BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig19
         (819 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB016061_1512754 Petunia x hybrida IMT-6 mRNA for cytochrome ...   261   8e-69   
sp|P37122|C762_SOLME|C762_SOLME Cytochrome P450 76A2 (EC 1.14.-.-) (CYPLXXV...   248   1e-64   Solanum melongena [aubergine]
gb:AB016060_1512753 Petunia x hybrida IMT-4 mRNA for cytochrome ...   206   4e-52   
pir|S38535|S38535 cytochrome P450 76A1 - eggplant (fragment)          193   4e-48   Solanum melongena [aubergine]
sp|P37121|C761_SOLME|C761_SOLME Cytochrome P450 76A1 (EC 1.14.-.-) (CYPLXXV...   193   4e-48   Solanum melongena [aubergine]
gb:AK118051_1816051 Arabidopsis thaliana At3g52970 mRNA for puta...   141   1e-32   
pir|T47554|T47554 cytochrome P450 homolog F8J2.140 [similarity] ...   141   1e-32   Arabidopsis thaliana [mouse-ear cress]
gb:VVI237995_1727512 Vitis vinifera mRNA for putative ripening-r...   120   2e-26   
sp|O23976|C76B_HELTU|C76B_HELTU Cytochrome P450 76B1 (EC 1.14.-.-) (7-ethox...   113   4e-24   Helianthus tuberosus [Jerusalem artichoke]
gb:HTCYP76B1_1682162 H.tuberosus mRNA for 7-ethoxycoumarin O-dee...   111   1e-23   
pir|T10895|T10895 cytochrome P450 76B1, xenobiotic-inducible - J...   111   1e-23   Helianthus tuberosus [Jerusalem artichoke]
gb:AY596977_1617028 Hypericum androsaemum cytochrome P450 mRNA, ...   110   2e-23   
gb:CRO251269_1673471 Catharanthus roseus mRNA for geraniol 10-hy...   106   6e-22   
gb:AY532372_1612055 Ammi majus cytochrome P450 (CYP76B8) mRNA, c...   105   8e-22   
gb:AB016062_1512755 Petunia x hybrida IMT-7 mRNA for cytochrome ...   104   2e-21   
gb:AX028842_1457182 Sequence 26 from Patent WO9732023.                103   3e-21   
gb:AF479661_1803546 Pastinaca sativa cytochrome P450 (CYP76B7) m...   100   6e-20   
gb:STU296346_1723032 Solanum tuberosum mRNA for cytochrome P450 ...    99   7e-20   
gb:OSJN00136_1695482 Oryza sativa genomic DNA, chromosome 4, BAC...    97   3e-19   
sp|Q9LIP4|C72X_ARATH|C72X_ARATH Cytochrome P450 71B36 (EC 1.14.-.-).>gb:AP0...    96   1e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AF368377_1791920 Nicotiana tabacum elicitor-inducible cytochr...    95   1e-18   
pir|T52256|T52256 cytochrome P-450LXXIA1 [similarity] - avocado>...    95   1e-18   Persea americana
sp|P24465|CP71_PERAE|CP71_PERAE Cytochrome P450 71A1 (EC 1.14.-.-) (CYPLXXI...    95   1e-18   Persea americana
sp|O81971|C7D9_SOYBN|C7D9_SOYBN Cytochrome P450 71D9 (EC 1.14.-.-) (P450 CP...    95   1e-18   Glycine max [soybeans]
gb:AX028830_1457176 Sequence 14 from Patent WO9732023.                 95   2e-18   
gb:OSJN00145_1190851 Oryza sativa (japonica cultivar-group) chro...    95   2e-18   
gb:AF368376_1791919 Nicotiana tabacum elicitor-inducible cytochr...    94   2e-18   
pir|T07960|T07960 probable (S)-N-methylcoclaurine 3'-hydroxylase...    94   2e-18   Eschscholzia californica
sp|O64900|C8B2_ESCCA|C8B2_ESCCA (S)-N-methylcoclaurine 3'-hydroxylase isozy...    94   2e-18   Eschscholzia californica
sp|O64899|C8B1_ESCCA|C8B1_ESCCA (S)-N-methylcoclaurine 3'-hydroxylase isozy...    94   2e-18   Eschscholzia californica
gb:AF313491_1785224 Matthiola incana flavonoid 3'-hydroxylase mR...    94   4e-18   
sp|O04164|C716_NEPRA|C716_NEPRA Cytochrome P450 71A6 (EC 1.14.-.-) (Fragmen...    94   4e-18   Nepeta racemosa
gb:AF313488_1785221 Callistephus chinensis putative flavonoid 3'...    93   5e-18   
gb:AF166332_1774015 Nicotiana tabacum cytochrome P450 gene, comp...    93   5e-18   
gb:AE016959_1021094 Oryza sativa (japonica cultivar-group) chrom...    93   5e-18   
gb:AP003990_1836016 Oryza sativa (japonica cultivar-group) genom...    93   7e-18   
gb:AB025030_1516092 Coptis japonica CYP80B2 mRNA for (S)-N-methy...    92   9e-18   
gb:AY541035_1612618 Allium cepa flavonoid 3'-hydroxylase mRNA, c...    92   1e-17   
sp|O81970|C719_SOYBN|C719_SOYBN Cytochrome P450 71A9 (EC 1.14.-.-) (P450 CP...    92   1e-17   Glycine max [soybeans]
gb:AX028832_1457177 Sequence 16 from Patent WO9732023.                 92   2e-17   
gb:AF386512_1794708 Pyrus communis cytochrome P450 mRNA, complet...    91   3e-17   
gb:AB127340_1528330 Muscari armeniacum MaP450 mRNA for cytochrom...    91   3e-17   
gb:AX028819_1457169 Sequence 3 from Patent WO9732023.                  91   3e-17   
sp|O81974|C7D8_SOYBN|C7D8_SOYBN Cytochrome P450 71D8 (EC 1.14.-.-) (P450 CP...    91   3e-17   Glycine max [soybeans]
gb:AP003523_1830358 Oryza sativa (japonica cultivar-group) genom...    90   4e-17   
gb:AF315465_1785416 Pelargonium x hortorum flavonoid 3'-hydroxyl...    90   4e-17   
sp|Q9SBQ9|F3PH_PETHY|F3PH_PETHY Flavonoid 3'-monooxygenase (EC 1.14.13.21) ...    90   4e-17   Petunia x hybrida [garden petunia]
sp|O48958|C7E1_SORBI|C7E1_SORBI Cytochrome P450 71E1 (EC 1.14.13.68) (4-hyd...    90   4e-17   Sorghum bicolor [broomcorn]
gb:AF191772_1775494 Papaver somniferum (S)-N-methylcoclaurine 3'...    90   6e-17   
gb:AX028838_1457180 Sequence 22 from Patent WO9732023.                 90   6e-17   
sp|O64637|C7C2_ARATH|C7C2_ARATH Cytochrome P450 76C2 (EC 1.14.-.-).>pir|T00...    90   6e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AP001298_1820965 Arabidopsis thaliana genomic DNA, chromosome...    89   8e-17   
gb:AY072124_1567018 Arabidopsis thaliana putative cytochrome P45...    89   8e-17   
gb:AB028462_1517854 Petunia x hybrida imt-5 mRNA for cytochrome ...    89   8e-17   
sp|O48923|C7DA_SOYBN|C7DA_SOYBN Cytochrome P450 71D10 (EC 1.14.-.-).>pir|T0...    89   8e-17   Glycine max [soybeans]
sp|O64718|C729_ARATH|C729_ARATH Cytochrome P450 71B9 (EC 1.14.-.-).>gb:AC00...    89   8e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AY463157_1607680 Ipomoea quamoclit flavonoid 3'-hydroxylase m...    89   1e-16   
gb:AF134590_1771026 Papaver somniferum (S)-N-methylcoclaurine 3'...    89   1e-16   
gb:AP005483_1852666 Oryza sativa (japonica cultivar-group) genom...    88   2e-16   
sp|Q9SD85|F3PH_ARATH|F3PH_ARATH Flavonoid 3'-monooxygenase (EC 1.14.13.21) ...    88   2e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AC003680_1531188 Arabidopsis thaliana chromosome 2 BAC F17K2 ...    88   2e-16   
pir|T52168|T52168 cytochrome P450 monooxygenase [imported] - Ara...    88   2e-16   Arabidopsis thaliana [mouse-ear cress]
sp|O64636|C7C1_ARATH|C7C1_ARATH Cytochrome P450 76C1 (EC 1.14.-.-).>pir|T00...    88   2e-16   Arabidopsis thaliana [mouse-ear cress]
sp|Q9LVD2|C72A_ARATH|C72A_ARATH Cytochrome P450 71B10 (EC 1.14.-.-).>gb:AB0...    88   2e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AB113263_1527234 Ipomoea tricolor Fuchsia mRNA for flavonoid ...    87   3e-16   
sp|O22307|C7DB_LOTJA|C7DB_LOTJA Cytochrome P450 71D11 (EC 1.14.-.-) (Fragme...    87   3e-16   Lotus japonicus
sp|Q9LIP5|C72W_ARATH|C72W_ARATH Cytochrome P450 71B35 (EC 1.14.-.-).>gb:BT0...    87   3e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AP005419_1851475 Oryza sativa (japonica cultivar-group) genom...    87   4e-16   
gb:AY532370_1612053 Ammi majus cytochrome P450 (CYP71AJ1) mRNA, ...    87   4e-16   
gb:AE016959_1021110 Oryza sativa (japonica cultivar-group) chrom...    87   4e-16   
gb:BT004038_1637150 Arabidopsis thaliana clone RAFL15-05-J07 (R2...    87   5e-16   
gb:AB122079_1528034 Panax ginseng mRNA for cytochrome P450, comp...    87   5e-16   
gb:AB113261_1527232 Ipomoea nil Magenta mRNA for flavonoid 3'-hy...    87   5e-16   
gb:AX028836_1457179 Sequence 20 from Patent WO9732023.                 87   5e-16   
gb:AP005570_1854232 Oryza sativa (japonica cultivar-group) genom...    86   6e-16   
gb:AF313489_1785222 Callistephus chinensis flavonoid 3',5'-hydro...    86   6e-16   
gb:NRCYP71A5_1691150 Nepeta racemosa mRNA for cytochrome P450, C...    86   6e-16   
sp|Q9LIP3|C72Y_ARATH|C72Y_ARATH Cytochrome P450 71B37 (EC 1.14.-.-).              86   6e-16   Arabidopsis thaliana [mouse-ear cress]
sp|Q9STK8|C71P_ARATH|C71P_ARATH Cytochrome P450 71A25 (EC 1.14.-.-).>pir|T0...    86   6e-16   Arabidopsis thaliana [mouse-ear cress]
sp|Q9STL1|C71M_ARATH|C71M_ARATH Cytochrome P450 71A22 (EC 1.14.-.-).>pir|T0...    86   6e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AP001298_1820969 Arabidopsis thaliana genomic DNA, chromosome...    86   1e-15   
sp|Q9STK7|C71Q_ARATH|C71Q_ARATH Cytochrome P450 71A26 (EC 1.14.-.-).>pir|T0...    86   1e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AP003990_1836014 Oryza sativa (japonica cultivar-group) genom...    85   1e-15   
gb:AP003571_1831049 Oryza sativa (japonica cultivar-group) genom...    85   1e-15   
gb:AY333420_1600105 Ipomoea purpurea flavonoid 3'-hydroxylase (F...    85   1e-15   
gb:AB113262_1527233 Ipomoea purpurea Pink mRNA for flavonoid 3'-...    85   1e-15   
sp|P93531|C7D7_SOLCH|C7D7_SOLCH Cytochrome P450 71D7 (EC 1.14.-.-).>pir|T10...    85   1e-15   Solanum chacoense
sp|Q9LTM0|C72N_ARATH|C72N_ARATH Cytochrome P450 71B23 (EC 1.14.-.-).>gb:AB0...    85   1e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AF426451_1799114 Citrus sinensis cytochrome P450 mRNA, partia...    85   2e-15   
gb:AE016959_1021114 Oryza sativa (japonica cultivar-group) chrom...    85   2e-15   
gb:AE016959_1021085 Oryza sativa (japonica cultivar-group) chrom...    85   2e-15   
sp|P93530|C7D6_SOLCH|C7D6_SOLCH Cytochrome P450 71D6 (EC 1.14.-.-).>pir|T10...    85   2e-15   Solanum chacoense
gb:AP003571_1831056 Oryza sativa (japonica cultivar-group) genom...    84   2e-15   
pir|T05735|T05735 cytochrome P450 71A10 - soybean>gb:AF022157_17...    84   2e-15   Glycine max [soybeans]
sp|Q9STL2|C71L_ARATH|C71L_ARATH Cytochrome P450 71A21 (EC 1.14.-.-).>pir|T0...    84   2e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AX028821_1457170 Sequence 5 from Patent WO9732023.                  84   3e-15   
gb:AC120537_1739920 Oryza sativa chromosome 3 BAC OSJNBb0042N11 ...    84   4e-15   
sp|Q9LIP6|C72V_ARATH|C72V_ARATH Cytochrome P450 71B34 (EC 1.14.-.-).>gb:AP0...    84   4e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AP003571_1831055 Oryza sativa (japonica cultivar-group) genom...    83   5e-15   
gb:AB052131_1521171 Asparagus officinalis Asp-3 mRNA for cytochr...    83   5e-15   
gb:AC135564_1742594 Oryza sativa chromosome 3 BAC OSJNBb0056O10 ...    83   7e-15   
sp|O64635|C7C4_ARATH|C7C4_ARATH Cytochrome P450 76C4 (EC 1.14.-.-).>pir|T00...    83   7e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AF321864_1786044 Lolium rigidum clone Lol-5-v putative cytoch...    82   9e-15   
gb:AP005419_1851474 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AP003990_1836015 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AB045592_1520403 Perilla frutescens PFSII3 mRNA for flavone s...    82   1e-14   
pir|T00605|T00605 probable cytochrome P450 At2g02580 [imported] ...    82   1e-14   Arabidopsis thaliana [mouse-ear cress]
sp|O04773|C756_CAMME|C756_CAMME Flavonoid 3',5'-hydroxylase (EC 1.14.-.-) (...    82   1e-14   Campanula medium [Canterbury bells]
sp|P58045|C71E_ARATH|C71E_ARATH Cytochrome P450 71A14 (EC 1.14.-.-).              82   1e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AB005249_1509673 Arabidopsis thaliana genomic DNA, chromosome...    82   2e-14   
gb:AX028825_1457172 Sequence 9 from Patent WO9732023.                  82   2e-14   
pir|T52173|T52173 cytochrome P450 monooxygenase [imported] - Ara...    82   2e-14   Arabidopsis thaliana [mouse-ear cress]
sp|O65788|C722_ARATH|C722_ARATH Cytochrome P450 71B2 (EC 1.14.-.-).>pir|H86...    82   2e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AP003571_1831052 Oryza sativa (japonica cultivar-group) genom...    81   2e-14   
gb:CAR249799_1645174 Cicer arietinum partial mRNA for cytochrome...    81   2e-14   
pir|T50525|T50525 cytochrome P450 monooxygenase-like protein - A...    81   2e-14   Arabidopsis thaliana [mouse-ear cress]
pir|T10896|T10896 cytochrome P450 (EC 1.14.-.-) 81B1c - Jerusale...    81   2e-14   Helianthus tuberosus [Jerusalem artichoke]
gb:AP004326_1840217 Oryza sativa (japonica cultivar-group) genom...    81   3e-14   
gb:AK118163_1816156 Arabidopsis thaliana At2g45580 mRNA for puta...    81   3e-14   
gb:AF156976_1773054 Gerbera hybrida flavone synthase II (CYP93B2...    81   3e-14   
gb:CRO238612_1673464 Catharanthus roseus mRNA for cytochrome P450.     81   3e-14   
gb:AB047809_1520669 Arabidopsis thaliana YLS6 mRNA for cytochrom...    81   3e-14   
gb:AB028152_1517808 Torenia hybrida TFNS5 mRNA for cytochrome P4...    81   3e-14   
pir|T00871|T00871 probable cytochrome P450 At2g45580 [imported] ...    81   3e-14   Arabidopsis thaliana [mouse-ear cress]
sp|O64638|C7C3_ARATH|C7C3_ARATH Cytochrome P450 76C3 (EC 1.14.-.-).               81   3e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AF022460_1761995 Glycine max cytochrome P450 monooxygenase CY...    80   4e-14   
gb:AB028151_1517807 Antirrhinum majus AFNS2 mRNA for cytochrome ...    80   4e-14   
pir|T05940|T05940 cytochrome P450 83D1p - soybean (fragment)           80   4e-14   Glycine max [soybeans]
pir|T06713|T06713 probable cytochrome P450 T29H11.190 - Arabidop...    80   4e-14   Arabidopsis thaliana [mouse-ear cress]
sp|O65787|C726_ARATH|C726_ARATH Cytochrome P450 71B6 (EC 1.14.-.-).>pir|T52...    80   4e-14   Arabidopsis thaliana [mouse-ear cress]
sp|Q9STK9|C71O_ARATH|C71O_ARATH Cytochrome P450 71A24 (EC 1.14.-.-).              80   4e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AP005308_1850270 Oryza sativa (japonica cultivar-group) genom...    80   5e-14   
gb:AF346833_1789996 Mentha x piperita menthofuran synthase mRNA,...    80   5e-14   
sp|O49342|C71D_ARATH|C71D_ARATH Cytochrome P450 71A13 (EC 1.14.-.-).>pir|E8...    80   5e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AP004326_1840219 Oryza sativa (japonica cultivar-group) genom...    80   6e-14   
gb:AK118875_1816829 Arabidopsis thaliana At2g30750 mRNA for puta...    80   6e-14   
gb:AF122821_1769853 Capsicum annuum cytochrome P450 (PepCYP) mRN...    80   6e-14   
gb:AY192573_1588679 Catharanthus roseus cytochrome P450 71D1 (CY...    80   6e-14   
gb:AY094484_1575777 Arabidopsis thaliana At2g30750/T11J7.14 mRNA...    80   6e-14   
gb:AB010697_1511191 Arabidopsis thaliana genomic DNA, chromosome...    80   6e-14   
gb:AE016959_1021729 Oryza sativa (japonica cultivar-group) chrom...    80   6e-14   
sp|Q9LTL0|C72Q_ARATH|C72Q_ARATH Cytochrome P450 71B26 (EC 1.14.-.-).>gb:AB0...    80   6e-14   Arabidopsis thaliana [mouse-ear cress]
sp|O49340|C71C_ARATH|C71C_ARATH Cytochrome P450 71A12 (EC 1.14.-.-).>pir|C8...    80   6e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AB036772_1519050 Triticum aestivum N-1 mRNA for cytochrome P4...    79   8e-14   
pir|F86460|F86460 probable cytochrome P450 [imported] - Arabidop...    79   8e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AP006461_1862010 Oryza sativa (japonica cultivar-group) genom...    79   1e-13   
gb:AP005114_1848113 Oryza sativa (japonica cultivar-group) genom...    79   1e-13   
gb:AP003434_1829313 Oryza sativa (japonica cultivar-group) genom...    79   1e-13   
gb:HTCYP81L_1682164 Helianthus tuberosus mRNA for cytochrome P45...    79   1e-13   
gb:AP003571_1831046 Oryza sativa (japonica cultivar-group) genom...    79   1e-13   
gb:AB078781_1523781 Vinca major VFH gene for Flavonoid 3',5'-hyd...    79   1e-13   
sp|O04790|C757_EUSGR|C757_EUSGR Flavonoid 3',5'-hydroxylase (EC 1.14.-.-) (...    79   1e-13   Eustoma exaltatum subsp. russellianum [bluebells]
sp|Q9SAB6|C71I_ARATH|C71I_ARATH Cytochrome P450 71A18 (EC 1.14.-.-).              79   1e-13   Arabidopsis thaliana [mouse-ear cress]
sp|Q9FH66|C71G_ARATH|C71G_ARATH Cytochrome P450 71A16 (EC 1.14.-.-).>gb:AB0...    79   1e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AP003571_1831053 Oryza sativa (japonica cultivar-group) genom...    78   2e-13   
gb:AP003523_1830359 Oryza sativa (japonica cultivar-group) genom...    78   2e-13   
gb:AC074355_1541401 Oryza sativa (japonica cultivar-group) chrom...    78   2e-13   
gb:AE016959_1021169 Oryza sativa (japonica cultivar-group) chrom...    78   2e-13   
sp|P49264|C7B1_THLAR|C7B1_THLAR Cytochrome P450 71B1 (EC 1.14.-.-) (CYPLXXI...    78   2e-13   Thlaspi arvense
sp|Q96418|C755_EUSGR|C755_EUSGR Flavonoid 3',5'-hydroxylase (EC 1.14.-.-) (...    78   2e-13   Eustoma exaltatum subsp. russellianum [bluebells]
gb:AP003434_1829312 Oryza sativa (japonica cultivar-group) genom...    78   2e-13   
gb:AC092559_1735529 Oryza sativa chromosome 3 BAC OSJNBb0096M04 ...    78   2e-13   
gb:AY850933_1630830 Broussonetia papyrifera ferulate-5-hydroxyla...    78   2e-13   
gb:AY072297_1567115 Zea mays cytochrome P450 monooxygenase CYP92...    78   2e-13   
sp|P58050|C72D_ARATH|C72D_ARATH Cytochrome P450 71B13 (EC 1.14.-.-).              78   2e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AP002968_1823977 Oryza sativa (japonica cultivar-group) genom...    77   3e-13   
gb:AP003571_1831043 Oryza sativa (japonica cultivar-group) genom...    77   4e-13   
gb:AF488522_1804421 Oryza sativa Cyt-P450 monooxygenase (PM-II) ...    77   4e-13   
gb:BT015411_1642239 Arabidopsis thaliana At4g12320 gene, complet...    77   4e-13   
gb:AY596979_1617030 Centaurium erythraea clone 2 cytochrome P450...    77   4e-13   
gb:AY566988_1615411 Verbena x hybrida flavonoid 3',5'-hydroxylas...    77   4e-13   
gb:AP005419_1851476 Oryza sativa (japonica cultivar-group) genom...    77   5e-13   
gb:AP003523_1830355 Oryza sativa (japonica cultivar-group) genom...    77   5e-13   
gb:AF368380_1791923 Nicotiana tabacum elicitor-inducible cytochr...    77   5e-13   
gb:AF218296_1778151 Pisum sativum cytochrome P450 mRNA, complete...    77   5e-13   
gb:AC134348_1741777 Oryza sativa (japonica cultivar-group) chrom...    77   5e-13   
gb:AE016959_1021701 Oryza sativa (japonica cultivar-group) chrom...    77   5e-13   
sp|P58049|C72B_ARATH|C72B_ARATH Cytochrome P450 71B11 (EC 1.14.-.-).>gb:AK1...    77   5e-13   Arabidopsis thaliana [mouse-ear cress]
sp|P58046|C71F_ARATH|C71F_ARATH Cytochrome P450 71A15 (EC 1.14.-.-).              77   5e-13   Arabidopsis thaliana [mouse-ear cress]
sp|P37118|C712_SOLME|C712_SOLME Cytochrome P450 71A2 (EC 1.14.-.-) (CYPLXXI...    77   5e-13   Solanum melongena [aubergine]
gb:AP003711_1832299 Oryza sativa (japonica cultivar-group) genom...    76   7e-13   
gb:AF150881_1772612 Lycopersicon esculentum x Lycopersicon peruv...    76   7e-13   
gb:PHPET1_1700155 P.hybrida mRNA for P450 hydroxylase.                 76   7e-13   
gb:AB012925_1511971 Torenia hybrida mRNA for flavonoid 3',5'-hyd...    76   7e-13   
gb:A29011_1448320 pCGP602 DNA from patent EP0522880.                   76   7e-13   
gb:AE016959_1021306 Oryza sativa (japonica cultivar-group) chrom...    76   7e-13   
pir|T14639|T14639 cytochrome P450 CYP99A1 - sorghum (fragment)         76   7e-13   Sorghum bicolor [broomcorn]
pir|S36807|S36807 cytochrome P450 71A3 - eggplant (fragment)           76   7e-13   Solanum melongena [aubergine]
pir|S32110|S32110 cytochrome P450 PET-1 - garden petunia (fragment)    76   7e-13   Petunia x hybrida [garden petunia]
sp|O48957|CP99_SORBI|CP99_SORBI Cytochrome P450 CYP99A1 (EC 1.14.-.-) (Frag...    76   7e-13   Sorghum bicolor [broomcorn]
sp|P48418|C751_PETHY|C751_PETHY Flavonoid 3',5'-hydroxylase 1 (EC 1.14.-.-)...    76   7e-13   Petunia x hybrida [garden petunia]
sp|P58051|C72E_ARATH|C72E_ARATH Cytochrome P450 71B14 (EC 1.14.-.-).              76   7e-13   Arabidopsis thaliana [mouse-ear cress]
sp|Q9ZU07|C72C_ARATH|C72C_ARATH Cytochrome P450 71B12 (EC 1.14.-.-).>gb:AC0...    76   7e-13   Arabidopsis thaliana [mouse-ear cress]
sp|Q9STL0|C71N_ARATH|C71N_ARATH Cytochrome P450 71A23 (EC 1.14.-.-).>pir|T0...    76   7e-13   Arabidopsis thaliana [mouse-ear cress]
sp|P37119|C713_SOLME|C713_SOLME Cytochrome P450 71A3 (EC 1.14.-.-) (CYPLXXI...    76   7e-13   Solanum melongena [aubergine]
gb:AF499734_1806170 Glycine max clone Gm-c1053-348 cultivar Haro...    76   9e-13   
gb:AF499728_1806164 Glycine max cultivar Harosoy gray pubescence...    76   9e-13   
gb:AB061212_1521992 Glycine max sf3'h1 mRNA for flavonoid 3'-hyd...    76   9e-13   
gb:AB057672_1521704 Torenia hybrida tht mRNA for flavonoid 3'-hy...    76   9e-13   
gb:AX028834_1457178 Sequence 18 from Patent WO9732023.                 76   9e-13   
gb:AF214009_1777815 Brassica napus cytochrome p450-dependent mon...    75   1e-12   
gb:AC113337_1738992 Genomic sequence for Oryza sativa (japonica ...    75   1e-12   
gb:AE016959_1021165 Oryza sativa (japonica cultivar-group) chrom...    75   1e-12   
gb:AY621153_1618349 Camptotheca acuminata ferulate 5-hydroxylase...    75   1e-12   
gb:AP004022_1836496 Oryza sativa (japonica cultivar-group) genom...    75   2e-12   
gb:AP003909_1835058 Oryza sativa (japonica cultivar-group) genom...    75   2e-12   
gb:AP003909_1835056 Oryza sativa (japonica cultivar-group) genom...    75   2e-12   
gb:ALY295586_1819129 Arabidopsis lyrata subsp. petraea partial f...    75   2e-12   
gb:ATH492859_1552764 Arabidopsis thaliana partial fah1 gene for ...    75   2e-12   
gb:ATH492840_1552745 Arabidopsis thaliana partial fah1 gene for ...    75   2e-12   
gb:ATH492832_1552737 Arabidopsis thaliana partial fah1 gene for ...    75   2e-12   
gb:ATH295580_1552363 Arabidopsis thaliana fah1 gene for ferulate...    75   2e-12   
gb:ATH295576_1552359 Arabidopsis thaliana fah1 gene for ferulate...    75   2e-12   
pir|T04566|T04566 cytochrome P450 homolog T12H17.100 - Arabidops...    75   2e-12   Arabidopsis thaliana [mouse-ear cress]
sp|Q42600|C84A_ARATH|C84A_ARATH Cytochrome P450 84A1 (Ferulate-5-hydroxylas...    75   2e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AY596978_1617029 Centaurium erythraea coniferylalcohol 5-hydr...    74   3e-12   
gb:AY217351_1590137 Manihot esculenta cytochrome P450 protein CY...    74   3e-12   
gb:AB045593_1520404 Perilla frutescens SHT12 mRNA for flavonoid ...    74   3e-12   
gb:AX146629_1462494 Sequence 5 from Patent WO0134817.                  74   3e-12   
pir|JC7886|JC7886 cytochrome P450 92B1 - garden petunia                74   3e-12   Petunia x hybrida [garden petunia]
sp|Q96581|C754_GENTR|C754_GENTR Flavonoid 3',5'-hydroxylase (EC 1.14.-.-) (...    74   3e-12   Gentiana triflora
sp|Q9LTM1|C72M_ARATH|C72M_ARATH Cytochrome P450 71B22 (EC 1.14.-.-).>gb:AB0...    74   3e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AC120537_1739927 Oryza sativa chromosome 3 BAC OSJNBb0042N11 ...    74   3e-12   
gb:AC109595_1738719 Oryza sativa (japonica cultivar-group) chrom...    74   3e-12   
gb:AY596975_1617026 Centaurium erythraea clone 1 cytochrome P450...    74   3e-12   
sp|O81973|C933_SOYBN|C933_SOYBN Cytochrome P450 93A3 (EC 1.14.-.-) (P450 CP...    74   3e-12   Glycine max [soybeans]
sp|P37120|C752_SOLME|C752_SOLME Flavonoid 3',5'-hydroxylase (EC 1.14.-.-) (...    74   3e-12   Solanum melongena [aubergine]
sp|P37117|C714_SOLME|C714_SOLME Cytochrome P450 71A4 (EC 1.14.-.-) (CYPLXXI...    74   3e-12   Solanum melongena [aubergine]
gb:AP006446_1861782 Oryza sativa (japonica cultivar-group) genom...    74   4e-12   
gb:AF501293S1_1806526 Glycine max cultivar Williams flavonoid 3'...    74   4e-12   
gb:OSJN00014_1693289 Oryza sativa genomic DNA, chromosome 4, BAC...    74   4e-12   
sp|Q9LTM2|C72L_ARATH|C72L_ARATH Cytochrome P450 71B21 (EC 1.14.-.-).>gb:AB0...    74   4e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AF313490_1785223 Lycianthes rantonnei flavonoid 3',5'-hydroxy...    73   6e-12   
gb:AF214008_1777814 Brassica napus cytochrome p450-dependent mon...    73   6e-12   
