVVGVTEGFTKKLVLKGVGYRAAMKGNAVGLTLGFSHPVEHELPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           ++ +    T I ++G DK  +GQ AA IR +R PEPYKGKG++YADE +R
Sbjct: 121 VKAECPSQTEIVLTGCDKQVVGQVAADIRSYRAPEPYKGKGIRYADENVR 170



>gb:BX571874_789566 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 16/17.
          Length = 177

 Score =  145 bits (366), Expect = 1e-33
 Identities = 77/171 (45%), Positives = 109/171 (63%), Gaps = 1/171 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGV-LRVRKAMETR 410
           SR+ K P+ +P++V +K++GQ   +KG  GEL  T    V+++  ++ +    R      
Sbjct: 2   SRVAKAPVVIPTDVEVKLDGQVISIKGKNGELSRTIHSAVEVKHADNQLTFAPRDGYVDG 61

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
            A    G  R+L + M++GV++GF KKLQLVGVGYRA V+G  I ++LGFSHPV   +P 
Sbjct: 62  WAQA--GTTRSLMNAMVIGVTEGFTKKLQLVGVGYRAAVKGNVINMSLGFSHPVDHELPA 119

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           G+  +    T I + G DK  IGQ AA +R +R PEPYKGKGV+YADEV+R
Sbjct: 120 GITAECPSQTEIVLKGADKQVIGQVAAELRAYRRPEPYKGKGVRYADEVVR 170



>gb:AE012189_280176 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 97 of 460 of the complete
           genome.>gb:AE008922_913458 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 175

 Score =  145 bits (366), Expect = 1e-33
 Identities = 78/171 (45%), Positives = 107/171 (62%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K+P+ +P  V + ++ +   VKGP G L +  P  V +E    G +    A +  +
Sbjct: 2   SRVAKKPVSLPKGVELNVQPELISVKGPKGTLTLQKP--VGVEIAIDGDVATLSANDPSQ 59

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              + G  R +  NMI GVS+GF++KL+LVGVGYRA ++GKD+ L LGFSHP+    P+G
Sbjct: 60  I-AITGTVRAILANMIKGVSEGFERKLELVGVGYRAAMQGKDLSLALGFSHPLVFVAPEG 118

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + +     T I V G DK  +G+ AA IR +RPPEPYKGKGVKYA EVI R
Sbjct: 119 ITLSTPTQTEILVQGADKQRVGEVAAKIRGFRPPEPYKGKGVKYAGEVIIR 169



>gb:AE011728_275941 Xanthomonas axonopodis pv. citri str. 306,
           section 106 of 469 of the complete
           genome.>gb:AE008923_917716 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 175

 Score =  145 bits (366), Expect = 1e-33
 Identities = 77/171 (45%), Positives = 106/171 (61%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K+P+ +P  V + ++     VKGP G L  T P+   +E    G +    A +  +
Sbjct: 2   SRVAKKPVSLPKGVELNVQPGLVSVKGPKGTL--TLPKPAGVEIAIDGGVATLSANDPSQ 59

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              + G  R +  NM+ GVS+GF++KL+LVGVGYRA ++GKD+ L LGFSHP+    P+G
Sbjct: 60  I-ALTGTVRAILANMVKGVSEGFERKLELVGVGYRAAMQGKDLSLALGFSHPLVFVAPEG 118

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + +     T I V G DK  +G+ AA IR +RPPEPYKGKGVKYA EVI R
Sbjct: 119 ITLSTPTQTEIVVQGADKQRVGEVAAKIRGFRPPEPYKGKGVKYAGEVIIR 169



>pir|D65123|R5EC6 ribosomal protein L6 [validated] - Escherichia
           coli (strain K-12)>pir|B91150|B91150 50S ribosomal
           subunit protein L6 [imported] - Escherichia coli (strain
           O157:H7, substrain RIMD 0509952)>pir|F85995|F85995 50S
           ribosomal subunit protein L6 [imported] - Escherichia
           coli (strain O157:H7, substrain
           EDL933)>gb:AE005174_68425 Escherichia coli O157:H7
           EDL933, complete genome.>gb:AE005674_72921 Shigella
           flexneri 2a str. 301, complete genome.>gb:ECOUW67_130862
           Escherichia coli K-12 chromosomal region from 67.4 to
           76.0 minutes.>gb:U00096_202305 Escherichia coli K-12
           MG1655 complete genome.>gb:AE016767_328044 Escherichia
           coli CFT073 section 13 of 18 of the complete
           genome.>gb:AE016992_373823 Shigella flexneri 2a str.
           2457T section 15 of 16 of the complete
           genome.>gb:BA000007_662182 Escherichia coli O157:H7 DNA,
           complete genome.>gb:AE014075_958628 Escherichia coli
           CFT073 complete genome.>gb:AE014073_998573 Shigella
           flexneri 2a str. 2457T complete
           genome.>gb:AX188899_1463403 Sequence 100 from Patent
           WO0148209.
          Length = 177

 Score =  144 bits (364), Expect = 2e-33
 Identities = 79/170 (46%), Positives = 103/170 (60%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K P+ VP+ V +K+ GQ   +KG  GEL  T    V++ K     L          
Sbjct: 2   SRVAKAPVVVPAGVDVKINGQVITIKGKNGELTRTLNDAVEV-KHADNTLTFGPRDGYAD 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
                G  R L ++M++GV++GF KKLQLVGVGYRA V+G  I L+LGFSHPV   +P G
Sbjct: 61  GWAQAGTARALLNSMVIGVTEGFTKKLQLVGVGYRAAVKGNVINLSLGFSHPVDHQLPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           +  +    T I + G DK  IGQ AA +R +R PEPYKGKGV+YADEV+R
Sbjct: 121 ITAECPTQTEIVLKGADKQVIGQVAADLRAYRRPEPYKGKGVRYADEVVR 170



>sp|P02390|RL6_ECOLI 50S ribosomal protein L6.
          Length = 176

 Score =  144 bits (364), Expect = 2e-33
 Identities = 79/170 (46%), Positives = 103/170 (60%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K P+ VP+ V +K+ GQ   +KG  GEL  T    V++ K     L          
Sbjct: 1   SRVAKAPVVVPAGVDVKINGQVITIKGKNGELTRTLNDAVEV-KHADNTLTFGPRDGYAD 59

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
                G  R L ++M++GV++GF KKLQLVGVGYRA V+G  I L+LGFSHPV   +P G
Sbjct: 60  GWAQAGTARALLNSMVIGVTEGFTKKLQLVGVGYRAAVKGNVINLSLGFSHPVDHQLPAG 119

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           +  +    T I + G DK  IGQ AA +R +R PEPYKGKGV+YADEV+R
Sbjct: 120 ITAECPTQTEIVLKGADKQVIGQVAADLRAYRRPEPYKGKGVRYADEVVR 169



>gb:AE016960_367501 Coxiella burnetii strain RSA 493, section 1 of 7
           of the complete genome.>gb:AE016828_1008237 Coxiella
           burnetii strain RSA 493, complete genome.
          Length = 178

 Score =  144 bits (363), Expect = 2e-33
 Identities = 74/167 (44%), Positives = 104/167 (62%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K PI +P+ V + + GQ   VKG LG L     R VK+ K ++  L+   A ++  
Sbjct: 3   SRVAKNPIKIPTGVEVNVAGQQITVKGKLGTLTRVIHRAVKVTKTDAE-LQTICANDSPG 61

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           +N + G  R +  NM+ GV  GF +KL +VGVGYRA  EGK + L +G SHPV + +P+G
Sbjct: 62  SNALAGTARAVLANMVQGVHTGFQRKLVMVGVGYRAKAEGKKLNLTVGLSHPVNIEMPEG 121

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADE 734
           + V+    T I V G DK  + Q AA+IR+ RPPEPYKGKG++Y +E
Sbjct: 122 ITVETPSQTEIIVKGADKQRVSQVAANIREIRPPEPYKGKGIRYDNE 168



>gb:AE015473_314670 Shewanella oneidensis MR-1 section 22 of 457 of
           the complete genome.>gb:AE014299_950267 Shewanella
           oneidensis MR-1 complete genome.
          Length = 177

 Score =  144 bits (363), Expect = 2e-33
 Identities = 78/171 (45%), Positives = 103/171 (60%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K P+ +P+ V + +  Q   VKG  G L       V +  E +GV++         
Sbjct: 2   SRVAKAPVSIPAGVEVTLNEQTLTVKGAKGSLTRVINNAVNVVIE-NGVIKFLPVEGAVG 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A    G  R L +NM+VGVS+GF++KL+LVGVGYRA + G DI L LGFSHP+   +P G
Sbjct: 61  AWAQAGTTRALVNNMVVGVSQGFERKLKLVGVGYRAKLVGADIDLTLGFSHPLVHKLPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +  +    T I + G DK  IGQ AA IR +RPPEPYKGKGV+Y DE +RR
Sbjct: 121 VTAECPSQTDIVLRGVDKQLIGQVAAEIRGYRPPEPYKGKGVRYDDEEVRR 171



>gb:AE012554_283879 Xylella fastidiosa Temecula1, section 2 of 9 of
           the complete genome.>gb:AE009442_960455 Xylella
           fastidiosa Temecula1, complete genome.
          Length = 175

 Score =  144 bits (363), Expect = 2e-33
 Identities = 74/171 (43%), Positives = 104/171 (60%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K+PI +P  V + ++     VKG  G L  T+P+   +     G +    A +   
Sbjct: 2   SRVAKKPISIPKGVEVSVQSDMLTVKGVKGVL--TFPKSDNVNVVMDGDILTLSANDHSH 59

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
            + + G  R +  NMI GVS GF++KL+LVGVGYRA ++GKD+ L+LGFSHP+    P+G
Sbjct: 60  VS-LAGTVRAILSNMIKGVSIGFERKLELVGVGYRASMQGKDLNLSLGFSHPLLFVPPEG 118

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + +     T + V G DK  +G+ AA IR +RPPEPYKGKG+KYA E I R
Sbjct: 119 INLLTPSQTEVVVQGIDKQRVGEVAAKIRNFRPPEPYKGKGLKYATEAIMR 169



>pir|AH1007|AH1007 50S ribosomal chain protein L6 [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)>gb:CP000026_77991 Salmonella enterica
           subsp. enterica serovar Paratypi A str. ATCC
           9150.>gb:AE008857_245060 Salmonella typhimurium LT2,
           section 161 of 220 of the complete
           genome.>gb:AE016848_348003 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, section 15 of 16 of the
           complete genome.>gb:AL627282_544376 Salmonella enterica
           serovar Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 18/20.>gb:AE014613_985335 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, complete
           genome.>gb:AE006468_1002142 Salmonella typhimurium LT2,
           complete genome.
          Length = 177

 Score =  144 bits (363), Expect = 2e-33
 Identities = 78/171 (45%), Positives = 107/171 (62%), Gaps = 1/171 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGV-LRVRKAMETR 410
           SR+ K P+ VP+ V +K+ GQ   +KG  GEL  T    V+++  ++ +    R      
Sbjct: 2   SRVAKAPVVVPAGVDVKINGQVITIKGKNGELTRTLNDAVEVKHADNALTFGPRDGYADG 61

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
            A    G  R L ++M++GV++GF KKLQLVGVGYRA V+G  + L+LGFSHPV   +P 
Sbjct: 62  WAQA--GTARALLNSMVIGVTEGFTKKLQLVGVGYRAAVKGNVVNLSLGFSHPVDHQLPA 119

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           G+  +    T I + G DK  IGQ AA +R +R PEPYKGKGV+YADEV+R
Sbjct: 120 GITAECPTQTEIVLKGADKQVIGQVAADLRAYRRPEPYKGKGVRYADEVVR 170



>sp|Q8XFL6|RL6_SALTY 50S ribosomal protein L6.
          Length = 176

 Score =  144 bits (363), Expect = 2e-33
 Identities = 78/171 (45%), Positives = 107/171 (62%), Gaps = 1/171 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGV-LRVRKAMETR 410
           SR+ K P+ VP+ V +K+ GQ   +KG  GEL  T    V+++  ++ +    R      
Sbjct: 1   SRVAKAPVVVPAGVDVKINGQVITIKGKNGELTRTLNDAVEVKHADNALTFGPRDGYADG 60

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
            A    G  R L ++M++GV++GF KKLQLVGVGYRA V+G  + L+LGFSHPV   +P 
Sbjct: 61  WAQA--GTARALLNSMVIGVTEGFTKKLQLVGVGYRAAVKGNVVNLSLGFSHPVDHQLPA 118

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           G+  +    T I + G DK  IGQ AA +R +R PEPYKGKGV+YADEV+R
Sbjct: 119 GITAECPTQTEIVLKGADKQVIGQVAADLRAYRRPEPYKGKGVRYADEVVR 169



>gb:BX294146_769410 Pirellula sp. strain 1 complete genome; segment
           14/24.
          Length = 181

 Score =  144 bits (362), Expect = 3e-33
 Identities = 68/171 (39%), Positives = 108/171 (63%), Gaps = 1/171 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKE-ESGVLRVRKAMETR 410
           SRIG +P+ +PS VT+ +  ++  V+GP G+L   +  EVK+  + ++  + V +  + R
Sbjct: 2   SRIGNKPVAIPSGVTVSIADRNIDVEGPKGKLSFKHRPEVKVAVDSDTNQVIVSRDGDDR 61

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
            + E HGL R +  NM+VGV  G++KKL++VGVGY A + G  + L +G+++ +   IP 
Sbjct: 62  PSREFHGLTRAIVANMLVGVKDGYEKKLEIVGVGYLASISGDTLQLRVGYANELHRKIPT 121

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
            L V   + T + + G DK ++GQFAA IR  R PEPYKGKG++Y  E ++
Sbjct: 122 DLTVTCPDQTHVVIQGCDKQSVGQFAAEIRSLRKPEPYKGKGIRYQGEQVK 172



>gb:AE014295_312254 Bifidobacterium longum NCC2705, complete genome.
          Length = 179

 Score =  143 bits (361), Expect = 4e-33
 Identities = 72/171 (42%), Positives = 104/171 (60%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           S IGK PI +P+ V +K+EGQ+F  KG  G      P  +    E + ++ +  A + R 
Sbjct: 3   SHIGKLPIAIPAGVEVKIEGQNFSAKGAKGSDSYVVPEGITAAVEGNEIV-LTAADDLRP 61

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
               HGL R++   M+ GV  G+ K L++VG GYRA+ +G+ I   LG+SH + +  P+G
Sbjct: 62  TRAKHGLARSIMAGMVKGVHDGYSKTLEIVGTGYRAVAKGQGIEFFLGYSHTITVNPPEG 121

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + +KV +   + V G DK  +GQ AA+IRK R PEPYKGKG+KY+DE I R
Sbjct: 122 ITLKVTDANHVVVEGTDKQVVGQVAANIRKLRAPEPYKGKGIKYSDERILR 172



>gb:BX842644_822732 Mycoplasma mycoides subsp. mycoides SC genomic
           DNA, complete sequence; segment 3/4.
          Length = 180

 Score =  143 bits (360), Expect = 5e-33
 Identities = 70/172 (40%), Positives = 109/172 (63%), Gaps = 1/172 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKM-EGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR 410
           SRIG + + +P+ V +K+ E     + G  G L   +   +K+E EE+ ++  ++  E +
Sbjct: 2   SRIGNRLLQIPNGVEVKIAENNLITITGSKGTLSKQFSPLIKIEVEENKLI-TKRLNEQK 60

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
              ++HG   +L   M+ GVS+GF K+LQ+ GVGY+A V G  + L+LG+SHPV   IP 
Sbjct: 61  HTKQLHGTTNSLLQGMLTGVSEGFKKELQITGVGYKAAVNGSKLNLSLGYSHPVEFEIPK 120

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           G++++  + T + +SG DK  +GQ AA+IR +R PEPYKGKG+KY +E I R
Sbjct: 121 GVEIQAVKPTELVISGIDKQLVGQVAANIRAYRKPEPYKGKGIKYKNETIIR 172



>gb:AE017156_393285 Haemophilus ducreyi strain 35000HP section 6 of
           6 of the complete genome.>gb:AE017143_1027547
           Haemophilus ducreyi strain 35000HP complete genome.
          Length = 177

 Score =  143 bits (360), Expect = 5e-33
 Identities = 72/170 (42%), Positives = 106/170 (62%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K P+ +P+ + +K+ GQ   VKG  GEL       V++ ++ + +  V +      
Sbjct: 2   SRVAKAPVNIPAGIEVKINGQLLTVKGKNGELSREIHNAVEVNQDANALTFVPRE-GVAN 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A+   G  R L + M++GV++GF KKLQLVGVGYRA ++G  + L+LG+SHP+   +P G
Sbjct: 61  ADAQAGTARALVNAMVIGVTEGFTKKLQLVGVGYRAQMKGNVVALSLGYSHPIEHTLPLG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           +  +    T I +   DK  IGQ AA IR +R PEPYKGKGV+Y+DEV+R
Sbjct: 121 VTGECPSQTEIILKSADKQLIGQVAADIRAYRRPEPYKGKGVRYSDEVVR 170



>pir|S29886|S29886 ribosomal protein L6 - Micrococcus
           luteus>gb:MLSPCOPER_148789 M.luteus DNA for
           spectinomycin (spc) operon.
          Length = 178