gb:AF214007_1777813 Brassica napus cytochrome p450-dependent mon...    73   6e-12   
gb:AF139532_1771438 Liquidambar styraciflua aldehyde 5-hydroxyla...    73   6e-12   
gb:AC096855_1736364 Oryza sativa chromosome 3 BAC OJ1365_D05 gen...    73   6e-12   
gb:AY675560_1621949 Solanum tuberosum flavonoid 3',5'-hydroxylas...    73   6e-12   
gb:AF313492_1785225 Matthiola incana putative cytochrome P450 mR...    73   7e-12   
gb:AY278229_1594517 Medicago truncatula CYP81E8 mRNA, complete cds.    73   7e-12   
gb:AY056209_1563532 Arabidopsis thaliana putative cytochrome P45...    73   7e-12   
gb:AB078514_1523730 Nierembergia sp. NB17 f3',5'h mRNA for flavo...    73   7e-12   
gb:AE016959_1023401 Oryza sativa (japonica cultivar-group) chrom...    73   7e-12   
gb:AE016959_1020912 Oryza sativa (japonica cultivar-group) chrom...    73   7e-12   
pir|T49141|T49141 cytochrome P450-like protein - Arabidopsis tha...    73   7e-12   Arabidopsis thaliana [mouse-ear cress]
pir|T04564|T04564 cytochrome P450 homolog T12H17.80 - Arabidopsi...    73   7e-12   Arabidopsis thaliana [mouse-ear cress]
sp|Q9LXM3|C72Z_ARATH|C72Z_ARATH Cytochrome P450 71B38 (EC 1.14.-.-).              73   7e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AF488521_1804420 Oryza sativa Cyt-P450 monooxygenase (PM-I) m...    72   1e-11   
gb:AF188612_1775231 Callistephus chinensis flavone synthase II (...    72   1e-11   
gb:CRO295719_1673475 Catharanthus roseus partial mRNA for cytoch...    72   1e-11   
gb:AY117551_1579411 Glycine max flavonoid 3', 5'-hydroxylase mRN...    72   1e-11   
gb:AY062168_1564987 Musa acuminata cytochrome P450-1 mRNA, compl...    72   1e-11   
pir|G86460|G86460 probable cytochrome P450 [imported] - Arabidop...    72   1e-11   Arabidopsis thaliana [mouse-ear cress]
sp|P48419|C753_PETHY|C753_PETHY Flavonoid 3',5'-hydroxylase 2 (EC 1.14.-.-)...    72   1e-11   Petunia x hybrida [garden petunia]
gb:OSJN00047_1693825 Oryza sativa genomic DNA, chromosome 4, BAC...    72   1e-11   
gb:OSJN00047_1693824 Oryza sativa genomic DNA, chromosome 4, BAC...    72   1e-11   
gb:HVU495774_1682727 Hordeum vulgare partial mRNA for putative c...    72   1e-11   
gb:AY072308_1567125 Arabidopsis thaliana cytochrome P450 monooxy...    72   1e-11   
pir|T04735|T04735 cytochrome P450 homolog F6G17.60 - Arabidopsis...    72   1e-11   Arabidopsis thaliana [mouse-ear cress]
pir|T48141|T48141 flavonoid 3',5'-hydroxylase homolog T4C9.150 [...    72   1e-11   Arabidopsis thaliana [mouse-ear cress]
pir|T00510|T00510 probable cytochrome P450 At2g23220 [imported] ...    72   1e-11   Arabidopsis thaliana [mouse-ear cress]
pir|T03275|T03275 probable cytochrome P450, hypersensitivity-rel...    72   1e-11   Nicotiana tabacum [American tobacco]
pir|T03634|T03634 cytochrome P450 - common tobacco>gb:NTP450GEN_...    72   1e-11   Nicotiana tabacum [American tobacco]
sp|Q42798|C931_SOYBN|C931_SOYBN Cytochrome P450 93A1 (EC 1.14.-.-).>pir|S62...    72   1e-11   Glycine max [soybeans]
gb:AP004346_1840586 Oryza sativa (japonica cultivar-group) genom...    72   2e-11   
gb:AP002842_1823064 Oryza sativa (japonica cultivar-group) genom...    72   2e-11   
gb:AY675561_1621950 Solanum tuberosum flavonoid 3',5'-hydroxylas...    72   2e-11   
gb:AP003523_1830362 Oryza sativa (japonica cultivar-group) genom...    71   2e-11   
gb:AP003523_1830361 Oryza sativa (japonica cultivar-group) genom...    71   2e-11   
gb:AF321858_1786038 Lolium rigidum clone BXH putative cytochrome...    71   2e-11   
gb:CRO011862_1673459 Catharanthus roseus mRNA for flavonoid 3',5...    71   2e-11   
gb:CAR239051_1645168 Cicer arietinum mRNA for cytochrome P450 (c...    71   2e-11   
gb:AY675558_1621947 Solanum tuberosum flavonoid 3',5'-hydroxylas...    71   2e-11   
gb:AY462228_1607541 Hordeum lechleri Bx3-like protein mRNA, comp...    71   2e-11   
gb:AY275430_1594368 Gossypium hirsutum flavonoid 3',5'-hydroxyla...    71   2e-11   
sp|O49858|C823_SOYBN|C823_SOYBN Cytochrome P450 82A3 (EC 1.14.-.-) (P450 CP...    71   2e-11   Glycine max [soybeans]
sp|Q9SAE1|C72R_ARATH|C72R_ARATH Cytochrome P450 71B27 (EC 1.14.-.-).              71   2e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AP004000_1836147 Oryza sativa (japonica cultivar-group) genom...    71   3e-11   
gb:AP003434_1829310 Oryza sativa (japonica cultivar-group) genom...    71   3e-11   
gb:AP003267_1826773 Oryza sativa (japonica cultivar-group) genom...    71   3e-11   
gb:D78606_1674788 Arabidopsis thaliana mRNA for cytochrome P450 ...    71   3e-11   
gb:AX146625_1462493 Sequence 1 from Patent WO0134817.                  71   3e-11   
gb:AX031179_1457266 Sequence 20 from Patent WO9846762.                 71   3e-11   
pir|T48140|T48140 flavonoid 3',5'-hydroxylase homolog T4C9.140 [...    71   3e-11   
pir|T52174|T52174 cytochrome P450 monooxygenase [imported] - Ara...    71   3e-11   
gb:AP005308_1850271 Oryza sativa (japonica cultivar-group) genom...    70   4e-11   
gb:AP004757_1844510 Oryza sativa (japonica cultivar-group) genom...    70   4e-11   
gb:AP003990_1836005 Oryza sativa (japonica cultivar-group) genom...    70   4e-11   
gb:BT005895_1638817 Arabidopsis thaliana At5g67310 gene, complet...    70   4e-11   
gb:AB010697_1511192 Arabidopsis thaliana genomic DNA, chromosome...    70   4e-11   
gb:AB007645_1510147 Arabidopsis thaliana genomic DNA, chromosome...    70   4e-11   
pir|T04648|T04648 cytochrome P450 F10N7.220 - Arabidopsis thalia...    70   4e-11   
sp|Q9SAE3|C72S_ARATH|C72S_ARATH Cytochrome P450 71B28 (EC 1.14.-.-).>pir|A8...    70   4e-11   
sp|O65784|C725_ARATH|C725_ARATH Cytochrome P450 71B5 (EC 1.14.-.-).>pir|T46...    70   4e-11   
sp|Q9T0K2|C71K_ARATH|C71K_ARATH Cytochrome P450 71A20 (EC 1.14.-.-).>pir|T0...    70   4e-11   
gb:AP004790_1845128 Oryza sativa (japonica cultivar-group) genom...    70   5e-11   
gb:AY062167_1564986 Musa acuminata cytochrome P450-3 mRNA, parti...    70   5e-11   
pir|A86143|A86143 probable cytochrome P450 [imported] - Arabidop...    70   5e-11   
pir|JC7172|JC7172 cytochrome P450 CYP703A1 - garden petunia>gb:A...    70   5e-11   
pir|G86264|G86264 F3F19 hypothetical protein - Arabidopsis thali...    70   5e-11   
sp|O65782|C831_ARATH|C831_ARATH Cytochrome P450 83B1 (EC 1.14.-.-).>pir|T10...    70   5e-11   
sp|Q9FG65|C81D_ARATH|C81D_ARATH Cytochrome P450 81D1 (EC 1.14.-.-).>gb:AB02...    70   5e-11   
gb:AP005682_1855933 Oryza sativa (japonica cultivar-group) genom...    70   6e-11   
gb:AB042628_1519901 Triticum aestivum CYP71C7v2 mRNA for P450, c...    70   6e-11   
pir|T05942|T05942 cytochrome P450 82C1 - soybean>gb:AF022461_176...    70   6e-11   
gb:AP003523_1830363 Oryza sativa (japonica cultivar-group) genom...    69   8e-11   
gb:AP005835_1858737 Oryza sativa (japonica cultivar-group) genom...    69   1e-10   
gb:AE016959_1022776 Oryza sativa (japonica cultivar-group) chrom...    69   1e-10   
sp|Q96514|C727_ARATH|C727_ARATH Cytochrome P450 71B7 (EC 1.14.-.-).>pir|T52...    69   1e-10   
gb:AF123602_1769932 Triticum aestivum clone CYP71C2-21TA cytochr...    69   1e-10   
gb:AE016959_1022775 Oryza sativa (japonica cultivar-group) chrom...    69   1e-10   
gb:AP004000_1836143 Oryza sativa (japonica cultivar-group) genom...    68   2e-10   
gb:AF406732_1796912 Euphorbia lagascae cytochrome P450 (CYP726A1...    68   2e-10   
gb:AF321860_1786040 Lolium rigidum clone Lol-20-f putative cytoc...    68   2e-10   
gb:AF321859_1786039 Lolium rigidum clone Lol-20-d putative cytoc...    68   2e-10   
gb:AY086620_1571666 Arabidopsis thaliana clone 262802 mRNA, comp...    68   2e-10   
pir|T49979|T49979 cytochrome P450-like protein - Arabidopsis tha...    68   2e-10   
pir|T49978|T49978 cytochrome P450-like protein - Arabidopsis tha...    68   2e-10   
sp|Q9LTM4|C72J_ARATH|C72J_ARATH Cytochrome P450 71B19 (EC 1.14.-.-).>gb:AB0...    68   2e-10   
gb:AP004872_1846364 Oryza sativa (japonica cultivar-group) genom...    68   2e-10   
gb:AK117274_1815316 Arabidopsis thaliana At1g13100 mRNA for puta...    68   2e-10   
sp|Q9SAE4|C72T_ARATH|C72T_ARATH Cytochrome P450 71B29 (EC 1.14.-.-).>pir|B8...    68   2e-10   
sp|Q9T0K0|C71J_ARATH|C71J_ARATH Cytochrome P450 71A19 (EC 1.14.-.-).>pir|T0...    68   2e-10   
gb:AP004688_1843417 Oryza sativa (japonica cultivar-group) genom...    67   3e-10   
gb:AP004000_1836151 Oryza sativa (japonica cultivar-group) genom...    67   3e-10   
gb:AF175278_1774495 Pisum sativum wound-inducible P450 hydroxyla...    67   3e-10   
gb:AB057673_1521705 Torenia hybrida ght mRNA for flavonoid 3'-hy...    67   3e-10   
gb:AB025016_1516089 Lotus corniculatus var. japonicus mRNA for c...    67   3e-10   
sp|O22203|C983_ARATH|C983_ARATH Cytochrome P450 98A3 (EC 1.14.-.-).>pir|T00...    67   3e-10   
sp|Q43068|C821_PEA|C821_PEA Cytochrome P450 82A1 (EC 1.14.-.-) (CYPLXXXII...    67   3e-10   
gb:AP005878_1859536 Oryza sativa (japonica cultivar-group) genom...    67   4e-10   
gb:AY087432_1572463 Arabidopsis thaliana clone 35385 mRNA, compl...    67   4e-10   
pir|T52171|T52171 cytochrome P450 monooxygenase [imported] - Ara...    67   4e-10   
pir|T06523|T06523 cytochrome P450 monooxygenase (EC 1.13.-.-) - ...    67   4e-10   
sp|O65786|C724_ARATH|C724_ARATH Cytochrome P450 71B4 (EC 1.14.-.-).>gb:AB02...    67   4e-10   
gb:AC134237_1741676 Oryza sativa (japonica cultivar-group) chrom...    67   5e-10   
gb:AB113663_1527266 Iris hollandica IhCYP-1 mRNA for cytochrome ...    67   5e-10   
gb:AP005846_1858999 Oryza sativa (japonica cultivar-group) genom...    66   7e-10   
gb:AF428409_1799339 Arabidopsis thaliana AT3g26180/MTC11_8 mRNA,...    66   7e-10   
gb:AB037245_1519120 Asparagus officinalis ASPI-2 mRNA for cytoch...    66   7e-10   
sp|Q9LTM3|C72K_ARATH|C72K_ARATH Cytochrome P450 71B20 (EC 1.14.-.-).>gb:AB0...    66   7e-10   
gb:AP006069_1860901 Oryza sativa (japonica cultivar-group) genom...    66   9e-10   
gb:PAJ10324_1698705 Populus trichocarpa cv trichobel mRNA for fe...    66   9e-10   
pir|T04651|T04651 cytochrome P450 F10N7.250 - Arabidopsis thalia...    66   9e-10   
gb:AP005192_1849164 Oryza sativa (japonica cultivar-group) genom...    65   1e-09   
gb:AP003990_1836008 Oryza sativa (japonica cultivar-group) genom...    65   1e-09   
gb:BT002260_1635863 Arabidopsis thaliana At5g44620/K15C23_6 mRNA...    65   1e-09   
gb:AY281025_1594663 Mentha x gracilis limonene-6-hydroxylase mRN...    65   1e-09   
gb:AY278227_1594515 Medicago truncatula isoflavone 2'-hydroxylas...    65   1e-09   
gb:AB024024_1515696 Arabidopsis thaliana genomic DNA, chromosome...    65   1e-09   
gb:AE016959_1022029 Oryza sativa (japonica cultivar-group) chrom...    65   1e-09   
pir|H85440|H85440 cytochrome P450-like protein [imported] - Arab...    65   1e-09   
pir|A84645|A84645 probable cytochrome P450 [imported] - Arabidop...    65   1e-09   
sp|O49859|C824_SOYBN|C824_SOYBN Cytochrome P450 82A4 (EC 1.14.-.-) (P450 CP...    65   1e-09   
gb:AC084282_1733419 Oryza sativa chromosome 3 BAC OSJNBb0048A17 ...    65   2e-09   
pir|B84514|B84514 probable cytochrome P450 [imported] - Arabidop...    65   2e-09   
gb:AP005835_1858746 Oryza sativa (japonica cultivar-group) genom...    64   3e-09   
gb:AP005385_1850790 Oryza sativa (japonica cultivar-group) genom...    64   3e-09   
gb:AP005285_1849830 Oryza sativa (japonica cultivar-group) genom...    64   3e-09   
gb:AF135485_1771085 Glycine max cytochrome P450 monooxygenaseCYP...    64   3e-09   
pir|T48142|T48142 cytochrome P450 homolog T4C9.160 [similarity] ...    64   3e-09   
pir|B85441|B85441 cytochrome P450-like protein [imported] - Arab...    64   3e-09   
sp|O48922|C982_SOYBN|C982_SOYBN Cytochrome P450 98A2 (EC 1.14.-.-).>pir|T05...    64   3e-09   
gb:AP004591_1842019 Oryza sativa (japonica cultivar-group) genom...    64   3e-09   
gb:AF466200_1802231 Sorghum bicolor putative protein kinase gene...    64   3e-09   
gb:AC084282_1733418 Oryza sativa chromosome 3 BAC OSJNBb0048A17 ...    64   3e-09   
gb:AY057637_1564050 Arabidopsis thaliana AT4g13770/F18A5_160 mRN...    64   3e-09   
gb:ATU18929_1556808 Arabidopsis thaliana cytochrome p450 depende...    64   3e-09   
gb:AB022733_1515266 Glycyrrhiza echinata CYP Ge-51 mRNA for cyto...    64   3e-09   
sp|P93149|C9B1_GLYEC|C9B1_GLYEC Cytochrome P450 93B1 (EC 1.14.-.-) ((2S)-fl...    64   3e-09   
sp|P48421|C83A_ARATH|C83A_ARATH Cytochrome P450 83A1 (EC 1.14.-.-) (CYPLXXX...    64   3e-09   
gb:AP004850_1845959 Oryza sativa (japonica cultivar-group) genom...    64   4e-09   
gb:AP004232_1839042 Oryza sativa (japonica cultivar-group) genom...    64   4e-09   
gb:AP003434_1829309 Oryza sativa (japonica cultivar-group) genom...    64   4e-09   
gb:BT006472_1639359 Arabidopsis thaliana At3g20130 gene, complet...    64   4e-09   
gb:AY532373_1612056 Ammi majus cytochrome P450 (CYP82H1) mRNA, c...    64   4e-09   
gb:AY462229_1607542 Hordeum lechleri Bx4-like protein mRNA, comp...    64   4e-09   
gb:AB037244_1519119 Asparagus officinalis ASPI-1 mRNA for cytoch...    64   4e-09   
pir|T03259|T03259 cytochrome P450 - maize>gb:ZMCYP71C1_1731816 Z...    64   4e-09   
gb:AP005846_1858998 Oryza sativa (japonica cultivar-group) genom...    63   6e-09   
gb:AP004850_1845955 Oryza sativa (japonica cultivar-group) genom...    63   6e-09   
gb:AP003909_1835063 Oryza sativa (japonica cultivar-group) genom...    63   6e-09   
gb:AC084282_1733420 Oryza sativa chromosome 3 BAC OSJNBb0048A17 ...    63   6e-09   
gb:AY278228_1594516 Medicago truncatula isoflavone 3'-hydroxylas...    63   6e-09   
gb:AB042629_1519902 Triticum aestivum CYP71C8v2 mRNA for P450, c...    63   6e-09   
sp|O65785|C723_ARATH|C723_ARATH Cytochrome P450 71B3 (EC 1.14.-.-).>gb:AB02...    63   6e-09   
gb:AP003990_1836009 Oryza sativa (japonica cultivar-group) genom...    63   8e-09   
gb:AP003909_1835062 Oryza sativa (japonica cultivar-group) genom...    63   8e-09   
gb:AP003909_1835060 Oryza sativa (japonica cultivar-group) genom...    63   8e-09   
gb:AP003909_1835059 Oryza sativa (japonica cultivar-group) genom...    63   8e-09   
gb:AP000383_1819904 Arabidopsis thaliana genomic DNA, chromosome...    63   8e-09   
gb:AY485940_1608514 Triticum aestivum P450 mRNA, complete cds.         63   8e-09   
gb:AY485938_1608512 Triticum aestivum P450 mRNA, complete cds.         63   8e-09   
gb:AY485936_1608510 Triticum aestivum P450 gene, complete cds.         63   8e-09   
gb:AB022732_1515265 Glycyrrhiza echinata CYP Ge-31 mRNA for cyto...    63   8e-09   
pir|T00513|T00513 cytochrome P450 homolog At2g23190 - Arabidopsi...    63   8e-09   
sp|Q43250|C7C1_MAIZE|C7C1_MAIZE Cytochrome P450 71C1 (EC 1.14.-.-).>pir|T03...    63   8e-09   
sp|Q9LTM6|C72H_ARATH|C72H_ARATH Cytochrome P450 71B17 (EC 1.14.-.-).>gb:AB0...    63   8e-09   
gb:AP003575_1831142 Oryza sativa (japonica cultivar-group) genom...    62   1e-08   
gb:AF123603_1769933 Triticum aestivum clone CYP71C3-TA cytochrom...    62   1e-08   
gb:AY485941_1608515 Thinopyrum ponticum P450 mRNA, complete cds.       62   1e-08   
gb:AY166658_1586209 Pisum sativum cytochrome P450 mRNA, complete...    62   1e-08   
gb:AB042627_1519900 Triticum aestivum CYP71C6v1 mRNA for P450, c...    62   1e-08   
gb:AY462227_1607540 Hordeum lechleri Bx2-like protein mRNA, comp...    62   1e-08   
gb:AY192574_1588680 Catharanthus roseus cytochrome P450 71D2 (CY...    62   1e-08   
pir|T05332|T05332 probable cytochrome P450 F1C12.160 - Arabidops...    62   1e-08   
sp|O65438|C71R_ARATH|C71R_ARATH Cytochrome P450 71A27 (EC 1.14.-.-).              62   1e-08   
gb:AP005285_1849832 Oryza sativa (japonica cultivar-group) genom...    62   2e-08   
gb:AP005160_1848456 Oryza sativa (japonica cultivar-group) genom...    62   2e-08   
gb:AF378333_1793364 Citrus x paradisi cinnamate 4-hydroxylase mR...    62   2e-08   
gb:AF255014_1781157 Citrus sinensis cinnamate 4-hydroxylase CYP7...    62   2e-08   
gb:AC132485_1741144 Oryza sativa (japonica cultivar-group) chrom...    62   2e-08   
gb:AB024038_1515894 Arabidopsis thaliana genomic DNA, chromosome...    62   2e-08   
sp|Q9LTM7|C72G_ARATH|C72G_ARATH Cytochrome P450 71B16 (EC 1.14.-.-).>gb:AB0...    62   2e-08   
sp|P58048|C728_ARATH|C728_ARATH Cytochrome P450 71B8 (EC 1.14.-.-).               62   2e-08   
gb:BX784398_2140371 Pinus pinaster STS PPC4HP1, sequence tagged ...    61   2e-08   
gb:AP005285_1849831 Oryza sativa (japonica cultivar-group) genom...    61   2e-08   
gb:AP005114_1848098 Oryza sativa (japonica cultivar-group) genom...    61   2e-08   
gb:AF097664_1767890 Mesembryanthemum crystallinum cinnamate 4-hy...    61   2e-08   
gb:AY504997_1609836 Triticum aestivum P450 gene, complete cds.         61   2e-08   
gb:AB042631_1519904 Triticum aestivum CYP71C9v2 mRNA for P450, c...    61   2e-08   
gb:AB026647_1517200 Arabidopsis thaliana genomic DNA, chromosome...    61   2e-08   
pir|T04731|T04731 cytochrome P450 homolog F6G17.20 - Arabidopsis...    61   2e-08   
gb:AP005285_1849829 Oryza sativa (japonica cultivar-group) genom...    61   3e-08   
gb:AP005160_1848464 Oryza sativa (japonica cultivar-group) genom...    61   3e-08   
gb:AF321863_1786043 Lolium rigidum clone Lol-3-k putative cytoch...    61   3e-08   
gb:AY622319_1618384 Mentha spicata limonene-3-hydroxylase (lim3h...    61   3e-08   
gb:AY485937_1608511 Thinopyrum ponticum P450 gene, complete cds.       61   3e-08   
gb:AY485935_1608509 Triticum aestivum P450 gene, complete cds.         61   3e-08   
gb:AY281027_1594665 Mentha x gracilis limonene-3-hydroxylase mRN...    61   3e-08   
gb:AY072298_1567116 Zea mays cytochrome P450 monooxygenase CYP71...    61   3e-08   
sp|P93147|C81E_GLYEC|C81E_GLYEC Cytochrome P450 81E1 (EC 1.14.-.-) (Isoflav...    61   3e-08   
gb:AP003623_1831646 Oryza sativa (japonica cultivar-group) genom...    60   4e-08   
gb:AJ585991_1811752 Triticum aestivum partial mRNA for cytochrom...    60   4e-08   
gb:AY062672_1565328 Arabidopsis thaliana cytochrome P450 (At3g26...    60   4e-08   
gb:AE016959_1022777 Oryza sativa (japonica cultivar-group) chrom...    60   4e-08   
pir|A71418|A71418 cytochrome P450 d13725w - Arabidopsis thaliana...    60   4e-08   
sp|O24312|TCMO_POPTM|TCMO_POPTM Trans-cinnamate 4-monooxygenase (EC 1.14.13...    60   4e-08   
sp|Q9LTL2|C72P_ARATH|C72P_ARATH Cytochrome P450 71B25 (EC 1.14.-.-).>gb:AB0...    60   4e-08   
gb:AF286648_1783208 Gossypium arboreum cinnamate-4-hydroxylase m...    60   5e-08   
gb:AF212318_1777442 Capsicum annuum cinnamic acid 4-hydroxylase ...    60   5e-08   
gb:AF096998_1767847 Pinus taeda trans-cinnamate 4-hydroxylase (T...    60   5e-08   
gb:AY541032_1612615 Allium cepa cinammate 4-hydroxylase mRNA, co...    60   5e-08   
gb:AB042630_1519903 Triticum aestivum CYP71C9v1 mRNA for P450, c...    60   5e-08   
pir|T52170|T52170 cytochrome P450 monooxygenase [imported] - Ara...    60   5e-08   
gb:AF321857_1786037 Lolium rigidum clone FHH-y putative cytochro...    60   6e-08   
gb:AF321856_1786036 Lolium rigidum clone FHH-t putative cytochro...    60   6e-08   
gb:AF321855_1786035 Lolium rigidum clone FHH-v putative cytochro...    60   6e-08   
gb:AF286647_1783207 Gossypium arboreum cinnamate-4-hydroxylase (...    60   6e-08   
gb:AB159039_1528423 Lolium rigidum mRNA for P450, complete cds, ...    60   6e-08   
pir|G84465|G84465 probable cytochrome P450 [imported] - Arabidop...    60   6e-08   
pir|A85441|A85441 cytochrome P450-like protein [imported] - Arab...    60   6e-08   
gb:AP000383_1819901 Arabidopsis thaliana genomic DNA, chromosome...    59   8e-08   
gb:AJ585990_1811751 Triticum aestivum partial mRNA for cytochrom...    59   8e-08   
gb:AJ585988_1811749 Triticum aestivum partial mRNA for cytochrom...    59   8e-08   
gb:AJ583532_1811352 Triticum aestivum mRNA for cytochrome P450 (...    59   8e-08   
gb:AJ583531_1811351 Triticum aestivum mRNA for cytochrome P450 (...    59   8e-08   
gb:AF088847_1767267 Capsicum chinense cinnamic acid 4-hydroxylas...    59   8e-08   
gb:AC084282_1733421 Oryza sativa chromosome 3 BAC OSJNBb0048A17 ...    59   8e-08   
gb:AY462230_1607543 Hordeum lechleri Bx5-like protein mRNA, comp...    59   8e-08   
gb:AY090446_1574135 Arabidopsis thaliana AT3g20080/MAL21_9 mRNA,...    59   8e-08   
gb:AY085356_1570427 Arabidopsis thaliana clone 147792 mRNA, comp...    59   8e-08   
gb:AB159037_1528421 Lolium rigidum mRNA for P450, complete cds, ...    59   8e-08   
sp|Q42797|TCMO_SOYBN|TCMO_SOYBN Trans-cinnamate 4-monooxygenase (EC 1.14.13...    59   8e-08   
gb:AP005385_1850789 Oryza sativa (japonica cultivar-group) genom...    59   1e-07   
gb:AP003805_1833634 Oryza sativa (japonica cultivar-group) genom...    59   1e-07   
gb:AF302495_1784300 Populus trichocarpa X Populus deltoides cinn...    59   1e-07   
gb:POPCYP73BB_1700998 Populus kitakamiensis cyp73b gene for cinn...    59   1e-07   
gb:AY485939_1608513 Triticum aestivum P450 mRNA, complete cds.         59   1e-07   
gb:AY065995_1566582 Sesamum indicum p-coumarate 3-hydroxylase mR...    59   1e-07   
pir|PC4236|PC4236 trans-cinnamate 4-monooxygenase (EC 1.14.13.11...    59   1e-07   
sp|Q43240|TCMO_ZINEL|TCMO_ZINEL Trans-cinnamate 4-monooxygenase (EC 1.14.13...    59   1e-07   
sp|Q43054|TCMO_POPKI|TCMO_POPKI Trans-cinnamate 4-monooxygenase (EC 1.14.13...    59   1e-07   
sp|Q04468|TCMO_HELTU|TCMO_HELTU Trans-cinnamate 4-monooxygenase (EC 1.14.13...    59   1e-07   
sp|P48522|TCMO_CATRO|TCMO_CATRO Trans-cinnamate 4-monooxygenase (EC 1.14.13...    59   1e-07   
gb:AP000383_1819909 Arabidopsis thaliana genomic DNA, chromosome...    59   1e-07   
gb:AY281026_1594664 Mentha x gracilis cytochrome P450 mRNA, comp...    59   1e-07   
gb:AY133696_1581516 Arabidopsis thaliana clone C103195 putative ...    59   1e-07   
gb:AY086486_1571534 Arabidopsis thaliana clone 253698 mRNA, comp...    59   1e-07   
gb:AY064170_1566041 Pinus taeda p-coumarate 3-hydroxylase mRNA, ...    59   1e-07   
gb:AB055507_1521485 Lithospermum erythrorhizon C4H-1 mRNA for ci...    59   1e-07   
pir|F71417|F71417 cytochrome P450 - Arabidopsis thaliana>gb:ATCH...    59   1e-07   
pir|F85169|F85169 cytochrome P450 like protein [imported] - Arab...    59   1e-07   
pir|G96541|G96541 probable cytochrome P450 [imported] - Arabidop...    59   1e-07   
pir|C71418|C71418 cytochrome P450 - Arabidopsis thaliana               59   1e-07   
sp|O81972|C822_SOYBN|C822_SOYBN Cytochrome P450 82A2 (EC 1.14.-.-) (P450 CP...    59   1e-07   
sp|Q43257|C7C4_MAIZE|C7C4_MAIZE Cytochrome P450 71C4 (EC 1.14.-.-).>pir|T03...    59   1e-07   
sp|Q9LTL8|C72O_ARATH|C72O_ARATH Cytochrome P450 71B24 (EC 1.14.-.-).>gb:AB0...    59   1e-07   
gb:AY764567S1_1627280 Pinus taeda isolate 27 coumarate 3-hydroxy...    58   2e-07   
gb:AY764553S1_1627266 Pinus taeda isolate 30 coumarate 3-hydroxy...    58   2e-07   
gb:AY621152_1618348 Camptotheca acuminata cinnamate-4-hydroxylas...    58   2e-07   
gb:AB159038_1528422 Lolium rigidum mRNA for P450, complete cds, ...    58   2e-07   
sp|Q96423|TCMO_GLYEC|TCMO_GLYEC Trans-cinnamate 4-monooxygenase (EC 1.14.13...    58   2e-07   
sp|Q42799|C932_SOYBN|C932_SOYBN Cytochrome P450 93A2 (EC 1.14.-.-).>pir|T07...    58   2e-07   
gb:AP005835_1858753 Oryza sativa (japonica cultivar-group) genom...    58   2e-07   
gb:AF255013_1781156 Citrus sinensis cinnamate 4-hydroxylase CYP7...    58   2e-07   
gb:AF124816_1770302 Mentha x piperita cytochrome p450 isoform PM...    58   2e-07   
gb:ZMCYP71C3_1731818 Z.mays CYP71C3 mRNA for cytochrome P-450.         58   2e-07   
gb:CAR012581_1645125 Cicer arietinum mRNA for cytochrome P450.         58   2e-07   
gb:AY466856_1608088 Camptotheca acuminata hydroxylase-like cytoc...    58   2e-07   


>gb:AB016061_1512754 Petunia x hybrida IMT-6 mRNA for cytochrome
           P450, complete cds.
          Length = 510

 Score =  261 bits (668), Expect = 8e-69
 Identities = 128/217 (58%), Positives = 159/217 (73%)
 Frame = +1

Query: 169 MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAE 348
           M  +W Y  W +IFL+P    +L+RKKS S +R         + GN+ DLG  PHQTIA 
Sbjct: 1   MVLDWCYFAWFSIFLVPFFFLVLSRKKSCS-HRLPPGPPGWPIFGNLFDLGTLPHQTIAG 59

Query: 349 MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA 528
           MK +YG V+ LRIGSV T+AILSAK A E FKNHD  FADR +ID M V  Y   SL  A
Sbjct: 60  MKLRYGPVVLLRIGSVKTIAILSAKVATEFFKNHDACFADRKIIDTMLVHNYNKSSLVLA 119

Query: 529 PYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFV 708
           PYG+YWRVLRRICTVE+F +KRINET  +R+KCID ML WI+KEA S+++G+G+ VA F+
Sbjct: 120 PYGTYWRVLRRICTVEMFTNKRINETAHLRQKCIDSMLQWIDKEAKSMKKGSGIEVARFI 179

Query: 709 FLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ 819
           FL++FN++GNL LSRDLVDP S KAS+FF AM G+M+
Sbjct: 180 FLASFNMMGNLMLSRDLVDPESKKASEFFTAMEGLME 216



>sp|P37122|C762_SOLME Cytochrome P450 76A2 (EC 1.14.-.-)
           (CYPLXXVIA2) (P-450EG7).>pir|S38534|S38534 cytochrome
           P450 76A2 - eggplant>gb:SMCYPEG7_1715490 S.melongena
           CYP76A2 mRNA for hydroxylase.
          Length = 505

 Score =  248 bits (633), Expect = 1e-64
 Identities = 113/216 (52%), Positives = 160/216 (74%), Gaps = 1/216 (0%)
 Frame = +1

Query: 169 MEWEWKYLVWSAIFLIPGLVFLLARKKSS-SSYRXXXXXXXXXVIGNMLDLGAFPHQTIA 345
           MEWEW Y+ +SAI ++P  +   ++K ++ SSY+         + GNM +LG  P++ +A
Sbjct: 1   MEWEWSYVFFSAIIILPAFILFFSQKNTTKSSYKFPPGPPGLPIFGNMFELGTEPYKKMA 60

Query: 346 EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAF 525
            ++ KYG V+WL++GS  TM + +A+A+ ELFKNHD+SFA+R + DV +   YY GSLA 
Sbjct: 61  VLRQKYGPVLWLKLGSTYTMVVQTAQASEELFKNHDISFANRVIPDVNQAHSYYQGSLAI 120

Query: 526 APYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHF 705
           APYG +WR  RRICT+E+FVHK+I+ET PVRRKC+D+ML WIEKEA+S ++G+G+ V  F
Sbjct: 121 APYGPFWRFQRRICTIEMFVHKKISETEPVRRKCVDNMLKWIEKEANSAEKGSGIEVTRF 180

Query: 706 VFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGI 813
           VFL++FN+LGNL LS+DL D  S++AS+FF AM  I
Sbjct: 181 VFLASFNMLGNLILSKDLADLESEEASEFFIAMKRI 216



>gb:AB016060_1512753 Petunia x hybrida IMT-4 mRNA for cytochrome
           P450, complete cds.
          Length = 507

 Score =  206 bits (524), Expect = 4e-52
 Identities = 98/196 (50%), Positives = 136/196 (69%), Gaps = 1/196 (0%)
 Frame = +1

Query: 226 VFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTM 405
           VF    KK+S SY+         ++GNM DLG  PH  +  M+N+YG V+WL+IG+++T+
Sbjct: 20  VFFFLLKKTSRSYKLPPGPSGLPIVGNMFDLGDLPHIKMEGMRNQYGPVMWLKIGAINTL 79

Query: 406 AILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFV 585
            I SA+AA   FKNHD +F +R V++V +V  Y  GSLA APYG+YWR+LRRIC++ELFV
Sbjct: 80  VIQSAQAATAFFKNHDANFLERVVVEVNRVCNYLQGSLALAPYGNYWRMLRRICSMELFV 139

Query: 586 HKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDL-V 762
           H RIN +  +RRK +D M+ WIE      ++G G+ +  FVFL++FN+LGNL +S++L  
Sbjct: 140 HSRINNSESIRRKSVDKMIQWIETHGKK-EQGQGIEITRFVFLASFNMLGNLIMSKELAA 198

Query: 763 DPMSDKASKFFDAMTG 810
           DP S  AS+FFDAM G
Sbjct: 199 DPDSTTASEFFDAMMG 214



>pir|S38535|S38535 cytochrome P450 76A1 - eggplant (fragment)
          Length = 467

 Score =  193 bits (490), Expect = 4e-48
 Identities = 97/177 (54%), Positives = 134/177 (75%), Gaps = 4/177 (2%)
 Frame = +1

Query: 301 GNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGS-VSTMAILSAKAAAELFKNHDVSFADRT 474
           GNM DL G+ P++ IA +K KYG ++WL+IGS ++TM I +A +A+ELF+NHDVSF+DR 
Sbjct: 2   GNMFDLAGSAPYKKIACLKEKYGPILWLKIGSSMNTMVIQTANSASELFRNHDVSFSDRP 61

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDML-LWI 651
           ++DV     YY GS+A APYG+YWR  RRICTVE+FVHKRINET  +R++ +D ML L  
Sbjct: 62  IVDVNLAHNYYKGSMALAPYGNYWRFSRRICTVEMFVHKRINETTNIRQESVDKMLRLDE 121

Query: 652 EKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLV-DPMSDKASKFFDAMTGIMQ 819
           EK +SS   G G+ V  ++FL++FN++GN+  S+DLV DP S + S+FF+AM GIM+
Sbjct: 122 EKASSSGGGGEGIEVTRYMFLASFNMVGNMIFSKDLVTDPESKQGSEFFNAMIGIME 178



>sp|P37121|C761_SOLME Cytochrome P450 76A1 (EC 1.14.-.-)
           (CYPLXXVIA1) (P-450EG8) (Fragment).>gb:SMCYPEG8_1715491
           S.melongena CYP76A1 mRNA.
          Length = 467

 Score =  193 bits (490), Expect = 4e-48
 Identities = 97/177 (54%), Positives = 134/177 (75%), Gaps = 4/177 (2%)
 Frame = +1

Query: 301 GNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGS-VSTMAILSAKAAAELFKNHDVSFADRT 474
           GNM DL G+ P++ IA +K KYG ++WL+IGS ++TM I +A +A+ELF+NHDVSF+DR 
Sbjct: 2   GNMFDLAGSAPYKKIACLKEKYGPILWLKIGSSMNTMVIQTANSASELFRNHDVSFSDRP 61

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDML-LWI 651
           ++DV     YY GS+A APYG+YWR  RRICTVE+FVHKRINET  +R++ +D ML L  
Sbjct: 62  IVDVNLAHNYYKGSMALAPYGNYWRFSRRICTVEMFVHKRINETTNIRQESVDKMLRLDE 121

Query: 652 EKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLV-DPMSDKASKFFDAMTGIMQ 819
           EK +SS   G G+ V  ++FL++FN++GN+  S+DLV DP S + S+FF+AM GIM+
Sbjct: 122 EKASSSGGGGEGIEVTRYMFLASFNMVGNMIFSKDLVTDPESKQGSEFFNAMIGIME 178



>gb:AK118051_1816051 Arabidopsis thaliana At3g52970 mRNA for
           putative cytochrome P450, complete cds, clone:
           RAFL19-29-L10.
          Length = 516

 Score =  141 bits (356), Expect = 1e-32
 Identities = 73/169 (43%), Positives = 108/169 (63%), Gaps = 2/169 (1%)
 Frame = +1

Query: 295 VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR 471
           VIGN+  L G  PH ++ ++  ++G ++ LRIGS+ T+ I S++ A E+FK HD + A R
Sbjct: 45  VIGNIFQLAGLPPHDSLTKLSRRHGPIMTLRIGSMLTVVISSSEVAREIFKKHDAALAGR 104

Query: 472 TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
            + + MK      GSL  A YG+YWR+LRR+CT + FV +R++    VR +C+D ML ++
Sbjct: 105 EIYEAMKGGKSSDGSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSDVRSRCVDQMLRFV 164

Query: 652 EKEASSVQRGT-GVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFF 795
           E+     Q GT  + V  + FL  FNL+GNL  SRDL+DP S + S+FF
Sbjct: 165 EEGG---QNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGSEFF 210



>pir|T47554|T47554 cytochrome P450 homolog F8J2.140 [similarity] -
           Arabidopsis thaliana>gb:ATF8J2_1551204 Arabidopsis
           thaliana DNA chromosome 3, BAC clone F8J2.
          Length = 512

 Score =  141 bits (356), Expect = 1e-32
 Identities = 73/169 (43%), Positives = 108/169 (63%), Gaps = 2/169 (1%)
 Frame = +1

Query: 295 VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR 471
           VIGN+  L G  PH ++ ++  ++G ++ LRIGS+ T+ I S++ A E+FK HD + A R
Sbjct: 45  VIGNIFQLAGLPPHDSLTKLSRRHGPIMTLRIGSMLTVVISSSEVAREIFKKHDAALAGR 104

Query: 472 TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
            + + MK      GSL  A YG+YWR+LRR+CT + FV +R++    VR +C+D ML ++
Sbjct: 105 KIYEAMKGGKSSDGSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSDVRSRCVDQMLRFV 164

Query: 652 EKEASSVQRGT-GVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFF 795
           E+     Q GT  + V  + FL  FNL+GNL  SRDL+DP S + S+FF
Sbjct: 165 EEGG---QNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGSEFF 210



>gb:VVI237995_1727512 Vitis vinifera mRNA for putative
           ripening-related P-450 enzyme (gfh2 gene).
          Length = 499

 Score =  120 bits (302), Expect = 2e-26
 Identities = 62/208 (29%), Positives = 119/208 (57%)
 Frame = +1

Query: 196 WSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVI 375
           W++I+++    F   R +  ++++         +IG++L+LG  PH+++A +   YG ++
Sbjct: 14  WTSIYIM----FSARRGRKHAAHKLPPGPVPLPIIGSLLNLGNRPHESLANLAKTYGPIM 69

Query: 376 WLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL 555
            L++G V+T+ I SA  A E+ +  D+SF +R++ D ++   +   S+A+ P  + WR L
Sbjct: 70  TLKLGYVTTIVISSAPMAKEVLQKQDLSFCNRSIPDAIRAAKHNQLSMAWIPVSTTWRAL 129

Query: 556 RRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLG 735
           RR C   LF  ++++    +R + + ++L  +E+   S Q G  V +    F ++ NLL 
Sbjct: 130 RRTCNSHLFTSQKLDSNTHLRHQKVQELLANVEQ---SCQAGGPVDIGQEAFRTSLNLLS 186

Query: 736 NLFLSRDLVDPMSDKASKFFDAMTGIMQ 819
           N   S DLVDP+S+ A +F + + G+M+
Sbjct: 187 NTIFSVDLVDPISETAQEFKELVRGVME 214



>sp|O23976|C76B_HELTU Cytochrome P450 76B1 (EC 1.14.-.-)
           (7-ethoxycoumarin O-deethylase) (ECOD) (Phenylurea
           dealkylase).>pir|T10773|T10773 cytochrome P450 (EC
           1.14.-.-) 76B1 - Jerusalem
           artichoke>gb:HT7EC0DET_1682160 Helianthus tuberosus mRNA
           for 7-ethoxycoumarin O-deethylase.
          Length = 490

 Score =  113 bits (283), Expect = 4e-24
 Identities = 57/174 (32%), Positives = 99/174 (56%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  LGA PHQ++A++   +G ++ L++G ++T+ I SA AA E+ K  D++F+ R 
Sbjct: 37  IIGNLHLLGALPHQSLAKLAKIHGPIMSLQLGQITTLVISSATAAEEVLKKQDLAFSTRN 96

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
           V D ++   +   S++F    + WR LRRI +  +F +  +     +R K +++++ +  
Sbjct: 97  VPDAVRAYNHERHSISFLHVCTEWRTLRRIVSSNIFSNSSLEAKQHLRSKKVEELIAYCR 156

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM 816
           K A S      VH+    F ++ NLL N   S+DL DP  D   +F + +T IM
Sbjct: 157 KAALS---NENVHIGRAAFRTSLNLLSNTIFSKDLTDPYEDSGKEFREVITNIM 207



>gb:HTCYP76B1_1682162 H.tuberosus mRNA for 7-ethoxycoumarin
           O-deethylase.
          Length = 477

 Score =  111 bits (278), Expect = 1e-23
 Identities = 59/176 (33%), Positives = 101/176 (57%), Gaps = 2/176 (1%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  LGA PHQ++A++   +G ++ L++G ++T+ I SA AA E+ K  D++F+ R 
Sbjct: 22  IIGNLHLLGALPHQSLAKLAKIHGPIMSLQLGQITTLVISSATAAEEVLKKQDLAFSTRN 81

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
           V D ++   +   S++F    + WR LRRI +  +F +  +     +R K +++++ +  
Sbjct: 82  VPDAVRAYNHERHSISFLHVCTEWRTLRRIVSSNIFSNSSLEAKQHLRSKKVEELIAYCR 141

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKAS--KFFDAMTGIM 816
           K A S      VH+    F ++ NLL N   S+DL DP  D AS  +F + +T IM
Sbjct: 142 KAALS---NENVHIGRAAFRTSLNLLSNTIFSKDLTDPYEDSASGKEFREVITNIM 194



>pir|T10895|T10895 cytochrome P450 76B1, xenobiotic-inducible -
           Jerusalem artichoke (fragment)
          Length = 477

 Score =  111 bits (278), Expect = 1e-23
 Identities = 59/176 (33%), Positives = 101/176 (57%), Gaps = 2/176 (1%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  LGA PHQ++A++   +G ++ L++G ++T+ I SA AA E+ K  D++F+ R 
Sbjct: 22  IIGNLHLLGALPHQSLAKLAKIHGPIMSLQLGQITTLVISSATAAEEVLKKQDLAFSTRN 81

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
           V D ++   +   S++F    + WR LRRI +  +F +  +     +R K +++++ +  
Sbjct: 82  VPDAVRAYNHERHSISFLHVCTEWRTLRRIVSSNIFSNSSLEAKQHLRSKKVEELIAYCR 141

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKAS--KFFDAMTGIM 816
           K A S      VH+    F ++ NLL N   S+DL DP  D AS  +F + +T IM
Sbjct: 142 KAALS---NENVHIGRAAFRTSLNLLSNTIFSKDLTDPYEDSASGKEFREVITNIM 194



>gb:AY596977_1617028 Hypericum androsaemum cytochrome P450 mRNA,
           complete cds.
          Length = 498

 Score =  110 bits (276), Expect = 2e-23
 Identities = 60/209 (28%), Positives = 112/209 (53%)
 Frame = +1

Query: 190 LVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGS 369
           L++ A +L+   V L  R K++ S +         +IGN+L L   PH+++A++   +G 
Sbjct: 11  LLFVATYLLVNHVILRGRSKNNGSTKLPPGPRPLPIIGNLLALRDKPHKSLAKLARVHGP 70

Query: 370 VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR 549
           ++ L++G V+T+ + S   A E+ + HD + ++R +ID ++ QG++   LA+ P G  WR
Sbjct: 71  LVTLKLGQVTTVVVSSPATAREILQKHDATLSNRYIIDAIRAQGHHEAGLAWVPVGPTWR 130

Query: 550 VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNL 729
             R++C   +F ++++N +  VR++ I  +L    +   S + G  + V    F +  + 
Sbjct: 131 KFRKVCYSHIFTNQKLNSSQHVRQRTIQQLL---AEARESCRVGEAMDVGKAAFRAALSS 187

Query: 730 LGNLFLSRDLVDPMSDKASKFFDAMTGIM 816
           L    +S DL D  SD A +F +    IM
Sbjct: 188 LSISVMSLDLADAASDTAREFKELARCIM 216



>gb:CRO251269_1673471 Catharanthus roseus mRNA for geraniol
           10-hydroxylase (g10h gene).
          Length = 493

 Score =  106 bits (264), Expect = 6e-22
 Identities = 53/173 (30%), Positives = 98/173 (56%)
 Frame = +1

Query: 298 IGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTV 477
           IG++  LG  PH+++A++  K+G ++ L++G ++T+ I S+  A E+ +  D++F+ R+V
Sbjct: 40  IGSLHLLGDQPHKSLAKLSKKHGPIMSLKLGQITTIVISSSTMAKEVLQKQDLAFSSRSV 99

Query: 478 IDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEK 657
            + +     +  S+ + P  S WR LR++    +F   R++    +R + + +++ +  K
Sbjct: 100 PNALHAHNQFKFSVVWLPVASRWRSLRKVLNSNIFSGNRLDANQHLRTRKVQELIAYCRK 159

Query: 658 EASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM 816
            +   Q G  V V    F ++ NLL NL  S+DL DP SD A +F D +  IM
Sbjct: 160 NS---QSGEAVDVGRAAFRTSLNLLSNLIFSKDLTDPYSDSAKEFKDLVWNIM 209



>gb:AY532372_1612055 Ammi majus cytochrome P450 (CYP76B8) mRNA,
           complete cds.
          Length = 497

 Score =  105 bits (263), Expect = 8e-22
 Identities = 53/174 (30%), Positives = 98/174 (56%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+ +LG  PH+++A++   YG ++ L++G V+T+ I S+  A ++F+    +F+ R 
Sbjct: 39  IIGNLTNLGKLPHRSLAKLSQNYGPIMHLQLGRVTTIVISSSAIAQQVFQKKGRAFSRRF 98

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
           + D +    + + S  + P G  WR LR+I    LF   +++    +R + +++++ +++
Sbjct: 99  IPDSLCACDHSLYSFVWLPIGPQWRNLRKISNSNLFSANKLDANQHLRGRKVNELIAYVQ 158

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM 816
           K     Q G  V +    F ++FNLL N   S+D+VDP  D A +F D    IM
Sbjct: 159 K---CSQTGDAVDIGRAAFRTSFNLLSNTVFSKDMVDPYQDSAQEFKDLAWNIM 209



>gb:AB016062_1512755 Petunia x hybrida IMT-7 mRNA for cytochrome
           P450, complete cds.
          Length = 532

 Score =  104 bits (260), Expect = 2e-21
 Identities = 62/209 (29%), Positives = 109/209 (52%)
 Frame = +1

Query: 190 LVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGS 369
           L + +IF   GL+++LA+  S  + +         +IGN+  LGA PH ++A++   YG 
Sbjct: 6   LAFGSIFAC-GLLYILAKIISKGNKKLPPGPTPWPIIGNLHLLGAKPHISLAQLAQIYGP 64

Query: 370 VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR 549
           ++ L++G V+T+ I S+  A ++ K  D++F+ R V D ++   +   S+ + P    WR
Sbjct: 65  IMSLKLGQVTTVVISSSAMAKQVLKYQDLAFSTRFVPDALQTHNHNKFSVVWLPVSPQWR 124

Query: 550 VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNL 729
            LRRI    +    R++    +R + + ++L +    A+  Q    V V   VF +  NL
Sbjct: 125 TLRRILNTNILSSNRLDSNQHLRSQKLKELLAYC---ATCSQEAKVVDVGQAVFKTNLNL 181

Query: 730 LGNLFLSRDLVDPMSDKASKFFDAMTGIM 816
           L N   S+DL DP SD   +  D + G++
Sbjct: 182 LSNTLFSKDLADPFSDSKVELKDVIWGVI 210



>gb:AX028842_1457182 Sequence 26 from Patent WO9732023.
          Length = 496

 Score =  103 bits (258), Expect = 3e-21
 Identities = 61/203 (30%), Positives = 112/203 (55%)
 Frame = +1

Query: 208 FLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRI 387
           FL+ GL+ L  RK S    +         +IGN+  LG  PH+++A++   +G ++ L++
Sbjct: 15  FLVNGLMSLRRRKISK---KLPPGPFPLPIIGNLHLLGNHPHKSLAQLAKIHGPIMNLKL 71

Query: 388 GSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRIC 567
           G ++T+ I S+  A E+ +  D++F++R V DV+ V+ +   S+ + P  S W+ LR+I 
Sbjct: 72  GQLNTVVISSSVVAREVLQKQDLTFSNRFVPDVVHVRNHSDFSVVWLPVNSRWKTLRKIM 131

Query: 568 TVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFL 747
              +F   +++    +R K + +++ + +K A   + G  V +    F +T NLL N   
Sbjct: 132 NSSIFSGNKLDGNQHLRSKKVQELIDYCQKCA---KNGEAVDIGRATFGTTLNLLSNTIF 188

Query: 748 SRDLVDPMSDKASKFFDAMTGIM 816
           S+DL +P SD A +F + +  IM
Sbjct: 189 SKDLTNPFSDSAKEFKELVWNIM 211



>gb:AF479661_1803546 Pastinaca sativa cytochrome P450 (CYP76B7)
           mRNA, CYP76B7-v1 allele, complete cds.
          Length = 496

 Score = 99.8 bits (247), Expect = 6e-20
 Identities = 50/175 (28%), Positives = 99/175 (56%), Gaps = 1/175 (0%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  LG  PH+++A +   YG ++ L++G ++T+ I S+  A ++ +  D++F++R 
Sbjct: 36  IIGNIHKLGKHPHKSLANLAQVYGPIMRLKLGHMTTVVISSSTTARQVLRKQDIAFSNRA 95

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
           + + ++   +   S  + P GS WR LR+I ++ LF   +++    +R + + D++ + E
Sbjct: 96  LPNAVRALDHNKYSAVWLPVGSQWRGLRKIMSMNLFTANKLDANQHLRSQKVHDLIRYCE 155

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFF-DAMTGIM 816
           K     Q G  V +    FL++ NL+ N   S+D++D   +  +K F D +  IM
Sbjct: 156 K---CSQSGEAVDIGGAAFLTSLNLMSNTIFSKDMIDSYENSEAKVFRDLVWNIM 207



>gb:STU296346_1723032 Solanum tuberosum mRNA for cytochrome P450
           (CYP71D4 gene).
          Length = 502

 Score = 99.4 bits (246), Expect = 7e-20
 Identities = 59/199 (29%), Positives = 104/199 (52%), Gaps = 8/199 (4%)
 Frame = +1

Query: 184 KYLVWSAIFLIPGLVFLLARKKSSSSY--RXXXXXXXXXVIGNMLDL-GAFPHQTIAEMK 354
           ++L  ++IFL    +FLL + K+S+S   +         ++G+ML + G  PH  + ++ 
Sbjct: 2   QFLSLASIFLFLSFLFLLRKWKNSNSQSKKLPPGPWKLPLLGSMLHMAGGLPHHVLRDLA 61

Query: 355 NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPY 534
            KYG ++ L++G VS + + S   A E+ K HD++FA R  +   ++  Y    +AF PY
Sbjct: 62  KKYGPLMHLQLGEVSAVVVTSPDMAKEVLKTHDIAFASRPKLLAPEIVCYNRSDIAFCPY 121

Query: 535 GSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFL 714
           G YWR +R+IC +EL   K +     +RR  +D ++ +I   +     G  V+    +FL
Sbjct: 122 GDYWRQMRKICVLELLSAKNVRSYGSIRRDEVDRLVNFIRSSS-----GEPVNFTERLFL 176

Query: 715 STFNL-----LGNLFLSRD 756
            T ++      G +F  +D
Sbjct: 177 FTSSMTCRSAFGKVFKEQD 195



>gb:OSJN00136_1695482 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0027O01, complete
           sequence.>gb:OSJN00137_1695517 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0052P16, complete
           sequence.
          Length = 507

 Score = 97.4 bits (241), Expect = 3e-19
 Identities = 60/164 (36%), Positives = 90/164 (54%), Gaps = 2/164 (1%)
 Frame = +1

Query: 202 AIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVIWL 381
           ++  +P L+ LL RK SS   R         V G +  L + P   + E+ +KYG V++L
Sbjct: 13  SLLTLPILLALLTRKSSSKKRRPPGPWNLPLVGGLLHLLRSHPQVALRELASKYGPVMFL 72

Query: 382 RIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRR 561
           R+G + T+ + S  AA E+ ++ DV FA R  + V ++  Y    + FAPYG+YWR+LR+
Sbjct: 73  RMGQIDTVVVSSPAAAQEVLRDKDVMFASRPSLLVSEIFCYDNLDVGFAPYGAYWRMLRK 132

Query: 562 ICTVELFVHKRINETVPVRRKCIDDMLLWIE--KEASSVQRGTG 687
           +CTVEL   K + +  PVR    D+ L  +   K ASS   G G
Sbjct: 133 LCTVELLSTKVVRQLAPVRN---DETLTLVRNIKAASSGHGGGG 173



>sp|Q9LIP4|C72X_ARATH Cytochrome P450 71B36 (EC
           1.14.-.-).>gb:AP001298_1820968 Arabidopsis thaliana
           genomic DNA, chromosome 3, BAC clone:F20C19.
          Length = 500

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 53/170 (31%), Positives = 87/170 (51%)
 Frame = +1

Query: 190 LVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGS 369
           L  S +FL   L+     KK     R         +IGN+  LG  PHQ++  +  KYG 
Sbjct: 5   LFLSLLFLSCILLAAFTHKKRQQHQRKPPSPPGFPIIGNLHQLGELPHQSLWRLSKKYGH 64

Query: 370 VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR 549
           V+ L+ GS+ T+ + S++ A ++ K HD+    R  +   +   Y    +AF+P+  YW+
Sbjct: 65  VMLLKFGSIPTVVVSSSETAKQVLKIHDLHCCSRPSLAGPRALSYNYLDIAFSPFDDYWK 124

Query: 550 VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVA 699
            LRRIC  ELF  KR+    P++    D++   I+  + S  +GT V+++
Sbjct: 125 ELRRICVQELFSVKRVQSFQPIKE---DEVKKLIDSVSESASQGTPVNLS 171



>gb:AF368377_1791920 Nicotiana tabacum elicitor-inducible cytochrome
           P450 (CYP71D21) mRNA, complete cds.
          Length = 473

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 53/159 (33%), Positives = 86/159 (54%), Gaps = 3/159 (1%)
 Frame = +1

Query: 202 AIFLIPGLVFLLARKKSSSSYRXXXXXX--XXXVIGNMLD-LGAFPHQTIAEMKNKYGSV 372
           +IFL    +FLL + K+S+S             ++G+ML  LG  PH  + ++  KYG +
Sbjct: 8   SIFLFLSFLFLLRKCKNSNSQTKQLPPGPWKIPILGSMLHMLGGEPHHILRDLAKKYGPI 67

Query: 373 IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRV 552
           + L+ G +S + + S + A E+ K HDV FA R  I  M +  Y    +AF+PYG +WR 
Sbjct: 68  MHLQFGEISAVVVTSREMAKEVLKTHDVVFASRPKIVAMDIICYNQSDIAFSPYGDHWRQ 127

Query: 553 LRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS 669
           +R+IC +EL   K +     +RR  +  ++  I  ++SS
Sbjct: 128 MRKICVMELLNAKNVRSFSSIRRDEVVRLIDSIRSDSSS 166



>pir|T52256|T52256 cytochrome P-450LXXIA1 [similarity] -
           avocado>gb:AVOCYP_1557688 Avocado cytochrome P-450LXXIA1
           (cyp71A1) mRNA, complete cds.
          Length = 502

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 57/205 (27%), Positives = 102/205 (49%), Gaps = 2/205 (0%)
 Frame = +1

Query: 199 SAIFLIPGLVFLLAR--KKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSV 372
           S +FL   L F L +  +K               +IGN+  LG  PH+++  + N+ G +
Sbjct: 6   SLLFLAIALTFFLLKLNEKREKKPNLPPSPPNLPIIGNLHQLGNLPHRSLRSLANELGPL 65

Query: 373 IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRV 552
           I L +G + T+ + +A+ A E+ K HD+ FA R      +   Y    +AF+PYG YWR 
Sbjct: 66  ILLHLGHIPTLIVSTAEIAEEILKTHDLIFASRPSTTAARRIFYDCTDVAFSPYGEYWRQ 125

Query: 553 LRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLL 732
           +R+IC +EL   KR+N    +R    +++ L +E+ + S   G  V+++  + L +   +
Sbjct: 126 VRKICVLELLSIKRVNSYRSIRE---EEVGLMMERISQSCSTGEAVNLSELLLLLSSGTI 182

Query: 733 GNLFLSRDLVDPMSDKASKFFDAMT 807
             +   +   +   ++ +KF D  T
Sbjct: 183 TRVAFGKK-YEGEEERKNKFADLAT 206



>sp|P24465|CP71_PERAE Cytochrome P450 71A1 (EC 1.14.-.-) (CYPLXXIA1)
           (ARP-2).>pir|A35867|A35867 cytochrome P450 71A1 -
           avocado
          Length = 471

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 57/205 (27%), Positives = 102/205 (49%), Gaps = 2/205 (0%)
 Frame = +1

Query: 199 SAIFLIPGLVFLLAR--KKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSV 372
           S +FL   L F L +  +K               +IGN+  LG  PH+++  + N+ G +
Sbjct: 6   SLLFLAIALTFFLLKLNEKREKKPNLPPSPPNLPIIGNLHQLGNLPHRSLRSLANELGPL 65

Query: 373 IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRV 552
           I L +G + T+ + +A+ A E+ K HD+ FA R      +   Y    +AF+PYG YWR 
Sbjct: 66  ILLHLGHIPTLIVSTAEIAEEILKTHDLIFASRPSTTAARRIFYDCTDVAFSPYGEYWRQ 125

Query: 553 LRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLL 732
           +R+IC +EL   KR+N    +R    +++ L +E+ + S   G  V+++  + L +   +
Sbjct: 126 VRKICVLELLSIKRVNSYRSIRE---EEVGLMMERISQSCSTGEAVNLSELLLLLSSGTI 182

Query: 733 GNLFLSRDLVDPMSDKASKFFDAMT 807
             +   +   +   ++ +KF D  T
Sbjct: 183 TRVAFGKK-YEGEEERKNKFADLAT 206



>sp|O81971|C7D9_SOYBN Cytochrome P450 71D9 (EC 1.14.-.-) (P450
           CP3).>pir|T07117|T07117 probable cytochrome P450 CP3 -
           soybean>gb:GMC450CP3_1680414 G.max mRNA for putative
           cytochrome P450, clone CP3.
          Length = 496

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 55/178 (30%), Positives = 93/178 (52%), Gaps = 2/178 (1%)
 Frame = +1

Query: 202 AIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDL--GAFPHQTIAEMKNKYGSVI 375
           +IF+   +   +  KKS+S+           +IGNM +L     PH  + ++  KYGS++
Sbjct: 13  SIFIFMFMTHKIVTKKSNSTPSLPPGPWKLPIIGNMHNLVGSPLPHHRLRDLSAKYGSLM 72

Query: 376 WLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL 555
            L++G VST+ + S + A E+ K HD  FA R  +   ++  Y    +AF PYG YWR L
Sbjct: 73  HLKLGEVSTIVVSSPEYAKEVMKTHDHIFASRPYVLAAEIMDYDFKGVAFTPYGDYWRQL 132

Query: 556 RRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNL 729
           R+I  +EL   KR+    P+R + +   +    K  ++++ G+ V+V   V  + F +
Sbjct: 133 RKIFALELLSSKRVQSFQPIREEVLTSFI----KRMATIE-GSQVNVTKEVISTVFTI 185



>gb:AX028830_1457176 Sequence 14 from Patent WO9732023.
          Length = 513

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 53/153 (34%), Positives = 81/153 (52%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           V+GN+  LG FPH +IAE+  K+G ++ LR+G V  +   SA  AA+  K HD +F+ R 
Sbjct: 40  VVGNLPHLGPFPHHSIAELAKKHGPLMHLRLGYVDVVVAASASVAAQFLKTHDANFSSRP 99