 Score =  142 bits (359), Expect = 6e-33
 Identities = 79/175 (45%), Positives = 112/175 (64%), Gaps = 4/175 (2%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLG---ELGITYPREVKLEKEESGVLRVRKAME 404
           SRIG+ PI +P+ V + ++G    VKGP G   +L  + P  +    EE G + V +  +
Sbjct: 2   SRIGRLPITIPAGVDVTIDGDRVSVKGPKGPKGQLEHSLPTPITATLEE-GQVTVARPDD 60

Query: 405 TRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAI 584
            R +  +HGL RTL  NM+ GV+ GF K+L++VG GYR   +G+D+  +LG+SHPV + +
Sbjct: 61  ERESRSLHGLTRTLISNMVEGVTNGFSKQLEVVGTGYRVQAKGQDLEFDLGYSHPVPVKV 120

Query: 585 PDGLQVKVEENTRITVSGYDKSA-IGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
             G+   VE N R+TV+G DK   +G+ AA+IRK R P+PYKGKGV YA E IRR
Sbjct: 121 SQGITFTVEGN-RVTVAGIDKQQQVGETAANIRKLRRPDPYKGKGV-YAGEQIRR 173



>sp|P04448|RL6_MYCCA 50S ribosomal protein L6.>pir|S02846|R5YM6
           ribosomal protein L6 - Mycoplasma
           capricolum>gb:MCRPCLUS_143189 Mycoplasma capricolum
           ribosomal protein gene cluster.>gb:MCRPS8L6_143196
           Mycoplasma capricolum genes for ribosomal proteins S8
           and L6.
          Length = 180

 Score =  142 bits (359), Expect = 6e-33
 Identities = 70/172 (40%), Positives = 109/172 (63%), Gaps = 1/172 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKM-EGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR 410
           SRIG + + +P+ V +K+ E     + G  G L   +   +K+E EE+ ++  ++  E +
Sbjct: 2   SRIGNRLLQIPNGVEVKIAENNLVTITGSKGTLSKQFSPLIKIEVEENKLI-TKRLNEQK 60

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
              ++HG   +L   M+ GVS+GF K+LQ+ GVGY+A V G  + L+LG+SHPV   IPD
Sbjct: 61  HTKQLHGTTNSLLQGMLTGVSEGFKKELQITGVGYKAAVNGSKLNLSLGYSHPVEFEIPD 120

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           G+ ++  + T + ++G DK  +GQ AA+IR +R PEPYKGKG+KY +E I R
Sbjct: 121 GVVIQAVKPTELAITGIDKQLVGQVAANIRAYRKPEPYKGKGIKYKNETIIR 172



>sp|P33099|RL6_MICLU 50S ribosomal protein L6.
          Length = 177

 Score =  142 bits (359), Expect = 6e-33
 Identities = 79/175 (45%), Positives = 112/175 (64%), Gaps = 4/175 (2%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLG---ELGITYPREVKLEKEESGVLRVRKAME 404
           SRIG+ PI +P+ V + ++G    VKGP G   +L  + P  +    EE G + V +  +
Sbjct: 1   SRIGRLPITIPAGVDVTIDGDRVSVKGPKGPKGQLEHSLPTPITATLEE-GQVTVARPDD 59

Query: 405 TRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAI 584
            R +  +HGL RTL  NM+ GV+ GF K+L++VG GYR   +G+D+  +LG+SHPV + +
Sbjct: 60  ERESRSLHGLTRTLISNMVEGVTNGFSKQLEVVGTGYRVQAKGQDLEFDLGYSHPVPVKV 119

Query: 585 PDGLQVKVEENTRITVSGYDKSA-IGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
             G+   VE N R+TV+G DK   +G+ AA+IRK R P+PYKGKGV YA E IRR
Sbjct: 120 SQGITFTVEGN-RVTVAGIDKQQQVGETAANIRKLRRPDPYKGKGV-YAGEQIRR 172



>gb:ECSPC_132779 Escherichia coli spc ribosomal protein operon.
          Length = 177

 Score =  142 bits (357), Expect = 1e-32
 Identities = 78/170 (45%), Positives = 102/170 (60%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K P+ VP+ V +K+ GQ   +KG  GEL  T    V++ K     L          
Sbjct: 2   SRVAKAPVVVPAGVDVKINGQVITIKGKNGELTRTLNDAVEV-KHADNTLTFGPRDGYAD 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
                G  R L ++M++GV++ F KKLQLVGVGYRA V+G  I L+LGFSHPV   +P G
Sbjct: 61  GWAQAGTARALLNSMVIGVTEDFTKKLQLVGVGYRAAVKGNVINLSLGFSHPVDHQLPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           +  +    T I + G DK  IGQ AA +R +R PEPYKGKGV+YADEV+R
Sbjct: 121 ITAECPTQTEIVLKGADKQVIGQVAADLRAYRRPEPYKGKGVRYADEVVR 170



>sp|O51446|RL6_BORBU 50S ribosomal protein L6.>pir|D70161|D70161
           ribosomal protein L6 (rplF) - Lyme disease
           spirochete>gb:AE001152_32473 Borrelia burgdorferi B31
           (section 38 of 70) of the complete
           genome.>gb:AE000783_1120124 Borrelia burgdorferi B31
           complete genome.
          Length = 180

 Score =  142 bits (357), Expect = 1e-32
 Identities = 73/171 (42%), Positives = 107/171 (62%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG+ PI +P  V + ++     V+G  G L       + + K E+G + V + +  ++
Sbjct: 2   SRIGRLPIKIPDAVKVDVKDNLVIVEGIRGRLVQDIKDSINV-KVENGSVIVDRVLNDKK 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A   HGL+R+L  NM+ GV++GF K L + G+GYR   +G  + L+LG+S      IPDG
Sbjct: 61  AKAYHGLYRSLIFNMVKGVTEGFSKSLTINGIGYRVEQQGNSLFLSLGYSTQFEYVIPDG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + VK++ NT+I+V G DK  +GQ AA IR  + PEPYKGKG+KY +EVIRR
Sbjct: 121 ISVKLDGNTKISVEGIDKFKVGQVAAEIRSLKKPEPYKGKGIKYDNEVIRR 171



>gb:AE015024_314288 Streptococcus mutans UA159 section 172 of 185 of
           the complete genome.>gb:AE014133_941289 Streptococcus
           mutans UA159 complete genome.
          Length = 178

 Score =  141 bits (356), Expect = 1e-32
 Identities = 71/171 (41%), Positives = 111/171 (64%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG + I +P+ V +  +     VKGP GEL   +P+ ++++ E + V  + +  +++ 
Sbjct: 2   SRIGNKVITLPAGVEVTNKDNVVTVKGPKGELTREFPKVIEIKIEGTEVT-LHRPNDSKE 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HG  R   +NM++GVS+GF K+L++ GVGYRA ++GK +VL++G SHP  +  P+G
Sbjct: 61  MKTIHGTARANLNNMVIGVSEGFKKELEMRGVGYRAQLQGKKLVLSVGKSHPDEVEAPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +  +V   T I V+G +K  +GQ AA IR  R PEPYKGKG++YA E +RR
Sbjct: 121 ITFEVPTATAIVVNGINKEVVGQTAAYIRGLRVPEPYKGKGIRYAGEYVRR 171



>gb:AF022186_1761937 Cyanidium caldarium strain RK1 chloroplast,
           complete genome.
          Length = 181

 Score =  141 bits (355), Expect = 2e-32
 Identities = 72/171 (42%), Positives = 107/171 (62%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+ I +  NV + ++ Q   VKG  G L    P  V+L K    +  +   ++T +
Sbjct: 2   SRIGKKSILLNQNVQVDIKDQVCIVKGQKGTLQRKLPCNVELIKRGPELFIIPVDLDTVK 61

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HGL RTL +NM++GVS GF KKL++ GVGY+A +  + +VL LG+SH ++   P+G
Sbjct: 62  KRRLHGLLRTLINNMVIGVSIGFSKKLEIHGVGYKAHIADQHLVLTLGYSHVIKFLPPEG 121

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + + VE N  + V G DK  +G  +A IR  +PPE YKGKG++YA E++RR
Sbjct: 122 VSLLVENNNIVLVKGIDKEKVGLASACIRSIKPPEVYKGKGIRYAGELVRR 172



>gb:AE017263_420690 Mesoplasma florum L1 complete genome.
          Length = 180

 Score =  141 bits (355), Expect = 2e-32
 Identities = 72/172 (41%), Positives = 105/172 (61%), Gaps = 1/172 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQD-FKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR 410
           SRIG + + +P+ V + +   +   VKG  G L   +   + + K E   L   +A E +
Sbjct: 2   SRIGNRILTIPAGVEVSVASDNTVTVKGSKGTLTQKFAEVITI-KVEGAELSTTRANEIK 60

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
              ++HG   +L   M++GVS+GF K L + GVGYRA + G  + L+LG+SHPV   IP 
Sbjct: 61  HTKQLHGTTNSLLQGMLIGVSEGFKKTLDINGVGYRAALAGSKLNLSLGYSHPVEYTIPQ 120

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           G+ V+  + T+I +SG DK  +GQ AA IR +R PEPYKGKG+KY+DE+I R
Sbjct: 121 GITVECPKPTQIIISGIDKQVVGQVAAEIRSYRRPEPYKGKGIKYSDEIIIR 172



>pir|C86885|C86885 50S ribosomal protein L6 [imported] - Lactococcus
           lactis subsp. lactis (strain IL1403)>gb:AE006437_218985
           Lactococcus lactis subsp. lactis IL1403 section 199 of
           218 of the complete genome.>gb:AE005176_1096058
           Lactococcus lactis subsp. lactis IL1403, complete
           genome.
          Length = 178

 Score =  140 bits (354), Expect = 2e-32
 Identities = 71/171 (41%), Positives = 106/171 (61%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG + I +P+ V++++ G    VKGP GEL  ++   + L+  E+ +  V++  +T+ 
Sbjct: 2   SRIGNKVIVIPAGVSVEVNGATVTVKGPKGELVRSFNENITLDIAENEIT-VKRPNDTKE 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HG  R L  NM+ GVS GF K L+++GVGYRA ++G  +VL++G SH   +  P+ 
Sbjct: 61  MKMLHGTTRALLANMVEGVSTGFSKALEMIGVGYRAQLQGTKLVLSVGKSHQDEVEAPEN 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           ++  V   T I V G  K A+GQ AA IR  R PEPYKGKG++Y  E +RR
Sbjct: 121 IKFVVATPTSIVVEGISKEAVGQTAAYIRSRRSPEPYKGKGIRYVGEYVRR 171



>gb:AJ749949_530797 Francisella tularensis subsp. tularensis
           complete genome.
          Length = 178

 Score =  140 bits (353), Expect = 3e-32
 Identities = 71/172 (41%), Positives = 105/172 (61%), Gaps = 1/172 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKME-GQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR 410
           SRIGK+P+ +PS VTI +  G   +VKG    L  T+  +V     ++ V  +     ++
Sbjct: 2   SRIGKKPVVIPSGVTINVAAGNKVEVKGAKATLSKTFSTDVTFSVADN-VATITPNNNSK 60

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
            A    G  R +  NM+ GVSKGF++KL+++GVGYRA  +G ++ L LGFSHPV   +P 
Sbjct: 61  NAVAQSGTARAILSNMVEGVSKGFERKLKIIGVGYRAKAQGNELNLTLGFSHPVVYKLPQ 120

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           G+  +    T I + G DK  +G+ A+ IR++R PEPYKGKGV+Y DE + +
Sbjct: 121 GITAETPAPTEIILKGADKELLGKVASEIREYRKPEPYKGKGVRYEDEYVAK 172



>gb:AY774332_2149045 Synthetic construct Francisella tularensis
           clone FLH157418.01X NT02FT0058 gene, complete cds.
          Length = 178

 Score =  139 bits (351), Expect = 5e-32
 Identities = 71/172 (41%), Positives = 104/172 (60%), Gaps = 1/172 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKME-GQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR 410
           SRIGK P+ +PS VTI +  G   +VKG    L  T+  +V     ++ V  +     ++
Sbjct: 2   SRIGKTPVVIPSGVTINVAAGNKVEVKGAKATLSKTFSTDVTFSVADN-VATITPNNNSK 60

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
            A    G  R +  NM+ GVSKGF++KL+++GVGYRA  +G ++ L LGFSHPV   +P 
Sbjct: 61  NAVAQSGTARAILSNMVEGVSKGFERKLKIIGVGYRAKAQGNELNLTLGFSHPVVYKLPQ 120

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           G+  +    T I + G DK  +G+ A+ IR++R PEPYKGKGV+Y DE + +
Sbjct: 121 GITAETPAPTEIILKGADKELLGKVASEIREYRKPEPYKGKGVRYEDEYVAK 172



>pir|H82713|H82713 50S ribosomal protein L6 XF1167 [imported] -
           Xylella fastidiosa (strain 9a5c)>gb:AE003951_48806
           Xylella fastidiosa 9a5c, section 97 of 229 of the
           complete genome.>gb:AE003849_1116016 Xylella fastidiosa
           9a5c, complete genome.
          Length = 175

 Score =  139 bits (351), Expect = 5e-32
 Identities = 73/171 (42%), Positives = 103/171 (60%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K+PI VP  V + +      VKG  G L  T+P+   +     G +    A +   
Sbjct: 2   SRVAKKPISVPKGVEVSVRSDMLTVKGVKGVL--TFPKSDNVNVVVDGDILTLSANDPSH 59

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
            + + G  R +  NMI GVS GF++KL+LVGVGYRA ++G+++ L+LGFSHP+    P+G
Sbjct: 60  VS-LAGTVRAILSNMIKGVSIGFERKLELVGVGYRASMQGENLNLSLGFSHPLVFVPPEG 118

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + +     T + V G DK  +G+ AA IR +RPPEPYKGKG+KYA E I R
Sbjct: 119 ITLLTPSQTEVVVQGIDKQRVGEVAAKIRSFRPPEPYKGKGLKYAAEAIMR 169



>sp|P56034|RL6_HELPY 50S ribosomal protein L6.>pir|H64682|H64682
           ribosomal protein L6 - Helicobacter pylori (strain
           26695)>gb:AE000633_25467 Helicobacter pylori 26695
           section 111 of 134 of the complete
           genome.>gb:AE000511_880906 Helicobacter pylori 26695
           complete genome.
          Length = 178

 Score =  139 bits (349), Expect = 9e-32
 Identities = 75/171 (43%), Positives = 107/171 (62%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+ I +PS+V   +EG     K    +  +     VK+  E +  L  +   E  +
Sbjct: 2   SRIGKRIIEIPSSVQASVEGSKLLFKNSKEKHELETHNRVKITLENNQ-LSFQPVGEDAQ 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           +    G +  L +N+++G+S GF K L++ GVGY+  +  K + L+LGFSHPV+  IP G
Sbjct: 61  SRAYWGTYGALANNIVIGLSTGFSKTLEVNGVGYKVALGNKTLDLSLGFSHPVKYPIPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +++ VE+NT IT+ G DK  +GQ AA IR +RPPEPYKGKGVKY+DEVI R
Sbjct: 121 IEMVVEKNT-ITIKGSDKQKVGQVAAEIRSFRPPEPYKGKGVKYSDEVIIR 170



>gb:AE017332_445463 Mycoplasma hyopneumoniae 232, complete genome.
          Length = 179

 Score =  138 bits (347), Expect = 2e-31
 Identities = 69/170 (40%), Positives = 104/170 (61%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+G + + VP  V I+++G   KV+GPLG L   + +E+ +  E   +   R + ET++
Sbjct: 2   SRVGNRILKVPEQVRIEIQGSSVKVQGPLGILERQFAKEITILLENQSLKTTRNS-ETKQ 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
             ++HG   +    MI+GVSKGF K+L++ GVGY+  ++   I L +G+SHPV + IP  
Sbjct: 61  VKQLHGTTNSHLSAMIIGVSKGFQKELKIKGVGYKVSLKENLIELLVGYSHPVEIRIPQE 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           L V V   T I + G DK  +GQFAA IR+ R P  Y GKG+ Y DE+++
Sbjct: 121 LDVLVPNPTTILIKGIDKQKVGQFAAQIRQVRKPNAYSGKGISYQDEILK 170



>pir|D97897|D97897 50S ribosomal protein L6 [imported] -
           Streptococcus pneumoniae (strain R6)>gb:AE008402_236525
           Streptococcus pneumoniae R6 section 18 of 184 of the
           complete genome.>gb:AE007317_942683 Streptococcus
           pneumoniae R6, complete genome.
          Length = 178

 Score =  138 bits (347), Expect = 2e-31
 Identities = 69/171 (40%), Positives = 106/171 (61%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG + I +P+ V +        VKGP GEL   + +++++  E + V  + +  +++ 
Sbjct: 2   SRIGNKVIVLPAGVELANNDNVVTVKGPKGELTREFSKDIEIRVEGTEVT-LHRPNDSKE 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HG  R L +NM+VGVS+GF K+L++ GVGYRA ++G  +VL +G SHP  +  P+G
Sbjct: 61  MKTIHGTTRALLNNMVVGVSEGFKKELEMRGVGYRAQLQGSKLVLAVGKSHPDEVEAPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +  ++   T I VSG  K  +GQ AA +R  R PEPYKGKG++Y  E +RR
Sbjct: 121 ITFELPNPTTIVVSGISKEVVGQTAAYVRSLRSPEPYKGKGIRYVGEFVRR 171



>pir|G97823|G97823 50S ribosomal protein L6 [imported] - Rickettsia
           conorii  (strain Malish 7)>gb:AE008651_239355 Rickettsia
           conorii str. Malish 7, section 83 of 114 of the complete
           genome.>gb:AE006914_1121473 Rickettsia conorii str.
           Malish 7, complete genome.
          Length = 177

 Score =  137 bits (346), Expect = 2e-31
 Identities = 70/171 (40%), Positives = 105/171 (61%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+GK PI +P  V I +   + K+ GP GEL  T+   + +   E+ +L V+     + 
Sbjct: 2   SRVGKLPITIPEGVKIGLNDLEVKISGPKGELSKTFKGNIAISLAENKLL-VKPLAANKN 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A  M G  R++  NM+ GV +GF  KL++ GVGYRAMV+GK + L L  SH  ++ IP  
Sbjct: 61  ARAMWGTARSIISNMVTGVKEGFKLKLEINGVGYRAMVKGKYLNLMLAKSHNTKIEIPSD 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +++++ +   I + G DK  +GQFA+ I K RPPEPYKGKG+K+ ++ I R
Sbjct: 121 IKIEMPKQNIIILEGTDKEKLGQFASIIIKQRPPEPYKGKGIKFENQCIPR 171



>gb:AY198133_596877 Spiroplasma kunkelii strain CR2-3x partial
           genome sequence.
          Length = 179

 Score =  137 bits (345), Expect = 3e-31
 Identities = 66/171 (38%), Positives = 106/171 (61%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG + + +P  V + ++  +  VK   G+L    P  + +  +E GV+   +A + + 
Sbjct: 2   SRIGNRELKIPVGVEVTIQPNNVIVKSAKGQLEQAIPSVITVAAKE-GVVTTTRANDVKH 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           + ++HG   +L   M+ GVSKGF K+L++ GVGYRA + G  + L+LG+SHP+   IP G
Sbjct: 61  SKQLHGTINSLIQGMLEGVSKGFKKELEINGVGYRAALAGNKLTLSLGYSHPIEYKIPQG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + + + + T+I V G  K  +G+ AA+IR +R PEPYKGKG+KY ++ I R
Sbjct: 121 ITITLPKPTQIIVEGISKKLVGEVAANIRNYRKPEPYKGKGIKYKNKHIIR 171



>gb:AE017197_402604 Rickettsia typhi str. Wilmington complete
           genome.
          Length = 177

 Score =  137 bits (345), Expect = 3e-31
 Identities = 69/171 (40%), Positives = 106/171 (61%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+GK PI +P  V + +   + K+ GP GEL  T+   + +  EE+ ++ V+     + 
Sbjct: 2   SRVGKLPITIPEGVKVGLNDLEVKISGPKGELSKTFKGNIAIIMEENKLV-VKPLAVNKN 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A  M G  R++  NM+ GV +GF  KL++ GVGYRAMV+GK + L L  SH  ++ IP  
Sbjct: 61  ARSMWGTARSIIYNMVTGVKEGFKLKLEINGVGYRAMVKGKYLNLMLAKSHNTKIEIPSN 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +++ + +   I + G DK  +GQFA+ I K RPPEPYKGKG+K+ ++ I+R
Sbjct: 121 IKIDLPKQNIILLEGIDKEKLGQFASIIIKQRPPEPYKGKGIKFENKFIQR 171



>gb:AE017178_398044 Porphyromonas gingivalis W83 section 7 of 8 of
           the complete genome.>gb:AE015924_1033655 Porphyromonas
           gingivalis W83 complete genome.
          Length = 183

 Score =  137 bits (345), Expect = 3e-31
 Identities = 73/175 (41%), Positives = 108/175 (61%), Gaps = 4/175 (2%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK PI +P+ VT+  + +   VKGP GEL       + +  E  G++ + +  + R 
Sbjct: 2   SRIGKLPISIPAGVTVSHKDEIVTVKGPKGELSQYVDPRITVVIE-GGMIHLERKTDDRI 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HGL+R+L +NM+ GVS GF ++L+LVGVGYRA  +G+ + L+LGF+H + M +P  
Sbjct: 61  ERSLHGLYRSLINNMVQGVSAGFKRELELVGVGYRASNQGQLLELSLGFTHSIFMQLPKE 120

Query: 594 LQVKVE----ENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + V+ +    +N  I +   DK  +GQ    IR +R PEPYKGKGVK+  E IRR
Sbjct: 121 VTVETKSERNKNPLIILESADKQLLGQVCMKIRSFRKPEPYKGKGVKFVGEQIRR 175



>sp|Q9ZCS0|RL6_RICPR 50S ribosomal protein L6.>pir|B71670|B71670
           ribosomal protein L6 - Rickettsia
           prowazekii>gb:RPXX03_167418 Rickettsia prowazekii strain
           Madrid E, complete genome; segment 3/4.
          Length = 177

 Score =  137 bits (345), Expect = 3e-31
 Identities = 70/171 (40%), Positives = 106/171 (61%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+GK PI +P  V + +   + K+ GP GEL  T+   + +  EE+ ++ V+     + 
Sbjct: 2   SRVGKLPITIPEGVKVGLNDLEVKISGPKGELSKTFKGNIAIIMEENKLV-VKPLAVNKN 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
           A  M G  R++  NMI GV +GF  KL++ GVGYRAMV+GK + L L  SH  ++ IP  
Sbjct: 61  ARAMWGTARSIICNMITGVKEGFKLKLEINGVGYRAMVKGKYLNLMLAKSHNTKIEIPSN 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +++ + +   I + G DK  +GQFA+ I K RPPEPYKGKG+K+ ++ I+R
Sbjct: 121 IKIDLPKQNIILLEGIDKEKLGQFASIIIKQRPPEPYKGKGIKFENKFIQR 171



>pir|E97592|E97592 50S ribosomal protein L6 nmb0157 [imported] -
           Agrobacterium tumefaciens (strain C58,
           Cereon)>gb:AE008112_233634 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 170 of 254 of the
           complete sequence.>gb:AE007869_1083303 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 163

 Score =  137 bits (344), Expect = 3e-31
 Identities = 72/158 (45%), Positives = 103/158 (65%)
 Frame = +3

Query: 273 VTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRTLTD 452
           +T  ++GQ    KGP GEL      +++L+ E++GV  V  A  T+ A    G+ RT+ +
Sbjct: 1   MTANVDGQKVTAKGPKGELFFVANDDIQLKLEDNGV-SVTPANGTKEARSKWGMSRTMIE 59

Query: 453 NMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITV 632
           N+  GV  G+++KL++ GVGYRA ++GK++ L LGFSH V    P G+ + V + T I V
Sbjct: 60  NIFKGVKDGYERKLEINGVGYRAALQGKNLQLALGFSHDVVYEPPVGITIAVPKPTEIIV 119

Query: 633 SGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           SG +K  +GQ AA IR++R PEPYKGKGVKYA+E I R
Sbjct: 120 SGINKQQVGQVAAEIREYRGPEPYKGKGVKYAEERIVR 157



>gb:CP000023_875765 Streptococcus thermophilus LMG 18311, complete
           genome.>gb:CP000024_877680 Streptococcus thermophilus
           CNRZ1066, complete genome.
          Length = 178

 Score =  135 bits (341), Expect = 8e-31
 Identities = 70/171 (40%), Positives = 105/171 (61%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG + I +P+ V I        VKGP GEL   + + +++ K E   + + +  +++ 
Sbjct: 2   SRIGNKVITLPAGVEITNNDNVVTVKGPKGELTREFNKNIEI-KVEGNEVTLHRPNDSKE 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HG  R   +NM+VGVS+GF K+L++ GVGYRA ++G  +VL++G SH   +  P+G
Sbjct: 61  NKTIHGTSRANLNNMVVGVSEGFKKELEMHGVGYRAQLQGTKLVLSVGKSHQDEVEAPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +  +V   T I VSG +K  +GQ AA IR  R PEPYKGKG++Y  E +RR
Sbjct: 121 ITFEVPSATSIVVSGINKEVVGQTAAYIRSLRSPEPYKGKGIRYVGEYVRR 171



>gb:AE016937_362079 Bacteroides thetaiotaomicron VPI-5482, section
           12 of 21 of the complete genome.>gb:AE015928_988567
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 189

 Score =  135 bits (340), Expect = 1e-30
 Identities = 76/181 (41%), Positives = 108/181 (59%), Gaps = 10/181 (5%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMET-- 407
           SRIGK PI +P+ VT+ ++     VKGP GEL       + +  E+  V       E   
Sbjct: 2   SRIGKLPISIPAGVTVTLKDDVVTVKGPKGELSQYVNPAINVAIEDGHVTLTENEKEMID 61

Query: 408 --RRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMA 581
             ++ +  HGL+R+L  NM+VGVS+G+ K+L+LVGVGYRA  +G  I L LG++H + + 
Sbjct: 62  NPKQKHAFHGLYRSLVHNMVVGVSEGYKKELELVGVGYRASNQGNIIELALGYTHNIFIQ 121

Query: 582 IPDGLQVKVE------ENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           +P   +VKVE      +N  I +   DK  +GQ  + IR +R PEPYKGKG+K+  EVIR
Sbjct: 122 LP--AEVKVETKSERNKNPLIILESCDKQLLGQVCSKIRSFRKPEPYKGKGIKFVGEVIR 179

Query: 744 R 746
           R
Sbjct: 180 R 180



>gb:AB002583_1508869 Cyanidioschyzon merolae chloroplast DNA,
           complete genome, strain:10D.
          Length = 174

 Score =  135 bits (339), Expect = 1e-30
 Identities = 74/170 (43%), Positives = 105/170 (61%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGKQ I     V I  +    KVKG  G+L +  P  VK+++  +        ++   
Sbjct: 2   SRIGKQVIK-HDQVQIVQQDNVLKVKGKKGDLTLCLPSHVKIQQNGN-------QLQVIA 53

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
            ++  GL+R+L D+M+ GV+ GF+KKL LVGVGYRA +   D+VL +GFSHP+ +   +G
Sbjct: 54  ESQWQGLYRSLIDSMVKGVTVGFEKKLLLVGVGYRAQLMENDLVLYVGFSHPITIKAREG 113

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           +Q ++E  T I + G DK  +G+ AASIR  R PE YKGKG++YA E IR
Sbjct: 114 IQFELENPTTIVIKGIDKQLVGRVAASIRALREPEVYKGKGIRYAYESIR 163



>pir|D95026|D95026 ribosomal protein L6 [imported] - Streptococcus
           pneumoniae  (strain TIGR4)>gb:AE007336_225466
           Streptococcus pneumoniae TIGR4 section 19 of 194 of the
           complete genome.>gb:AE005672_1103234 Streptococcus
           pneumoniae TIGR4, complete genome.
          Length = 178

 Score =  134 bits (338), Expect = 2e-30
 Identities = 67/171 (39%), Positives = 105/171 (61%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG + I +P+ V +        VKG  GEL   + +++++  E + +  + +  +++ 
Sbjct: 2   SRIGNKVIVLPAGVELANNDNVVTVKGSKGELTREFSKDIEIRVEGTEIT-LHRPNDSKE 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HG  R L +NM+VGVS+GF K+L++ GVGYRA ++G  +VL +G SHP  +  P+G
Sbjct: 61  MKTIHGTTRALLNNMVVGVSEGFKKELEMRGVGYRAQLQGSKLVLAVGKSHPDEVEAPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +  ++   T I VSG  K  +GQ AA +R  R PEPYKGKG++Y  E +RR
Sbjct: 121 ITFELPNPTTIVVSGISKEVVGQTAAYVRSLRSPEPYKGKGIRYVGEFVRR 171



>sp|Q9ZJS6|RL6_HELPJ 50S ribosomal protein L6.>pir|H71833|H71833
           ribosomal protein L6 - Helicobacter pylori (strain
           J99)>gb:AE001547_36215 Helicobacter pylori, strain J99
           section 108 of 132 of the complete
           genome.>gb:AE001439_884985 Helicobacter pylori, strain
           J99 complete genome.
          Length = 178

 Score =  134 bits (338), Expect = 2e-30
 Identities = 74/171 (43%), Positives = 106/171 (61%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK+ I +PS+V   +EG     K    +  +     VK+  E +  L  +   E  +
Sbjct: 2   SRIGKRIIEIPSSVQASVEGSKLLFKNNKEKHELETHNRVKITLENNQ-LSFQPVGEDAQ 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
                G +  L +N+++G+S GF K L++ GVGY+  +  K + L+LGFSHPV+  IP G
Sbjct: 61  FRAYWGTYGALANNIVIGLSAGFSKTLEVNGVGYKVALGHKTLDLSLGFSHPVKYPIPAG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +++ VE+NT IT+ G DK  +GQ AA IR +RPPEPYKGKGVKY++EVI R
Sbjct: 121 IEMVVEKNT-ITIKGSDKQQVGQVAAEIRSFRPPEPYKGKGVKYSNEVIIR 170



>gb:BX321857_772744 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 2/10.
          Length = 180

 Score =  134 bits (337), Expect = 2e-30
 Identities = 65/164 (39%), Positives = 95/164 (57%)
 Frame = +3

Query: 249 QPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMH 428
           +PI +P +V +++      +KGPLG L              S  L +     T++   + 
Sbjct: 9   KPIEIPKSVEVQLTEFGVFIKGPLGSLFQAIDAHNAKIVVSSDQLTIEALNATKQTKSIV 68

Query: 429 GLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKV 608
           G  + L  NMI GV+ GF+KKL ++GVGY+A   G  + LNLGFSHPV   +P+G++V+ 
Sbjct: 69  GTLKALISNMIKGVTAGFEKKLLIIGVGYKAQAAGNILNLNLGFSHPVAYTVPEGIKVET 128

Query: 609 EENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI 740
              T I + G DK  +GQ AA +R +R PEPYKGKG++Y DE +
Sbjct: 129 PSTTEILIKGIDKQKVGQVAAEVRSYRRPEPYKGKGIRYFDEKV 172



>gb:AE017308_437872 Mycoplasma mobile 163K complete genome.
          Length = 179

 Score =  134 bits (337), Expect = 2e-30
 Identities = 66/171 (38%), Positives = 107/171 (62%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+G++ + +P +V + ++    ++KG LG L       + +E E   V  +R A E + 
Sbjct: 2   SRVGRRVLTLPKDVELNIKNNLVEIKGKLGVLTFNVNPLIAIEVENHEVKTIR-ANEEKH 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
             ++HG   ++ +NMI+GVSKGF K+L++ GVGY++ ++G  I +  G+SH V + +P  
Sbjct: 61  TKQLHGTTNSIIENMIIGVSKGFKKELEIKGVGYKSALKGSQIEIAAGYSHLVYVNVPKE 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           L+V++ + T+I +SG D   +G+ AA IRK R P PY GKG+ Y  EVIRR
Sbjct: 121 LKVEIPKPTQIIISGIDNQKVGELAAVIRKVRTPNPYSGKGIMYKGEVIRR 171



>pir|G82916|G82916 ribosomal protein L6 UU246 [imported] -
           Ureaplasma urealyticum>gb:AE002122_43118 Ureaplasma
           parvum serovar 3 str. ATCC 700970 section 23 of 59 of
           the complete genome.>gb:AF222894_1114489 Ureaplasma
           parvum serovar 3 str. ATCC 700970, complete genome.
          Length = 182

 Score =  133 bits (335), Expect = 4e-30
 Identities = 66/171 (38%), Positives = 102/171 (59%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG + + +P+NV + +E     +     +L + +P  +         ++V +A + ++
Sbjct: 2   SRIGNRKLTIPANVNVSVESGKVHIVSQTAKLSVDFPVNLISVDVVDNTVKVSRANDEKQ 61

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
               HG       N +VGV+ G+ K+L++ GVG+RA VEG  + L LGFSHP+ + IP G
Sbjct: 62  TKMFHGTVNANIANALVGVTTGWKKELEVKGVGFRAKVEGSKLNLGLGFSHPLLIQIPTG 121

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           L+V+    T I+++G DK+A+G FAA +R +R PEPYKGKGV Y  E I R
Sbjct: 122 LKVETPSATEISINGADKAAVGAFAAVVRAYRKPEPYKGKGVMYKGERIVR 172



>gb:AP006841_574686 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 189

 Score =  132 bits (331), Expect = 1e-29
 Identities = 73/179 (40%), Positives = 108/179 (60%), Gaps = 8/179 (4%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELG--ITYPREVKLEKEESGVLRVRKAM-- 401
           SRIGK PI +P+ VT+ ++     VKGP GEL   +     V +E     +     AM  
Sbjct: 2   SRIGKLPISIPAGVTVTLKDDVVTVKGPKGELSQYVNPAINVAIEDGHITLTENENAMLD 61

Query: 402 ETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMA 581
             ++ +  HGL+R+L  NM+VGVS+G+ K+L+LVGVGYRA  +G  I L LG++H + + 
Sbjct: 62  NPKQKHAFHGLYRSLVHNMVVGVSEGYKKELELVGVGYRASNQGNIIELALGYTHNIFIQ 121

Query: 582 IPDGLQVKVE----ENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +P  ++V+ +    +N  I +   DK  +GQ  + IR +R PEPYKGKG+K+  E IRR
Sbjct: 122 LPPEVKVETKSERNKNPLILLESCDKQLLGQVCSKIRSFRKPEPYKGKGIKFVGEEIRR 180