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                K   Y    L F PYG  WR+ R+I +V LF  K +++   VR++ +  +   + 
Sbjct: 100 PNSGAKHLAYNYQDLVFRPYGPRWRMFRKISSVHLFSGKALDDLKHVRQEEVSVLAHALA 159

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSR 753
              S V     V++A  + L T N LG + + R
Sbjct: 160 NSGSKV-----VNLAQLLNLCTVNALGRVMVGR 187



>gb:OSJN00145_1190851 Oryza sativa (japonica cultivar-group)
           chromosome 4 clone OSJNBa0096F01, *** SEQUENCING IN
           PROGRESS ***, 2 ordered pieces.
          Length = 501

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 52/139 (37%), Positives = 79/139 (56%)
 Frame = +1

Query: 202 AIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVIWL 381
           ++  +P L+ LL RK SS   R         V G +  L + P   + ++  KYG V++L
Sbjct: 13  SVVTLPILLALLTRKSSSKKRRPPGPWNLPLVGGLLHLLRSQPQVALRDLAGKYGPVMFL 72

Query: 382 RIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRR 561
           R G V T+ I S  AA E+ ++ DV+FA R  + V ++  Y    + FAPYG+YWR+LR+
Sbjct: 73  RTGQVDTVVISSPAAAQEVLRDKDVTFASRPSLLVSEIFCYGNLDIGFAPYGAYWRMLRK 132

Query: 562 ICTVELFVHKRINETVPVR 618
           +CTVEL   K + +  P+R
Sbjct: 133 LCTVELLSTKMVRQLAPIR 151



>gb:AF368376_1791919 Nicotiana tabacum elicitor-inducible cytochrome
           P450 (CYP71D20) mRNA, complete cds.
          Length = 473

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 52/159 (32%), Positives = 87/159 (54%), Gaps = 3/159 (1%)
 Frame = +1

Query: 202 AIFLIPGLVFLLARKKSSSSY--RXXXXXXXXXVIGNMLDL-GAFPHQTIAEMKNKYGSV 372
           +IFL    +FLL + K+S+S   +         ++G+ML + G  PH  + ++  KYG +
Sbjct: 8   SIFLFLAFLFLLRKWKNSNSQSKKLPPGPWKIPILGSMLHMIGGEPHHVLRDLAKKYGPL 67

Query: 373 IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRV 552
           + L++G +S + + S   A E+ K HDV FA R  I  M +  Y    +AF+PYG +WR 
Sbjct: 68  MHLQLGEISAVVVTSRDMAKEVLKTHDVVFASRPKIVAMDIICYNQSDIAFSPYGDHWRQ 127

Query: 553 LRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS 669
           +R+IC +EL   K +     +RR  +  ++  I  ++SS
Sbjct: 128 MRKICVMELLNAKNVRSFSSIRRDEVVRLIDSIRSDSSS 166



>pir|T07960|T07960 probable (S)-N-methylcoclaurine 3'-hydroxylase
           (EC 1.1.3.-) - California poppy (fragment)
          Length = 487

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 46/157 (29%), Positives = 85/157 (54%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+L LG  PH   AE+   YG +  L++G+ + +   ++ AA+E+ K HD   + R 
Sbjct: 37  IVGNLLQLGEKPHAQFAELAQTYGDIFTLKMGTETVVVASTSSAASEILKTHDRILSARY 96

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
           V    +V+G+   S+ ++     W+ LR++C  ELF  K I     VR K  ++M+ ++ 
Sbjct: 97  VFQSFRVKGHVENSIVWSDCTETWKNLRKVCRTELFTQKMIESQAHVREKKCEEMVEYLM 156

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVD 765
           K     ++G  V +   +F +  N+ GNL  S+++ +
Sbjct: 157 K-----KQGEEVKIVEVIFGTLVNIFGNLIFSQNIFE 188



>sp|O64900|C8B2_ESCCA (S)-N-methylcoclaurine 3'-hydroxylase isozyme
           2 (EC 1.14.13.71) (Cytochrome P450
           80B2).>pir|T07963|T07963 probable (S)-N-methylcoclaurine
           3'-hydroxylase (EC 1.1.3.-) B1 - California
           poppy>gb:AF014801_1761356 Eschscholzia californica
           (S)-N-methylcoclaurine 3'-hydroxylase (CYP80B1) mRNA,
           complete cds.
          Length = 488

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 46/157 (29%), Positives = 85/157 (54%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+L LG  PH   AE+   YG +  L++G+ + +   ++ AA+E+ K HD   + R 
Sbjct: 38  IVGNLLQLGEKPHAQFAELAQTYGDIFTLKMGTETVVVASTSSAASEILKTHDRILSARY 97

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
           V    +V+G+   S+ ++     W+ LR++C  ELF  K I     VR K  ++M+ ++ 
Sbjct: 98  VFQSFRVKGHVENSIVWSDCTETWKNLRKVCRTELFTQKMIESQAHVREKKCEEMVEYLM 157

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVD 765
           K     ++G  V +   +F +  N+ GNL  S+++ +
Sbjct: 158 K-----KQGEEVKIVEVIFGTLVNIFGNLIFSQNIFE 189



>sp|O64899|C8B1_ESCCA (S)-N-methylcoclaurine 3'-hydroxylase isozyme
           1 (EC 1.14.13.71) (Cytochrome P450 80B1)
           (Fragment).>gb:AF014800_1761355 Eschscholzia californica
           (S)-N-methylcoclaurine 3'-hydroxylase (CYP80B1) mRNA,
           partial cds.
          Length = 487

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 46/157 (29%), Positives = 85/157 (54%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+L LG  PH   AE+   YG +  L++G+ + +   ++ AA+E+ K HD   + R 
Sbjct: 37  IVGNLLQLGEKPHAQFAELAQTYGDIFTLKMGTETVVVASTSSAASEILKTHDRILSARY 96

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
           V    +V+G+   S+ ++     W+ LR++C  ELF  K I     VR K  ++M+ ++ 
Sbjct: 97  VFQSFRVKGHVENSIVWSDCTETWKNLRKVCRTELFTQKMIESQAHVREKKCEEMVEYLM 156

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVD 765
           K     ++G  V +   +F +  N+ GNL  S+++ +
Sbjct: 157 K-----KQGEEVKIVEVIFGTLVNIFGNLIFSQNIFE 188



>gb:AF313491_1785224 Matthiola incana flavonoid 3'-hydroxylase mRNA,
           complete cds.
          Length = 513

 Score = 93.6 bits (231), Expect = 4e-18
 Identities = 60/198 (30%), Positives = 95/198 (47%), Gaps = 1/198 (0%)
 Frame = +1

Query: 226 VFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTM 405
           +F L R+  + ++R         ++GN+  +G  PHQT+A M   YG ++ LR+G V+ +
Sbjct: 18  IFFLLRRNRNRNHRLPPGPNPWPIVGNLPHMGPKPHQTLAAMVTTYGPILHLRLGFVNVV 77

Query: 406 AILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFV 585
              S   A +  K HD +FA R      K   Y    L FAPYG  WR+LR+I +V LF 
Sbjct: 78  VAASKSVAEQFLKIHDANFASRPPNSGAKHIAYNYQDLVFAPYGQRWRMLRKISSVHLFS 137

Query: 586 HKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLV- 762
            K + +   VR++ I  +   + +  +       V++   V +   N LG   + R L  
Sbjct: 138 AKALEDFKHVRQEEIGRLTREVARADTK-----PVNLGQLVNMCVVNALGREMIGRRLFG 192

Query: 763 DPMSDKASKFFDAMTGIM 816
           D    KA +F   +T +M
Sbjct: 193 DGADHKAEEFRSMVTEMM 210



>sp|O04164|C716_NEPRA Cytochrome P450 71A6 (EC 1.14.-.-)
           (Fragment).>gb:NRCYP71A6_1691151 N.racemosa mRNA for
           cytochrome P450, CYP71A6, partial.
          Length = 511

 Score = 93.6 bits (231), Expect = 4e-18
 Identities = 48/137 (35%), Positives = 76/137 (55%)
 Frame = +1

Query: 214 IPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGS 393
           +P L FL   ++S S            V+GN+  LG FPH+++  +  +YG V+ L  GS
Sbjct: 9   LPFLFFLKKWRRSYSGKTPPPSPPKLPVLGNLHQLGTFPHRSLQSLSRRYGPVMQLHFGS 68

Query: 394 VSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTV 573
           V  +   S +AA E+ KN D++F++R  + + +   Y    +AFAPYG YWR +R IC +
Sbjct: 69  VPVLVASSPEAAREIMKNQDLNFSNRPNLSIPRRLLYDNHDVAFAPYGEYWRQIRSICVL 128

Query: 574 ELFVHKRINETVPVRRK 624
           +L  +KR+     VR +
Sbjct: 129 QLLSNKRVQSFRRVREE 145



>gb:AF313488_1785221 Callistephus chinensis putative flavonoid
           3'-hydroxylase mRNA, complete cds.
          Length = 518

 Score = 93.2 bits (230), Expect = 5e-18
 Identities = 61/185 (32%), Positives = 94/185 (50%), Gaps = 10/185 (5%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+  LG  PH ++A +  KYG ++ LR+G V  +   SA  AA+  K HD +FA R 
Sbjct: 40  IVGNLPHLGMIPHHSLAALAQKYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFASRP 99

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDML-LWI 651
                K   Y    L FAPYG  WR+LR+IC+V LF  K +++   VR + +  +  + +
Sbjct: 100 PNSGAKHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSTKALDDFRHVREEEVAILTRVLV 159

Query: 652 EKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDL---------VDPMSDKASKFFDAM 804
               S+V+ G  ++V       T N L  + L R +         VDP   KA +F D +
Sbjct: 160 HAGESAVKLGQLLNVC------TTNALARVMLGRRVFADGSEGRGVDP---KADEFKDMV 210

Query: 805 TGIMQ 819
             +M+
Sbjct: 211 VELME 215



>gb:AF166332_1774015 Nicotiana tabacum cytochrome P450 gene,
           complete cds.
          Length = 499

 Score = 93.2 bits (230), Expect = 5e-18
 Identities = 49/150 (32%), Positives = 84/150 (56%), Gaps = 3/150 (2%)
 Frame = +1

Query: 202 AIFLIPGLVFLLARKKSSSSY--RXXXXXXXXXVIGNMLD-LGAFPHQTIAEMKNKYGSV 372
           ++FL    +FL  + K+S+S   R         ++G+ML  LG  PH  + ++  KYG +
Sbjct: 8   SLFLFVSFLFLFKKWKNSNSQTKRLPPGPWKLPILGSMLHMLGGLPHHVLRDLAKKYGPI 67

Query: 373 IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRV 552
           + L++G VS + I S   A E+ K HD++FA+R ++   K+  Y    +A +PYG+YWR 
Sbjct: 68  MHLQLGEVSLVVISSPGMAKEVLKTHDLAFANRPLLVAAKIFSYNCMDIALSPYGNYWRQ 127

Query: 553 LRRICTVELFVHKRINETVPVRRKCIDDML 642
           +R+IC +EL   K +     +R+  +  M+
Sbjct: 128 MRKICLLELLSAKNVKSFNSIRQDEVHRMI 157



>gb:AE016959_1021094 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC078944_1541633
           Genomic Sequence for Oryza sativa, Nipponbare strain,
           clone OSJNBa0089D15, from Chromosome 10, complete
           sequence.>gb:AE017061_1750913 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 15 of 77 of the
           complete sequence.
          Length = 501

 Score = 93.2 bits (230), Expect = 5e-18
 Identities = 67/217 (30%), Positives = 109/217 (50%), Gaps = 2/217 (0%)
 Frame = +1

Query: 175 WEWKYLVWSAIFLIP-GLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEM 351
           W   +L+W  +FLI   LV +LA     S  R          IG++  LG  PH+++A +
Sbjct: 4   WILGWLLWLPVFLISLYLVDILAH----SCRRLPPGPRPLPFIGSLHLLGDQPHRSLAGL 59

Query: 352 KNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAP 531
             KYG ++ LR+G+V+T+ + S + A E  + HD  FADR++ D   +  +   S+ +  
Sbjct: 60  AKKYGPLMSLRLGAVTTVVVSSPEVAREFVQKHDAVFADRSIPD--SIGDHTKNSVIWLN 117

Query: 532 YGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVF 711
            G  WR LRRI   ELF   +++    +R++ + ++   ++  A   + G  V V    F
Sbjct: 118 PGPRWRALRRIMATELFSPHQLDALQQLRQEKVAEL---VDHVARLAREGAAVDVGRVAF 174

Query: 712 LSTFNLLGNLFLSRDLVDPMSDKASK-FFDAMTGIMQ 819
            ++ NLL     SRDL       AS+ F   +T IM+
Sbjct: 175 ATSLNLLSRTIFSRDLTSLDDRGASREFKQVITDIME 211



>gb:AP003990_1836016 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1073_F05.>gb:AP004000_1836163 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1115_B01.
          Length = 523

 Score = 92.8 bits (229), Expect = 7e-18
 Identities = 55/181 (30%), Positives = 97/181 (53%), Gaps = 2/181 (1%)
 Frame = +1

Query: 187 YLVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDL--GAFPHQTIAEMKNK 360
           YL+   +  +P L+ L + +++++  R         V+G++  L  G  PH+ + ++  +
Sbjct: 8   YLLLVGLVAVPLLILLGSERRTAARTRLPPGPWALPVVGHLHHLAGGLPPHRAMRDLARR 67

Query: 361 YGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGS 540
           +G ++ LR+G V  +   S  AA E+ + HDV+FA R V  + ++       L FAPYG 
Sbjct: 68  HGPLMLLRLGEVEAVVASSPDAAREIMRTHDVAFASRPVGPMSRLWFQGADGLVFAPYGE 127

Query: 541 YWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLST 720
            WR LRR+CT EL  H+R+    PVR   +  +L  ++  A++   GT V++     +ST
Sbjct: 128 AWRRLRRVCTQELLSHRRVQSFRPVREDELGRLLRAVDAAAAA---GTAVNLT--AMMST 182

Query: 721 F 723
           +
Sbjct: 183 Y 183



>gb:AB025030_1516092 Coptis japonica CYP80B2 mRNA for
           (S)-N-methylcoclaurine-3'-hydroxylase, complete cds.
          Length = 488

 Score = 92.4 bits (228), Expect = 9e-18
 Identities = 48/157 (30%), Positives = 81/157 (51%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+L LG  PH   A++  KYG +  L++GS + +   S  AAAE+ K HD   + R 
Sbjct: 38  IVGNLLQLGDKPHAEFAKLAQKYGELFSLKLGSQTVVVASSPAAAAEILKTHDKILSGRY 97

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
           V    +V+ +   S+ ++     W++LR++C  ELF  K I     +R     +M+ ++ 
Sbjct: 98  VFQSFRVKEHVENSIVWSECNDNWKLLRKVCRTELFTPKMIESQSEIREAKAREMVKFLR 157

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVD 765
            +   V     V +   VF +  N+ GNL  S+D+ D
Sbjct: 158 GKEGEV-----VKIVEVVFGTLVNIFGNLIFSKDVFD 189



>gb:AY541035_1612618 Allium cepa flavonoid 3'-hydroxylase mRNA,
           complete cds.
          Length = 510

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 58/176 (32%), Positives = 90/176 (51%), Gaps = 2/176 (1%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+  LGA PHQ++ E+   YG +  LR G V  +   SA  A +  + HDV+F++R 
Sbjct: 40  ILGNLPQLGAKPHQSLCELSRTYGPLFGLRFGYVDVVVAASADVAEQFLRVHDVNFSNRP 99

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                +   Y    L FAPYG  WR+LR++C + LF  K + +  PVR   +  +   + 
Sbjct: 100 PNSGAEHIAYNYQDLVFAPYGPRWRMLRKLCALHLFSPKALEDLSPVRSLEVATLANTLY 159

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDL-VDPMSD-KASKFFDAMTGIM 816
             A S Q    V++A  +   T N L    + R + V+  +D + SKF D +  IM
Sbjct: 160 LRAQSDQ--PTVNLAQMLTTCTTNALSKAMMGRRVFVNETTDTETSKFKDMVLEIM 213



>sp|O81970|C719_SOYBN Cytochrome P450 71A9 (EC 1.14.-.-) (P450
           CP1).>pir|T07113|T07113 probable cytochrome P450 -
           soybean>gb:GMC450CP1_1680413 G.max mRNA for putative
           cytochrome P450, clone CP1.
          Length = 499

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 44/107 (41%), Positives = 68/107 (63%)
 Frame = +1

Query: 298 IGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTV 477
           IGN+  LG  PHQ++  + NK+G +++L++GS+ T+ + SA+ A E+FKNHD  F+ R  
Sbjct: 43  IGNLHQLGTLPHQSLQYLSNKHGPLMFLQLGSIPTLVVSSAEMAREIFKNHDSVFSGRPS 102

Query: 478 IDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVR 618
           +      G Y  +++FAPYG YWR +R+I  +EL   KR+     VR
Sbjct: 103 LYAANRLG-YGSTVSFAPYGEYWREMRKIMILELLSPKRVQSFEAVR 148



>gb:AX028832_1457177 Sequence 16 from Patent WO9732023.
          Length = 508

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 61/204 (29%), Positives = 99/204 (48%), Gaps = 2/204 (0%)
 Frame = +1

Query: 211 LIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIG 390
           ++  ++++     S  S R         ++GN+  LG  PH  +A +  KYG ++ LR+G
Sbjct: 12  ILGSVLYVFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALAKKYGPLMHLRLG 71

Query: 391 SVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICT 570
            V  +   SA  AA+  K HD +FA R      K   Y    L FAPYG  WR+LR+IC+
Sbjct: 72  CVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPYGPRWRLLRKICS 131

Query: 571 VELFVHKRINETVPVRRKCIDDML-LWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFL 747
           V LF  K +++   VR++ +  +  + +    S VQ G  ++V         N L  + L
Sbjct: 132 VHLFSAKALDDFRHVRQEEVAVLTRVLLSAGNSPVQLGQLLNVC------ATNALARVML 185

Query: 748 SRDLV-DPMSDKASKFFDAMTGIM 816
            R +  D +   A++F D +  +M
Sbjct: 186 GRRVFGDGIDRSANEFKDMVVELM 209



>gb:AF386512_1794708 Pyrus communis cytochrome P450 mRNA, complete
           cds.
          Length = 506

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 40/110 (36%), Positives = 64/110 (58%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  LG  PH+++  +  KYG ++ +R+GSV T+ + S K A    K HD  FA R 
Sbjct: 43  IIGNLHMLGDLPHRSLQNLAKKYGPIMSMRLGSVPTIVVSSPKTAKLFLKTHDTIFASRP 102

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRK 624
            +   +   Y   ++AF  YG YWR +R++CT++L    +I    P+RR+
Sbjct: 103 KLQASEYMAYGTKAMAFTEYGPYWRHIRKLCTLQLLCPSKIESFAPLRRE 152



>gb:AB127340_1528330 Muscari armeniacum MaP450 mRNA for cytochrome
           P450, complete cds.>gb:AB127341_1528331 Muscari
           armeniacum MaP450 gene for cytochrome P450, complete
           cds.
          Length = 503

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 49/155 (31%), Positives = 82/155 (52%)
 Frame = +1

Query: 205 IFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVIWLR 384
           +FLIP LV+ + RK SS+  +         +IGN+  +G  PHQ++  +  KYG ++ L+
Sbjct: 13  LFLIPILVYTIRRKISSTKSKLPPCPPKLPLIGNLHQMGTLPHQSLHALSVKYGPLMLLK 72

Query: 385 IGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRI 564
           +G + T+ + SA  A E+ K HD  FA R  +    +  Y    + FAPYG +WR +R++
Sbjct: 73  LGQIPTLIVSSADMAREIMKTHDHIFASRPSLMTAGIILYGSMDVVFAPYGEHWRQMRKL 132

Query: 565 CTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS 669
           C   L   K +     +  + +  M+  I + +SS
Sbjct: 133 CVNHLLSPKAVQSFRRMHEEEVATMVAKISEVSSS 167



>gb:AX028819_1457169 Sequence 3 from Patent WO9732023.
          Length = 496

 Score = 90.5 bits (223), Expect = 3e-17
 Identities = 52/178 (29%), Positives = 90/178 (50%), Gaps = 4/178 (2%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+  +G  PHQ +A +  KYG ++++R+G V  +   SA  A +  K HD++F+ R 
Sbjct: 28  IVGNLPHMGQAPHQGLAALAQKYGPLLYMRLGYVDVVVAASASVATQFLKTHDLNFSSRP 87

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                K   Y    L FAPYG  WR+LR+IC++ +F  K +++   VR++ +  ++  I 
Sbjct: 88  PNSGAKHIAYNYQDLVFAPYGPKWRMLRKICSLHMFSSKALDDFRLVRQEEVSILVNAIA 147

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSR----DLVDPMSDKASKFFDAMTGIM 816
           K  +       V +   + + T N L  + L +    D       KA +F D +  +M
Sbjct: 148 KAGTK-----PVQLGQLLNVCTTNALSRVMLGKRVLGDGTGKSDPKAEEFKDMVLELM 200



>sp|O81974|C7D8_SOYBN Cytochrome P450 71D8 (EC 1.14.-.-) (P450
           CP7).>pir|T07120|T07120 probable cytochrome P450 CP7 -
           soybean>gb:GMC450CP7_1680417 G.max mRNA for putative
           cytochrome P450, clone CP7.
          Length = 504

 Score = 90.5 bits (223), Expect = 3e-17
 Identities = 52/158 (32%), Positives = 83/158 (52%), Gaps = 3/158 (1%)
 Frame = +1

Query: 205 IFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLG---AFPHQTIAEMKNKYGSVI 375
           +FL+  L +L+   K  SS++         +IGN+  L    + P Q + ++  KYG ++
Sbjct: 14  VFLL--LHWLVKTYKQKSSHKLPPGPWRLPIIGNLHQLALAASLPDQALQKLVRKYGPLM 71

Query: 376 WLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL 555
            L++G +ST+ + S K A E+ K HDV F  R  +   +   Y    +AFAPYG YWR +
Sbjct: 72  HLQLGEISTLVVSSPKMAMEMMKTHDVHFVQRPQLLAPQFMVYGATDIAFAPYGDYWRQI 131

Query: 556 RRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS 669
           R+ICT+EL   KR+     +R+     ++  I   A S
Sbjct: 132 RKICTLELLSAKRVQSFSHIRQDENKKLIQSIHSSAGS 169



>gb:AP003523_1830358 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0416A11.
          Length = 519

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 51/158 (32%), Positives = 92/158 (58%), Gaps = 3/158 (1%)
 Frame = +1

Query: 205 IFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDL-GAFPHQTIAEMKNKYGSVIWL 381
           +F++P L+   +R++  +  R         VIG++  L GA PH+ + ++  ++G ++ L
Sbjct: 16  LFILPFLLLRSSRRRRGACGRLPPSPWALPVIGHLHHLAGALPHRAMRDIARRHGPLVLL 75

Query: 382 RIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGS--LAFAPYGSYWRVL 555
           R+G +  +   SA AA ++ K HD++FA R +  +M++  +  GS  + F+PYG  WR L
Sbjct: 76  RLGELPVVVASSADAARDVMKTHDLAFATRPITRMMRLV-FPEGSEGIIFSPYGETWRQL 134

Query: 556 RRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS 669
           R+ICTVEL   +R+N    VR + ++ +L  +   A+S
Sbjct: 135 RKICTVELLSARRVNSFRSVREEEVNRLLRAVAAAAAS 172



>gb:AF315465_1785416 Pelargonium x hortorum flavonoid 3'-hydroxylase
           mRNA, complete cds.
          Length = 511

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 51/178 (28%), Positives = 91/178 (51%), Gaps = 4/178 (2%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+  +G+ PHQ +A M   YG +++LR+G V  +  LSA  A++  K HD +F+ R 
Sbjct: 42  IVGNLPHMGSMPHQNLAAMARTYGPLVYLRLGFVDVVVALSASMASQFLKTHDSNFSSRP 101

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                K   Y    L FAPYG  WR+ R+I ++ LF  K +++   VR++ +  +   + 
Sbjct: 102 PNAGAKHIAYNYHDLVFAPYGPRWRLFRKITSIHLFSGKALDDYRHVRQEEVGVLASNLA 161

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLS----RDLVDPMSDKASKFFDAMTGIM 816
           +  S++     V++   + +   N LG   +     +D  D +  KA +F   +  +M
Sbjct: 162 RAVSTI-----VNLGQLLNICATNALGRAVIGKKVFKDGTDDVDPKADEFKSMVVELM 214



>sp|Q9SBQ9|F3PH_PETHY Flavonoid 3'-monooxygenase (EC 1.14.13.21)
           (Flavonoid 3'-hydroxylase) (Cytochrome P450
           75B2).>gb:AX028817_1457168 Sequence 1 from Patent
           WO9732023.>gb:AF155332_1772958 Petunia x hybrida
           flavonoid 3'-hydroxylase (Ht1) mRNA, complete cds.
          Length = 512

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 52/153 (33%), Positives = 82/153 (53%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN++ LG  PHQ+ A M   YG +++L++G V  +   SA  AA+  K HD +F+ R 
Sbjct: 42  IIGNLVHLGPKPHQSTAAMAQTYGPLMYLKMGFVDVVVAASASVAAQFLKTHDANFSSRP 101

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                +   Y    L FAPYG  WR+LR+IC+V LF  K +++   VR+   D++     
Sbjct: 102 PNSGAEHMAYNYQDLVFAPYGPRWRMLRKICSVHLFSTKALDDFRHVRQ---DEVKTLTR 158

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSR 753
             AS+ Q+   V +   + + T N L  + L +
Sbjct: 159 ALASAGQK--PVKLGQLLNVCTTNALARVMLGK 189



>sp|O48958|C7E1_SORBI Cytochrome P450 71E1 (EC 1.14.13.68)
           (4-hydroxyphenylacetaldehyde oxime
           monooxygenase).>pir|T14640|T14640 cytochrome P450
           CYP71E1 - sorghum>gb:A85321_1451079 Sequence 1 from
           Patent WO9840470.>gb:AF029858_1762428 Sorghum bicolor
           cytochrome P450 CYP71E1 (CYP71E1) mRNA, complete cds.
          Length = 531

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 47/149 (31%), Positives = 83/149 (55%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+  LG  PH+ + E+  +YG V+ LR+G+V T+ + SA+AA E+ K HDV    R 
Sbjct: 64  ILGNLHLLGPLPHKNLRELARRYGPVMQLRLGTVPTVVVSSAEAAREVLKVHDVDCCSRP 123

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                K   Y + ++ FAPYG YWR +R++  +EL   +R+      R + +D ++  ++
Sbjct: 124 ASPGPKRLSYDLKNVGFAPYGEYWREMRKLFALELLSMRRVKAACYAREQEMDRLVADLD 183

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNL 741
           + A+S      + +   VF  T  ++G +
Sbjct: 184 RAAAS---KASIVLNDHVFALTDGIIGTV 209



>gb:AF191772_1775494 Papaver somniferum (S)-N-methylcoclaurine
           3'-hydroxylase (CYP80B1) mRNA, partial cds.
          Length = 481

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 46/155 (29%), Positives = 80/155 (51%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+L LG  PH   A++   YG +  L++GS + +   +  AA+E+ K HD   + R 
Sbjct: 32  IVGNLLQLGEKPHSQFAQLAETYGDLFSLKLGSETVVVASTPLAASEILKTHDRVLSGRY 91

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
           V    +V+ +   S+ ++     W+ LR++C  ELF  K I     VR     +M+ +++
Sbjct: 92  VFQSFRVKEHVENSIVWSECNETWKKLRKVCRTELFTQKMIESQAEVRESKAMEMVEYLK 151

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDL 759
           K       G  V +A  VF +  N+ GNL  S+++
Sbjct: 152 KNV-----GNEVKIAEVVFGTLVNIFGNLIFSQNI 181



>gb:AX028838_1457180 Sequence 22 from Patent WO9732023.
          Length = 476

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 53/153 (34%), Positives = 81/153 (52%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+  LG+ PHQT+AEM   YG ++ L+ G    +   SA  A +  K HDV+F++R 
Sbjct: 2   ILGNIPHLGSKPHQTLAEMAKTYGPLMHLKFGLKDAVVASSASVAEQFLKKHDVNFSNRP 61

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                K   Y    L FAPYG  WR+LR+IC+V LF  K +++   VR    +++ + I 
Sbjct: 62  PNSGAKHIAYNYQDLVFAPYGPRWRLLRKICSVHLFSSKALDDFQHVRH---EEICILIR 118

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSR 753
             AS       V++   + + T N L  + L R
Sbjct: 119 AIASGGH--APVNLGKLLGVCTTNALARVMLGR 149



>sp|O64637|C7C2_ARATH Cytochrome P450 76C2 (EC
           1.14.-.-).>pir|T00870|T00870 probable cytochrome P450
           At2g45570 [imported] - Arabidopsis
           thaliana>gb:AC003680_1531189 Arabidopsis thaliana
           chromosome 2 BAC F17K2 genomic sequence, complete
           sequence.>gb:AY062600_1565256 Arabidopsis thaliana
           putative cytochrome P450 (At2g45570; F17K2.10) mRNA,
           complete cds.>gb:AY114660_1578702 Arabidopsis thaliana
           putative cytochrome P450 (At2g45570) mRNA, complete cds.
          Length = 512

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 48/176 (27%), Positives = 99/176 (56%), Gaps = 1/176 (0%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  +G  PH + A++   YG ++ L+ GS++T+ + S +AA E+ + +D   + RT
Sbjct: 47  IIGNIHLVGRNPHHSFADLSKTYGPIMSLKFGSLNTVVVTSPEAAREVLRTYDQILSSRT 106

Query: 475 VIDVMKVQGYYMGSLAF-APYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
             + ++   +   S+ +  P  S WR+LR++   +LF  +RI  T  +R   + +++ ++
Sbjct: 107 PTNSIRSINHDKVSVVWLPPSSSRWRLLRKLSATQLFSPQRIEATKTLRENKVKELVSFM 166

Query: 652 EKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ 819
              + S +R   V ++   F++  N++ N+  S DL +  S+K+  F D + G+M+
Sbjct: 167 ---SESSEREEAVDISRATFITALNIISNILFSVDLGNYDSNKSGVFQDTVIGVME 219



>gb:AP001298_1820965 Arabidopsis thaliana genomic DNA, chromosome 3,
           BAC clone:F20C19.
          Length = 445

 Score = 89.4 bits (220), Expect = 8e-17
 Identities = 45/159 (28%), Positives = 86/159 (54%)
 Frame = +1

Query: 190 LVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGS 369
           L+ S +FL+  L+    ++     +R         +IGN+  LG  PHQ++ ++  KYG 
Sbjct: 5   LILSLLFLVILLLLTAFKRAKRRQHRPIPSPPGFPIIGNLHQLGELPHQSLWKLSKKYGP 64

Query: 370 VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR 549
           V+ L +G V T+ + S++ A +  +++D+    R  +   +   Y    ++F+PY  YW+
Sbjct: 65  VMLLNLGKVPTVILSSSETAKQALRDYDLHCCSRPSLAGGRELSYNNRDISFSPYNDYWK 124

Query: 550 VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS 666
            LR++CT ELF  K I+ T  ++ + +  +++ I + AS
Sbjct: 125 ELRKLCTQELFSAKNIHSTQHIKDEEVKKLIVSIAESAS 163



>gb:AY072124_1567018 Arabidopsis thaliana putative cytochrome P450
           protein (At2g02580) mRNA, complete cds.
          Length = 500

 Score = 89.4 bits (220), Expect = 8e-17
 Identities = 48/160 (30%), Positives = 85/160 (53%), Gaps = 2/160 (1%)
 Frame = +1

Query: 193 VW--SAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYG 366
           +W  S +FL   L+     KK  ++ +         +IGN+  LG  PHQ++  +   YG
Sbjct: 4   IWFLSLLFLCCILLAAFKHKKRRTNQQQPPSPPGFPIIGNLHQLGELPHQSLWSLSKTYG 63

Query: 367 SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW 546
            V+ L++GSV T+ + S++ A ++ K +D+    R  +   K   Y    +AF+P+  YW
Sbjct: 64  PVMLLKLGSVPTVVVSSSETAKQVLKINDLHCCSRPSLAGAKELSYNYLDIAFSPFDDYW 123

Query: 547 RVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS 666
           + LRRIC  ELF  KR++   P++ + +  +++   + AS
Sbjct: 124 KELRRICVQELFSAKRVHSIQPIKEEEVRKLIVSATESAS 163



>gb:AB028462_1517854 Petunia x hybrida imt-5 mRNA for cytochrome
           P450, complete cds.
          Length = 502

 Score = 89.4 bits (220), Expect = 8e-17
 Identities = 52/164 (31%), Positives = 83/164 (50%), Gaps = 3/164 (1%)
 Frame = +1

Query: 169 MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDL---GAFPHQT 339
           ME +   LV   +FL    +FLL RK  +              IG++  L   G  PH  
Sbjct: 1   MEIQLSSLVPFLLFL--SSIFLLLRKWKTQELNLPPGPWKLPFIGSLHHLVFAGPLPHHG 58

Query: 340 IAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSL 519
           +  +  +YG ++ L++G   T+ I S + A E+ K HD++FA R  +   ++  Y    +
Sbjct: 59  LTNLAKRYGPLMLLQLGEQPTVFISSPQMAKEVLKTHDLAFATRPKLTFAEIIKYGSTDI 118

Query: 520 AFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
           AF+PYG YWR +R+IC +EL   K +N    +R   + +M+ WI
Sbjct: 119 AFSPYGEYWRQIRKICVMELLSAKMVNSFSSIREDELSNMISWI 162



>sp|O48923|C7DA_SOYBN Cytochrome P450 71D10 (EC
           1.14.-.-).>pir|T05939|T05939 cytochrome P450
           monooxygenase 71D10p - soybean>gb:AF022459_1761994
           Glycine max cytochrome P450 monooxygenase CYP71D10p
           (CYP71D10) mRNA, complete cds.
          Length = 510

 Score = 89.4 bits (220), Expect = 8e-17
 Identities = 53/185 (28%), Positives = 99/185 (53%), Gaps = 4/185 (2%)
 Frame = +1

Query: 187 YLVWSAIFLIPGLVFLLARK--KSSSSYRXXXXXXXXXVIGNMLDL-GAFP-HQTIAEMK 354
           Y + S +F+      L+ R   K+SS+ +         +IGN+  + G+ P H  +  + 
Sbjct: 14  YFITSILFIFFVFFKLVQRSDSKTSSTCKLPPGPRTLPLIGNIHQIVGSLPVHYYLKNLA 73

Query: 355 NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPY 534
           +KYG ++ L++G VS + + S + A E+ K HD++F+DR    + ++  Y    + F+ +
Sbjct: 74  DKYGPLMHLKLGEVSNIIVTSPEMAQEIMKTHDLNFSDRPDFVLSRIVSYNGSGIVFSQH 133

Query: 535 GSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFL 714
           G YWR LR+ICTVEL   KR+     +R + + +++  I   AS  + G+  ++   ++ 
Sbjct: 134 GDYWRQLRKICTVELLTAKRVQSFRSIREEEVAELVKKIAATASE-EGGSIFNLTQSIYS 192

Query: 715 STFNL 729
            TF +
Sbjct: 193 MTFGI 197



>sp|O64718|C729_ARATH Cytochrome P450 71B9 (EC
           1.14.-.-).>gb:AC004136_1531456 Arabidopsis thaliana
           chromosome 2 BAC T8K22 genomic sequence, complete
           sequence.
          Length = 500

 Score = 89.4 bits (220), Expect = 8e-17
 Identities = 48/160 (30%), Positives = 85/160 (53%), Gaps = 2/160 (1%)
 Frame = +1

Query: 193 VW--SAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYG 366
           +W  S +FL   L+     KK  ++ +         +IGN+  LG  PHQ++  +   YG
Sbjct: 4   IWFLSLLFLCCILLAAFKHKKRRTNQQQPPSPPGFPIIGNLHQLGELPHQSLWSLSKTYG 63

Query: 367 SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW 546
            V+ L++GSV T+ + S++ A ++ K +D+    R  +   K   Y    +AF+P+  YW
Sbjct: 64  PVMLLKLGSVPTVVVSSSETAKQVLKINDLHCCSRPSLAGAKELSYNYLDIAFSPFDDYW 123

Query: 547 RVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS 666
           + LRRIC  ELF  KR++   P++ + +  +++   + AS
Sbjct: 124 KELRRICVQELFSAKRVHSIQPIKEEEVRKLIVSATESAS 163



>gb:AY463157_1607680 Ipomoea quamoclit flavonoid 3'-hydroxylase
           mRNA, complete cds.
          Length = 519

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 55/163 (33%), Positives = 86/163 (52%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           V+GN+  LG  PHQ+IA M  KYG ++ LR+G V  +   SA  AA+  K HD +F+ R 
Sbjct: 41  VLGNLPHLGEKPHQSIAAMAQKYGPLMHLRLGFVDVVVAASAAVAAQFLKVHDANFSSRP 100

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                +   Y    L FAPYG  WR+LR+I +V LF  K +++   VR+    + +  + 
Sbjct: 101 PNSGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFSHVRQ----EEVATLT 156

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKA 783
           +  +S  + T V +   + + T N L  + L R + +  S K+
Sbjct: 157 RSLASAGK-TPVKLGQLLNVCTTNALARVMLGRKVFNDGSSKS 198



>gb:AF134590_1771026 Papaver somniferum (S)-N-methylcoclaurine
           3'-hydroxylase (cyp80b1) mRNA, partial cds.
          Length = 481

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 45/155 (29%), Positives = 80/155 (51%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+L LG  PH   A++   YG +  L++GS + +   +  AA+E+ K HD   + R 
Sbjct: 32  IVGNLLQLGEKPHSQFAQLAETYGDLFSLKLGSETVVVASTPLAASEILKTHDRVLSGRY 91

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
           V    +V+ +   S+ ++     W+ LR++C  +LF  K I     VR     +M+ +++
Sbjct: 92  VFQSFRVKEHVENSIVWSECNETWKKLRKVCRTDLFTQKMIESQAEVRESKAMEMVEYLK 151

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDL 759
           K       G  V +A  VF +  N+ GNL  S+++
Sbjct: 152 KNV-----GNEVKIAEVVFGTLVNIFGNLIFSQNI 181



>gb:AP005483_1852666 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:B1144B06.
          Length = 520

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 64/196 (32%), Positives = 92/196 (46%), Gaps = 2/196 (1%)
 Frame = +1

Query: 202 AIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVIWL 381
           A FL+ GL+    RK S   Y          VIGN   +GA PH++I E+  KYG ++ L
Sbjct: 15  AAFLLLGLI---KRKGSRRGYNLPPGPTPWPVIGNFNLIGALPHRSIHELSRKYGELMLL 71

Query: 382 RIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRR 561
           R GS   +   S   A  + K HD  F DR      K   Y    + ++PYG+YWR  RR
Sbjct: 72  RFGSFPVVVGSSVAMARLVLKTHDAVFIDRPRTASRKHTTYGYADITWSPYGAYWRQARR 131

Query: 562 ICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHV--AHFVFLSTFNLLG 735
           IC  ELF  +R+     +R   +  ++  +   ASS + G  VH+   H   LS  N++ 
Sbjct: 132 ICVTELFSARRVASFEHIRADEVRALVRGLFAAASSGRSG-AVHLNRDHLSTLS-MNVIT 189

Query: 736 NLFLSRDLVDPMSDKA 783
            + L +      +D A
Sbjct: 190 RMVLGKRFFGEGADAA 205



>sp|Q9SD85|F3PH_ARATH Flavonoid 3'-monooxygenase (EC 1.14.13.21)
           (Flavonoid 3'-hydroxylase) (AtF3'H) (Cytochrome P450
           75B1) (TRANSPARENT TESTA 7 protein).>pir|T45624|T45624
           flavonoid 3'-hydroxylase-like protein [imported] -
           Arabidopsis thaliana>gb:ATF13G24_1548449 Arabidopsis
           thaliana DNA chromosome 5, BAC clone F13G24 (ESSA
           project).>gb:AF155171_1772947 Arabidopsis thaliana
           flavonoid 3'-hydroxylase (TT7) gene, complete
           cds.>gb:AF241643S4_1780124 Arabidopsis thaliana
           flavonoid 3'hydroxylase gene, exon 4 and complete
           cds.>gb:AF271650_1782158 Arabidopsis thaliana chromosome
           V flavonoid 3'-hydroxylase mRNA, complete
           cds.>gb:AF271651_1782159 Arabidopsis thaliana chromosome
           V flavonoid 3'-hydroxylase mRNA, complete cds.
          Length = 513

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 65/211 (30%), Positives = 100/211 (47%), Gaps = 2/211 (0%)
 Frame = +1

Query: 190 LVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGS 369
           L+ + +FLI  L     R+  S + R         +IGN+  +G  PH+T++ M   YG 
Sbjct: 9   LLATVLFLI--LRIFSHRRNRSHNNRLPPGPNPWPIIGNLPHMGTKPHRTLSAMVTTYGP 66

Query: 370 VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR 549
           ++ LR+G V  +   S   A +  K HD +FA R      K   Y    L FAPYG  WR
Sbjct: 67  ILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGHRWR 126

Query: 550 VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGT-GVHVAHFVFLSTFN 726
           +LR+I +V LF  K + +   VR++ +  +          V+ GT  V++   V +   N
Sbjct: 127 LLRKISSVHLFSAKALEDFKHVRQEEVGTL------TRELVRVGTKPVNLGQLVNMCVVN 180

Query: 727 LLGNLFLSRDLVDPMSD-KASKFFDAMTGIM 816
            LG   + R L    +D KA +F   +T +M
Sbjct: 181 ALGREMIGRRLFGADADHKADEFRSMVTEMM 211



>gb:AC003680_1531188 Arabidopsis thaliana chromosome 2 BAC F17K2
           genomic sequence, complete sequence.>gb:AY085090_1570172
           Arabidopsis thaliana clone 12830 mRNA, complete
           sequence.
          Length = 322

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 48/156 (30%), Positives = 88/156 (56%), Gaps = 1/156 (0%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  +G  PH++ AE+   YG V+ L++GS++T+ I S +AA E+ + HD   + R+
Sbjct: 47  IIGNIHLVGKHPHRSFAELSKTYGPVMSLKLGSLNTVVIASPEAAREVLRTHDQILSARS 106

Query: 475 VIDVMKVQGYYMGSLAFAPYGS-YWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
             + ++   +   SL + P  S  WR+LRR+   +L   +RI  T  +R   + +++ +I
Sbjct: 107 PTNAVRSINHQDASLVWLPSSSARWRLLRRLSVTQLLSPQRIEATKALRMNKVKELVSFI 166

Query: 652 EKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDL 759
              + S  R   V ++   F++T N++ N+  S DL
Sbjct: 167 ---SESSDREESVDISRVAFITTLNIISNILFSVDL 199



>pir|T52168|T52168 cytochrome P450 monooxygenase [imported] -
           Arabidopsis thaliana>gb:D78600_1674782 Arabidopsis
           thaliana mRNA for cytochrome P450 monooxygenase,
           complete cds, clone P450-4.
          Length = 495

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 48/156 (30%), Positives = 88/156 (56%), Gaps = 1/156 (0%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  +G  PH++ AE+   YG V+ L++GS++T+ I S +AA E+ + HD   + R+
Sbjct: 47  IIGNIHLVGKHPHRSFAELSKTYGPVMSLKLGSLNTVVIASPEAAREVLRTHDQILSARS 106

Query: 475 VIDVMKVQGYYMGSLAFAPYGS-YWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
             + ++   +   SL + P  S  WR+LRR+   +L   +RI  T  +R   + +++ +I
Sbjct: 107 PTNAVRSINHQDASLVWLPSSSARWRLLRRLSVTQLLSPQRIEATKALRMNKVKELVSFI 166

Query: 652 EKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDL 759
              + S  R   V ++   F++T N++ N+  S DL
Sbjct: 167 ---SESSDREESVDISRVAFITTLNIISNILFSVDL 199



>sp|O64636|C7C1_ARATH Cytochrome P450 76C1 (EC
           1.14.-.-).>pir|T00869|T00869 probable cytochrome P450
           [imported] - Arabidopsis thaliana>gb:AY078939_1568100
           Arabidopsis thaliana At2g45560/F17K2.9 mRNA, complete
           cds.>gb:AY124874_1580239 Arabidopsis thaliana
           At2g45560/F17K2.9 mRNA, complete cds.
          Length = 512

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 48/156 (30%), Positives = 88/156 (56%), Gaps = 1/156 (0%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  +G  PH++ AE+   YG V+ L++GS++T+ I S +AA E+ + HD   + R+
Sbjct: 47  IIGNIHLVGKHPHRSFAELSKTYGPVMSLKLGSLNTVVIASPEAAREVLRTHDQILSARS 106

Query: 475 VIDVMKVQGYYMGSLAFAPYGS-YWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
             + ++   +   SL + P  S  WR+LRR+   +L   +RI  T  +R   + +++ +I
Sbjct: 107 PTNAVRSINHQDASLVWLPSSSARWRLLRRLSVTQLLSPQRIEATKALRMNKVKELVSFI 166

Query: 652 EKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDL 759
              + S  R   V ++   F++T N++ N+  S DL
Sbjct: 167 ---SESSDREESVDISRVAFITTLNIISNILFSVDL 199



>sp|Q9LVD2|C72A_ARATH Cytochrome P450 71B10 (EC
           1.14.-.-).>gb:AB019233_1514195 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1 clone:MJB24.
          Length = 502

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 45/160 (28%), Positives = 87/160 (54%), Gaps = 1/160 (0%)
 Frame = +1

Query: 190 LVWSAIFLIPGLVFLLARKKSSSSY-RXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYG 366
           ++W    ++   + L+A K S   + R         +IGN+  LG  PHQ++ ++  KYG
Sbjct: 3   VLWFVSLILLISILLVAVKHSKRRWVRQPPSPPGLPIIGNLHQLGELPHQSLCKLSKKYG 62

Query: 367 SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW 546
            V+ L++G V T+ + + + A ++ K++D+    R  ++  +   Y    +AF+ +  YW
Sbjct: 63  PVMLLKLGRVPTVIVSTPETAKQVLKDYDLHCCSRPSLEGTRKLSYNYLDIAFSRFDDYW 122

Query: 547 RVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS 666
           + LR++C  ELF +KRIN   P++   ++ ++  I + AS
Sbjct: 123 KELRKLCVEELFCNKRINSIQPIKEAEMEKLIDSIAESAS 162



>gb:AB113263_1527234 Ipomoea tricolor Fuchsia mRNA for flavonoid
           3'-hydroxylase, complete cds.>gb:AB113267_1527237
           Ipomoea tricolor Fuchsia gene for flavonoid
           3'-hydroxylase, complete cds, strain: Heavenly Blue.
          Length = 522

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 54/163 (33%), Positives = 85/163 (52%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           V+GN+  LG  PHQ+IA M   YG ++ LR+G V  +   SA  AA+  K HD +F+ R 
Sbjct: 41  VLGNLPHLGEKPHQSIAAMAQSYGPLMHLRLGFVDVVVAASAAVAAQFLKVHDANFSSRP 100

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                +   Y    L FAPYG  WR+LR+I +V LF  K +++   VR+    + +  + 
Sbjct: 101 PNSGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQ----EEVATLT 156

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKA 783
           +  +S  + T V +   + + T N L  + L R + +  S K+
Sbjct: 157 RSLASAGK-TPVKLGQLLNVCTTNALARVMLGRKVFNDGSSKS 198



>sp|O22307|C7DB_LOTJA Cytochrome P450 71D11 (EC 1.14.-.-)
           (Fragment).>gb:AF000403_1760500 Lotus japonicus putative
           cytochorome P450 mRNA, partial cds.
          Length = 490

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 45/127 (35%), Positives = 74/127 (58%), Gaps = 1/127 (0%)
 Frame = +1

Query: 295 VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR 471
           +IG++  L G+ PH+ + ++  KYG ++ L++G V  + + SA+ A E+ K HDV+FA R
Sbjct: 28  IIGSIPHLVGSPPHRKLRDLAKKYGPLMHLQLGEVIFIIVSSAEYAKEVMKTHDVTFASR 87

Query: 472 TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
                  +  Y    + F+PYG YWR +R+IC VEL   KR+    P+R + + +++  I
Sbjct: 88  PRSLFTDIVFYGSTDIGFSPYGDYWRQVRKICNVELLSMKRVQSLWPIREEEVKNLIQRI 147

Query: 652 EKEASSV 672
             E  SV
Sbjct: 148 ASEEGSV 154



>sp|Q9LIP5|C72W_ARATH Cytochrome P450 71B35 (EC
           1.14.-.-).>gb:BT011754_1641276 Arabidopsis thaliana
           At3g26310 gene, complete cds.>gb:AP001298_1820967
           Arabidopsis thaliana genomic DNA, chromosome 3, BAC
           clone:F20C19.
          Length = 500

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 48/160 (30%), Positives = 84/160 (52%), Gaps = 6/160 (3%)
 Frame = +1

Query: 205 IFLIPGLVFLLA------RKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYG 366
           I+L+P L+FL+         K    YR         +IGN+  +G  PHQT+ ++  KYG
Sbjct: 4   IWLLP-LIFLVCILLAVFNHKKHPKYRQFPCPPGFPIIGNLHQIGELPHQTLWKLSKKYG 62

Query: 367 SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW 546
            V+ L +G V T+ + S+  A ++ + HD+    R  +   +   Y    +AF+PY  YW
Sbjct: 63  PVMHLMLGRVPTVVVSSSDTARQVLRVHDLHCCTRPSLSGPRELSYNYLDIAFSPYDDYW 122

Query: 547 RVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS 666
           + +R++C  ELF  K+++   P++ + +  M+  I + AS
Sbjct: 123 KEVRKLCVQELFSTKQVHSIQPIKDEEVKKMIDSIAESAS 162



>gb:AP005419_1851475 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0046G12.>gb:AP005570_1854237 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OJ1344_B01.
          Length = 518

 Score = 87.0 bits (214), Expect = 4e-16
 Identities = 50/156 (32%), Positives = 80/156 (51%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  +G+ PH++I  +  KYG ++ LR GS   +   S + A    K HDV FADR 
Sbjct: 44  IIGNLNLMGSLPHRSIHSLSKKYGPLMHLRFGSFPVVVGSSVEMAKFFLKTHDVVFADRP 103

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                K   Y    + ++PYG+YWR  R++C  ELF  KRI     +RR+ +  +L  + 
Sbjct: 104 KTAAGKHTTYNYSDMTWSPYGAYWRQARKVCLAELFSAKRIESYEHIRREEVRALLRDLH 163

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLV 762
             +  V        A  + + +  +LG  +L R++V
Sbjct: 164 AASGRVVALKDYLSAASLNVISRMVLGKKYLEREVV 199



>gb:AY532370_1612053 Ammi majus cytochrome P450 (CYP71AJ1) mRNA,
           complete cds.
          Length = 494

 Score = 87.0 bits (214), Expect = 4e-16
 Identities = 49/168 (29%), Positives = 84/168 (50%)
 Frame = +1

Query: 169 MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAE 348
           +E   +YL + ++FL+   ++     K +             +IGN+  +G  P  ++ +
Sbjct: 4   LEQNPQYLYFFSLFLVTIFLYKWLTLKKTPLKNLPPSPPQYPIIGNLHQIGPDPQASLRD 63

Query: 349 MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA 528
           +  KYG +++L+ G+V  + + SA AA E  K HD+ FADR    V     Y    + FA
Sbjct: 64  LAQKYGPLMFLKFGTVPVLVVSSADAAREALKTHDLVFADRPYSSVANKIFYNGKDMVFA 123

Query: 529 PYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSV 672
            Y  YWR ++ IC  +L  +KR+N    VR + +D ++  +E   S V
Sbjct: 124 RYTEYWRQVKSICVTQLLSNKRVNSFHYVREEEVDLLVQNLENSHSKV 171



>gb:AE016959_1021110 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC116603_1739340
           Oryza sativa (japonica cultivar-group) chromosome 10
           clone OSJNBb0015J03, complete
           sequence.>gb:AC131375_1741006 Oryza sativa (japonica
           cultivar-group) chromosome 10 clone OSJNAb0015J03,
           complete sequence.>gb:AE017061_1750929 Oryza sativa
           (japonica cultivar-group) chromosome 10, section 15 of
           77 of the complete sequence.
          Length = 651

 Score = 87.0 bits (214), Expect = 4e-16
 Identities = 53/176 (30%), Positives = 92/176 (52%), Gaps = 1/176 (0%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IG++  LG  PH+++A +   YG ++ LR+G+V+T+   S + A E  + HD  FA R+
Sbjct: 40  LIGSLHLLGDLPHRSLAGLAKTYGPLMSLRLGAVTTVVASSPEVAREFLQKHDAVFATRS 99

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
             D      +   S+A+ P G  WR LR+I   ELF  +R++    +R++ + ++   ++
Sbjct: 100 TPDA--TGDHARNSVAWLPPGPRWRELRKIMATELFSTRRLDALHELRQEKVAEL---VD 154

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAM-TGIMQ 819
             A   + GT V +    F ++ NL+     S DL       ASK F  + T +M+
Sbjct: 155 HVAGLARDGTAVDIGRVAFTTSLNLVARTIFSHDLTSLDDHGASKEFQRLITDVME 210



>gb:BT004038_1637150 Arabidopsis thaliana clone RAFL15-05-J07
           (R20236) putative cytochrome p450 (At5g57260) mRNA,
           complete cds.
          Length = 502

 Score = 86.7 bits (213), Expect = 5e-16
 Identities = 45/160 (28%), Positives = 86/160 (53%), Gaps = 1/160 (0%)
 Frame = +1

Query: 190 LVWSAIFLIPGLVFLLARKKSSSSY-RXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYG 366
           ++W    ++   + L+A K S   + R         +IGN+  LG  PHQ++ ++  KYG
Sbjct: 3   VLWFVSLILLISILLVAVKHSKRRWVRQPPSPPGLPIIGNLHQLGELPHQSLCKLSKKYG 62

Query: 367 SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW 546
            V+ L++G V T+ + +   A ++ K++D+    R  ++  +   Y    +AF+ +  YW
Sbjct: 63  PVMLLKLGRVPTVIVSTPGTAKQVLKDYDLHCCSRPSLEGTRKLSYNYLDIAFSRFDDYW 122

Query: 547 RVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS 666
           + LR++C  ELF +KRIN   P++   ++ ++  I + AS
Sbjct: 123 KELRKLCVEELFCNKRINSIQPIKEAEMEKLIDSIAESAS 162



>gb:AB122079_1528034 Panax ginseng mRNA for cytochrome P450,
           complete cds.
          Length = 500

 Score = 86.7 bits (213), Expect = 5e-16
 Identities = 49/148 (33%), Positives = 80/148 (54%), Gaps = 2/148 (1%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IG++  LGA PH+T+  +  KYG ++ +R+GSV T+ + S +AA    K HD  FA R 
Sbjct: 42  IIGSLHTLGALPHRTLQTLAKKYGPIMSMRLGSVPTIVVSSPQAAELFLKTHDNIFASRP 101

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
            +   +   Y    ++F  YG +WR +R+   +EL    +IN  V +RR+ +  M++   
Sbjct: 102 KLQAAEYMSYGTKGMSFTAYGPHWRNIRKFVVLELLTPAKINSFVGMRREEL-GMVVKSI 160

Query: 655 KEASSVQR--GTGVHVAHFVFLSTFNLL 732
           KEAS+          VA+ +   T+ LL
Sbjct: 161 KEASAANEVVDLSAKVANIIENMTYRLL 188



>gb:AB113261_1527232 Ipomoea nil Magenta mRNA for flavonoid
           3'-hydroxylase, complete cds.>gb:AB113264_1527235
           Ipomoea nil Magenta gene for flavonoid 3'-hydroxylase,
           complete cds.
          Length = 519

 Score = 86.7 bits (213), Expect = 5e-16
 Identities = 59/198 (29%), Positives = 96/198 (48%)
 Frame = +1

Query: 190 LVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGS 369
           L++  +     L FL+ R K               V+GN+  LG  PHQ+IA M  +YG 
Sbjct: 6   LIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGKKPHQSIAAMAERYGP 65

Query: 370 VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR 549
           ++ LR+G V  +   SA  AA+  K HD +F++R      +   Y    L FAPYG  WR
Sbjct: 66  LMHLRLGFVDVVVAASAAVAAQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR 125

Query: 550 VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNL 729
           +LR+I +V LF  K +++   VR+    + +  + +  +S  + T V +   + + T N 
Sbjct: 126 MLRKITSVHLFSAKALDDFCHVRQ----EEVATLTRSLASAGK-TPVKLGQLLNVCTTNA 180

Query: 730 LGNLFLSRDLVDPMSDKA 783
           L  + L R + +    K+
Sbjct: 181 LARVMLGRKVFNDGGSKS 198



>gb:AX028836_1457179 Sequence 20 from Patent WO9732023.
          Length = 517

 Score = 86.7 bits (213), Expect = 5e-16
 Identities = 59/198 (29%), Positives = 96/198 (48%)
 Frame = +1

Query: 190 LVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGS 369
           L++  +     L FL+ R K               V+GN+  LG  PHQ+IA M  +YG 
Sbjct: 4   LIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGKKPHQSIAAMAERYGP 63

Query: 370 VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR 549
           ++ LR+G V  +   SA  AA+  K HD +F++R      +   Y    L FAPYG  WR
Sbjct: 64  LMHLRLGFVDVVVAASAAVAAQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR 123

Query: 550 VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNL 729
           +LR+I +V LF  K +++   VR+    + +  + +  +S  + T V +   + + T N 
Sbjct: 124 MLRKITSVHLFSAKALDDFCHVRQ----EEVATLTRSLASAGK-TPVKLGQLLNVCTTNA 178

Query: 730 LGNLFLSRDLVDPMSDKA 783
           L  + L R + +    K+
Sbjct: 179 LARVMLGRKVFNDGGSKS 196



>gb:AP005570_1854232 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OJ1344_B01.
          Length = 525

 Score = 86.3 bits (212), Expect = 6e-16
 Identities = 51/163 (31%), Positives = 85/163 (52%), Gaps = 4/163 (2%)
 Frame = +1

Query: 196 WSAIFLI--PGLVFLLAR--KKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKY 363
           W+++ +I    +VFLLA   +    +YR         +IGN+  +GA PH++I E+  +Y
Sbjct: 8   WASVLVIVLAAVVFLLATILRHGRRAYRLPPGPNPWPIIGNLNLIGALPHRSIHELSKRY 67

Query: 364 GSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSY 543
           G ++ LR GS   +   SA+ A    K+HD+ F DR      K   Y    + ++PYG+Y
Sbjct: 68  GPLMQLRFGSFPVVVGSSAEMARFFLKSHDIVFTDRPRTAAGKHTTYNYTDILWSPYGAY 127

Query: 544 WRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSV 672
           WR  R++C  ELF  +R+     +R + +  +L  +   A+ V
Sbjct: 128 WRQARKMCVTELFSARRLESFEHIRGEEVRALLRDLHGAAAPV 170



>gb:AF313489_1785222 Callistephus chinensis flavonoid
           3',5'-hydroxylase mRNA, complete cds.
          Length = 510

 Score = 86.3 bits (212), Expect = 6e-16
 Identities = 56/184 (30%), Positives = 89/184 (48%), Gaps = 10/184 (5%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           V+GN+  LGA PH T+A +  KYG +++LR+G V  +   S   AA+  K HD+ FA R 
Sbjct: 41  VVGNLPHLGAIPHHTLAALATKYGPLVYLRLGFVHVVVASSPSVAAQFLKVHDLKFASRP 100

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                K   Y    + FAPYG  W + R+IC   LF  K +++   VR           +
Sbjct: 101 PNSGAKHIAYNYQDMVFAPYGPQWTMFRKICKDHLFSSKALDDFRHVR-----------Q 149

Query: 655 KEASSVQRG------TGVHVAHFVFLSTFNLLGNLFLSRDLVDPMS----DKASKFFDAM 804
           +E + + RG      + V++   + + T N L  + L + +    S     KA++F +  
Sbjct: 150 EEVAILARGLAGAGRSKVNLGQQLNMCTANTLARMMLDKRVFGNESGGDDPKANEFKEMA 209

Query: 805 TGIM 816
           T +M
Sbjct: 210 TELM 213



>gb:NRCYP71A5_1691150 Nepeta racemosa mRNA for cytochrome P450,
           CYP71A5.
          Length = 509

 Score = 86.3 bits (212), Expect = 6e-16
 Identities = 45/146 (30%), Positives = 76/146 (52%)
 Frame = +1

Query: 187 YLVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYG 366
           Y + + +  +P L+FL   ++S S            VIGN+  LG +PH+ +  +  +YG
Sbjct: 6   YFLIALLCTLPFLLFLNKWRRSYSGKTPPPSPPKLPVIGNLHQLGLYPHRYLQSLSRRYG 65

Query: 367 SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW 546
            ++ L  GSV  +   S +AA E+ KN D+ F++R  + +     +    +AF  YG YW
Sbjct: 66  PLMQLHFGSVPVLVASSPEAAREIMKNQDIVFSNRPKMSIANRLFFNNRDVAFTQYGEYW 125

Query: 547 RVLRRICTVELFVHKRINETVPVRRK 624
           R +R IC ++L  +KR+     VR +
Sbjct: 126 RQIRSICVLQLLSNKRVQSFRRVREE 151



>sp|Q9LIP3|C72Y_ARATH Cytochrome P450 71B37 (EC 1.14.-.-).
          Length = 500

 Score = 86.3 bits (212), Expect = 6e-16
 Identities = 44/146 (30%), Positives = 76/146 (52%)
 Frame = +1