>gb:AE006478_219322 Streptococcus pyogenes M1 GAS, section 7 of 167
           of the complete genome.>gb:AE009959_257777 Streptococcus
           pyogenes strain MGAS8232, section 7 of 173 of the
           complete genome.>gb:AE014137_303532 Streptococcus
           pyogenes MGAS315, section 2 of 37 of the complete
           genome.>gb:BA000034_712981 Streptococcus pyogenes SSI-1
           DNA, complete genome.>gb:CP000003_860033 Streptococcus
           pyogenes MGAS10394, complete genome.>gb:AE009949_904159
           Streptococcus pyogenes strain MGAS8232, complete
           genome.>gb:AE014074_926711 Streptococcus pyogenes
           MGAS315, complete genome.>gb:AE004092_1105168
           Streptococcus pyogenes M1 GAS, complete genome.
          Length = 178

 Score =  132 bits (331), Expect = 1e-29
 Identities = 68/170 (40%), Positives = 103/170 (60%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG + I +P+ V +        VKGP GEL   + + ++++ E + +  VR   +++ 
Sbjct: 2   SRIGNKVITMPAGVELTNNNNVITVKGPKGELTREFNKNIEIKVEGTEITVVRPN-DSKE 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HG  R   +NM+VGVS+GF K L++ GVGYRA ++G  +VL++G SH   +  P+G
Sbjct: 61  MKTIHGTTRANLNNMVVGVSEGFKKDLEMKGVGYRAQLQGTKLVLSVGKSHQDEVEAPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           +   V   T I+V G +K  +GQ AA IR  R PEPYKGKG++Y  E +R
Sbjct: 121 ITFTVANPTSISVEGINKEVVGQTAAYIRSLRSPEPYKGKGIRYVGEYVR 170



>pir|B84989|B84989 50S ribosomal protein L6 [imported] - Buchnera
           sp. (strain APS)>gb:BA000003_653856 Buchnera aphidicola
           str. APS (Acyrthosiphon pisum) genomic DNA, complete
           sequence.
          Length = 190

 Score =  130 bits (328), Expect = 2e-29
 Identities = 67/171 (39%), Positives = 104/171 (60%), Gaps = 1/171 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K PI +PS V ++++ QD  +KG  G L  T  + VK+E   + ++     +    
Sbjct: 14  SRVAKCPIVIPSGVNVQLDLQDISIKGKYGHLSRTIHQSVKIEFLNNQII-FSPRLGFSN 72

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIV-LNLGFSHPVRMAIPD 590
                G  R L ++MI+GVS+ F KKLQL GVGYR  +   +I+ ++LG+SH +   +P 
Sbjct: 73  GWAQAGTSRALVNSMIIGVSEKFSKKLQLSGVGYRVSITKDNIINMSLGYSHIITYHLPK 132

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           G+  +    T I + G DK  +GQ AA++R +R PEPYKGKG++Y++EV+R
Sbjct: 133 GINAENLSPTEIIIQGIDKQLVGQIAANLRSYRTPEPYKGKGIRYSNEVVR 183



>sp|P57576|RL6_BUCAI 50S ribosomal protein L6.
          Length = 178

 Score =  130 bits (328), Expect = 2e-29
 Identities = 67/171 (39%), Positives = 104/171 (60%), Gaps = 1/171 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K PI +PS V ++++ QD  +KG  G L  T  + VK+E   + ++     +    
Sbjct: 2   SRVAKCPIVIPSGVNVQLDLQDISIKGKYGHLSRTIHQSVKIEFLNNQII-FSPRLGFSN 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIV-LNLGFSHPVRMAIPD 590
                G  R L ++MI+GVS+ F KKLQL GVGYR  +   +I+ ++LG+SH +   +P 
Sbjct: 61  GWAQAGTSRALVNSMIIGVSEKFSKKLQLSGVGYRVSITKDNIINMSLGYSHIITYHLPK 120

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           G+  +    T I + G DK  +GQ AA++R +R PEPYKGKG++Y++EV+R
Sbjct: 121 GINAENLSPTEIIIQGIDKQLVGQIAANLRSYRTPEPYKGKGIRYSNEVVR 171



>gb:SAG766843_169601 Streptococcus agalactiae NEM316 complete
           genome, segment 1.
          Length = 178

 Score =  130 bits (327), Expect = 3e-29
 Identities = 69/171 (40%), Positives = 104/171 (60%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG + I +P+ V I  +     VKGP GEL   + + + +  E + V  V +  +++ 
Sbjct: 2   SRIGNKVITLPAGVEIINKDNVVTVKGPKGELTREFNKNIGITVEGTEVT-VTRPNDSKE 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HG  R   +NM+VGVS+GF K L++ GVGYRA ++G  +VL++G SH   +  P+G
Sbjct: 61  MKTIHGTTRANLNNMVVGVSEGFKKALEMRGVGYRAQLQGSKLVLSVGKSHQDEVEAPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +  +V   T I V G +K ++GQ AA +R  R PEPYKGKG++Y  E +RR
Sbjct: 121 VTFEVPTPTTINVIGINKESVGQTAAYVRSLRSPEPYKGKGIRYVGEFVRR 171



>gb:AE014194_305415 Streptococcus agalactiae 2603V/R section 4 of
           100 of the complete genome.>gb:AE009948_935528
           Streptococcus agalactiae 2603V/R complete genome.
          Length = 178

 Score =  129 bits (324), Expect = 7e-29
 Identities = 68/171 (39%), Positives = 104/171 (60%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG + I +P+ V I  +     VKGP G+L   + + + +  E + V  V +  +++ 
Sbjct: 2   SRIGNKVITLPAGVEIINKDNVVTVKGPKGQLTREFNKNIGITVEGTEVT-VTRPNDSKE 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HG  R   +NM+VGVS+GF K L++ GVGYRA ++G  +VL++G SH   +  P+G
Sbjct: 61  MKTIHGTTRANLNNMVVGVSEGFKKALEMRGVGYRAQLQGSKLVLSVGKSHQDEVEAPEG 120

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +  +V   T I V G +K ++GQ AA +R  R PEPYKGKG++Y  E +RR
Sbjct: 121 VTFEVPTPTTINVIGINKESVGQTAAYVRSLRSPEPYKGKGIRYVGEFVRR 171



>gb:AY191298_596055 Aster yellows phytoplasma clone A448 genomic
           sequence.
          Length = 175

 Score =  129 bits (323), Expect = 9e-29
 Identities = 66/167 (39%), Positives = 104/167 (62%), Gaps = 5/167 (2%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG  P+ +P+NV +K +     +KGPLG+L      ++ +    + ++ V++    ++
Sbjct: 10  SRIGNIPVLIPNNVFVKKQDNIIYIKGPLGKLNQEIIGDINIIINHNNII-VKRKHNDKK 68

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKD---IVLNLGFSHPVRMAI 584
              +HGL+R L  NMI GVS GF KKL+L+GVG+RA +   +   + LN+G+SH + + +
Sbjct: 69  NRALHGLYRMLIYNMIKGVSNGFKKKLELIGVGFRANINNNNNQILNLNIGYSHNIMIKL 128

Query: 585 PDG--LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGV 719
           P    L+VK+++N +I +  YDK  +G  AA IR  R PEPYKGKG+
Sbjct: 129 PQSITLEVKMDKNPQIILKSYDKQLLGIVAAKIRSLRKPEPYKGKGI 175



>gb:CR628336_110521 Legionella pneumophila str. Paris complete
           genome.>gb:CR628337_113579 Legionella pneumophila str.
           Lens complete genome.>gb:AE017354_458727 Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1,
           complete genome.
          Length = 179

 Score =  127 bits (318), Expect = 4e-28
 Identities = 72/172 (41%), Positives = 96/172 (55%), Gaps = 1/172 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLE-KEESGVLRVRKAMETR 410
           SR+ K P+   +NV +        VKGP G L     + V ++  +ES  L    A    
Sbjct: 2   SRVAKAPVIHSANVEVTFVDGVITVKGPKGILTQKINKLVNIQHSKESNKLEFSPASNDP 61

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
                 G  R L  NM+ GV++G+   L+LVGVGYRA  + K I L+LG+SH +   +P 
Sbjct: 62  MGWAQAGTARALVRNMVQGVTEGYTVTLELVGVGYRAQSKDKSISLSLGYSHSIEYDLPK 121

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           G+ V+   NT I + G DK  +GQ A+ IR +RPPEPYKGKGVKYA E I R
Sbjct: 122 GVTVETPNNTTILLKGVDKQVLGQIASEIRAFRPPEPYKGKGVKYAGEQIVR 173



>sp|O21255|RM06_RECAM Mitochondrial 60S ribosomal protein
           L6.>pir|S78149|S78149 ribosomal protein L6 -
           Reclinomonas americana (ATCC 50394)
           mitochondrion>gb:AF007261_1231396 Reclinomonas americana
           mitochondrial DNA, complete genome.
          Length = 185

 Score =  127 bits (318), Expect = 4e-28
 Identities = 69/177 (38%), Positives = 101/177 (57%), Gaps = 7/177 (3%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPR-EVKLEKEESGVLRVRKAMETR 410
           S IG + I +P NV+I +      V+G LG+L +      + L+  E+    +   + T 
Sbjct: 2   SHIGSKQIKIPKNVSIDLSMNKIYVRGDLGKLELPLNNINIHLKNIENDQFLILDPINTG 61

Query: 411 RANE------MHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPV 572
              +      M G +RTL +NM++GVSKG+ K ++LVGVGY+A +  K +VL +GFS  +
Sbjct: 62  TKKQKTASYIMWGTYRTLIENMLIGVSKGYSKTIELVGVGYKAQLIDKKLVLKIGFSIEI 121

Query: 573 RMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
              IP  ++V    +  I +SG DK  + Q AA IR  R PEPYKGKG++Y  EVIR
Sbjct: 122 NYEIPSDIKVDCSRSNIIVISGIDKQKVNQVAAEIRLLRKPEPYKGKGIRYLGEVIR 178



>gb:AE014124_303393 Buchnera aphidicola str. Sg (Schizaphis
           graminum) section 49 of 57 of the complete
           genome.>gb:AE013218_935371 Buchnera aphidicola str. Sg
           (Schizaphis graminum) complete genome.
          Length = 191

 Score =  125 bits (314), Expect = 1e-27
 Identities = 66/173 (38%), Positives = 103/173 (59%), Gaps = 2/173 (1%)
 Frame = +3

Query: 228 KESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGV-LRVRKAME 404
           K SR+ K+PI +P  + I++  Q   +KG  G L       VK+E   + +   +R    
Sbjct: 13  KMSRVAKRPILIPEGIKIELNLQSISIKGKYGYLSRIIHDAVKVECLNNKITFSIRSGFS 72

Query: 405 TRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYR-AMVEGKDIVLNLGFSHPVRMA 581
              A    G  R L ++MI+GVSK F KKLQ  GVGYR ++ +G  + ++LG+SHP+  +
Sbjct: 73  DAWAQA--GTSRALVNSMIIGVSKKFSKKLQFSGVGYRVSLTKGNIVNMSLGYSHPIVYS 130

Query: 582 IPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI 740
           +P  ++ +    T I + G DK  +GQ AA++R +R PEPYKGKG++Y++EV+
Sbjct: 131 LPPYIEAENPSPTEIVIKGVDKQLVGQIAANLRSYRRPEPYKGKGIRYSNEVV 183



>sp|Q8K964|RL6_BUCAP 50S ribosomal protein L6.
          Length = 178

 Score =  124 bits (311), Expect = 2e-27
 Identities = 65/171 (38%), Positives = 102/171 (59%), Gaps = 2/171 (1%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGV-LRVRKAMETR 410
           SR+ K+PI +P  + I++  Q   +KG  G L       VK+E   + +   +R      
Sbjct: 2   SRVAKRPILIPEGIKIELNLQSISIKGKYGYLSRIIHDAVKVECLNNKITFSIRSGFSDA 61

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYR-AMVEGKDIVLNLGFSHPVRMAIP 587
            A    G  R L ++MI+GVSK F KKLQ  GVGYR ++ +G  + ++LG+SHP+  ++P
Sbjct: 62  WAQA--GTSRALVNSMIIGVSKKFSKKLQFSGVGYRVSLTKGNIVNMSLGYSHPIVYSLP 119

Query: 588 DGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI 740
             ++ +    T I + G DK  +GQ AA++R +R PEPYKGKG++Y++EV+
Sbjct: 120 PYIEAENPSPTEIVIKGVDKQLVGQIAANLRSYRRPEPYKGKGIRYSNEVV 170



>gb:AY744382_644921 Buchnera aphidicola (Cinara cedri) genomic
           sequence.
          Length = 179

 Score =  123 bits (309), Expect = 4e-27
 Identities = 66/171 (38%), Positives = 99/171 (57%), Gaps = 1/171 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR+ K PI +P NV I ++     V G LG L     + +K+ K+ S +        +  
Sbjct: 2   SRVAKSPIKIPQNVNISLQDLKVIVHGKLGILKKNIHKCIKIIKKNSYLFFSHNHSSSSY 61

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIV-LNLGFSHPVRMAIPD 590
                G  R L + MI+GV+ GF K+L L G+GYR ++E  +I+ L LGFSH +   +P+
Sbjct: 62  GWMQAGTCRALVNTMIIGVTTGFKKQLILFGIGYRVILENNNILKLYLGFSHSISYQLPN 121

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
            +   +   T I +SG +K  +GQ AA+IR +R PEPYKGKG++Y +E+IR
Sbjct: 122 LITANLLSQTEIVLSGINKQLVGQVAANIRSYRKPEPYKGKGIRYLNEIIR 172



>gb:BA000021_687304 Wigglesworthia glossinidia endosymbiont of
           Glossina brevipalpis DNA, complete genome.
          Length = 178

 Score =  122 bits (306), Expect = 9e-27
 Identities = 58/170 (34%), Positives = 104/170 (61%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRI + PI +P +V +K+  ++  + G  GE+     + + ++   + ++         +
Sbjct: 2   SRIARLPIFIPKSVKVKILKKNIIIIGQYGEINQLINKNINIKVNNNNIIISPFKENCNK 61

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              + G  R++ +NMI+GV+K F KKL + GVGYRA +  K ++++LGFSH +++ IP+ 
Sbjct: 62  LWAIAGTMRSIINNMIIGVTKKFTKKLIITGVGYRANISQKVLIMSLGFSHQIKIKIPEA 121

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           +  +   +  I +S  DK  IGQFAA+IR ++  +PYKGKG++Y+ E+I+
Sbjct: 122 IFAECTNSNEIILSSVDKQKIGQFAANIRNYKISDPYKGKGIRYSYEIIK 171



>sp|Q89A80|RL6_BUCBP 50S ribosomal protein L6.>gb:AE014017_302842
           Buchnera aphidicola str. Bp (Baizongia pistaciae),
           section 2 of 2 of the complete
           genome.>gb:AE016826_981443 Buchnera aphidicola str. Bp
           (Baizongia pistaciae), complete genome.
          Length = 179

 Score =  121 bits (304), Expect = 1e-26
 Identities = 67/171 (39%), Positives = 105/171 (61%), Gaps = 1/171 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRI KQPI +PS+V+I + GQ   VKG  GEL       V ++  +S ++   +   + +
Sbjct: 2   SRIAKQPIVIPSDVSITLIGQMVIVKGSKGELKRLIHDSVLVKSVKSCLVFSSRINSSVK 61

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEG-KDIVLNLGFSHPVRMAIPD 590
                G  R+L ++MI GV+ GF KKL+L GVGYR  +   K++ ++LG+SH +   +P 
Sbjct: 62  GWAQAGTARSLVNSMIHGVTVGFFKKLKLFGVGYRISINSSKNLNMSLGYSHIIEYVLPF 121

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           G+ V+      I V G +K  +GQ AA++R +R  EPYKGKG++Y++E++R
Sbjct: 122 GIFVESISQAEIIVKGINKQLVGQVAANLRAYRKSEPYKGKGIRYSNEIVR 172



>gb:CR382132_1665362 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 203

 Score =  121 bits (303), Expect = 2e-26
 Identities = 77/183 (42%), Positives = 99/183 (54%), Gaps = 12/183 (6%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEES-----GVLRVRKA 398
           S IGKQPI VP +VT+++   +  V+GPLG + ++ P  V +   +       VL V   
Sbjct: 15  SYIGKQPILVPESVTLQISPTEVVVEGPLGRVQMSKPTFVNIASSQDTMSSGSVLSVSVN 74

Query: 399 METRRANE-MHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVE-----GKDIV-LNLG 557
             T +    M G  R L +N + GV+ G    L LVG GYRA VE     G  IV +  G
Sbjct: 75  DATNKTQRAMWGTMRGLINNHVTGVTDGHVALLTLVGTGYRAGVEKDAHTGAPIVSVRCG 134

Query: 558 FSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEV 737
           FSHP+   IP G++V     TRI + G DK  +  F ASIR  RPPEPYKGKG+   DE 
Sbjct: 135 FSHPINFVIPAGIEVTTPIPTRILIKGADKQQVKLFGASIRLKRPPEPYKGKGIYLDDET 194

Query: 738 IRR 746
           I R
Sbjct: 195 ITR 197



>gb:AF295546_1259614 Malawimonas jakobiformis mitochondrial DNA,
           complete genome.
          Length = 172