Query: 205 IFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVIWLR 384
           +FL   L+  L  KK     R         +IGN+  LG  PHQ++  +  KYG V+ L+
Sbjct: 10  LFLSCLLLAALRLKKRRQHQRKPPSPPGFPIIGNLHQLGELPHQSLWSLSKKYGPVMLLK 69

Query: 385 IGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRI 564
            GS+ T+ + S++ A +  K HD++   R  +   +   Y    + F+P+  YW+ LRR+
Sbjct: 70  FGSIPTVVVSSSETAKQALKIHDLNCCSRPSLAGPRALSYNYLDIVFSPFNDYWKELRRM 129

Query: 565 CTVELFVHKRINETVPVRRKCIDDML 642
           C  ELF  K+++   P+R + +  ++
Sbjct: 130 CVQELFSPKQVHLIQPIREEEVKKLM 155



>sp|Q9STK8|C71P_ARATH Cytochrome P450 71A25 (EC
           1.14.-.-).>pir|T06714|T06714 probable cytochrome P450
           T29H11.200 - Arabidopsis thaliana>gb:ATT29H11_1555640
           Arabidopsis thaliana DNA chromosome 3, BAC clone T29H11.
          Length = 490

 Score = 86.3 bits (212), Expect = 6e-16
 Identities = 47/159 (29%), Positives = 81/159 (50%)
 Frame = +1

Query: 190 LVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGS 369
           L+WS IF+    +  L ++ S    +         +IGN+  LG   H+++ ++  +YG 
Sbjct: 7   LLWSIIFMT---ILFLKKQLSGKKGKTPPSPPGLPLIGNLHQLGRHTHRSLCDLSRRYGP 63

Query: 370 VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR 549
           ++ L +G V  + + SA  A E+ K HD +FA+R    + +   Y    +A APYG YWR
Sbjct: 64  LMLLHLGRVPVLIVSSADMAQEILKTHDQAFANRPRSKLSQKLLYNNRDVASAPYGEYWR 123

Query: 550 VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS 666
            ++ +C + L  +K +     VR + I  M+  I K +S
Sbjct: 124 QMKSVCVIHLLSNKMVRSFRDVREEEITLMMAKIRKSSS 162



>sp|Q9STL1|C71M_ARATH Cytochrome P450 71A22 (EC
           1.14.-.-).>pir|T06711|T06711 probable cytochrome P450
           T29H11.170 - Arabidopsis thaliana>gb:ATT29H11_1555643
           Arabidopsis thaliana DNA chromosome 3, BAC clone
           T29H11.>gb:AY096499_1576041 Arabidopsis thaliana unknown
           protein (At3g48310) mRNA, complete
           cds.>gb:AY133854_1581674 Arabidopsis thaliana clone
           U10369 unknown protein (At3g48270) mRNA, complete cds.
          Length = 490

 Score = 86.3 bits (212), Expect = 6e-16
 Identities = 50/166 (30%), Positives = 84/166 (50%)
 Frame = +1

Query: 169 MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAE 348
           ME   + ++ S I  I  L F+  +K   S+           +IGN+  LG  PH+++  
Sbjct: 1   MESMIRIILLSLIIFITILFFIKQKKGKKSN--TPASPPRLPLIGNLHQLGRHPHRSLCS 58

Query: 349 MKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFA 528
           + N+YG ++ LR G V  + + SA  A ++ K +D  FA R    + +   Y    +A A
Sbjct: 59  LSNRYGPLMLLRFGLVPVLVVSSADVARDILKTYDRVFASRPRSKIFEKIFYEARDVALA 118

Query: 529 PYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS 666
           PYG YWR ++ +C + L  +K +     VR++ I  M+  I+K +S
Sbjct: 119 PYGEYWRQMKSVCVLHLLTNKMVRSFRNVRQEEISLMMEKIQKSSS 164



>gb:AP001298_1820969 Arabidopsis thaliana genomic DNA, chromosome 3,
           BAC clone:F20C19.
          Length = 510

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 47/156 (30%), Positives = 81/156 (51%), Gaps = 10/156 (6%)
 Frame = +1

Query: 205 IFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVIWLR 384
           +FL   L+  L  KK     R         +IGN+  LG  PHQ++  +  KYG V+ L+
Sbjct: 10  LFLSCLLLAALRLKKRRQHQRKPPSPPGFPIIGNLHQLGELPHQSLWSLSKKYGPVMLLK 69

Query: 385 IGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGY-YMG---------SLAFAPY 534
            GS+ T+ + S++ A +  K HD++   R  +  +K + Y Y+G          + F+P+
Sbjct: 70  FGSIPTVVVSSSETAKQALKIHDLNCCSRPSLAGLKQKSYDYLGPRALSYNYLDIVFSPF 129

Query: 535 GSYWRVLRRICTVELFVHKRINETVPVRRKCIDDML 642
             YW+ LRR+C  ELF  K+++   P+R + +  ++
Sbjct: 130 NDYWKELRRMCVQELFSPKQVHLIQPIREEEVKKLM 165



>sp|Q9STK7|C71Q_ARATH Cytochrome P450 71A26 (EC
           1.14.-.-).>pir|T06715|T06715 probable cytochrome P450
           T29H11.210 - Arabidopsis thaliana>gb:ATT29H11_1555639
           Arabidopsis thaliana DNA chromosome 3, BAC clone T29H11.
          Length = 489

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 47/160 (29%), Positives = 81/160 (50%)
 Frame = +1

Query: 187 YLVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYG 366
           +L+ S IF++  ++F   ++K               +IGN+  LG  PH+++  + ++YG
Sbjct: 6   FLLCSIIFVVTIIIF--RKQKRGKKRNTLPSPPGLPLIGNLHQLGRHPHRSLCSLSHRYG 63

Query: 367 SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW 546
            ++ L  G V  + + SA+ A ++ K HD  FA R    + +   Y    +A APYG YW
Sbjct: 64  PLMLLHFGRVPVLVVSSAELARDVLKTHDRVFASRPRSKIFEKLLYDKHDVASAPYGEYW 123

Query: 547 RVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS 666
           R ++ +C + LF +K +     VR + I  M+  I K  S
Sbjct: 124 RQMKSVCVLHLFSNKMVRSFREVREEEISLMMEKIRKSIS 163



>gb:AP003990_1836014 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1073_F05.>gb:AP004000_1836161 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1115_B01.
          Length = 509

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 50/165 (30%), Positives = 86/165 (52%), Gaps = 3/165 (1%)
 Frame = +1

Query: 184 KYLVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDL---GAFPHQTIAEMK 354
           +YL+   + ++P L    +  + S   R         VIG++  L   GA  H+ + +M 
Sbjct: 7   EYLLLLPLLVVPLLYLAASSSRRSGRLRLPPGPWALPVIGHLHHLALAGAPTHRAMRDMA 66

Query: 355 NKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPY 534
            ++G ++ LR   +  +   S  AA E+ + HDV+FA R +  ++++       + FAPY
Sbjct: 67  RRHGPLMLLRFCELPVVVASSPDAAREIMRTHDVAFASRPIGPMLRLVFQGAEGVIFAPY 126

Query: 535 GSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS 669
           G  WR LR+ICTVEL  H+R++   PVR   +  +L  +  +A+S
Sbjct: 127 GDGWRQLRKICTVELLSHRRVHSFRPVRADELGRLLRAVADQAAS 171



>gb:AP003571_1831049 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0458E02.
          Length = 518

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 52/157 (33%), Positives = 81/157 (51%), Gaps = 7/157 (4%)
 Frame = +1

Query: 193 VWSAIFLIPGLVFLLARKKSSSSYRXXXXXXX------XXVIGNMLDL-GAFPHQTIAEM 351
           ++  + L+  L   LAR++ SS+                 VIG++  L G  PHQ + ++
Sbjct: 8   LYLGLALVSLLAVQLARRRRSSAAHGSGALRLPPGPWQLPVIGSLHHLVGKLPHQAMRDL 67

Query: 352 KNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAP 531
             ++G V+ LR+G V T+ + S +AA E+ K HDVSFA R +    +V       + FAP
Sbjct: 68  ARRHGPVMMLRLGEVPTLVVSSPEAAREVTKTHDVSFATRPLSSTTRVFSNGGRDIVFAP 127

Query: 532 YGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDML 642
           YG YWR LR+I   EL   +R+     +R + +  ML
Sbjct: 128 YGDYWRQLRKITVTELLSARRVASFRAIREEEVAAML 164



>gb:AY333420_1600105 Ipomoea purpurea flavonoid 3'-hydroxylase
           (F3'H) gene, F3'H-pink allele, complete cds.
          Length = 323

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 58/198 (29%), Positives = 96/198 (48%)
 Frame = +1

Query: 190 LVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGS 369
           L++  +     L FL+ R K               V+GN+  LG  PHQ+IA M  ++G 
Sbjct: 6   LIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMAERHGP 65

Query: 370 VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR 549
           ++ LR+G V  +   SA  AA+  K HD +F++R      +   Y    L FAPYG  WR
Sbjct: 66  LMHLRMGFVDVVVAASAAVAAQFLKVHDANFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR 125

Query: 550 VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNL 729
           +LR+I +V LF  K +++   VR+    + +  + +  +S  + T V +   + + T N 
Sbjct: 126 MLRKITSVHLFSAKALDDFCHVRQ----EEVATLTRSLASAGK-TPVKLGQLLNVCTTNA 180

Query: 730 LGNLFLSRDLVDPMSDKA 783
           L  + L R + +    K+
Sbjct: 181 LARVMLGRKVFNDGGSKS 198



>gb:AB113262_1527233 Ipomoea purpurea Pink mRNA for flavonoid
           3'-hydroxylase, complete cds.>gb:AB113265_1527236
           Ipomoea purpurea Pink gene for flavonoid 3'-hydroxylase,
           complete cds, strain: YO/FP-39.>gb:AY333419_1600104
           Ipomoea purpurea flavonoid 3'-hydroxylase (F3'H) gene,
           F3'H-purple allele, complete cds.
          Length = 519

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 58/198 (29%), Positives = 96/198 (48%)
 Frame = +1

Query: 190 LVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGS 369
           L++  +     L FL+ R K               V+GN+  LG  PHQ+IA M  ++G 
Sbjct: 6   LIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMAERHGP 65

Query: 370 VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR 549
           ++ LR+G V  +   SA  AA+  K HD +F++R      +   Y    L FAPYG  WR
Sbjct: 66  LMHLRMGFVDVVVAASAAVAAQFLKVHDANFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR 125

Query: 550 VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNL 729
           +LR+I +V LF  K +++   VR+    + +  + +  +S  + T V +   + + T N 
Sbjct: 126 MLRKITSVHLFSAKALDDFCHVRQ----EEVATLTRSLASAGK-TPVKLGQLLNVCTTNA 180

Query: 730 LGNLFLSRDLVDPMSDKA 783
           L  + L R + +    K+
Sbjct: 181 LARVMLGRKVFNDGGSKS 198



>sp|P93531|C7D7_SOLCH Cytochrome P450 71D7 (EC
           1.14.-.-).>pir|T10499|T10499 probable cytochrome P450
           (clone pGHgen) - Chaco potato>gb:SCU48435_1710436
           Solanum chacoense putative cytochrome P450 gene,
           complete cds.
          Length = 500

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 46/144 (31%), Positives = 77/144 (53%), Gaps = 5/144 (3%)
 Frame = +1

Query: 202 AIFLIPGLVFLLARKK----SSSSYRXXXXXXXXXVIGNMLDL-GAFPHQTIAEMKNKYG 366
           +IFL    +FLL + K    +S + +          IG M  L G  PH+ + ++  KYG
Sbjct: 5   SIFLFISFLFLLRKWKKYLNNSQTKKLPPGPWKLPFIGGMHHLAGGLPHRVLRDLAEKYG 64

Query: 367 SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW 546
            ++ L++G VS + + S + A ++ K HD++FA R  +  M +  Y    +AF+PYG YW
Sbjct: 65  PLMHLQLGEVSAVVVTSPEMAKQVLKTHDIAFASRPKLLAMDIICYNRRDIAFSPYGDYW 124

Query: 547 RVLRRICTVELFVHKRINETVPVR 618
           R +R+IC +E+   K +     +R
Sbjct: 125 RQMRKICIMEVLSAKSVRSFSSIR 148



>sp|Q9LTM0|C72N_ARATH Cytochrome P450 71B23 (EC
           1.14.-.-).>gb:AB024038_1515899 Arabidopsis thaliana
           genomic DNA, chromosome 3, P1 clone:
           MTC11.>gb:BT015161_1642131 Arabidopsis thaliana
           At3g26210 gene, complete cds.
          Length = 501

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 56/209 (26%), Positives = 97/209 (46%), Gaps = 8/209 (3%)
 Frame = +1

Query: 187 YLVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYG 366
           +L +  + L+  +  +  RK  SS  +         +IGN+  L   PH+ +  +   +G
Sbjct: 4   FLCFLLLLLLLLVTIIFTRKSQSSKLKLPPGPPKLPIIGNLHYLNGLPHKCLLNLWKIHG 63

Query: 367 SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW 546
            V+ L++G V  + I S +AA E+ K HD+    R      K   Y    + FAPYG  W
Sbjct: 64  PVMQLQLGYVPLVVISSNQAAEEVLKTHDLDCCSRPETIASKTISYNFKDIGFAPYGEEW 123

Query: 547 RVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTF- 723
           R LR++  +ELF  K+ N    +R +  +D+L+    EAS  Q    +  A F   ++  
Sbjct: 124 RALRKLAVIELFSLKKFNSFRYIREE-ENDLLVKKLSEASEKQSPVNLKKALFTLSASIV 182

Query: 724 -------NLLGNLFLSRDLVDPMSDKASK 789
                  NL  + F+  D ++ ++ ++ K
Sbjct: 183 CRLAFGQNLHESEFIDEDSMEDLASRSEK 211



>gb:AF426451_1799114 Citrus sinensis cytochrome P450 mRNA, partial
           cds.
          Length = 500

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 49/155 (31%), Positives = 83/155 (53%)
 Frame = +1

Query: 205 IFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVIWLR 384
           + LIP L+ +L + K+ +  +         VIGN   LG  PHQ++ ++  KYG V+ L+
Sbjct: 1   LLLIP-LLLILKKLKAQNKQQLPPSPPKLPVIGNFHQLGELPHQSLWQLSKKYGPVMLLK 59

Query: 385 IGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRI 564
           +G V  + I SA+AA ++ K HD+    R  +       Y    +AF+PY  YWR LR+I
Sbjct: 60  LGRVPLVVISSAEAARDVLKVHDLDCCSRPPLIGSGKFTYNYSDIAFSPYSDYWRELRKI 119

Query: 565 CTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS 669
             +E+F  +R+     +R + +  ++  I + +SS
Sbjct: 120 SVLEVFSLRRVQSFGFIREEEVALLMNSISESSSS 154



>gb:AE016959_1021114 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC116603_1739336
           Oryza sativa (japonica cultivar-group) chromosome 10
           clone OSJNBb0015J03, complete
           sequence.>gb:AC131375_1741010 Oryza sativa (japonica
           cultivar-group) chromosome 10 clone OSJNAb0015J03,
           complete sequence.>gb:AE017061_1750933 Oryza sativa
           (japonica cultivar-group) chromosome 10, section 15 of
           77 of the complete sequence.
          Length = 999

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 55/175 (31%), Positives = 89/175 (50%), Gaps = 1/175 (0%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IG++  LG  PH+++A +   YG ++ LR+G+V+T+ + S   A E  + HD  FA R+
Sbjct: 468 LIGSLHLLGDQPHRSLAGLAKTYGPLMSLRLGAVTTVVVSSPDVAREFLQKHDAVFATRS 527

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
             D      +   S+A  P    WR LR+I   ELF   R++    +R++ + ++   ++
Sbjct: 528 APDAS--GDHARNSVALLPNSPRWRELRKIMATELFSTSRLDALHELRQEKVVEL---VD 582

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASK-FFDAMTGIM 816
             A   + G  V V    F ++ NLL +   SRDL       ASK F   +T IM
Sbjct: 583 HVARLAREGAAVDVGRVAFTTSLNLLSHTIFSRDLTSLDDHGASKEFQQVVTDIM 637



 Score = 83.2 bits (204), Expect = 5e-15
 Identities = 54/175 (30%), Positives = 88/175 (50%), Gaps = 1/175 (0%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IG++  LG  PH+++A +   YG ++ LR+G+V+T+ + S   A E  + HD  FA R+
Sbjct: 41  LIGSLHLLGDQPHRSLAGLAKTYGPLMSLRLGAVTTVVVSSPDVAREFLQKHDAVFATRS 100

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
             D      +   S+ + P G  WR LR+I   EL    R++    +R++ + ++   ++
Sbjct: 101 APDA--AGDHTRNSVPWLPPGPRWRELRKIMATELLATHRLDALHELRQEKVSEL---VD 155

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASK-FFDAMTGIM 816
             A   + G  V V    F ++ NLL     SRDL       ASK F   +T IM
Sbjct: 156 HVARLARDGAAVDVGRVAFTTSLNLLSRTIFSRDLTSLDDRGASKEFQQVVTDIM 210



>gb:AE016959_1021085 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC078944_1541624
           Genomic Sequence for Oryza sativa, Nipponbare strain,
           clone OSJNBa0089D15, from Chromosome 10, complete
           sequence.>gb:AE017061_1750904 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 15 of 77 of the
           complete sequence.
          Length = 419

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 48/155 (30%), Positives = 83/155 (53%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IG++  LG  PH+++A +   YG ++ LR+G+V+T+ + S   A E  + H+ +FA R+
Sbjct: 40  LIGSLHLLGDQPHRSLAGLAKMYGPLMSLRLGAVTTVVVSSPDVAREFLQRHNAAFASRS 99

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
           V D      +   S+A+ P    WR LRRI   ELF   R++    +RR+ + +++  + 
Sbjct: 100 VPDA--TGDHATNSVAWLPNSPRWRALRRIMAAELFAPHRLDALRRLRREKVQELVDHVA 157

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDL 759
           + A        V V    F ++ NLL +   SR+L
Sbjct: 158 RLAEREGGAAAVDVGRVAFATSLNLLSSTIFSRNL 192



>sp|P93530|C7D6_SOLCH Cytochrome P450 71D6 (EC
           1.14.-.-).>pir|T10493|T10493 probable cytochrome P450
           (clone pGH1) - Chaco potato>gb:SCU48434_1710435 Solanum
           chacoense cytochrome P450 mRNA, complete cds.
          Length = 501

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 54/181 (29%), Positives = 91/181 (50%), Gaps = 5/181 (2%)
 Frame = +1

Query: 202 AIFLIPGLVFLLAR----KKSSSSYRXXXXXXXXXVIGNMLDL-GAFPHQTIAEMKNKYG 366
           +IFL    +FLL +     K+S + +          IG+M  L G  PH+ + ++  KYG
Sbjct: 5   SIFLFICFLFLLRKWKKYSKNSQTKKLPPGPWKLPFIGSMHHLAGGRPHRVLRDLAKKYG 64

Query: 367 SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW 546
            ++ L++G VS + + S   A E+ K HD++FA R  +  M +  Y    +AF+PYG YW
Sbjct: 65  PLMHLQLGEVSAVVVTSPDMAKEVLKTHDIAFASRPKLLAMDIICYDRCDIAFSPYGEYW 124

Query: 547 RVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFN 726
           + +R+IC  E+   K +     +R    D+++  I+   SS   G  V+    V   T +
Sbjct: 125 KQMRKICVTEVLSAKSVRSFSSIR---CDEVVRLIDSIQSSSSSGELVNFKERVIWFTSS 181

Query: 727 L 729
           +
Sbjct: 182 M 182



>gb:AP003571_1831056 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0458E02.
          Length = 504

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 60/209 (28%), Positives = 101/209 (48%), Gaps = 7/209 (3%)
 Frame = +1

Query: 190 LVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDL-GAFPHQTIAEMKNKYG 366
           LV   + ++P + F    ++     R         VIG++  L GA PH  + ++  ++G
Sbjct: 9   LVLVPLAVVPFVYFNRVARRRGGDVRLPPSPWGLPVIGHLHHLVGALPHVAMRDLARRHG 68

Query: 367 SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGS-LAFAPYGSY 543
            ++ LR+G +  +   SA+AA E+ K  D+ FA R +  + ++     G  + FAPYG  
Sbjct: 69  PLMLLRLGELPVVVASSAEAAREVMKTRDLDFATRPMSRMARLVFPEGGEGIIFAPYGDR 128

Query: 544 WRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHV-----AHFV 708
           WR LR+ICTVEL   +R+    PVR +    +L    +  ++   G  V++     AH  
Sbjct: 129 WRELRKICTVELLSGRRVQSFRPVREEEAGRLL----RAVAAASPGQAVNLSELLSAHAA 184

Query: 709 FLSTFNLLGNLFLSRDLVDPMSDKASKFF 795
             S   ++G+ F  RD    M ++  K F
Sbjct: 185 DSSVRAIMGDRFRDRDAFLAMLERGLKLF 213



>pir|T05735|T05735 cytochrome P450 71A10 -
           soybean>gb:AF022157_1761781 Glycine max cytochrome P450
           monooxygenase CYP71A10 (CYP71A10) mRNA, complete cds.
          Length = 513

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 56/204 (27%), Positives = 98/204 (48%)
 Frame = +1

Query: 193 VWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSV 372
           V+  IFLI  L+ L+ R K    Y          +IGN+  LG  PH++   + +KYG +
Sbjct: 23  VFFCIFLI--LLQLIRRNK----YNLPPSPPKIPIIGNLHQLGTLPHRSFHALSHKYGPL 76

Query: 373 IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRV 552
           + L++G + T+ + SA  A E+ K HDV F++R      K+ GY    +AF  Y   WR 
Sbjct: 77  MMLQLGQIPTLVVSSADVAREIIKTHDVVFSNRRQPTAAKIFGYGCKDVAFVYYREEWRQ 136

Query: 553 LRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLL 732
             + C VEL   K++     +R++ + +++  I +   S +    V++   +  ++ +++
Sbjct: 137 KIKTCKVELMSLKKVRLFHSIRQEVVTELVEAIGEACGSER--PCVNLTEMLMAASNDIV 194

Query: 733 GNLFLSRDLVDPMSDKASKFFDAM 804
               L R   D      S  F A+
Sbjct: 195 SRCVLGRKCDDACGGSGSSSFAAL 218



>sp|Q9STL2|C71L_ARATH Cytochrome P450 71A21 (EC
           1.14.-.-).>pir|T06710|T06710 probable cytochrome P450
           T29H11.160 - Arabidopsis thaliana>gb:ATT29H11_1555644
           Arabidopsis thaliana DNA chromosome 3, BAC clone T29H11.
          Length = 490

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 48/153 (31%), Positives = 85/153 (55%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  LG  PH+++  + ++YG ++ L +G V  + + SA  A ++ K HD  FA R 
Sbjct: 41  LIGNLHQLGHHPHRSLCSLSHRYGPLMLLHLGRVPVLVVSSADVARDILKTHDRVFASRP 100

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
              + +   Y    +AFAPYG YWR ++ +C + L  +K +     VR++ I  M+  I+
Sbjct: 101 RSKLFEKLFYDGRDVAFAPYGEYWRQIKSVCVLRLLSNKMVTSFRNVRQEEISLMMEKIQ 160

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSR 753
           K +SS+Q    V+V+  +   T +++  + L R
Sbjct: 161 K-SSSLQ----VNVSELLGSLTNDVISRIALGR 188



>gb:AX028821_1457170 Sequence 5 from Patent WO9732023.
          Length = 512

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 51/166 (30%), Positives = 82/166 (49%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+  LG  PHQ++A +   +G +I L++G V  +   SA  A +  K HD +F+ R 
Sbjct: 52  IVGNLPHLGPKPHQSMAALARVHGPLIHLKMGFVHVVVASSASVAEKFLKVHDANFSSRP 111

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                K   Y    L FAPYG  WR+LR+IC + LF  K +N+   VR+  +  +L  + 
Sbjct: 112 PNSGAKHVAYNYQDLVFAPYGPRWRMLRKICALHLFSAKALNDFTHVRQDEV-GILTRVL 170

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKF 792
            +A      T + +   +     N +  + L R +V     KA +F
Sbjct: 171 ADAGE----TPLKLGQMMNTCATNAIARVMLGRRVVGHADSKAEEF 212



>gb:AC120537_1739920 Oryza sativa chromosome 3 BAC OSJNBb0042N11
           genomic sequence, complete sequence.
          Length = 515

 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 40/100 (40%), Positives = 59/100 (59%)
 Frame = +1

Query: 319 GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQ 498
           G  PH+ + E+  +YG+++ LR G+V T+ + SA+AA E+ K HD  FA R +   + V 
Sbjct: 62  GDLPHRALRELAGRYGALMLLRFGAVPTLVVSSAEAAREVLKTHDACFASRHMTPTLAVF 121

Query: 499 GYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVR 618
                 + F+PYG  WR LRRIC +ELF  +R+     VR
Sbjct: 122 TRGGRDILFSPYGDLWRQLRRICVLELFSARRVQSLRHVR 161



>sp|Q9LIP6|C72V_ARATH Cytochrome P450 71B34 (EC
           1.14.-.-).>gb:AP001298_1820966 Arabidopsis thaliana
           genomic DNA, chromosome 3, BAC clone:F20C19.
          Length = 500

 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 46/160 (28%), Positives = 83/160 (51%), Gaps = 2/160 (1%)
 Frame = +1

Query: 193 VW--SAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYG 366
           +W  S IF+I  LV +   K   +  R         +IGN+  LG  PHQ++ ++  KYG
Sbjct: 4   IWLLSLIFVICILVAVFNHKNRRNYQRTPPSPPGCPIIGNLHQLGELPHQSLWKLSKKYG 63

Query: 367 SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW 546
            V+ L++G V T+ + S++ A +  K HD+    R      +   Y    +AF+PY  YW
Sbjct: 64  PVMLLKLGRVPTVIVSSSETAKQALKIHDLHCCSRPGFAGARELSYNYLDIAFSPYDDYW 123

Query: 547 RVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS 666
           + +R++   ELF  K+++   P++ + +  ++  I + A+
Sbjct: 124 KEVRKLAVQELFSSKQVHSIQPIKDEEVKKLIDSISESAA 163



>gb:AP003571_1831055 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0458E02.
          Length = 539

 Score = 83.2 bits (204), Expect = 5e-15
 Identities = 52/170 (30%), Positives = 86/170 (50%), Gaps = 9/170 (5%)
 Frame = +1

Query: 193 VWSAIFLIPGLVFLLARKKSS--------SSYRXXXXXXXXXVIGNMLDL-GAFPHQTIA 345
           V+  + L+   V LLAR++ S           R         +IG++  L G  PH+ + 
Sbjct: 9   VYVGLALVSLFVVLLARRRRSPPPAAHGDGGLRLPPGPWTLPIIGSLHHLVGQIPHRAMR 68

Query: 346 EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAF 525
           ++  ++G V+ LRIG V T+ + S  AA E+ K HD +FA R +   ++V       L F
Sbjct: 69  DLARRHGPVMLLRIGEVPTLVVSSRDAAREVTKTHDTAFAMRPLSATLRVLTNGGRDLVF 128

Query: 526 APYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ 675
           APYG YWR +R+I   EL   +R++    +R + +  +L  +   A +V+
Sbjct: 129 APYGDYWRQVRKIAVTELLTARRVHSFRSIREEEVAALLRAVAVAAGTVE 178



>gb:AB052131_1521171 Asparagus officinalis Asp-3 mRNA for cytochrome
           P450, complete cds.
          Length = 498

 Score = 83.2 bits (204), Expect = 5e-15
 Identities = 45/151 (29%), Positives = 81/151 (53%)
 Frame = +1

Query: 190 LVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGS 369
           L+   + L+P L+ ++ R+KS+SS +         +IGN+  LG+ PHQ++  +  KYG 
Sbjct: 3   LILVILLLLPILLLVIRREKSTSS-KLPPCPPKLPLIGNLHQLGSLPHQSLHALSVKYGP 61

Query: 370 VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR 549
           ++ L++G + T+ + S+  A E+ + HD  FA R  +    +       + FAPYG +WR
Sbjct: 62  LMLLKLGEIPTLIVSSSDMAREIMRTHDHIFASRPSLLTSDILLNGATDVVFAPYGEHWR 121

Query: 550 VLRRICTVELFVHKRINETVPVRRKCIDDML 642
            +R++C   L   K +     +R + +  ML
Sbjct: 122 QMRKLCVNHLLSAKMVQSFRLMREEEVSSML 152



>gb:AC135564_1742594 Oryza sativa chromosome 3 BAC OSJNBb0056O10
           genomic sequence, complete sequence.
          Length = 511

 Score = 82.8 bits (203), Expect = 7e-15
 Identities = 53/152 (34%), Positives = 81/152 (53%), Gaps = 12/152 (7%)
 Frame = +1

Query: 223 LVFLLARKKS----SSSYRXXXXXXXXXVIGNMLDL-----GAFPHQTIAEMKNKYGSVI 375
           LV L+AR  S     S+ R         +IG++  L     G  PH+ + E+   YG ++
Sbjct: 17  LVELIARYASPSGRESALRLPPGPSQLPLIGSLHHLLLSRYGDLPHRAMRELSLTYGPLM 76

Query: 376 WLRIGSVSTMAILSAKAAAELFKNHDVSFADR---TVIDVMKVQGYYMGSLAFAPYGSYW 546
            LR+G+V T+ + SA+AAAE+ + HD +FA R     ID++   G     + F PY   W
Sbjct: 77  LLRLGAVPTLVVSSAEAAAEVMRAHDAAFAGRHLSATIDILSCGGK---DIIFGPYTERW 133

Query: 547 RVLRRICTVELFVHKRINETVPVRRKCIDDML 642
           R LR++C +ELF H+R+    PVR   +  +L
Sbjct: 134 RELRKVCALELFNHRRVLSFRPVREDEVGRLL 165



>sp|O64635|C7C4_ARATH Cytochrome P450 76C4 (EC
           1.14.-.-).>pir|T00868|T00868 probable cytochrome P450
           [imported] - Arabidopsis thaliana>gb:AC003680_1531187
           Arabidopsis thaliana chromosome 2 BAC F17K2 genomic
           sequence, complete sequence.
          Length = 511

 Score = 82.8 bits (203), Expect = 7e-15
 Identities = 47/176 (26%), Positives = 95/176 (53%), Gaps = 1/176 (0%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  +G  PH + A++   YG ++ L+ G ++++ I S +AA E+ + HD   + R 
Sbjct: 47  IIGNIHQVGKNPHSSFADLAKIYGPIMSLKFGCLNSVVITSPEAAREVLRTHDQILSGRK 106

Query: 475 VIDVMKVQGYYMGSLAFAPYGS-YWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
             D ++  G+   S+ + P  S  WR+LR++    +F  +R   T  +R K + +++ ++
Sbjct: 107 SNDSIRCFGHEEVSVIWLPPSSARWRMLRKLSVTLMFSPQRTEATKALRMKKVQELVSFM 166

Query: 652 EKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ 819
            +   S +R   V ++   + +  N++ N+  S DL    S K+++F D + G M+
Sbjct: 167 NE---SSERKEAVDISRASYTTVLNIISNILFSVDLGSYDSKKSNEFQDTVIGAME 219



>gb:AF321864_1786044 Lolium rigidum clone Lol-5-v putative
           cytochrome P450 mRNA, complete cds.
          Length = 513

 Score = 82.4 bits (202), Expect = 9e-15
 Identities = 52/172 (30%), Positives = 89/172 (51%)
 Frame = +1

Query: 166 EMEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIA 345
           EME     L + ++  +  LV L++RK SS   R         V      L + PH  + 
Sbjct: 4   EMEPSSATLFFLSVVTLVILVSLVSRKPSSKLRRPPGPRDLPFVGSLHHLLTSQPHVALR 63

Query: 346 EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAF 525
            +   +G V+ LR+G V  + + S+ AA E+ +++D+SFA R  +   ++  Y    +AF
Sbjct: 64  NLAKTHGPVMRLRLGQVEAVVVSSSAAAQEVLRDNDLSFASRPNLLATEIMCYGNLDVAF 123

Query: 526 APYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRG 681
           APYG+YWR L+++C +EL   +++ +  PVR    D   + + KE  +  +G
Sbjct: 124 APYGAYWRALKKLCVLELLSSRKVRQFKPVR----DSETMSLIKEICAAGKG 171



>gb:AP005419_1851474 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0046G12.>gb:AP005570_1854236 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OJ1344_B01.
          Length = 514

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 47/157 (29%), Positives = 78/157 (49%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           VIGN+  +G  PH++I  +  KYG +++LR GS   +   S + A    K HDV F DR 
Sbjct: 44  VIGNLNLVGTLPHRSIHNLSKKYGPLMYLRFGSFPVVVGSSVEMAKFFLKTHDVVFTDRP 103

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                K   Y    + ++PYG+YWR  R++C  ELF  KR+     +R + +  +L  + 
Sbjct: 104 KTAAGKHTTYNYSDITWSPYGAYWRQARKMCLTELFSAKRLESYEYIRGEEVRALLRDLH 163

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVD 765
             A  V     V +  ++   + N++  + L +  +D
Sbjct: 164 GAAGGV-----VVLKDYLSTVSLNVITRMVLGKKYLD 195



>gb:AP003990_1836015 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1073_F05.>gb:AP004000_1836162 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1115_B01.
          Length = 518

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 55/178 (30%), Positives = 91/178 (51%), Gaps = 7/178 (3%)
 Frame = +1

Query: 295 VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR 471
           VIG++  L G  PH+ ++ +  ++G+++ LR+G V  +   S  AA ++ + HD +FA R
Sbjct: 49  VIGHLHHLAGDLPHRALSALARRHGALMLLRLGEVQAVVASSPDAARDIMRTHDAAFASR 108

Query: 472 TVIDVMKVQ-GYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLW 648
            +  + ++  G     + FAPYG  WR LR+ICT EL   +R+    PVR   +  +L  
Sbjct: 109 PLSPMQQLAYGRDAEGVIFAPYGDGWRHLRKICTAELLSARRVQSFRPVREAELGRLLRS 168

Query: 649 IEKEASSVQRGTGVH----VAHFVFLSTFN-LLGNLFLSRDLVDPMSDKASKFFDAMT 807
           + +  SS    + V+    ++ FV  ST   ++G+ F  RD    M     K    MT
Sbjct: 169 VAEATSSSSSASLVNLTELISAFVADSTVRAIIGSRFEHRDAYLRMLQDGLKIVPGMT 226



>gb:AB045592_1520403 Perilla frutescens PFSII3 mRNA for flavone
           synthase II, complete cds.
          Length = 506

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 54/191 (28%), Positives = 97/191 (50%), Gaps = 5/191 (2%)
 Frame = +1

Query: 193 VWSAIFLIPGLVF--LLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYG 366
           +++A+FL+   V   +L RK+    Y          +IG++  LG   HQT  ++  +YG
Sbjct: 3   LYAALFLLSAAVVRSVLDRKRGRPPYPPGPFPLP--IIGHLHLLGPRLHQTFHDLSQRYG 60

Query: 367 SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR---TVIDVMKVQGYYMGSLAFAPYG 537
            ++ LR+GS+  +   S + A E  K H++ F+ R   T ID++     Y  S AF+PYG
Sbjct: 61  PLMQLRLGSIRCVIAASPELAKECLKTHELVFSSRKHSTAIDIVT----YDSSFAFSPYG 116

Query: 538 SYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLS 717
            YW+ ++++CT EL   + +    P+R   +   L  + ++  S   G   +V   +   
Sbjct: 117 PYWKFIKKLCTYELLGARNLAHFQPIRTLEVKSFLQILMRKGES---GESFNVTEELVKL 173

Query: 718 TFNLLGNLFLS 750
           T N++ ++ LS
Sbjct: 174 TSNVISHMMLS 184



>pir|T00605|T00605 probable cytochrome P450 At2g02580 [imported] -
           Arabidopsis thaliana
          Length = 512

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 48/172 (27%), Positives = 86/172 (50%), Gaps = 14/172 (8%)
 Frame = +1

Query: 193 VW--SAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYG 366
           +W  S +FL   L+     KK  ++ +         +IGN+  LG  PHQ++  +   YG
Sbjct: 4   IWFLSLLFLCCILLAAFKHKKRRTNQQQPPSPPGFPIIGNLHQLGELPHQSLWSLSKTYG 63

Query: 367 SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVM------------KVQGYYM 510
            V+ L++GSV T+ + S++ A ++ K +D+    R  +  +            K   Y  
Sbjct: 64  PVMLLKLGSVPTVVVSSSETAKQVLKINDLHCCSRPSLAELNKNHDFDHSLGAKELSYNY 123

Query: 511 GSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS 666
             +AF+P+  YW+ LRRIC  ELF  KR++   P++ + +  +++   + AS
Sbjct: 124 LDIAFSPFDDYWKELRRICVQELFSAKRVHSIQPIKEEEVRKLIVSATESAS 175



>sp|O04773|C756_CAMME Flavonoid 3',5'-hydroxylase (EC 1.14.-.-)
           (F3'5'H) (Cytochrome P450 75A6).>gb:D14590_1674472
           Campanula medium mRNA for flavonoid 3',5'-hydroxylase,
           complete cds.
          Length = 523

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 46/153 (30%), Positives = 80/153 (52%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IG +  LG  PH ++A+M  KYG +++L++GS  T+   + KAA    K HD +F++R 
Sbjct: 47  IIGALPLLGTMPHVSLADMAVKYGPIMYLKLGSKGTVVASNPKAARAFLKTHDANFSNRP 106

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
           +        Y    + FA YG  W++LR++C++ +   K + +   V+   +  ML  + 
Sbjct: 107 IDGGPTYLAYNAQDMVFAEYGPKWKLLRKLCSLHMLGPKALEDWAHVKVSEVGHMLKEM- 165

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSR 753
            E SS      V V   +  +  N++G + LSR
Sbjct: 166 YEQSSKSVPVPVVVPEMLTYAMANMIGRIILSR 198



>sp|P58045|C71E_ARATH Cytochrome P450 71A14 (EC 1.14.-.-).
          Length = 497

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 39/124 (31%), Positives = 69/124 (55%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           VIGN+  L   PH+++  + ++YG ++ L  G V  + + S+  A +L K HD+  A+R 
Sbjct: 42  VIGNLHQLSLHPHRSLRSLSHRYGPLMLLHFGRVPVLVVSSSDVAHDLMKTHDLKVANRP 101

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
            + V++        + F+PYG YWR ++ +C V L   K++     VR + I +M+  +E
Sbjct: 102 QLKVVEKIFNGGREMVFSPYGEYWRQIKSVCIVNLLNKKKVQSFEKVREEEISEMMERVE 161

Query: 655 KEAS 666
           K +S
Sbjct: 162 KASS 165



>gb:AB005249_1509673 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MXM12.
          Length = 151

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 49/144 (34%), Positives = 72/144 (50%)
 Frame = +1

Query: 190 LVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGS 369
           L+ + +FLI  L     R+  S + R         +IGN+  +G  PH+T++ M   YG 
Sbjct: 9   LLATVLFLI--LRIFSHRRNRSHNNRLPPGPNPWPIIGNLPHMGTKPHRTLSAMVTTYGP 66

Query: 370 VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR 549
           ++ LR+G V  +   S   A +  K HD +FA R      K   Y    L FAPYG  WR
Sbjct: 67  ILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGHRWR 126

Query: 550 VLRRICTVELFVHKRINETVPVRR 621
           +LR+I +V LF  K + +   VR+
Sbjct: 127 LLRKISSVHLFSAKALEDFKHVRQ 150



>gb:AX028825_1457172 Sequence 9 from Patent WO9732023.
          Length = 150

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 49/144 (34%), Positives = 72/144 (50%)
 Frame = +1

Query: 190 LVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGS 369
           L+ + +FLI  L     R+  S + R         +IGN+  +G  PH+T++ M   YG 
Sbjct: 9   LLATVLFLI--LRIFSHRRNRSHNNRLPPGPNPWPIIGNLPHMGTKPHRTLSAMVTTYGP 66

Query: 370 VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR 549
           ++ LR+G V  +   S   A +  K HD +FA R      K   Y    L FAPYG  WR
Sbjct: 67  ILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGHRWR 126

Query: 550 VLRRICTVELFVHKRINETVPVRR 621
           +LR+I +V LF  K + +   VR+
Sbjct: 127 LLRKISSVHLFSAKALEDFKHVRQ 150



>pir|T52173|T52173 cytochrome P450 monooxygenase [imported] -
           Arabidopsis thaliana>gb:D78605_1674787 Arabidopsis
           thaliana mRNA for cytochrome P450 monooxygenase,
           complete cds, clone P450-48.
          Length = 502

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 47/185 (25%), Positives = 93/185 (50%)
 Frame = +1

Query: 202 AIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVIWL 381
           ++  I   +FL  ++  +S +          +IGN+  L   PH+   ++  KYG +++L
Sbjct: 11  SLLTIVSSIFL--KQNKTSKFNLPPSPSSLPIIGNLHHLAGLPHRCFHKLSIKYGPLVFL 68

Query: 382 RIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRR 561
           R+GSV  + I S++AA  + K +D+    R          Y    + FAPYG YWR +R+
Sbjct: 69  RLGSVPVVVISSSEAAEAVLKTNDLECCSRPKTVGSGKLSYGFKDITFAPYGEYWREVRK 128

Query: 562 ICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNL 741
           +  +ELF  K++     +R + +D +   ++K + S  + + V ++   F  T +++  +
Sbjct: 129 LAVIELFSSKKVQSFRYIREEEVDFV---VKKVSESALKQSPVDLSKTFFSLTASIICRV 185

Query: 742 FLSRD 756
            L ++
Sbjct: 186 ALGQN 190



>sp|O65788|C722_ARATH Cytochrome P450 71B2 (EC
           1.14.-.-).>pir|H86264|H86264 cytochrome P450
           monooxygenase F3F19.10 - Arabidopsis
           thaliana>gb:AE005172_890319 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:BT003811_1636942 Arabidopsis thaliana clone
           C105429 putative cytochrome P450 monooxygenase
           (At1g13080) mRNA, complete cds.>gb:F3F19_1678233
           Arabidopsis thaliana chromosome 1 BAC F3F19 sequence,
           complete sequence.
          Length = 502

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 47/185 (25%), Positives = 93/185 (50%)
 Frame = +1

Query: 202 AIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVIWL 381
           ++  I   +FL  ++  +S +          +IGN+  L   PH+   ++  KYG +++L
Sbjct: 11  SLLTIVSSIFL--KQNKTSKFNLPPSPSSLPIIGNLHHLAGLPHRCFHKLSIKYGPLVFL 68

Query: 382 RIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRR 561
           R+GSV  + I S++AA  + K +D+    R          Y    + FAPYG YWR +R+
Sbjct: 69  RLGSVPVVVISSSEAAEAVLKTNDLECCSRPKTVGSGKLSYGFKDITFAPYGEYWREVRK 128

Query: 562 ICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNL 741
           +  +ELF  K++     +R + +D +   ++K + S  + + V ++   F  T +++  +
Sbjct: 129 LAVIELFSSKKVQSFRYIREEEVDFV---VKKVSESALKQSPVDLSKTFFSLTASIICRV 185

Query: 742 FLSRD 756
            L ++
Sbjct: 186 ALGQN 190



>gb:AP003571_1831052 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0458E02.
          Length = 512

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 48/146 (32%), Positives = 77/146 (52%), Gaps = 8/146 (5%)
 Frame = +1

Query: 211 LIPGLVFLLARKKSSSS-------YRXXXXXXXXXVIGNMLDL-GAFPHQTIAEMKNKYG 366
           L+  LV L AR++ S++        R         VIG++  L G  PH+ + ++  ++G
Sbjct: 12  LVSLLVVLFARRRRSAAAAHGDAGLRLPPGPWQLPVIGSLHHLAGKLPHRAMRDLARRHG 71

Query: 367 SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW 546
            V+ LR+G V T+ + S  AA E+ + HD +FA R +   ++        +AFAPYG YW
Sbjct: 72  PVMMLRLGEVPTLVVSSRDAAREVMRTHDAAFASRPLSASVRAATKGGRDIAFAPYGDYW 131

Query: 547 RVLRRICTVELFVHKRINETVPVRRK 624
           R LR+I   EL   +R+    P+R +
Sbjct: 132 RQLRKIAVTELLSARRVLSFRPIREE 157



>gb:CAR249799_1645174 Cicer arietinum partial mRNA for cytochrome
           P450 monooxygenase (cyp gene).
          Length = 437

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 52/150 (34%), Positives = 84/150 (56%)
 Frame = +1

Query: 370 VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR 549
           V+ L++G V+T+ I SA  A E+   HD+  ++RTV D + V  +   SL+F      WR
Sbjct: 5   VMTLKLGQVTTVVISSADMAKEVLLTHDLITSNRTVPDALSVLNHDQYSLSFMRVSPRWR 64

Query: 550 VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNL 729
            LR+IC  +LF +K ++ +  +RR+ + D+L  IE+  S V  G  V V    F +T NL
Sbjct: 65  DLRKICNYQLFSNKTLDSSQALRRRKLQDLLNDIER-CSKV--GEAVDVGKAAFKTTVNL 121

Query: 730 LGNLFLSRDLVDPMSDKASKFFDAMTGIMQ 819
           L N F S D V   + +A ++ + +  I++
Sbjct: 122 LSNTFFSVDFVH-SAKEAGEYKEIIVSILK 150



>pir|T50525|T50525 cytochrome P450 monooxygenase-like protein -
           Arabidopsis thaliana>gb:ATT27I15_1555538 Arabidopsis
           thaliana DNA chromosome 3, BAC clone T27I15.
          Length = 498

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 45/168 (26%), Positives = 92/168 (54%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++ N+L     PH+++A++   YGSV+  ++G ++T+ I S + A E+ K HD   + R 
Sbjct: 42  LLRNILQTVEKPHRSLADLSRIYGSVMSFKLGCLTTVVISSPETAKEVLKTHDHVLSYRV 101

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
             D ++  G++  SL + P  + WR LR+I   +LF  +R+  T  +R + + +++ ++ 
Sbjct: 102 SSDPVRAAGHHELSLLWIPPLARWRFLRKITRNQLFSTQRLEATSAIRTRKVQELMNFVN 161

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFD 798
           K     +R   V+++   F+++ N++ N   S +L +   D +  F D
Sbjct: 162 K---CCERREAVNISRASFITSLNIISNALFSTNLAN--FDDSKTFHD 204



>pir|T10896|T10896 cytochrome P450 (EC 1.14.-.-) 81B1c - Jerusalem
           artichoke>gb:HTCYP81C_1682163 Helianthus tuberosus mRNA
           for cytochrome P450, CYP81B1c.
          Length = 505

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 55/186 (29%), Positives = 99/186 (53%), Gaps = 1/186 (0%)
 Frame = +1

Query: 178 EWKYLVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKN 357
           E  YL+ + + L+   ++LL R++SS+            +IG++  L    ++T+A++  
Sbjct: 2   EIPYLLTTTLLLLFTTLYLLLRRRSSTL--PPTIFPSLPIIGHLYLLKPPLYRTLAKLSA 59

Query: 358 KYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYG 537
           K+G ++ L++G    + + S  AA E F  +D+ FA+R  +   K+ G    SLA++PYG
Sbjct: 60  KHGQILRLQLGFRRVLIVSSPSAAEECFTKNDIVFANRPKMLFGKIIGVNYTSLAWSPYG 119

Query: 538 SYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLS 717
             WR LRRI ++E+    R+NE   +R   +++  L I+K  S+   G+      F F  
Sbjct: 120 DNWRNLRRIASIEILSIHRLNEFHDIR---VEETRLLIQKLLSACNSGSSQVTMKFSFYE 176

Query: 718 -TFNLL 732
            T N++
Sbjct: 177 LTLNVM 182



>gb:AP004326_1840217 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OJ1294_F06.
          Length = 523

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 38/101 (37%), Positives = 58/101 (57%)
 Frame = +1

Query: 316 LGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKV 495
           LG+ PH  + E+  +YG V+ LR+G V T+ + S +AA E+ K HD +FA R V     +
Sbjct: 56  LGSLPHHAMRELSRRYGPVMLLRLGHVRTLVLSSPEAAREVMKTHDAAFATRAVTPTASI 115

Query: 496 QGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVR 618
             Y    + FAP+  + R LR++CT+EL   +R+     VR
Sbjct: 116 LTYGARDIVFAPFSKHLRELRKLCTLELLSPRRVRSFRHVR 156



>gb:AK118163_1816156 Arabidopsis thaliana At2g45580 mRNA for
           putative cytochrome P450, complete cds, clone:
           RAFL19-48-E18.
          Length = 515

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 42/167 (25%), Positives = 89/167 (53%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+  LG  PH+++A     YG ++ L++G ++ + I S +AA E  + HD   + RT
Sbjct: 47  LVGNIFQLGFNPHRSLAAFSKTYGPIMSLKLGRLTAVVISSPEAAKEALRTHDHVMSART 106

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
             D ++   ++  S+ + P  + WR L++  T  L   + ++    +R + +++++  + 
Sbjct: 107 FNDALRAFDHHKHSIVWIPPSARWRFLKKTITKYLLSPQNLDAIQSLRMRKVEELVSLVN 166

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFF 795
           +     +RG  + +A   F+++FN++ N   S DL    S+ +S  F
Sbjct: 167 EFR---ERGEAIDLARASFVTSFNIISNALFSVDLATYDSNSSSYEF 210



>gb:AF156976_1773054 Gerbera hybrida flavone synthase II (CYP93B2)
           mRNA, complete cds.
          Length = 511

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 51/187 (27%), Positives = 100/187 (53%), Gaps = 5/187 (2%)
 Frame = +1

Query: 205 IFLIPGLVFL--LARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVIW 378
           +F  P L+FL  L  K++ +  R         +IG++  LG   HQ+   +  +YGS+I 
Sbjct: 10  LFFFPTLLFLYCLPYKRNQNHRRLPPSPPSFPIIGHLHHLGPLIHQSFHALSTRYGSLIH 69

Query: 379 LRIGSVSTMAILSAKAAAELFKNHDVSFADR---TVIDVMKVQGYYMGSLAFAPYGSYWR 549
           LR+GSV  + + +   A +  K ++++F+ R     ID +     Y  + AFAPYG+YW+
Sbjct: 70  LRLGSVPCVVVSTPDLAKDFLKTNELAFSSRKHSLAIDHIT----YGVAFAFAPYGTYWK 125

Query: 550 VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNL 729
            ++++ TVEL   + ++  +P+R   I ++L  +  ++ + +R   V++   +   T N+
Sbjct: 126 FIKKLFTVELLGTQNLSHFLPIRTHEIRELLRTLMVKSRAKER---VNLTEELLKLTNNV 182

Query: 730 LGNLFLS 750
           +  + +S
Sbjct: 183 ISQMMMS 189



>gb:CRO238612_1673464 Catharanthus roseus mRNA for cytochrome P450.
          Length = 495

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 45/147 (30%), Positives = 82/147 (55%), Gaps = 2/147 (1%)
 Frame = +1

Query: 295 VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR 471
           ++GN   L G   H  + ++  KYG ++ L+IG VST+   S + A E+F+ HD+ FADR
Sbjct: 35  ILGNAHQLSGGHTHHILRDLAKKYGPLMHLKIGEVSTIVASSPQIAEEIFRTHDILFADR 94

Query: 472 -TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLW 648
            + ++  K+  Y    +  +PYG+YWR LR+I  +EL   K +     +R    +++L +
Sbjct: 95  PSNLESFKIVSYDFSDMVVSPYGNYWRQLRKISMMELLSQKSVQSFRSIRE---EEVLNF 151

Query: 649 IEKEASSVQRGTGVHVAHFVFLSTFNL 729
           I+   S  + GT ++++  + L  + +
Sbjct: 152 IKSIGS--KEGTRINLSKEISLLIYGI 176



>gb:AB047809_1520669 Arabidopsis thaliana YLS6 mRNA for cytochrome
           P450 (CYP76C2), partial cds.
          Length = 174

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 43/164 (26%), Positives = 91/164 (55%), Gaps = 1/164 (0%)
 Frame = +1

Query: 331 HQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYM 510
           H + A++   YG ++ L+ GS++T+ + S +AA E+ + +D   + RT  + ++   +  
Sbjct: 1   HHSFADLSKTYGPIMSLKFGSLNTVVVTSPEAAREVLRTYDQILSSRTSTNSIRSINHDK 60

Query: 511 GSLAFAP-YGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTG 687
            S+ + P   S WR+LR++   +LF  +RI  T  +R   + +++ ++   + S +R   
Sbjct: 61  VSVVWLPPSSSRWRLLRKLSATQLFSPQRIEATKTLRENKVKELVSFM---SESSEREEA 117

Query: 688 VHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ 819
           V ++   F++  N++ N+  S DL +  S+K+  F D + G+M+
Sbjct: 118 VDISRATFITALNIISNILFSVDLGNYDSNKSGGFQDTVIGVME 161



>gb:AB028152_1517808 Torenia hybrida TFNS5 mRNA for cytochrome P450,
           complete cds.
          Length = 512

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 52/189 (27%), Positives = 96/189 (50%), Gaps = 3/189 (1%)
 Frame = +1

Query: 193 VWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSV 372
           +++A+F+I     LL R++   S           +IG++  LG   H T  E   KYG +
Sbjct: 8   LYTALFVITTTFLLLLRRRGPPS---PPGPLSLPIIGHLHLLGPRLHHTFHEFSLKYGPL 64

Query: 373 IWLRIGSVSTMAILSAKAAAELFKNHDVSFADR---TVIDVMKVQGYYMGSLAFAPYGSY 543
           I L++GS+  +   + + A E  K ++++F+ R   T ID++     Y  S AF+PYG Y
Sbjct: 65  IQLKLGSIPCVVASTPELAREFLKTNELAFSSRKHSTAIDIVT----YDSSFAFSPYGPY 120

Query: 544 WRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTF 723
           W+ ++++CT EL   + +    P+R   +   L  +  ++    +G  V+V   +   T 
Sbjct: 121 WKYIKKLCTYELLGARNLGHFQPIRNLEVRSFLQLLMHKSF---KGESVNVTDELVRLTS 177

Query: 724 NLLGNLFLS 750
           N++ ++ LS
Sbjct: 178 NVISHMMLS 186



>pir|T00871|T00871 probable cytochrome P450 At2g45580 [imported] -
           Arabidopsis thaliana>gb:AC003680_1531190 Arabidopsis
           thaliana chromosome 2 BAC F17K2 genomic sequence,
           complete sequence.
          Length = 507

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 42/167 (25%), Positives = 89/167 (53%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+  LG  PH+++A     YG ++ L++G ++ + I S +AA E  + HD   + RT
Sbjct: 39  LVGNIFQLGFNPHRSLAAFSKTYGPIMSLKLGRLTAVVISSPEAAKEALRTHDHVMSART 98

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
             D ++   ++  S+ + P  + WR L++  T  L   + ++    +R + +++++  + 
Sbjct: 99  FNDALRAFDHHKHSIVWIPPSARWRFLKKTITKYLLSPQNLDAIQSLRMRKVEELVSLVN 158

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFF 795
           +     +RG  + +A   F+++FN++ N   S DL    S+ +S  F
Sbjct: 159 EFR---ERGEAIDLARASFVTSFNIISNALFSVDLATYDSNSSSYEF 202



>sp|O64638|C7C3_ARATH Cytochrome P450 76C3 (EC 1.14.-.-).
          Length = 515

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 42/167 (25%), Positives = 89/167 (53%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+  LG  PH+++A     YG ++ L++G ++ + I S +AA E  + HD   + RT
Sbjct: 47  LVGNIFQLGFNPHRSLAAFSKTYGPIMSLKLGRLTAVVISSPEAAKEALRTHDHVMSART 106

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
             D ++   ++  S+ + P  + WR L++  T  L   + ++    +R + +++++  + 
Sbjct: 107 FNDALRAFDHHKHSIVWIPPSARWRFLKKTITKYLLSPQNLDAIQSLRMRKVEELVSLVN 166

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFF 795
           +     +RG  + +A   F+++FN++ N   S DL    S+ +S  F
Sbjct: 167 EFR---ERGEAIDLARASFVTSFNIISNALFSVDLATYDSNSSSYEF 210



>gb:AF022460_1761995 Glycine max cytochrome P450 monooxygenase
           CYP83D1p (CYP83D1) mRNA, partial cds.
          Length = 516

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 44/154 (28%), Positives = 84/154 (54%), Gaps = 1/154 (0%)
 Frame = +1

Query: 295 VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR 471
           +IGN+  L  + PH  + ++   +G ++  R+G+V T+ + SA+ A ++ K HD++FA R
Sbjct: 38  LIGNLHQLHNSSPHLCLWQLAKLHGPLMSFRLGAVQTVVVSSARIAEQILKTHDLNFASR 97

Query: 472 TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
            +    +   Y    + FAPYG YWR ++++C V LF  +R+    P+R   +  M+  +
Sbjct: 98  PLFVGPRKLSYDGLDMGFAPYGPYWREMKKLCIVHLFSAQRVRSFRPIRENEVAKMVRKL 157

Query: 652 EKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSR 753
            +  +S   GT V++   +   T +L+  + L +
Sbjct: 158 SEHEAS---GTVVNLTETLMSFTNSLICRIALGK 188



>gb:AB028151_1517807 Antirrhinum majus AFNS2 mRNA for cytochrome
           P450, complete cds.
          Length = 506

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 52/189 (27%), Positives = 93/189 (49%), Gaps = 3/189 (1%)
 Frame = +1

Query: 190 LVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGS 369
           LV+S +F++  L+  L  +    +           +IG++  LG   H T  +   +YG 
Sbjct: 4   LVYSTLFILSTLLLTLLTRTRRKT--RPPGPLALPLIGHLHLLGPKLHHTFHQFSQRYGP 61

Query: 370 VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR---TVIDVMKVQGYYMGSLAFAPYGS 540
           +I L +GSV  +   + + A E  K H++ F+ R   T ID++     Y  S AFAPYG 
Sbjct: 62  LIQLYLGSVPCVVASTPELAREFLKTHELDFSSRKHSTAIDIVT----YDSSFAFAPYGP 117

Query: 541 YWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLST 720
           YW+ ++++CT EL   + ++   P+R   ++  L  + ++    Q    V+V   +   T
Sbjct: 118 YWKFIKKLCTYELLGARNLSHFQPIRALEVNSFLRILYEKTEQKQ---SVNVTEELVKLT 174

Query: 721 FNLLGNLFL 747
            N++ N+ L
Sbjct: 175 SNVISNMML 183



>pir|T05940|T05940 cytochrome P450 83D1p - soybean (fragment)
          Length = 516

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 44/154 (28%), Positives = 84/154 (54%), Gaps = 1/154 (0%)
 Frame = +1

Query: 295 VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR 471
           +IGN+  L  + PH  + ++   +G ++  R+G+V T+ + SA+ A ++ K HD++FA R
Sbjct: 38  LIGNLHQLHNSSPHLCLWQLAKLHGPLMSFRLGAVQTVVVSSARIAEQILKTHDLNFASR 97

Query: 472 TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
            +    +   Y    + FAPYG YWR ++++C V LF  +R+    P+R   +  M+  +
Sbjct: 98  PLFVGPRKLSYDGLDMGFAPYGPYWREMKKLCIVHLFSAQRVRSFRPIRENEVAKMVRKL 157

Query: 652 EKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSR 753
            +  +S   GT V++   +   T +L+  + L +
Sbjct: 158 SEHEAS---GTVVNLTETLMSFTNSLICRIALGK 188



>pir|T06713|T06713 probable cytochrome P450 T29H11.190 - Arabidopsis
           thaliana>gb:ATT29H11_1555641 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T29H11.
          Length = 512

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 41/121 (33%), Positives = 67/121 (55%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +I N+  LG  PH+++  + ++YG ++ L  GSV  + + SA AA ++ K HD  FA R 
Sbjct: 40  LIRNLHQLGRHPHRSLCSLSHRYGPLMLLHFGSVPVLVVSSADAAKDVLKTHDRVFASRP 99

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
              +     Y    +A APYG YWR ++ +C + LF +K +     VR+   +++ L IE
Sbjct: 100 RSKIFDKIFYNGRDVALAPYGEYWRQMKSVCVLHLFSNKMVRSFRDVRQ---EEISLMIE 156

Query: 655 K 657
           K
Sbjct: 157 K 157



>sp|O65787|C726_ARATH Cytochrome P450 71B6 (EC
           1.14.-.-).>pir|T52172|T52172 probable cytochrome P450
           At2g24180 [imported] - Arabidopsis
           thaliana>gb:AC005967_1533272 Arabidopsis thaliana
           chromosome 2 clone F27D4 map CIC06C07, complete
           sequence.>gb:AY054534_1563188 Arabidopsis thaliana
           putative cytochrome P450 (At2g24180; F27D4.9) mRNA,
           complete cds.>gb:AY064632_1566083 Arabidopsis thaliana
           putative cytochrome P450 (At2g24180; F27D4.9) mRNA,
           complete cds.>gb:D78604_1674786 Arabidopsis thaliana
           mRNA for cytochrome P450 monooxygenase, complete cds,
           clone P450-23.
          Length = 503

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 51/161 (31%), Positives = 81/161 (50%), Gaps = 1/161 (0%)
 Frame = +1

Query: 190 LVWSAIFLIPGL-VFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYG 366
           L W  + LIP L +F L R    S            ++GN+  LG+ PH+++ ++  KYG
Sbjct: 13  LPWLLLLLIPPLLIFFLLR----SPKNLPPGPPRLPILGNIHQLGSLPHRSLRDLSLKYG 68

Query: 367 SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW 546
            VI + +GSV T+ + S + A E+ K HD     R  + + K   Y    L F  +G Y+
Sbjct: 69  PVITVYLGSVRTVVVHSPETAEEVLKLHDSECCTRPKLSITKSFFYDGLGLGFTKWGDYY 128