 Score =  119 bits (299), Expect = 6e-26
 Identities = 66/169 (39%), Positives = 108/169 (63%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           S IGK PI +P+NV I++  +   V G LG L    P  ++L K  +     R  ++T+ 
Sbjct: 2   SNIGKNPIMIPNNVKIEIINKYLIVIGNLGVLIKKMPDTIELLKSNN-----RLFIKTKN 56

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
            + + G +R L +NM++GVSKGF  KL+LVGVGYR  +E K I L +G+++ ++++IP+ 
Sbjct: 57  FS-LWGTYRMLINNMVIGVSKGFIIKLRLVGVGYRFFIENKHIKLKIGYTNMIKISIPNY 115

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI 740
           ++VK  +NT + + G D   I ++A  IR ++ P+PYKGKG+ + +E+I
Sbjct: 116 IKVKSIKNTILYLYGLDLQKIKEYAYKIRLFKQPDPYKGKGILFENEII 164



>sp|O67565|RL6_AQUAE 50S ribosomal protein L6.>pir|D70442|D70442
           ribosomal protein L06 - Aquifex
           aeolicus>gb:AE000749_26919 Aquifex aeolicus VF5 section
           81 of 109 of the complete genome.>gb:AE000657_977450
           Aquifex aeolicus VF5 complete genome.
          Length = 183

 Score =  119 bits (299), Expect = 6e-26
 Identities = 63/173 (36%), Positives = 105/173 (60%), Gaps = 3/173 (1%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFK--VKGPLGELGITYPREVKLE-KEESGVLRVRKAME 404
           SR+ K+PIP P NV +    ++ K  V+GP G+L +    ++K+   ++   +++ +  +
Sbjct: 2   SRLAKKPIPYPENVKVNYVEKEHKIVVEGPKGKLELNVHPDIKVTVNQQERWIKLDRPTD 61

Query: 405 TRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAI 584
                 +HG    L  NMI GV++GF + L++ G+GYRA ++G  + L+LG SHP    I
Sbjct: 62  RSFHKAIHGTMAALVKNMIKGVTEGFTEVLEIHGLGYRAQLKGNVLELHLGKSHPDIYPI 121

Query: 585 PDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           P  ++++V+ N  I + G DK  +GQ AA IR +R P+PYKGKG++Y  E ++
Sbjct: 122 PPDVKIEVKGN-EIHIHGIDKQRVGQVAAEIRSFRKPDPYKGKGIRYKGEQLK 173



>gb:AE017347_1757957 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 237

 Score =  119 bits (297), Expect = 1e-25
 Identities = 75/214 (35%), Positives = 109/214 (50%), Gaps = 42/214 (19%)
 Frame = +3

Query: 228 KESRIGKQPIPVPSNVTIKMEGQD---------------FKVKGPLGELGITYPREVKLE 362
           + S++GK PIP+P +V + +                   F V GPLG   +     V L 
Sbjct: 19  RRSQVGKVPIPIPPSVVLALPASSVPPHVHPGSPEAHRVFTVSGPLGSTTLPISPSVILT 78

Query: 363 KEESGVLRVR-----KAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMV 527
                   +       A++T+R+  + GL RTL  N + GVS GF+ +++LVGVGYRA +
Sbjct: 79  PPTPSASTLTISVHDPAVKTQRS--VWGLTRTLISNAVTGVSAGFNLEVKLVGVGYRAAI 136

Query: 528 EG----------------------KDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGY 641
           E                       + + + LGF+HPV + IP  ++V V E T+I +SG 
Sbjct: 137 EPIPQVFIDLAKQTSSLPTDALPRERLNIKLGFAHPVLIDIPPQIKVTVPEPTKIMLSGT 196

Query: 642 DKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           DK  +GQFAA+IR+WR PEPY+GKG+    E IR
Sbjct: 197 DKQKLGQFAATIRQWRKPEPYRGKGIFVGGETIR 230



>gb:AY268081_604346 Candidatus Portiera aleyrodidarum, partial
           genomic sequence.
          Length = 176

 Score =  116 bits (290), Expect = 6e-25
 Identities = 64/169 (37%), Positives = 98/169 (57%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           S+I K PI VP+NV I ++ +   V G  G L ++ P  V + K++  ++   K  +   
Sbjct: 2   SKIAKCPIKVPNNVEILLDKEVVIVIGNNGRLFLSKPSSVVIVKDQQKLIFNSKKKDW-- 59

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              + G  R L +NMI+GV KGF +KL++ GVGYRA + G+ I L LG++H +   +P  
Sbjct: 60  --VITGTIRALVNNMIIGVYKGFTRKLEINGVGYRAKIFGRIINLMLGYTHRIEYKLPKN 117

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI 740
           +  +    T I + G DK  +G  AA IR  RP EPYKG+G++Y +E +
Sbjct: 118 IFAETHSKTLIILKGADKQKLGIVAAEIRAVRPIEPYKGRGIRYTEEKV 166



>gb:TASPCOP_197332 T.aquaticus spc operon for ribosomal proteins
           S17, L14, L24, L5, S14, S8 & L6.
          Length = 131

 Score =  115 bits (288), Expect = 1e-24
 Identities = 61/131 (46%), Positives = 86/131 (65%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG+ PIPVP  V +++     KVKGP GEL +    E+K+  EE+ V+RV +  + RR
Sbjct: 2   SRIGRLPIPVPKGVQVQVSPGLVKVKGPKGELSVPVSPELKVVVEEN-VVRVERPSDERR 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HGL RTL  N + GVS+G+ K+L + G+GYRA + G+ I L +GFSHPV +  P+G
Sbjct: 61  HRSLHGLTRTLIANAVKGVSEGYVKELLIKGIGYRARLVGRSIELTVGFSHPVVVEPPEG 120

Query: 594 LQVKVEENTRI 626
           +  +V E TRI
Sbjct: 121 ITFEVPEPTRI 131



>pir|S15442|S15442 ribosomal protein L6 - Thermus aquaticus
           (fragment)
          Length = 131

 Score =  115 bits (288), Expect = 1e-24
 Identities = 61/131 (46%), Positives = 86/131 (65%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIG+ PIPVP  V +++     KVKGP GEL +    E+K+  EE+ V+RV +  + RR
Sbjct: 2   SRIGRLPIPVPKGVQVQVSPGLVKVKGPKGELSVPVSPELKVVVEEN-VVRVERPSDERR 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG 593
              +HGL RTL  N + GVS+G+ K+L + G+GYRA + G+ I L +GFSHPV +  P+G
Sbjct: 61  HRSLHGLTRTLIANAVKGVSEGYVKELLIKGIGYRARLVGRSIELTVGFSHPVVVEPPEG 120

Query: 594 LQVKVEENTRI 626
           +  +V E TRI
Sbjct: 121 ITFEVPEPTRI 131



>sp|Q09865|RM06_SCHPO Putative 60S ribosomal protein L6,
           mitochondrial precursor.>pir|S62539|S62539 probable
           ribosomal protein L6 precursor, mitochondrial - fission
           yeast (Schizosaccharomyces pombe)>gb:SPAC12G12_1716409
           S.pombe chromosome I cosmid c12G12.
          Length = 213

 Score =  110 bits (274), Expect = 4e-23
 Identities = 61/186 (32%), Positives = 101/186 (54%), Gaps = 5/186 (2%)
 Frame = +3

Query: 189 IARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKE 368
           IAR      T     S +GK+ I VP N+   +EG+  ++ GP G L + +P  + L K 
Sbjct: 17  IARLGMNFTTCSAARSYVGKKEIIVPKNIQFDLEGEQLQITGPHGTLNMRFPNYLNLSKT 76

Query: 369 ESGVLRVR-----KAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEG 533
              +L+V      +   T++   M G  R +  N + GV+  +   ++LVG+GYR  +  
Sbjct: 77  ND-ILKVGMDANIEKQATKKQRAMWGTTRAILANNVKGVTMYWQSIIKLVGIGYRTSLND 135

Query: 534 KDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGK 713
            +I L +G+++ + ++IP  +QV+    T + + G D+  + QFAA IR ++ PEPYKGK
Sbjct: 136 GNIHLKIGYANDILVSIPTDVQVENPTPTSLVLRGIDRQKVTQFAAKIRSFKKPEPYKGK 195

Query: 714 GVKYAD 731
           G+ Y D
Sbjct: 196 GI-YVD 200



>sp|Q9ZI38|RL6_AQUPY 50S ribosomal protein L6.>gb:AF040101_472195
           Aquifex pyrophilus ribosomal proteins L14 (rpl14), L24
           (rpl24), L5 (rpl5), S14 (rps14), S8 (rps8), L6 (rpl6),
           and L18 (rpl18) genes, complete cds; and ribosomal
           protein S6 (rps6) gene, partial cds.
          Length = 162

 Score =  108 bits (270), Expect = 1e-22
 Identities = 59/162 (36%), Positives = 98/162 (60%), Gaps = 3/162 (1%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKV--KGPLGELGITYPREVKLE-KEESGVLRVRKAME 404
           SR+ K+PIP P NV +  + ++ KV  +GP G+L +    ++K+   ++   +++ +  +
Sbjct: 2   SRLVKKPIPYPENVKVSYDEKEHKVTVEGPKGKLELNIHPDIKVTLNQQERWIKLDRPSD 61

Query: 405 TRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAI 584
                 +HG    L  NMI GV++GF + L++ G+GYRA ++G  + L+LG SHP    I
Sbjct: 62  RSFHKAIHGTMAALIKNMIKGVTEGFTEILEIHGLGYRAQLKGNVLELHLGKSHPDIYPI 121

Query: 585 PDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKG 710
           P  ++++V+ N  I + G DK  +GQ AA IR +R P+PYKG
Sbjct: 122 PPDVKIEVKGN-EIHIHGIDKQRVGQVAAEIRSFRKPDPYKG 162



>gb:BX248584_763823 Blochmannia floridanus complete genome; segment
           1/3.
          Length = 181

 Score =  106 bits (265), Expect = 5e-22
 Identities = 56/165 (33%), Positives = 92/165 (55%)
 Frame = +3

Query: 246 KQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEM 425
           K  I +P+ + I ++     V G LG L   +   + ++      L V           +
Sbjct: 8   KSIICIPNEIQITIQDCCILVVGVLGNLSYKFHNFIGVQFSNVKNLIVYSRYRNHVNRAL 67

Query: 426 HGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVK 605
            G   +L ++MIVGV++GF KKLQL+G+GYR  ++   + L +GFSH +R  +P  ++ +
Sbjct: 68  LGTTCSLINSMIVGVTEGFVKKLQLIGIGYRVSIQESVLNLEVGFSHDIRYTLPIEVKAQ 127

Query: 606 VEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI 740
               T I ++  +K  IGQ AA +R  +PPEP+KGKG++Y DE++
Sbjct: 128 CVNQTEIVLTSINKQLIGQVAADLRAIKPPEPFKGKGIRYFDELV 172



>sp|P32904|RM06_YEAST 60S ribosomal protein L6, mitochondrial
           precursor (YmL16) (MRP-L6).>pir|S46764|S46764 ribosomal
           protein L6 precursor, mitochondrial - yeast
           (Saccharomyces cerevisiae)>gb:YSCH9666_1729224
           Saccharomyces cerevisiae chromosome VIII cosmid 9666.
          Length = 214

 Score =  105 bits (261), Expect = 1e-21
 Identities = 60/154 (38%), Positives = 90/154 (58%), Gaps = 4/154 (2%)
 Frame = +3

Query: 294 QDFKVKGPLGELGITYPREVKLEKEES-GVLRVR-KAMETRRANEMHGLFRTLTDNMIVG 467
           Q+  VKGP GEL +  P  + L+K+E  G + V  +  E +    M G  R+L +N I+G
Sbjct: 54  QNITVKGPKGELSVEVPDFLHLDKDEKHGKINVTVQNSEDKHQRSMWGTVRSLINNHIIG 113

Query: 468 VSKGFDKKLQLVGVGYRAMVE--GKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGY 641
           V++G    L+ VG GYRA +E  GK + + +G S    + +P+G+ VK    T + + G 
Sbjct: 114 VTEGHLAVLRFVGTGYRAQLENDGKFVNVKVGASIKQGLDVPEGIVVKTPAPTSLIIEGC 173

Query: 642 DKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           +K  +  FAA +RK+ PPEPYKGKG+   DE I+
Sbjct: 174 NKQQVLLFAAKLRKFHPPEPYKGKGIYVNDETIK 207



>gb:CR522870_99985 Desulfotalea psychrophila LSv54 chromosome.
          Length = 106

 Score =  103 bits (257), Expect = 4e-21
 Identities = 50/98 (51%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +3

Query: 456 MIVGVSKGFDKKLQLVGVGYRAMVEG-KDIVLNLGFSHPVRMAIPDGLQVKVEENTRITV 632
           M++GV +GF K L + GVGY+A +EG K +V+N+G+S+PV   +P+ +Q  VE NT+ITV
Sbjct: 1   MVIGVDEGFKKVLLIEGVGYKANLEGSKKLVINVGYSNPVEYKLPENVQAVVEGNTKITV 60

Query: 633 SGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
              DK  +G  AA IR+ R PEPYKGKG++Y +E I R
Sbjct: 61  ESIDKELLGLVAAQIRQIRKPEPYKGKGIRYENEQIVR 98



>gb:CP000030_83740 Anaplasma marginale str. St. Maries, complete
           genome.
          Length = 181

 Score =  101 bits (251), Expect = 2e-20
 Identities = 60/173 (34%), Positives = 93/173 (53%), Gaps = 2/173 (1%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKM-EGQDFKVKGPLG-ELGITYPREVKLEKEESGVLRVRKAMET 407
           SR+G  PI VP  V + + +G    V G  G     +    ++   + S +L V +   +
Sbjct: 2   SRVGAMPIEVPEGVKVDVCDGNSVTVIGKDGTSSSFSLCHGIRAVLDGSTLLLVNERQSS 61

Query: 408 RRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIP 587
            RA  M G +R+   N I G+SKGF  +L++ GVGYR +   K + + +GFSH VR  IP
Sbjct: 62  PRAKVMWGSYRSGISNAIKGLSKGFSVELEVNGVGYRVVCGNKYLSMFVGFSHGVRYVIP 121

Query: 588 DGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           +G+++K  + T++ + G DK  +   AA I   R  +PYKGKG+    E + R
Sbjct: 122 EGIEIKCPKPTQLVIKGSDKVKVHMVAADICSIRRYDPYKGKGIFVKGEYVYR 174



>gb:SCMTRPL6_1708807 S.cerevisiae gene for mitochondrial ribosomal
           protein L6.
          Length = 205

 Score =  100 bits (249), Expect = 4e-20
 Identities = 57/146 (39%), Positives = 86/146 (58%), Gaps = 4/146 (2%)
 Frame = +3

Query: 294 QDFKVKGPLGELGITYPREVKLEKEES-GVLRVR-KAMETRRANEMHGLFRTLTDNMIVG 467
           Q+  VKGP GEL +  P  + L+K+E  G + V  +  E +    M G  R+L +N I+G
Sbjct: 54  QNITVKGPKGELSVEVPDFLHLDKDEKHGKINVTVQNSEDKHQRSMWGTVRSLINNHIIG 113

Query: 468 VSKGFDKKLQLVGVGYRAMVE--GKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGY 641
           V++G    L+ VG GYRA +E  GK + + +G S    + +P+G+ VK    T + + G 
Sbjct: 114 VTEGHLAVLRFVGTGYRAQLENDGKFVNVKVGASIKQGLDVPEGIVVKTPAPTSLIIEGC 173

Query: 642 DKSAIGQFAASIRKWRPPEPYKGKGV 719
           +K  +  FAA +RK+ PPEPYKGKG+
Sbjct: 174 NKQQVLLFAAKLRKFHPPEPYKGKGI 199



>gb:CR925677_117874 Ehrlichia ruminantium str. Gardel, complete
           genome.
          Length = 178

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 55/172 (31%), Positives = 93/172 (54%), Gaps = 1/172 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGV-LRVRKAMETR 410
           SR+G  PI +PSNV + + G    +K     L +     V    + + + L V  +    
Sbjct: 2   SRVGSMPILIPSNVQVDLVGNQLTLKNSENSLKLVLDYGVSCNIDGNSITLHVNDSSANS 61

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
           R   M G +R++ ++  +G+S+G   +L++ GVGY+A V  + + L+LGFSH ++  IP+
Sbjct: 62  RV--MWGTYRSMINSYAIGLSQGLVVELEITGVGYKAEVNDEYLSLSLGFSHGIKYKIPN 119

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           G+ ++  + T+I V G+DK  +   A+ I   R   PYKGKG+    + I R
Sbjct: 120 GIIIQCVKPTQILVKGFDKQKVYMVASDICSIRKYNPYKGKGISIKGKYIYR 171



>gb:AF110138_1768729 Nephroselmis olivacea mitochondrion, complete
           genome.
          Length = 187

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 58/182 (31%), Positives = 99/182 (54%), Gaps = 13/182 (7%)
 Frame = +3

Query: 237 RIGKQPIPVPSNVTIKMEGQDFKVKGPLGEL----------GITYPREVKLEKEESGVLR 386
           +I K  + +P  ++I +     K++GPLG +          GI +   +K+  + S   +
Sbjct: 2   KIFKYTLYIPIGLSIVITESSLKMEGPLGSIIIPLSTMDPYGIIF---IKIINDNSKEQK 58

Query: 387 VRKAMETRRANEMHGLFRTLTDN---MIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLG 557
             + +     +++  LF ++      MI GVS+G    L+L+GVGYRA +E   + L LG
Sbjct: 59  YIEIIGNSSHSKIQSLFPSIISKFKQMIDGVSRGVFTSLELIGVGYRAQLESNFLDLKLG 118

Query: 558 FSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEV 737
            SHP++  I   +++  ++ T I + G DK  + Q AA +R +RPPE YKGKG++Y +E 
Sbjct: 119 HSHPIQYPINPSMKIVQKKPTEIALYGIDKQYVRQVAADLRYFRPPEVYKGKGIRYHNEC 178

Query: 738 IR 743
           I+
Sbjct: 179 IK 180



>gb:CR767821_116956 Ehrlichia ruminantium strain Welgevonden,
           complete genome.>gb:CR925678_118833 Ehrlichia
           ruminantium str. Welgevonden, complete genome.
          Length = 178

 Score = 97.4 bits (241), Expect = 3e-19
 Identities = 53/172 (30%), Positives = 93/172 (54%), Gaps = 1/172 (0%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGV-LRVRKAMETR 410
           SR+G  PI +PSNV + + G    +K     L +     +    + + + L V  +    
Sbjct: 2   SRVGSMPILIPSNVQVDLVGNQLTLKNSENSLKLVLDYGISCNIDGNSITLHVNDSSANS 61

Query: 411 RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD 590
           +   M G +R++ ++  +G+S+G   +L++ GVGY+A V  + + L+LGFSH ++  IP+
Sbjct: 62  KV--MWGTYRSMINSYAIGLSQGLVVELEITGVGYKAEVNDEYLSLSLGFSHGIKYKIPN 119

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           G+ ++  + T+I V G+DK  +   A+ I   R   PYKGKG+    + I R
Sbjct: 120 GIIIQCVKPTQILVKGFDKQKVYMVASDICSIRKYNPYKGKGISIKGKYIYR 171



>gb:CR380955_1651592 Candida glabrata strain CBS138 chromosome I
           complete sequence.
          Length = 216

 Score = 96.7 bits (239), Expect = 5e-19
 Identities = 63/192 (32%), Positives = 97/192 (50%), Gaps = 21/192 (10%)
 Frame = +3

Query: 231 ESRIGKQPIPVPSNVTIKME-----------------GQDFKVKGPLGELGITYPREVKL 359
           +S +G  PI V   V + +                   Q   V+GP G L +  P  + +
Sbjct: 18  QSHVGSMPIYVAPEVNVSIGPMSVAKTIRKGRGLLSLAQVISVEGPKGTLKLEVPDFISM 77

Query: 360 EKE-ESGVLRVR-KAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVE- 530
           EK+ +SG + +  K  E++    M G  R+L +N IVGV++G    L+ VG GY A +E 
Sbjct: 78  EKDKDSGKVTISVKDNESKLQKSMWGTVRSLVNNHIVGVTEGHMAILKFVGTGYGARLEN 137

Query: 531 -GKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYK 707
            GK + + +G S    + +P+G+ VK    T + + G DK  +  FAA +R + PPEPYK
Sbjct: 138 DGKFVNIKVGASIKQGLDVPEGITVKSPSLTSLIIEGSDKQQVLLFAAKLRDFHPPEPYK 197

Query: 708 GKGVKYADEVIR 743
           GKG+    E I+
Sbjct: 198 GKGIYVNGETIK 209



>gb:AE017258_418417 Wolbachia endosymbiont of Drosophila
           melanogaster, section 3 of 5 of the complete
           genome.>gb:AE017196_1059054 Wolbachia endosymbiont of
           Drosophila melanogaster, complete genome.
          Length = 181

 Score = 94.4 bits (233), Expect = 3e-18
 Identities = 54/164 (32%), Positives = 90/164 (54%), Gaps = 2/164 (1%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR- 410
           SRIG  PI +P+ V+++       +K    E  ++  R+V  +  ++ +L      +   
Sbjct: 2   SRIGAAPINIPAGVSVEYNNGSMLIKSAKAEKEVSLIRDVVCQIIDNQLLLSVDQDKDNY 61

Query: 411 -RANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIP 587
            +   M G +R+  +N+I G+  GF   L++ GVGY+A  +GK + L LG+SH V+  +P
Sbjct: 62  DKIKPMWGTYRSNINNIINGMVDGFSVNLEINGVGYKAECDGKYLTLYLGYSHNVKYKVP 121

Query: 588 DGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGV 719
             +++K  + T + VSG DK  +   A+ I K R  +PYKGKGV
Sbjct: 122 KDVEIKCIKPTHLIVSGMDKQKVYMVASDICKIRKYDPYKGKGV 165



>gb:CR382125_1657933 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 214

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 57/162 (35%), Positives = 92/162 (56%), Gaps = 4/162 (2%)
 Frame = +3

Query: 270 NVTIKMEGQDFKVKGPLGELGITYPREVKLEKE-ESGVLRVR-KAMETRRANEMHGLFRT 443
           N ++K+  Q+  V GPLG++ +  P  V+++++  SG + V  K    +    M G  R+
Sbjct: 47  NKSLKLS-QNVTVSGPLGKIDMEIPDFVEIKQDGSSGKIEVAVKDSTDKTQRSMWGTVRS 105

Query: 444 LTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVR--MAIPDGLQVKVEEN 617
             +N I GV++     L+ VG GYRA +E  +  +N+     VR  + IP+G+ VK    
Sbjct: 106 HINNHITGVNESHMAVLKFVGTGYRAQLEENNTFVNVKVGASVRQGLPIPEGIIVKSPVP 165

Query: 618 TRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           T + V G +K  +  FAA++RK+ PPEPYKGKG+   +E I+
Sbjct: 166 TSLIVEGVNKQQVLLFAANLRKFHPPEPYKGKGIYVNNETIK 207



>sp|P46748|RM06_PROWI Mitochondrial 60S ribosomal protein
           L6.>pir|T11928|T11928 ribosomal protein L6 - Prototheca
           wickerhamii mitochondrion>gb:PWU02970_1703127 Prototheca
           wickerhamii 263-11 complete mitochondrial DNA.
          Length = 194

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 60/181 (33%), Positives = 97/181 (53%), Gaps = 19/181 (10%)
 Frame = +3

Query: 255 IPVPSNVTIKMEGQDF--KVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRA---- 416
           I +P  + I     ++   + GPLG   I      KL+K  +G+  +   ++ ++     
Sbjct: 11  IKIPEKIEIHPTTTEYIYTITGPLGSSSINLK---KLDK--NGIACINFDIQNKQVLIRS 65

Query: 417 --NEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMV-------EGKD----IVLNLG 557
              + +GL++ L +N  +GVS+GF   L++VGVGYRA +         KD    IVL LG
Sbjct: 66  LYPKYNGLYKKLIENKFLGVSRGFCVYLEIVGVGYRAALLSSSLQNSTKDTNDTIVLKLG 125

Query: 558 FSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEV 737
            SH +   +P+G++V ++  + I + G D + + Q A SIR  RPP  YKGKG++Y +E 
Sbjct: 126 HSHDIHYKVPNGVRVFLQSPSEICIFGVDLNQVTQVAHSIRNTRPPSVYKGKGIRYTNEK 185

Query: 738 I 740
           I
Sbjct: 186 I 186



>gb:CR382134_1667063 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 215

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 60/194 (30%), Positives = 90/194 (46%), Gaps = 24/194 (12%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFK-------------------VKGPLGELGITYPREVK 356
           S IGKQPI +   V    E   F+                   VKGP G L    P  V+
Sbjct: 15  SNIGKQPITITEAVQCYTEQIPFEFCKSFTKGKTTVSLNKQIVVKGPKGVLKTAVPEFVQ 74

Query: 357 LEKEESGVLRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVE-- 530
           ++ E + +    +  E +    + G  R L  N I+G ++G    ++ VG GYRA +E  
Sbjct: 75  VKNENNLITVSVENPEDKIQRTIWGTSRALVQNNIIGTTEGHLAIVKFVGTGYRATIETA 134

Query: 531 ---GKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEP 701
               K I L +G+ +  ++ +P+ L V      R+ + G DK  +  FAA IR+ + PEP
Sbjct: 135 EDGSKVIALKIGYPYTPKLKVPEALTVSSPNPARLLIEGSDKQQVKLFAARIREHKKPEP 194

Query: 702 YKGKGVKYADEVIR 743
           YKGKG+    E I+
Sbjct: 195 YKGKGIFVDGETIK 208



>gb:AC006439_1534287 Arabidopsis thaliana chromosome 2 clone T30D6
           map mi39, complete sequence.>gb:AY044317_1561032
           Arabidopsis thaliana putative ribosomal protein L6
           (At2g18400; T30D6.9) mRNA, complete
           cds.>gb:AY088468_1573487 Arabidopsis thaliana clone 692
           mRNA, complete sequence.
          Length = 102

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 41/91 (45%), Positives = 63/91 (69%), Gaps = 2/91 (2%)
 Frame = +3

Query: 480 FDKKLQLVGVGYRAMVE--GKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSA 653
           F + L++VGVGY+A  E  G+ + L LG+SH V +A+P  ++V   +N  +  +G DK  
Sbjct: 5   FFRFLKIVGVGYKARAEEAGRFLYLKLGYSHEVELAVPPAVRVFCFKNNVVCCTGIDKQR 64

Query: 654 IGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + QFAA++R  +PPEPYKGKG+ Y DEV+++
Sbjct: 65  VHQFAATVRSCKPPEPYKGKGIMYTDEVVKK 95



>gb:AE017321_441959 Wolbachia endosymbiont strain TRS of Brugia
           malayi, complete genome.
          Length = 181

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 49/164 (29%), Positives = 90/164 (54%), Gaps = 2/164 (1%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESG-VLRVRKAMET- 407
           SRIG  PI +P+ V+++       +K    E  +    ++  +  ++  VL V +  ++ 
Sbjct: 2   SRIGAAPINIPAGVSVECNDGKVLIKSAKAEKELRLCSDIVCQVTDNQLVLSVDQGKDSY 61

Query: 408 RRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIP 587
                + G +R+  +N+I G+  GF   L++ G+GY+A  +GK + L LG+SH ++  +P
Sbjct: 62  NEIKPIWGTYRSNINNIINGIVNGFSVDLEINGIGYKAECDGKYLTLYLGYSHNIKYKVP 121

Query: 588 DGLQVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGV 719
             +++K  + T + V+G DK  +   A+ I K R  +PYKGKG+
Sbjct: 122 KDVEIKCIKPTHLVVNGMDKQKVYVIASDICKIRKYDPYKGKGI 165



>pir|H84563|H84563 probable ribosomal protein L6 [imported] -
           Arabidopsis thaliana
          Length = 144

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 41/91 (45%), Positives = 63/91 (69%), Gaps = 2/91 (2%)
 Frame = +3

Query: 480 FDKKLQLVGVGYRAMVE--GKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSA 653
           F + L++VGVGY+A  E  G+ + L LG+SH V +A+P  ++V   +N  +  +G DK  
Sbjct: 47  FFRFLKIVGVGYKARAEEAGRFLYLKLGYSHEVELAVPPAVRVFCFKNNVVCCTGIDKQR 106

Query: 654 IGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           + QFAA++R  +PPEPYKGKG+ Y DEV+++
Sbjct: 107 VHQFAATVRSCKPPEPYKGKGIMYTDEVVKK 137



>gb:AY534144_1612200 Saprolegnia ferax strain ATCC 36051
           mitochondion, complete genome.
          Length = 204

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 44/165 (26%), Positives = 92/165 (55%), Gaps = 1/165 (0%)
 Frame = +3

Query: 249 QPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMH 428
           + I +P N+ I ++     ++GPLG + +     +    + + +L    ++  +R  +  
Sbjct: 31  EKIRIPKNINIVLKKNQLILQGPLGSIDLNIMHSLNYFIKNNNILLSFNSLHLKRKKKSF 90

Query: 429 -GLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVK 605
             L+++L    I G+ +GF   L L G+G++A +E K+++L LG+SH + + IP+ +++ 
Sbjct: 91  LNLYKSLIKLKIKGILQGFKLNLFLKGLGFKAFIEEKNLILKLGYSHSITIEIPENIKI- 149

Query: 606 VEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI 740
           + +  ++  S  D   + ++   I+ ++ PEPYKGKG+   +EVI
Sbjct: 150 INQTNKLIFSSNDWIFLTKYVHYIKNFKKPEPYKGKGLLLKNEVI 194



>gb:AE016817_1747254 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 214

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 56/156 (35%), Positives = 85/156 (54%), Gaps = 6/156 (3%)
 Frame = +3

Query: 294 QDFKVKGPLGELGITYPREVKLEKEE-SGVLRVR---KAMETRRANEMHGLFRTLTDNMI 461
           Q   V+GPLG   +  P  V L+ +  SG + V     A +++RA  M G  R+   + +
Sbjct: 54  QKVTVEGPLGSASMELPDFVSLDHDAASGQVAVTVHDAANKSQRA--MWGTVRSTLGSHV 111

Query: 462 VGVSKGFDKKLQLVGVGYRAMVE--GKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVS 635
            GV++G    L+ VG GYRA +E  GK + + +G S    + +P G+ VK    T + + 
Sbjct: 112 QGVNEGHMAFLKFVGTGYRAALEDDGKFVSVKVGASIRQGLPVPPGVTVKSPAPTLLIIE 171

Query: 636 GYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           G  K  +  FAAS+R + PPEPYKGKG+   +E I+
Sbjct: 172 GCVKQQVNLFAASLRMFHPPEPYKGKGIYMNNETIK 207



>gb:AC135228_1742179 Oryza sativa chromosome 3 BAC OSJNBb0122C16
           genomic sequence, complete sequence.
          Length = 103

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 37/86 (43%), Positives = 56/86 (65%), Gaps = 2/86 (2%)
 Frame = +3

Query: 492 LQLVGVGYRAMVE--GKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQF 665
           L+LVGVG++A  E  G+++ L LG+SH V+   P  ++V   +   I  +G DK+ +  F
Sbjct: 9   LKLVGVGFKARTEREGRELFLKLGYSHEVQFTAPPAVRVFCFKPNLICCTGIDKNRVHNF 68

Query: 666 AASIRKWRPPEPYKGKGVKYADEVIR 743
           A ++R  +PPE YKGKG+ Y DEVI+
Sbjct: 69  AGAVRNCKPPEVYKGKGILYIDEVIK 94



>gb:U17009_1726280 Phytophthora infestans mitochondrion, complete
           genome.
          Length = 201

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 46/159 (28%), Positives = 81/159 (50%)
 Frame = +3

Query: 264 PSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGLFRT 443
           P N+ I    +    +  LG L +T+   +     ++ +L +   +   + + +H L+  
Sbjct: 36  PKNIKISTTNKTIFFETSLGLLSLTFIDNIYFFLIKNKLL-INVNINKNKKSILH-LYNK 93

Query: 444 LTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTR 623
           L    I GV +GF   L L G+G++A +E  +++L LGFSH + + IP  +++ + +   
Sbjct: 94  LIKIKIKGVLQGFKISLLLKGIGFKAFIENNNLILKLGFSHNIIIPIPSNIEI-INQTNI 152

Query: 624 ITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI 740
           +  S  D   + QF   IR  + PEPYKGKG+   +E I
Sbjct: 153 LIFSSIDYIFLNQFVHYIRNHKKPEPYKGKGLLLKNEKI 191



>gb:AY267353_1593888 Chara vulgaris mitochondrion, complete genome.
          Length = 101

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 35/85 (41%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = +3

Query: 492 LQLVGVGYRAMVEGKD--IVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQF 665
           L++VGVGY+A    +   ++L LGFSH +++  P  ++V   + T I  +G D+  + QF
Sbjct: 9   LEIVGVGYKASTNPQSSILILKLGFSHDMKLQAPPSVRVFCLKPTLICCTGIDRQKVTQF 68

Query: 666 AASIRKWRPPEPYKGKGVKYADEVI 740
           AA I++ +PPE YKGKG++Y +E+I
Sbjct: 69  AARIKRCKPPEVYKGKGLRYRNEII 93



>gb:AP005918_1860106 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0419H09.
          Length = 103

 Score = 73.9 bits (180), Expect = 4e-12
 Identities = 37/90 (41%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +3

Query: 480 FDKKLQLVGVGYRAMVE--GKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSA 653
           F + L+LVGVG++A  E  G+++ L LG+SH V+   P  ++V   +   I  +G DK+ 
Sbjct: 5   FFRFLKLVGVGFKARTEREGRELFLKLGYSHEVQFTAPPAVRVFCFKPNLICCTGIDKNR 64

Query: 654 IGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
           +  FA ++R  + PE YKGKG+ Y DEVI+
Sbjct: 65  VHHFAGAVRNSKTPEVYKGKGILYIDEVIK 94



>gb:AF494279_1805291 Chaetosphaeridium globosum mitochondrial DNA,
           complete genome.
          Length = 99

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 36/83 (43%), Positives = 52/83 (62%)
 Frame = +3

Query: 492 LQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAA 671
           L++ GVGYRA +  + + L LGFS  ++M IP  +++   + T I   G  K  + QFAA
Sbjct: 9   LEIHGVGYRASILDEQLCLKLGFSSEIKMPIPSDIKIFCLKPTLICCVGTSKINVTQFAA 68

Query: 672 SIRKWRPPEPYKGKGVKYADEVI 740
            IRK +PPE YKGKG++Y  E +
Sbjct: 69  QIRKLKPPEVYKGKGIRYKIETL 91



>sp|P26861|RM06_MARPO Mitochondrial 60S ribosomal protein
           L6.>pir|S25981|S25981 ribosomal protein L6 - liverwort
           (Marchantia polymorpha) mitochondrion>gb:MPOMTCG_1686838
           Marchantia polymorpha mitochondrion, complete genome.
          Length = 101

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 33/87 (37%), Positives = 55/87 (63%), Gaps = 2/87 (2%)
 Frame = +3

Query: 492 LQLVGVGYRAMV--EGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQF 665
           L+++GVGY+A    +G  + L LGFSH +R+ +   ++V   +   I  +G D   + QF
Sbjct: 9   LEIIGVGYKASTNAQGSILYLKLGFSHEIRLQVTPSVRVFCLKPNLICCTGMDHQKVTQF 68

Query: 666 AASIRKWRPPEPYKGKGVKYADEVIRR 746
           AA ++  +PPE YKGKG++Y +E+I +
Sbjct: 69  AAIVKSCKPPEVYKGKGIQYRNEIIHK 95



>gb:LDI344328_1684118 Laminaria digitata complete mitochondrial
           genome.
          Length = 163

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 38/100 (38%), Positives = 61/100 (61%)
 Frame = +3

Query: 441 TLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENT 620
           +L    I GV  G+  +LQL G+GYR   + K ++ +LG+S  V + IP+G+ V + + T
Sbjct: 57  SLFTQAIFGVVLGYTIELQLKGIGYRVRQDKKTLIFSLGYSKSVIVDIPEGVSVNLGKKT 116

Query: 621 RITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI 740
              +S  +   +  FA+SIR++R P+ YKG GV Y +E+I
Sbjct: 117 FSLISA-NLGLLQNFASSIRRYRYPDSYKGAGVLYENEII 155



>gb:AP006878_576677 Thermococcus kodakaraensis strain KOD1 DNA,
           complete genome.
          Length = 184

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 52/154 (33%), Positives = 82/154 (53%), Gaps = 8/154 (5%)
 Frame = +3

Query: 246 KQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEK----EESGVLRVRKAMETRR 413
           ++ I +P  V + +EG   KVKGP GEL     RE+K        E G + + K    ++
Sbjct: 8   REEIEIPEGVEVTVEGNTVKVKGPKGEL----QRELKYPGVQIFTEDGKVVIYKEFPRKK 63

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGY--RAMVEGKDIVLN--LGFSHPVRMA 581
              +   F+   +NMI GV++GF  +L++V   +     V+G ++V+   LG  +P R  
Sbjct: 64  DVAIVRTFKAHINNMIKGVTEGFKYRLKVVYSHFPMTVKVQGDEVVIENFLGEKNPRRAK 123

Query: 582 IPDGLQVKVEENTRITVSGYDKSAIGQFAASIRK 683
           I  G+ VKV + + I V G DK A+GQ AA+I +
Sbjct: 124 ILPGVTVKV-KGSEIEVEGIDKEAVGQTAANIEQ 156



>gb:AF193903_1775596 Cafeteria roenbergensis mitochondrial DNA,
           complete genome.
          Length = 181

 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 35/102 (34%), Positives = 60/102 (58%), Gaps = 4/102 (3%)
 Frame = +3

Query: 453 NMIVGVSKGFDKKLQLVGVGYRA--MVEGKDIVLNLGFSHPVRMAIPDGLQVK-VEENTR 623
           N+ + +   +  KL+++GVGY+   M   K + L LGFSH ++  +  G+  + + + + 
Sbjct: 72  NIFLNIEYNYSIKLKVIGVGYKIDPMPSQKILNLKLGFSHEIQFPLEPGIFCRRLNDRSS 131

Query: 624 ITV-SGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIRR 746
           I + S  D   +  F A ++K+RP EPYKGKG++Y  E I+R
Sbjct: 132 IYIFSSNDPQTLKNFLARLKKYRPVEPYKGKGLRYLTETIKR 173



>sp|Q9V1V1|RL6_PYRAB 50S ribosomal protein L6P.>pir|H75145|H75145
           lsu ribosomal protein l6p (rpl6p) PAB2132 - Pyrococcus
           abyssi (strain Orsay)>gb:CNSPAX02_849086 Pyrococcus
           abyssi complete genome; segment 2/6.
          Length = 184

 Score = 66.2 bits (160), Expect = 7e-10
 Identities = 51/152 (33%), Positives = 82/152 (53%), Gaps = 6/152 (3%)
 Frame = +3

Query: 246 KQPIPVPSNVTIKMEGQDFKVKGPLGEL--GITYPREVKLEKEESGVLRVRKAMETRRAN 419
           ++ I +P  V + ++G   KVKGP GE+   + +P  VK+   E G + + K    R+  
Sbjct: 8   REEIEIPEGVEVSVQGNTVKVKGPKGEVERELFWP-GVKI-FVEGGKVVIYKDFPRRKDV 65

Query: 420 EMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGY--RAMVEGKDIVLN--LGFSHPVRMAIP 587
            +   F+   +NMI GV++GF  KL++V   +     V+G ++++   LG   P R  I 
Sbjct: 66  AIVRTFKAHINNMIKGVTEGFTYKLKVVYSHFPITVKVQGDEVIIENFLGEKAPRRAKIL 125

Query: 588 DGLQVKVEENTRITVSGYDKSAIGQFAASIRK 683
            G+ VKV +   I V G DK A+GQ AA+I +
Sbjct: 126 PGVTVKV-KGQEIIVEGIDKEAVGQTAANIEQ 156



>gb:PLI277126_1700584 Pilayella littoralis complete mitochondrial
           genome.
          Length = 163

 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 31/94 (32%), Positives = 56/94 (59%)
 Frame = +3

Query: 459 IVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITVSG 638
           + GV  G+  +L L G+GY+   + ++++L+LG+S PV + IP+ + VK+ + +   +S 
Sbjct: 63  VQGVVLGYTIELNLKGIGYKVSTKERNLILSLGYSKPVILNIPEEVSVKLSKKSFSLISP 122

Query: 639 YDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVI 740
            +   +  FA  +R  R P+ YKG G+ Y  E+I
Sbjct: 123 -NMGVLQNFATMVRSQRFPDSYKGAGILYGGEII 155



>gb:AE013454_292470 Methanosarcina mazei strain Goe1, section 236 of
           379 of the complete genome.>gb:AE008384_966579
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 176

 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 51/149 (34%), Positives = 76/149 (51%), Gaps = 6/149 (4%)
 Frame = +3

Query: 255 IPVPSNVTIKMEGQDFKVKGPLGELGIT--YPREVKLEKEESGVLRVRKAMETRRANEMH 428
           I +P  V++ +    F  KGP G +  T  YP  +K+E  E  V+ V      +    M 
Sbjct: 9   IEIPEGVSVSLSQDVFTAKGPKGTVERTFWYPG-IKIEVREGEVV-VDAESSRKEQKAMV 66

Query: 429 GLFRTLTDNMIVGVSKGFDKKLQLVGVGY--RAMVEGKDIVLN--LGFSHPVRMAIPDGL 596
           G F +   N+I+GVS+GF+ K+ +V   +  +  VEGK +V+   LG   P    I    
Sbjct: 67  GTFASHLKNLIIGVSEGFECKMNIVYAHFPMQVKVEGKTLVIGNFLGEKKPRIAKILGET 126

Query: 597 QVKVEENTRITVSGYDKSAIGQFAASIRK 683
           +VKV  N  I VSG +K  +GQ AA+I +
Sbjct: 127 KVKVSGN-EIVVSGINKEDVGQTAANIEQ 154



>gb:AE010278_261375 Pyrococcus furiosus DSM 3638, section 153 of 173
           of the complete genome.>gb:AE009950_902156 Pyrococcus
           furiosus DSM 3638, complete genome.
          Length = 184

 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 48/150 (32%), Positives = 74/150 (49%), Gaps = 4/150 (2%)
 Frame = +3

Query: 246 KQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEM 425
           ++ + +P  V + +EG   KVKGP GEL   +         E G + + K    R+   +
Sbjct: 8   REEVEIPEGVEVTVEGYKVKVKGPKGELEREFFWPGIQIFTEDGNVVIYKDFPRRKDVAI 67

Query: 426 HGLFRTLTDNMIVGVSKGFDKKLQLVGVGY--RAMVEGKDIVLN--LGFSHPVRMAIPDG 593
              F     NMI GV++GF  KL++V   +     V+G ++++   LG   P +  I  G
Sbjct: 68  ARTFAAHIRNMIKGVTEGFTYKLKVVYSHFPISVKVQGDEVIIENFLGEKAPRKAKILPG 127

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRK 683
           + VKV     I V G DK A+GQ AA+I +
Sbjct: 128 VTVKV-RGQEIIVEGIDKEAVGQTAANIEQ 156



>pir|F71185|F71185 probable ribosomal protein L6 - Pyrococcus
           horikoshii>gb:BA000001_650439 Pyrococcus horikoshii OT3
           DNA, complete genome.
          Length = 187

 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 50/152 (32%), Positives = 82/152 (53%), Gaps = 6/152 (3%)
 Frame = +3

Query: 246 KQPIPVPSNVTIKMEGQDFKVKGPLGEL--GITYPREVKLEKEESGVLRVRKAMETRRAN 419
           ++ I +P  V + ++  + KVKGP GE+   + +P  VK+  E+  V+ + K    R+  
Sbjct: 11  REEIEIPEGVEVSVQDYNVKVKGPKGEVEKKLFWP-GVKIFVEDGKVV-IYKDFPRRKDV 68

Query: 420 EMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGY--RAMVEGKDIVLN--LGFSHPVRMAIP 587
            +   F+   +NMI GV++GF  KL++V   +     V+G ++++   LG   P R  I 
Sbjct: 69  AIVRTFKAHINNMIKGVTEGFTYKLKVVYSHFPITVKVQGDEVIIENFLGEKAPRRAKIL 128

Query: 588 DGLQVKVEENTRITVSGYDKSAIGQFAASIRK 683
            G+ VKV +   I V G DK A GQ AA+I +
Sbjct: 129 PGVTVKV-KGQEIIVEGIDKEATGQTAANIEQ 159



>sp|O59433|RL6_PYRHO 50S ribosomal protein L6P.
          Length = 184

 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 50/152 (32%), Positives = 82/152 (53%), Gaps = 6/152 (3%)
 Frame = +3

Query: 246 KQPIPVPSNVTIKMEGQDFKVKGPLGEL--GITYPREVKLEKEESGVLRVRKAMETRRAN 419
           ++ I +P  V + ++  + KVKGP GE+   + +P  VK+  E+  V+ + K    R+  
Sbjct: 8   REEIEIPEGVEVSVQDYNVKVKGPKGEVEKKLFWP-GVKIFVEDGKVV-IYKDFPRRKDV 65

Query: 420 EMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGY--RAMVEGKDIVLN--LGFSHPVRMAIP 587
            +   F+   +NMI GV++GF  KL++V   +     V+G ++++   LG   P R  I 
Sbjct: 66  AIVRTFKAHINNMIKGVTEGFTYKLKVVYSHFPITVKVQGDEVIIENFLGEKAPRRAKIL 125

Query: 588 DGLQVKVEENTRITVSGYDKSAIGQFAASIRK 683
            G+ VKV +   I V G DK A GQ AA+I +
Sbjct: 126 PGVTVKV-KGQEIIVEGIDKEATGQTAANIEQ 156



>gb:MC388_143094 M.capricolum DNA for CONTIG MC388.
          Length = 52

 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 27/50 (54%), Positives = 38/50 (76%)
 Frame = +3

Query: 456 MIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVK 605
           M+ GVS+GF K+LQ+ GVGY+A V G  + L+LG+SHPV   IPDG+ ++
Sbjct: 1   MLTGVSEGFKKELQITGVGYKAAVNGSKLNLSLGYSHPVEFEIPDGVVIQ 50



>sp|P54042|RL6_METJA 50S ribosomal protein L6P.>pir|G64358|G64358
           ribosomal protein L6 - Methanococcus
           jannaschii>gb:U67497_206566 Methanocaldococcus
           jannaschii DSM 2661 section 39 of 150 of the complete
           genome.>gb:L77117_1099324 Methanocaldococcus jannaschii
           DSM 2661, complete genome.
          Length = 182

 Score = 62.8 bits (151), Expect = 8e-09
 Identities = 42/150 (28%), Positives = 76/150 (50%), Gaps = 4/150 (2%)
 Frame = +3

Query: 246 KQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEM 425
           ++ + +P NV +++   +  VK    EL   +     + K+E   + +      R+   M
Sbjct: 8   EERVKIPENVQVEINNNEVVVKSGGKELRRRFEHPKIVIKKEGDEIVIFCEYPRRKDKAM 67

Query: 426 HGLFRTLTDNMIVGVSKGFDKKLQLVGVGY--RAMVEGKDIVLN--LGFSHPVRMAIPDG 593
            G  R   +NMI GV++GF  KL++    +  +  V+G ++++   LG  HP R  I +G
Sbjct: 68  VGTIRAHINNMIKGVTEGFTYKLKIRYAHFPMKVSVKGNEVIIENFLGEKHPRRARIMEG 127

Query: 594 LQVKVEENTRITVSGYDKSAIGQFAASIRK 683
           + VK+     + V+G DK  +GQ AA+I +
Sbjct: 128 VTVKI-SGEDVIVTGIDKEKVGQTAANIEQ 156



>gb:AY714814_1188353 Uncultured archaeon GZfos10C7 clone GZfos10C7,
           *** SEQUENCING IN PROGRESS ***, 2 unordered pieces.
          Length = 195

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 49/156 (31%), Positives = 84/156 (53%), Gaps = 13/156 (8%)
 Frame = +3

Query: 255 IPVPSNVTIKMEGQDFKVKGPLG--ELGITYP-REVKLEKEESG---VLRVRKAMETRRA 416
           IP+P NV + + G+  KV+GP G  E  +  P   +++EK ++G   V+R     + +RA
Sbjct: 15  IPIPENVNLTISGRLVKVEGPKGAIERELWQPGLRIQIEKRDNGDEVVIRSDSGRKKKRA 74

Query: 417 NEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMV----EGKDI-VLNLGFSHPVRMA 581
             M G + +   NMI GV  GF  +L++V   +   +    +G  + V N       R+A
Sbjct: 75  --MAGTYASHLKNMITGVESGFFYRLKVVHAHFPTQIAVAKDGNSVSVSNFLGEKKARIA 132

Query: 582 -IPDGLQVKVE-ENTRITVSGYDKSAIGQFAASIRK 683
            I +G++V+++ +   I VSG DK  +GQ AA++ +
Sbjct: 133 KIEEGVKVEIKGKGEEIVVSGIDKVLVGQTAANLEQ 168



>gb:AE017261_419673 Picrophilus torridus DSM 9790, complete genome.
          Length = 180

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 43/147 (29%), Positives = 70/147 (47%), Gaps = 4/147 (2%)
 Frame = +3

Query: 255 IPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRANEMHGL 434
           I +P +V   ME  + K+KG LGE    +         E   +++  +   +    + G 
Sbjct: 10  IKLPDDVQATMENNELKIKGKLGEASRIFRDNYVKAYIEGSSVKIATSKNNKYTKGIVGT 69

Query: 435 FRTLTDNMIVGVSKGFD--KKLQLVGVGYRAMVEGKDIVLN--LGFSHPVRMAIPDGLQV 602
           + + T  +I GV+KGF+   K+       R  V G  +++   LG   P    I DG +V
Sbjct: 70  WYSETKLLIEGVTKGFEYHMKIDFTHFPMRVSVRGDKLIVENFLGEKSPRSAKIVDGCKV 129

Query: 603 KVEENTRITVSGYDKSAIGQFAASIRK 683
            V +  RIT++G DK  IG+ AA+I +
Sbjct: 130 SV-KGDRITINGIDKRKIGETAANIER 155



>gb:AE009873_256774 Pyrobaculum aerophilum strain IM2 section 128 of
           201 of the complete genome.>gb:AE009441_899400
           Pyrobaculum aerophilum strain IM2 complete genome.
          Length = 196

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 37/153 (24%), Positives = 78/153 (50%), Gaps = 9/153 (5%)
 Frame = +3

Query: 249 QPIPVPSNVTIKMEGQD-----FKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           + + +P  V++ +E         KVKGPLGE+   +     +   + G + +      +R
Sbjct: 8   EEVEIPKGVSVSIERTGPFDYIVKVKGPLGEVTKEFKNTPVVMSLQDGKIVMEVFKARKR 67

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAM--VEGKDIVLN--LGFSHPVRMA 581
              + G ++ +  NM +GV++G+  KL+++   +  +  V+G  +V+   LG    + + 
Sbjct: 68  EYAILGTYKGILKNMFLGVTRGWRYKLKVIYTHFPMLVKVQGNQLVIENFLGRKSKITLN 127

Query: 582 IPDGLQVKVEENTRITVSGYDKSAIGQFAASIR 680
           IP G++V+V+    I + G D+  +  FAA+++
Sbjct: 128 IPKGVKVEVKGKEDIVIEGIDRELVSTFAAAVQ 160



>sp|P14030|RL6_METVA 50S ribosomal protein L6P.>pir|S05620|R5MX6
           ribosomal protein L6 - Methanococcus
           vannielii>gb:MVRPOP_151782 Methanococcus vanelli DNA for
           transcriptional unit for ribosomal proteins.
          Length = 182

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 44/153 (28%), Positives = 80/153 (52%), Gaps = 7/153 (4%)
 Frame = +3

Query: 246 KQPIPVPSNVTIKMEGQDFKVKGPLGELG--ITYPR-EVKLEKEESGVLRVRKAMETRRA 416
           ++ I +P NV++++ G +  VK     L   + +P  E+K+E E+   + V      +  
Sbjct: 8   REEIEIPGNVSVEVNGSEVVVKSGAKVLKRELAFPGIEIKMENEK---VVVESTFPKKNQ 64

Query: 417 NEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGY--RAMVEGKDIVLN--LGFSHPVRMAI 584
             M G +R+   NMI GVS+GF+ KL +    +  +   +G  ++++  LG  +P    +
Sbjct: 65  TAMVGTYRSHIQNMIKGVSEGFEYKLVIRYAHFPMKVTFKGNTVIIDNFLGEKYPRTAKV 124

Query: 585 PDGLQVKVEENTRITVSGYDKSAIGQFAASIRK 683
            +G+ VKV     + VSG +K  +GQ AA+I +
Sbjct: 125 MEGVTVKV-NGEEVIVSGTNKEFVGQTAANIEQ 156



>gb:AF370037_505423 Azospirillum sp. MI13 50S ribosomal protein L6
           gene, partial cds.
          Length = 93

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 35/93 (37%), Positives = 50/93 (53%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SRIGK  +PVP+ V + + GQ    KG LG L +T   ++   K E G + V  A +++R
Sbjct: 2   SRIGKHSVPVPAGVDVAVNGQLVTAKGKLGSLSLTLIDDI-TAKLEDGKVVVAPANDSKR 60

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVG 512
           A  M    RTL +NM+ G   G   + +  GVG
Sbjct: 61  ARVMWATSRTLINNMVTGSQPGLPHQPRDHGVG 93



>gb:AE017199_403072 Nanoarchaeum equitans Kin4-M, complete genome.
          Length = 192

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 46/156 (29%), Positives = 75/156 (48%), Gaps = 10/156 (6%)
 Frame = +3

Query: 246 KQPIPVPSNVTIKMEGQDFKVKGPLGELGIT-YPREVKLEKEESGVLRVRKAMETRRANE 422
           K  IP+P NV +  E    KV GP GE+    Y   +KL   ++ ++ +     TRR   
Sbjct: 7   KYEIPIPENVKVSYENNILKVSGPKGEVERKFYHPLIKLSVNDNKII-LETYFATRREKR 65

Query: 423 MHGLFRTLTDNMIVGVSKGFDKKLQLVGVGY--RAMVEGKDIVLN--LGFSHPVRMAIP- 587
           +   +R+   NM+ GV   F  +L++    +  R  +EG  +++   LG   P+   +P 
Sbjct: 66  LINTWRSHIKNMLEGVQNPFVYRLKVCYTHFPMRVKLEGNKLIVENFLGEKAPIIKELPY 125

Query: 588 -DGLQVKVEEN---TRITVSGYDKSAIGQFAASIRK 683
            D ++VK+E+N   T I V   DK   G  A+ I +
Sbjct: 126 LDKVKVKIEQNKDETEIVVESPDKEKAGIVASMIEQ 161



>gb:CHTOMPD_846351 C.trachomatis outer membrane binding protein
           (chlanectin) gene, complete cds.>gb:A01434_1446545
           C.trachomitis DNA for chlanectin.
          Length = 162

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 30/92 (32%), Positives = 48/92 (52%)
 Frame = +3

Query: 234 SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR 413
           SR  + PI +P  V + ++  +  VKGP G L     +EV++  + + V     A    R
Sbjct: 2   SRKARDPIVLPQGVEVSIQNDEISVKGPKGSLTQVLAKEVEIAVKGNEVFVAPAAHVVDR 61

Query: 414 ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGV 509
              M GL+  L  NM+ GV  GF+K+L+++ V
Sbjct: 62  PGRMQGLYWALIANMVKGVHTGFEKRLEMIMV 93



>gb:AF288090_1783348 Rhodomonas salina mitochondrial DNA, complete
           genome.
          Length = 171

 Score = 57.0 bits (136), Expect = 5e-07
 Identities = 34/105 (32%), Positives = 54/105 (51%), Gaps = 4/105 (3%)
 Frame = +3

Query: 441 TLTDNMIVGVSKGFDKKLQLVGVGYRAMV----EGKDIVLNLGFSHPVRMAIPDGLQVKV 608
           +L +N + GV   F KKL LVGVG+R       + K +V+    S    + IP+ + V  
Sbjct: 60  SLIENGLKGVCYNFSKKLSLVGVGFRCWTVCEKDKKFLVVKTSLSRDCILFIPETVDVLC 119

Query: 609 EENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
             +  + V+G  KS +  F  SI++ + P  YK KG+   +E I+
Sbjct: 120 LNSATVFVTGVRKSDVNSFILSIKRIKKPNFYKQKGIFLENETIK 164



>gb:BA000023_690987 Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 186

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 38/149 (25%), Positives = 76/149 (51%), Gaps = 6/149 (4%)
 Frame = +3

Query: 249 QPIPVPSNVTIKMEGQDFKVKGPLGEL--GITYPREVKLEKEESGVLRVRKAMETRRANE 422
           + I +P  + + +EG   KVKGP GE+    ++   +++ KE++ ++      + R+  +
Sbjct: 8   EEIEIPQGINVNIEGMKIKVKGPKGEIEKDFSHISGIEIRKEDNKIVVETTFADRRKKAQ 67

Query: 423 MHGLFRTLTDNMIVGVSKGFDKKLQLVGVGY--RAMVEGKDIVLN--LGFSHPVRMAIPD 590
            + +   + +NM  GV+KG+   L+++   +     V G ++ +   +G  +  R  I  
Sbjct: 68  FYSIIAHI-ENMFTGVTKGYRYYLKIIYTHFPVTVKVSGNEVQIQNLIGEKNIRRAKIMT 126

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASI 677
           G++V V +   I V G D   +GQ AA+I
Sbjct: 127 GVKVNV-KGEDIIVEGQDIEKVGQTAANI 154



>gb:BX957222_844668 Methanococcus maripaludis S2 complete genome;
           segment 4/5.
          Length = 182

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 43/152 (28%), Positives = 77/152 (50%), Gaps = 6/152 (3%)
 Frame = +3

Query: 246 KQPIPVPSNVTIKMEGQDFKVKGPLGELG--ITYPREVKLEKEESGVLRVRKAMETRRAN 419
           ++ I +P NV +++ G    VK    EL   + YP  +++  E+  V+ +  A   +   
Sbjct: 8   REEIEIPENVNVEINGSTVVVKSGAKELKRELMYPG-IEISTEDGKVV-IECAFPRKAQT 65

Query: 420 EMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGY--RAMVEGKDIVLN--LGFSHPVRMAIP 587
            + G +R+   NMI GV+ GF+ KL +    +  +   +G  ++++  LG  +     I 
Sbjct: 66  AIVGTYRSHIQNMITGVTDGFEYKLVIRYAHFPMKVSAKGNTVMIDNFLGEKYTRTAKIM 125

Query: 588 DGLQVKVEENTRITVSGYDKSAIGQFAASIRK 683
           DG+ VKV     + VSG +K  +GQ AA+I +
Sbjct: 126 DGVTVKV-SGEDVVVSGANKEFVGQTAANIEQ 156



>sp|O28370|RL6_ARCFU 50S ribosomal protein L6P.>pir|D69488|D69488
           LSU ribosomal protein L6P (rpl6P) homolog -
           Archaeoglobus fulgidus>gb:AE000971_30001 Archaeoglobus
           fulgidus DSM 4304 section 136 of 172 of the complete
           genome.>gb:AE000782_975785 Archaeoglobus fulgidus DSM
           4304 complete genome.
          Length = 196

 Score = 53.9 bits (128), Expect = 4e-06
 Identities = 46/165 (27%), Positives = 74/165 (44%), Gaps = 9/165 (5%)
 Frame = +3

Query: 216 TVECKESRIGKQPIPVPSNVTIKMEGQDF-----KVKGPLGELGITYPREVKLEKEESGV 380
           + E  E R+    + VP +V + +EG  F     K  GP GE            +   G 
Sbjct: 15  STEVYEERV----VEVPEDVQLTIEGDSFRGYTLKAVGPKGENTRYLKYRGVFIEVGDGK 70

Query: 381 LRVRKAMETRRANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGY--RAMVEGKDIVLN- 551
           +RV      ++   M G F    +N+I GV +GF+  L++V   +  +  VEG ++++  
Sbjct: 71  VRVYTTSPKKKHKAMVGTFAGHIENLITGVKEGFEYHLKVVYAHFPIKVRVEGNEVIIEN 130

Query: 552 -LGFSHPVRMAIPDGLQVKVEENTRITVSGYDKSAIGQFAASIRK 683
            +G  HP R  I    QV++     I V G D    GQ AA++ +
Sbjct: 131 FIGEKHPRRAKIVGRAQVEI-SGQDIYVRGIDIEECGQTAANLEQ 174



>gb:AY534910_626214 Uncultured marine group II euryarchaeote
           DeepAnt-JyKC7 clone cosmid DeepAnt-JyKC7, complete
           sequence.
          Length = 188

 Score = 52.8 bits (125), Expect = 9e-06
 Identities = 45/151 (29%), Positives = 71/151 (47%), Gaps = 8/151 (5%)
 Frame = +3

Query: 255 IPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLE-KEESGVLRVRKAMETRRANEMHG 431
           I +P  VT  + G D  V      L   + R  ++E ++ SG L V   +  ++   + G
Sbjct: 11  ISLPEGVTAAVNGNDVTVAKDGNSLTREF-RHPRIEVRDSSGELEVFVNLPRKKEKALAG 69

Query: 432 LFRTLTDNMIVGVSKGFDKKLQLVGVGY--RAMVEGKDIVLNLGFSHPV-RMAI----PD 590
            +     NM  GV  GF+ KL+ V   +     V G  + +   F   V R+A     P 
Sbjct: 70  TWAAHLTNMARGVDSGFEYKLKAVYSHFPMTIRVNGNQMTVTNLFGEKVPRVAALPWSPA 129

Query: 591 GLQVKVEENTRITVSGYDKSAIGQFAASIRK 683
            ++VKV+  T +TVSG D+  +GQ AA+I +
Sbjct: 130 EVEVKVQNKTDVTVSGADREKVGQTAANIER 160



>gb:AE016767_328043 Escherichia coli CFT073 section 13 of 18 of the
           complete genome.>gb:AE014075_958627 Escherichia coli
           CFT073 complete genome.
          Length = 207

 Score = 52.8 bits (125), Expect = 9e-06
 Identities = 33/95 (34%), Positives = 46/95 (48%)
 Frame = -3

Query: 740 NNFIGILHTLTFIRLRRPPFPNRGSKLTDGRFIVSTHSDSSVLFNLNLQAIRDCHPNRMR 561
           ++F+G+ +TL F+RLR          L D   I +   D S+    +    R    NRMR
Sbjct: 113 HDFVGVTNTLAFVRLRTTVGAQIRCNLADHLLISAFQHDFSLSRTFSSDTRRQLMVNRMR 172

Query: 560 ESEIKNYIFAFNHRTVPYTNQLQFLVKPLRYAYNH 456
           E++ +    AFN  TV YTNQLQ L +      NH
Sbjct: 173 ETQRQVNHIAFNRCTVTYTNQLQLLSEAFGNTDNH 207



>sp|O21037|RM06_DICDI Mitochondrial 60S ribosomal protein
           L6.>pir|T43779|T43779 ribosomal protein L6 [imported] -
           slime mold (Dictyostelium discoideum)
           mitochondrion>gb:AB000109_1192608 Dictyostelium
           discoideum mitochondrial DNA, complete
           sequence.>gb:D63523_1376247 Dictyostelium discoideum
           mitochondrial genes for ribosomal proteins, complete and
           partial cds.
          Length = 170

 Score = 52.8 bits (125), Expect = 9e-06
 Identities = 35/109 (32%), Positives = 59/109 (54%), Gaps = 3/109 (2%)
 Frame = +3

Query: 426 HGLFRTLTDNM---IVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGL 596
           HG  R +   M   I GV  GF  +L+LVG+G+     G  +VL++G+SH     IP  +
Sbjct: 56  HGDSRIIIGTMKQQIQGVLAGFCIELKLVGLGFVVHKVGNTLVLDVGYSHYRSCLIPKEV 115

Query: 597 QVKVEENTRITVSGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEVIR 743
            VK+ E ++I +   +K  +  FA+ ++ ++    YKG G+   +E I+
Sbjct: 116 VVKL-EGSQIILYSINKEKVTTFASLLKTFKKINMYKGTGILGINEKIK 163



>gb:AF287134_1783244 Ochromonas danica mitochondrial DNA, complete
           genome.
          Length = 178

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 27/95 (28%), Positives = 47/95 (49%)
 Frame = +3

Query: 453 NMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQVKVEENTRITV 632
           N+++       KKL LVG+G++ +     +   LG+SH +R+ IP  +        R+ +
Sbjct: 75  NLLLASKLNLKKKLNLVGLGFKVIRSNFYLKFKLGYSHIIRVEIPKEIIRFSGNKKRVRM 134

Query: 633 SGYDKSAIGQFAASIRKWRPPEPYKGKGVKYADEV 737
              DK  +G F   I   R  + YKGKG  + +++
Sbjct: 135 ESADKIKLGNFLQKIFHLRSYDCYKGKGFSFFNKI 169



>sp|O26127|RL6_METTH 50S ribosomal protein L6P.>pir|E69120|E69120
           ribosomal protein L6 - Methanobacterium
           thermoautotrophicum  (strain Delta H)>gb:AE000795_27724
           Methanobacterium thermoautotrophicum from bases 1 to
           10208 (section 1 of 148) of the complete
           genome.>gb:AE000666_924806 Methanobacterium
           thermoautotrophicum str. Delta H complete genome.
          Length = 177

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 44/153 (28%), Positives = 75/153 (49%), Gaps = 7/153 (4%)
 Frame = +3

Query: 246 KQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPR-EVKLEKEESGVLRVRKAMETRRANE 422
           ++ IP+P  V + ++G    VKGP  EL   +   E+ +  E+  V+   K    ++   
Sbjct: 8   REEIPIPDGVDVTIDG-GVTVKGPKWELSRKFNHSEISMAVEDDKVVLEVK-FPKKKDKA 65

Query: 423 MHGLFRTLTDNMIVGVSKGFDKKLQLVGVGY--RAMVEGKDIVLN--LGFSHP--VRMAI 584
           M G  R    NMI GV++GF  ++++V   +     V G  +V+   LG  HP   R   
Sbjct: 66  MIGTVRAHISNMITGVTEGFRYRMKIVYAHFPMSVKVAGDKVVIENFLGERHPRTARFVG 125

Query: 585 PDGLQVKVEENTRITVSGYDKSAIGQFAASIRK 683
              +QVK +E   + ++G +K  +GQ  A+I +
Sbjct: 126 DTKVQVKGDE---VEITGINKEHVGQTMANIEQ 155



>sp|Q9YF91|RL6_AERPE 50S ribosomal protein L6P.>pir|E72726|E72726
           probable ribosomal protein L6 APE0350 - Aeropyrum pernix
            (strain K1)>gb:BA000002_651049 Aeropyrum pernix K1 DNA,
           complete genome.
          Length = 182

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 46/147 (31%), Positives = 73/147 (49%), Gaps = 6/147 (4%)
 Frame = +3

Query: 255 IPVPSNVTIKMEGQDFKVKGPLGEL--GITYPREVKLEKEESGVLRVRKAMETRRANEMH 428
           + VP  VT+ ++G   KV GP GE+    ++ R V +  E++ V+ V       R   + 
Sbjct: 11  VEVPEGVTVSIDGMRVKVSGPKGEVERDFSHARGVLIRLEDNSVV-VESFFAKARQRALV 69

Query: 429 GLFRTLTDNMIVGVSKGFDKKLQLVGVGY--RAMVEG-KDIVLNLGFSHPVRMA-IPDGL 596
           G       NMI GV  GF  KL+++   +     VEG K I+ N      +R+A I  G+
Sbjct: 70  GAIAGHIRNMIKGVQGGFRYKLKIMYSHFPINVKVEGDKFIISNFLGEKGLRIARIMPGV 129

Query: 597 QVKVEENTRITVSGYDKSAIGQFAASI 677
           +V+V + + + V G D   + Q AA+I
Sbjct: 130 KVQV-KGSDVIVEGIDVEKVAQTAANI 155


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 893,224,482
Number of Sequences: 1806583
Number of extensions: 18461115
Number of successful extensions: 49454
Number of sequences better than 10.0: 315
Number of HSP's better than 10.0 without gapping: 47868
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 49179
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 58272739092
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)