Query: 547 RVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS 669
           R +R++C +ELF  KR N    +R + +  ++      ASS
Sbjct: 129 RDVRKLCVLELFSVKRANSFRNIREEELSRLVNSFSDSASS 169



>sp|Q9STK9|C71O_ARATH Cytochrome P450 71A24 (EC 1.14.-.-).
          Length = 486

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 41/121 (33%), Positives = 67/121 (55%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +I N+  LG  PH+++  + ++YG ++ L  GSV  + + SA AA ++ K HD  FA R 
Sbjct: 40  LIRNLHQLGRHPHRSLCSLSHRYGPLMLLHFGSVPVLVVSSADAAKDVLKTHDRVFASRP 99

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
              +     Y    +A APYG YWR ++ +C + LF +K +     VR+   +++ L IE
Sbjct: 100 RSKIFDKIFYNGRDVALAPYGEYWRQMKSVCVLHLFSNKMVRSFRDVRQ---EEISLMIE 156

Query: 655 K 657
           K
Sbjct: 157 K 157



>gb:AP005308_1850270 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0047B10.>gb:AP005575_1854330 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OJ1596_C06.
          Length = 510

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 47/168 (27%), Positives = 85/168 (50%), Gaps = 3/168 (1%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+ DL    H  +A +  ++G V+ L++G+ + +   SA AA +  + +D   A R 
Sbjct: 46  LLGNVFDLRGELHLALARLAEEHGPVMSLKLGTATAVVASSAAAARDALQRYDHVLAARA 105

Query: 475 VIDVMKVQGYYMGSLAFAPYGS-YWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
           V D  +  G +  S+ + P  S  W+ LR +CT  LF  + ++ T  VR   + +++  +
Sbjct: 106 VCDAARALGTHERSIVWLPGSSALWKRLRAVCTNHLFSARGLDATRAVREAKVRELVEHL 165

Query: 652 EKEASSV--QRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASK 789
              A+    +    V V   VF +  NL+ N+  S D+ D  SD+A +
Sbjct: 166 RGHAAGAGEEEAAAVDVGRVVFSAVINLVSNVLFSEDVADLSSDRAQE 213



>gb:AF346833_1789996 Mentha x piperita menthofuran synthase mRNA,
           complete cds.
          Length = 493

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 50/146 (34%), Positives = 72/146 (49%), Gaps = 1/146 (0%)
 Frame = +1

Query: 190 LVWSAIFLIPGLVFLLARKKS-SSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYG 366
           LV+ ++ LI   V    RK S SS  R         VIG+   +GA  H++   +  +YG
Sbjct: 5   LVFFSVSLILLAVLFHKRKSSLSSRKRPPPSPLRLPVIGHFHLIGALSHRSFTSLSKRYG 64

Query: 367 SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW 546
            V+ L  GS   +   SA AA E+ KN DV FA R  + +     Y    +AFAPYG +W
Sbjct: 65  EVMLLHFGSAPVLVASSAAAAREIMKNQDVIFASRPRLSIFDRLMYSGKGVAFAPYGEHW 124

Query: 547 RVLRRICTVELFVHKRINETVPVRRK 624
           R  R +C ++L   KR+     +R +
Sbjct: 125 RNARSMCMLQLLSAKRVQSFGGIREE 150



>sp|O49342|C71D_ARATH Cytochrome P450 71A13 (EC
           1.14.-.-).>pir|E84712|E84712 probable cytochrome P450
           [imported] - Arabidopsis thaliana>gb:AC002340_1530535
           Arabidopsis thaliana chromosome 2 BAC T11J7 genomic
           sequence, complete sequence.
          Length = 497

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 43/127 (33%), Positives = 68/127 (53%), Gaps = 2/127 (1%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           VIGN+  L   PH+++  +  +YG ++ L  G V  + + S +AA E+ K HD  FA+R 
Sbjct: 42  VIGNLHQLSLHPHRSLRSLSLRYGPLMLLHFGRVPILVVSSGEAAQEVLKTHDHKFANRP 101

Query: 475 VIDVMKVQGYYMG--SLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLW 648
                 V G   G   + FAPYG YWR ++ +C + L  +K +     VR   ++ M+  
Sbjct: 102 --RSKAVHGLMNGGRDVVFAPYGEYWRQMKSVCILNLLTNKMVESFEKVREDEVNAMIEK 159

Query: 649 IEKEASS 669
           +EK +SS
Sbjct: 160 LEKASSS 166



>gb:AP004326_1840219 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OJ1294_F06.
          Length = 552

 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 43/135 (31%), Positives = 72/135 (53%)
 Frame = +1

Query: 316 LGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKV 495
           LG+ PH  + E+  +YG V+ LR+G V T+ + S +AA E+ K HDV+FA+R V     +
Sbjct: 86  LGSLPHHAMRELSRRYGPVMLLRLGHVRTLVLSSPEAAREVMKTHDVAFANRAVTPTASI 145

Query: 496 QGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ 675
                  + FAP+G + R LR++C +EL   +R+     VR    ++        A++  
Sbjct: 146 ------DIVFAPFGKHLRELRKLCALELLSPRRVRSFRHVRE---EEAARLARSVAAAAS 196

Query: 676 RGTGVHVAHFVFLST 720
             + V+V+  V + T
Sbjct: 197 ASSAVNVSELVKIMT 211



>gb:AK118875_1816829 Arabidopsis thaliana At2g30750 mRNA for
           putative cytochrome P450, complete cds, clone:
           RAFL21-20-H20.
          Length = 421

 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 40/127 (31%), Positives = 70/127 (55%), Gaps = 2/127 (1%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  L   PH+++  +  +YG ++ L  G V  + + S +AA E+ K HD+ FA+R 
Sbjct: 48  LIGNLHQLSLHPHRSLHSLSLRYGPLMLLHFGRVPILVVSSGEAAQEVLKTHDLKFANRP 107

Query: 475 VIDVMKVQGYYMG--SLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLW 648
                 V G   G   + F PYG YWR ++ +C + L  +K +     +R + +++M+  
Sbjct: 108 --RSKAVHGLMNGGRDVVFGPYGEYWRQMKSVCILNLLTNKMVASFEKIREEELNEMIKK 165

Query: 649 IEKEASS 669
           +EK +SS
Sbjct: 166 LEKASSS 172



>gb:AF122821_1769853 Capsicum annuum cytochrome P450 (PepCYP) mRNA,
           complete cds.
          Length = 502

 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 48/154 (31%), Positives = 77/154 (50%), Gaps = 3/154 (1%)
 Frame = +1

Query: 169 MEWEWKYLVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDL---GAFPHQT 339
           ME ++  LV   +FL    + LL +K  +              IG++  L   G  PH  
Sbjct: 1   MEIQFTNLVAFLLFL--SSIILLLKKWKTQKLNLPPGPWKLPFIGSLHHLAVAGPLPHHG 58

Query: 340 IAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSL 519
           +  +   YG ++ LR+G + T+ I S + A E+ K HD++FA R  + V  +  Y    +
Sbjct: 59  LKNLAKLYGPLMHLRLGEIPTVIISSPRMAKEVLKTHDLAFATRPKLVVADIVHYDSTDI 118

Query: 520 AFAPYGSYWRVLRRICTVELFVHKRINETVPVRR 621
           AF+PYG YWR +R+IC +EL   K +     +R+
Sbjct: 119 AFSPYGEYWRQIRKICILELLSAKMVKFFSSIRQ 152



>gb:AY192573_1588679 Catharanthus roseus cytochrome P450 71D1
           (CYP71D1) mRNA, partial cds.
          Length = 495

 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 35/111 (31%), Positives = 66/111 (59%), Gaps = 2/111 (1%)
 Frame = +1

Query: 295 VIGNM--LDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFAD 468
           ++GN+  + +G+ PH+ + ++  K+G ++ L++G  + + + S + A E+ K HD+SF +
Sbjct: 35  ILGNLHNMMMGSVPHRLLRDLAKKHGDLMLLKLGEFNAIVVSSPRMAKEVLKTHDLSFLN 94

Query: 469 RTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRR 621
           R +I   K+  Y    L F+ YG  WR +R+I  +EL   KR+    P+R+
Sbjct: 95  RPIIQAPKILCYDNSDLVFSQYGDSWREMRKIFVLELLSTKRVRSFQPIRQ 145



>gb:AY094484_1575777 Arabidopsis thaliana At2g30750/T11J7.14 mRNA,
           complete cds.>gb:BT001046_1635301 Arabidopsis thaliana
           At2g30750/T11J7.14 mRNA, complete cds.
          Length = 503

 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 40/127 (31%), Positives = 70/127 (55%), Gaps = 2/127 (1%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  L   PH+++  +  +YG ++ L  G V  + + S +AA E+ K HD+ FA+R 
Sbjct: 48  LIGNLHQLSLHPHRSLHSLSLRYGPLMLLHFGRVPILVVSSGEAAQEVLKTHDLKFANRP 107

Query: 475 VIDVMKVQGYYMG--SLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLW 648
                 V G   G   + F PYG YWR ++ +C + L  +K +     +R + +++M+  
Sbjct: 108 --RSKAVHGLMNGGRDVVFGPYGEYWRQMKSVCILNLLTNKMVASFEKIREEELNEMIKK 165

Query: 649 IEKEASS 669
           +EK +SS
Sbjct: 166 LEKASSS 172



>gb:AB010697_1511191 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MOJ9.
          Length = 507

 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 38/125 (30%), Positives = 75/125 (60%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IG++  LG   HQ + ++  +YG +++L IGS+  + + SA+ A E+ K+++++F +R 
Sbjct: 43  IIGHIHLLGPIAHQALHKLSIRYGPLMYLFIGSIPNLIVSSAEMANEILKSNELNFLNRP 102

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
            +  +    Y       APYG +W+ ++RIC VELF  + ++  V VR + +  +L+ + 
Sbjct: 103 TMQNVDYLTYGSADFFSAPYGLHWKFMKRICMVELFSSRALDSFVSVRSEELKKLLIRVL 162

Query: 655 KEASS 669
           K+A +
Sbjct: 163 KKAEA 167



>gb:AE016959_1021729 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC021892_1538791
           Genomic sequence for Oryza sativa, Nipponbare strain,
           clone OSJNBa0053D03, from chromosome 10, complete
           sequence.>gb:AC131968_1741080 Oryza sativa (japonica
           cultivar-group) chromosome 10 clone OSJNAa0053D03,
           complete sequence.>gb:AE017074_1751548 Oryza sativa
           (japonica cultivar-group) chromosome 10, section 28 of
           77 of the complete sequence.
          Length = 526

 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 44/135 (32%), Positives = 71/135 (52%), Gaps = 1/135 (0%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           V+GN+  LG  PH T+  +  +YG +  LR G    +   SA  AA+  + HD +F++R 
Sbjct: 50  VLGNLPQLGDKPHHTMCALARQYGPLFRLRFGCAEVVVAASAPVAAQFLRGHDANFSNRP 109

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI- 651
                +   Y    L FAPYG+ WR LR++C + LF  K +++   VR   +  M+  + 
Sbjct: 110 PNSGAEHVAYNYQDLVFAPYGARWRALRKLCALHLFSAKALDDLRAVREGEVALMVRNLA 169

Query: 652 EKEASSVQRGTGVHV 696
            ++A+SV  G   +V
Sbjct: 170 RQQAASVALGQEANV 184



>sp|Q9LTL0|C72Q_ARATH Cytochrome P450 71B26 (EC
           1.14.-.-).>gb:AB024038_1515909 Arabidopsis thaliana
           genomic DNA, chromosome 3, P1 clone:
           MTC11.>gb:AY128393_1580692 Arabidopsis thaliana
           cytochrome P450, putative (At3g26290) mRNA, complete
           cds.>gb:BT008871_1640067 Arabidopsis thaliana At3g26290
           mRNA, complete cds.
          Length = 500

 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 41/153 (26%), Positives = 80/153 (52%), Gaps = 4/153 (2%)
 Frame = +1

Query: 193 VWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSV 372
           + S +F I  L+    ++K+   +R         +IGN+  LG   HQ++ ++  KYG V
Sbjct: 6   ILSLLFFIIFLLLAAFKRKNHGKHRRIPSPPGFPIIGNLHQLGELQHQSLWKLSKKYGPV 65

Query: 373 IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRV 552
           + L++G V T+ + S++ A +  +++D+    R  +   +   Y    ++ +PY  YW+ 
Sbjct: 66  MLLKLGKVPTLILSSSETAKQALRDYDLHCCSRPSLAGGRELSYNNLDMSSSPYNEYWKE 125

Query: 553 LRRICTVELFVHKRINETVPVR----RKCIDDM 639
           LR++C+ ELF   +I    P++    +K ID +
Sbjct: 126 LRKLCSQELFSANKIQSIQPIKDEEVKKVIDSI 158



>sp|O49340|C71C_ARATH Cytochrome P450 71A12 (EC
           1.14.-.-).>pir|C84712|C84712 probable cytochrome P450
           [imported] - Arabidopsis thaliana>gb:AC002340_1530533
           Arabidopsis thaliana chromosome 2 BAC T11J7 genomic
           sequence, complete sequence.
          Length = 497

 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 40/127 (31%), Positives = 70/127 (55%), Gaps = 2/127 (1%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  L   PH+++  +  +YG ++ L  G V  + + S +AA E+ K HD+ FA+R 
Sbjct: 42  LIGNLHQLSLHPHRSLHSLSLRYGPLMLLHFGRVPILVVSSGEAAQEVLKTHDLKFANRP 101

Query: 475 VIDVMKVQGYYMG--SLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLW 648
                 V G   G   + F PYG YWR ++ +C + L  +K +     +R + +++M+  
Sbjct: 102 --RSKAVHGLMNGGRDVVFGPYGEYWRQMKSVCILNLLTNKMVASFEKIREEELNEMIKK 159

Query: 649 IEKEASS 669
           +EK +SS
Sbjct: 160 LEKASSS 166



>gb:AB036772_1519050 Triticum aestivum N-1 mRNA for cytochrome P450,
           complete cds.
          Length = 514

 Score = 79.3 bits (194), Expect = 8e-14
 Identities = 45/147 (30%), Positives = 81/147 (55%), Gaps = 1/147 (0%)
 Frame = +1

Query: 295 VIGNMLD-LGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR 471
           VIG++   + A PH+T+ ++  ++G ++ LR+G V  + + +A AAA + K HD+ F DR
Sbjct: 47  VIGSLHHVISALPHRTMMQLSCRHGPLMLLRLGEVPAVVVSTADAAALVMKTHDLVFVDR 106

Query: 472 TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
                M +       + FAPYG +WR +R+IC V+L    +++    VR + +  +L  I
Sbjct: 107 PRSPTMDIASSGGKDIVFAPYGGHWRQMRKICVVQLLSSTQVSRMEGVRAEEVGSLLRDI 166

Query: 652 EKEASSVQRGTGVHVAHFVFLSTFNLL 732
              AS+   G  ++V+  V   T +++
Sbjct: 167 TAAAST---GATINVSEKVMALTNDIV 190



>pir|F86460|F86460 probable cytochrome P450 [imported] - Arabidopsis
           thaliana>gb:AE005172_892178 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC010164_1536951 Arabidopsis thaliana
           chromosome I BAC F14M2 genomic sequence, complete
           sequence.
          Length = 511

 Score = 79.3 bits (194), Expect = 8e-14
 Identities = 45/176 (25%), Positives = 93/176 (52%), Gaps = 1/176 (0%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  +G  PH +  ++   YG V+ L++G ++++ I S  A  E+ K HD   + R 
Sbjct: 47  IIGNIHLVGKNPHHSFTDLSKTYGPVMSLKLGCLNSVVIASRDAVREVLKTHDQILSGRY 106

Query: 475 VIDVMKVQGYYMGSLAFA-PYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
           + +  K   ++  S+ +  P  S +R+LR++   +LF  + I  T  +R K + +++ ++
Sbjct: 107 ISEATKSNNHHEFSVGWIHPSSSRFRMLRKLSATQLFSPQCIQATKALRMKKVQELVNFL 166

Query: 652 EKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ 819
              + S +R   V ++H  F++  N++ N+  S +L    S  +S F + + G  +
Sbjct: 167 ---SESCEREEAVDISHVSFVTALNIISNILFSVNLGSYDSKNSSAFQEMVIGYQE 219



>gb:AP006461_1862010 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0104B02.
          Length = 500

 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 50/176 (28%), Positives = 88/176 (50%), Gaps = 1/176 (0%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+L+L       +A +   YG V+ L++G  +T+ I S  AA E F  HD   A RT
Sbjct: 43  LVGNLLNLRGHLPPALARLARTYGPVMMLKMGLTTTVVISSGDAAREAFTKHDRHLAART 102

Query: 475 VIDVMKVQGYYMGSLAFAPYG-SYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
           V+DV +   +   S+ + P   + W+ LR +    +F  + +     VR   + D++ + 
Sbjct: 103 VLDVTRSLDFADRSMIWLPSSDTVWKTLRGVTAASIFSPRGLAALRGVRESKVRDLVGYF 162

Query: 652 EKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIMQ 819
              A  V     V V H V+    +L+ + F S D+VD  ++  ++F  +MT +M+
Sbjct: 163 RGRAGEV-----VDVRHAVYGCMLSLVSSAFFSVDVVDLSAESENEFRQSMTFLME 213



>gb:AP005114_1848113 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0689H05.
          Length = 512

 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 49/164 (29%), Positives = 81/164 (49%), Gaps = 1/164 (0%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+L LG   HQT+A++   +G V+ L++G  + + + SA+AA E +  HD   A R 
Sbjct: 48  LIGNLLCLGGIFHQTLAKLARVHGPVMTLKLGLTTAVVVSSAEAAREAYTKHDQRLAARP 107

Query: 475 VIDVMKVQGYYMGSLAFAPYGS-YWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
           V D  +  G+   S+ F+P     W+ LR I    +F  + +     +R + + D++ +I
Sbjct: 108 VPDAFRANGFSERSIVFSPSSDPQWKNLRGIHATHIFSPRALAALRGIRERKVRDIVGYI 167

Query: 652 EKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKA 783
              A     G  + V   V     NL+   F S D+ D  S+ A
Sbjct: 168 RTVA-----GEEMCVREVVHNGVLNLISTSFFSMDMADVRSESA 206



>gb:AP003434_1829313 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0452F10.
          Length = 551

 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 38/101 (37%), Positives = 61/101 (60%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++G++  LGA PH+ +  +   +G V+ LR+G V  + + SA AA E+ ++ D+ FA R 
Sbjct: 61  LLGHLHLLGALPHRALRSLAAAHGPVLLLRLGRVPVVVVSSAAAAEEVMRSRDMEFASRP 120

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRI 597
            + + ++  Y    +AFAPYG YWR  RRIC V L   +R+
Sbjct: 121 RMAMAELLLYGGRDVAFAPYGEYWRQARRICVVHLLSARRV 161



>gb:HTCYP81L_1682164 Helianthus tuberosus mRNA for cytochrome P450,
           CYP81B1l.
          Length = 520

 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 53/182 (29%), Positives = 98/182 (53%), Gaps = 1/182 (0%)
 Frame = +1

Query: 190 LVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGS 369
           L+++ + L+   ++LL R++ SS+           +IG++  L    ++T+A++  K+G 
Sbjct: 20  LLFTTLLLLFTTLYLLLRRRRSSTLPPTIFPYLP-IIGHLYLLKPPLYRTLAKLSAKHGP 78

Query: 370 VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR 549
           ++ L++G    + + S  AA E F  +D+ FA+R  +   K+ G    SLA++PYG  WR
Sbjct: 79  ILRLQLGFRRVLIVSSPSAAEECFTKNDIVFANRPKMLFGKIIGVNYTSLAWSPYGDNWR 138

Query: 550 VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLS-TFN 726
            LRRI ++E+    R+NE   +R   +++  L I+K  S+   G+      F F   T N
Sbjct: 139 NLRRIASIEILSIHRLNEFHDIR---VEETRLLIQKLLSACNSGSSQVTMKFSFYELTLN 195

Query: 727 LL 732
           ++
Sbjct: 196 VM 197



>gb:AP003571_1831046 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0458E02.
          Length = 526

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 46/153 (30%), Positives = 78/153 (50%), Gaps = 1/153 (0%)
 Frame = +1

Query: 187 YLVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDL-GAFPHQTIAEMKNKY 363
           YL  + + L+   V L  R + +++ R         VIG++  L G  PH  + ++  ++
Sbjct: 16  YLAMAVVALLG--VLLTKRSRKATAQRLPPGPWQLPVIGSLHHLAGKLPHHAMRDLARRH 73

Query: 364 GSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSY 543
           G V+ LR+G V T+ + S +AA E+ + HD  FA R +   ++        +AFAPYG  
Sbjct: 74  GPVMMLRLGEVPTLVVSSPEAAQEVMRTHDAVFATRALSATVRAATMGGRDIAFAPYGDR 133

Query: 544 WRVLRRICTVELFVHKRINETVPVRRKCIDDML 642
           WR LR+I   +L   +R+     +R + +  ML
Sbjct: 134 WRQLRKIAATQLLSARRVASFRAIREEEVATML 166



>gb:AB078781_1523781 Vinca major VFH gene for Flavonoid
           3',5'-hydroxylase, complete cds.
          Length = 505

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 54/209 (25%), Positives = 99/209 (47%), Gaps = 6/209 (2%)
 Frame = +1

Query: 208 FLIPGLVFLLARKKSSSSYRXXXXXXXXX------VIGNMLDLGAFPHQTIAEMKNKYGS 369
           FL   L+F+L +K   + +R               VIG +  LG  PH ++A M  KYG 
Sbjct: 6   FLAAFLIFILTQKLIQTLFRRTYRRKLPPGPKGWPVIGALPYLGTMPHTSLAYMAKKYGP 65

Query: 370 VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR 549
           V++L++G+   + + +  AA    K  D++F++R          Y    + FA YG  W+
Sbjct: 66  VMYLKVGTNDMVVVSTPDAARAFLKTLDINFSNRPPNAGATHLAYGAQDMVFAHYGPKWK 125

Query: 550 VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNL 729
           +LR++  + +   K + +   VR   I ++   +E    S ++G  V VA  +  +  N+
Sbjct: 126 LLRKLSNLHMRGGKALEDWSNVR---ISELGHMLETMYESSKKGEAVVVAEMLTYAMANM 182

Query: 730 LGNLFLSRDLVDPMSDKASKFFDAMTGIM 816
           +G + LSR +       +++F D +  +M
Sbjct: 183 IGQVILSRRVFVTKGSDSNEFKDMVVELM 211



>sp|O04790|C757_EUSGR Flavonoid 3',5'-hydroxylase (EC 1.14.-.-)
           (F3'5'H) (Cytochrome P450 75A7).>gb:AB078957_1523809
           Eustoma grandiflorum EgF3'5'H mRNA for flavonoid
           3',5'-hydroxylase, complete cds.>gb:D14589_1674471
           Eustoma russellianum mRNA for flavonoid
           3',5'-hydroxylase, complete cds.
          Length = 510

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 48/174 (27%), Positives = 86/174 (49%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           V+G +  LG  PH  +A M  KYG V++L++GS       + +AA    K  D++F++R 
Sbjct: 46  VLGALRLLGTMPHVALANMAKKYGPVMYLKVGSCGLAVASTPEAAKAFLKTLDMNFSNRP 105

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                    Y    + FA YG  W++LR++  + +   K +     VR+K +  ML  + 
Sbjct: 106 PNAGATHLAYNAQDMVFADYGPRWKLLRKLSNIHILGGKALQGWEEVRKKELGYMLYAM- 164

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM 816
             A S + G  V V+  +  +  N+LG + LS+ +      ++++F D +  +M
Sbjct: 165 --AESGRHGQPVVVSEMLTYAMANMLGQVMLSKRVFGSQGSESNEFKDMVVELM 216



>sp|Q9SAB6|C71I_ARATH Cytochrome P450 71A18 (EC 1.14.-.-).
          Length = 497

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 41/127 (32%), Positives = 69/127 (54%), Gaps = 2/127 (1%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           VIGN+  L   PH+++  +  +YG ++ L  G V  + + S++AA E+ K HD+ FA+R 
Sbjct: 42  VIGNLHQLSLHPHRSLHSLSLRYGPLMLLHFGRVPILVVSSSEAAHEILKTHDLKFANRP 101

Query: 475 VIDVMKVQGYYMG--SLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLW 648
                 V G   G   + F PYG YWR ++ +C + L  +K +     VR + ++ M+  
Sbjct: 102 --KSKAVHGLMNGGRDVVFGPYGEYWRQMKSVCILNLLTNKMVASFEKVREEEVNAMMEK 159

Query: 649 IEKEASS 669
           +EK + S
Sbjct: 160 LEKASCS 166



>sp|Q9FH66|C71G_ARATH Cytochrome P450 71A16 (EC
           1.14.-.-).>gb:AB022210_1514974 Arabidopsis thaliana
           genomic DNA, chromosome 5, TAC clone:K16E1.
          Length = 497

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 41/153 (26%), Positives = 80/153 (52%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           VIGN+  L   PH+ ++ +  ++G ++ LR G V  + + SA  A ++ K HD+ FA+R 
Sbjct: 41  VIGNLHQLSLHPHRALSSLSARHGPLMLLRFGRVPVLIVSSADVAHDVMKTHDLKFANRP 100

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
           +             L FAPYG YWR ++ +CT+ L  +K +  +   R + I  ++  +E
Sbjct: 101 ITKSAHKISNGGRDLVFAPYGEYWRNVKSLCTIHLLSNKMVQSSEKRREEEITLLMETLE 160

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSR 753
           + + S    + V+++  +     +++G + L +
Sbjct: 161 EASLS---SSSVNLSKLITNMVSDIMGKVVLGK 190



>gb:AP003571_1831053 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0458E02.
          Length = 520

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 48/155 (30%), Positives = 81/155 (52%), Gaps = 6/155 (3%)
 Frame = +1

Query: 223 LVFLLARKKSSSSY-----RXXXXXXXXXVIGNMLDL-GAFPHQTIAEMKNKYGSVIWLR 384
           LV L AR++ S+++     R         VIG++  L G  PH+ + ++  ++G V+ LR
Sbjct: 16  LVVLFARRRRSAAHGDGGLRLPPGPWQLPVIGSLHHLAGKLPHRAMRDLARRHGPVMMLR 75

Query: 385 IGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRI 564
           +G V T+ + S  AA E+ + HD +FA R +   ++V       + FAPYG  WR LR+I
Sbjct: 76  LGEVPTLVVSSRDAAREVMRAHDAAFASRPLSATVRVLTSGGRGIIFAPYGGSWRQLRKI 135

Query: 565 CTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS 669
              EL   +R+     +R + +  ML  +   A++
Sbjct: 136 AVTELLTARRVASFRAIREEEVAAMLRAVAAAAAA 170



>gb:AP003523_1830359 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0416A11.
          Length = 504

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 60/204 (29%), Positives = 101/204 (49%), Gaps = 7/204 (3%)
 Frame = +1

Query: 205 IFLIPGLVFLLA---RKKSSSSYRXXXXXXXXXVIGNMLDL-GAFPHQTIAEMKNKYGSV 372
           +F I  L+FL+    R++   S R         V+G++  L GA  H+ + ++  ++G +
Sbjct: 18  LFFIVPLLFLVCSPRRRRGRGSCRLPPSPWALPVVGHLHHLAGALQHRAMRDIARRHGPL 77

Query: 373 IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGS--LAFAPYGSYW 546
           + LR+G +  +   SA AA E+ +  DV+FA R V  +++V  +  GS  + FAPYG  W
Sbjct: 78  VLLRLGRLPVVVASSADAAREVMRTSDVAFAARPVNRMIRVV-FPEGSEGVIFAPYGETW 136

Query: 547 RVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRG-TGVHVAHFVFLSTF 723
           R LR+ICT EL   +R++    VR +    ML  +   A+      + +  A+    S  
Sbjct: 137 RQLRKICTAELLSARRVHSFRSVREEEAGRMLRAVASAAAQTTVNLSELMSAYAADSSAR 196

Query: 724 NLLGNLFLSRDLVDPMSDKASKFF 795
            ++G     RD    M ++  K F
Sbjct: 197 AMIGRRLKDRDTFLAMVERGIKLF 220



>gb:AC074355_1541401 Oryza sativa (japonica cultivar-group)
           chromosome 10 clone OSJNBa0071I20, complete sequence.
          Length = 154

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 44/134 (32%), Positives = 68/134 (50%)
 Frame = +1

Query: 316 LGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKV 495
           +G  PH+++ ++  +YG V+ L+ G V  + + S +AA ++ K HD  FA R   ++MK+
Sbjct: 8   IGDLPHRSLHDLSRRYGPVMLLKFGQVPFIIVSSPEAAKDIMKTHDSIFAMRPQSEIMKI 67

Query: 496 QGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ 675
                  L FAPY   WR LR+IC  EL   KR+     +R           E+EA+ + 
Sbjct: 68  ITKRGQGLVFAPYDDQWRQLRKICIRELLCAKRVQSFCAIR-----------EEEAARLV 116

Query: 676 RGTGVHVAHFVFLS 717
           +      AH V LS
Sbjct: 117 KSISSDQAHLVNLS 130



>gb:AE016959_1021169 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC113337_1738996
           Genomic sequence for Oryza sativa (japonica
           cultivar-group) cultivar Nipponbare clone OSJNBa0061H20,
           from chromosome 10, complete
           sequence.>gb:AE017062_1750988 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 16 of 77 of the
           complete sequence.
          Length = 479

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 44/134 (32%), Positives = 68/134 (50%)
 Frame = +1

Query: 316 LGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKV 495
           +G  PH+++ ++  +YG V+ L+ G V  + + S +AA ++ K HD  FA R   ++MK+
Sbjct: 52  IGDLPHRSLHDLSRRYGPVMLLKFGQVPFIIVSSPEAAKDIMKTHDSIFAMRPQSEIMKI 111

Query: 496 QGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ 675
                  L FAPY   WR LR+IC  EL   KR+     +R           E+EA+ + 
Sbjct: 112 ITKRGQGLVFAPYDDQWRQLRKICIRELLCAKRVQSFCAIR-----------EEEAARLV 160

Query: 676 RGTGVHVAHFVFLS 717
           +      AH V LS
Sbjct: 161 KSISSDQAHLVNLS 174



>sp|P49264|C7B1_THLAR Cytochrome P450 71B1 (EC 1.14.-.-)
           (CYPLXXIB1).>pir|T52255|T52255 cytochrome P450
           [imported] - Thlaspi arvense>gb:THLCYP450A_1725084
           Thlaspi arvense germline cytochrome P450 mRNA, complete
           cds.
          Length = 496

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 42/159 (26%), Positives = 79/159 (49%), Gaps = 4/159 (2%)
 Frame = +1

Query: 205 IFLIPGLVF----LLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSV 372
           ++++  LV     L+A+ K               +IGN+  LG  PH+ + E+   YG +
Sbjct: 4   LYIVAALVIFASLLIAKSKRKPKKNLPPGPPRLPIIGNLHQLGEKPHRAMVELSKTYGPL 63

Query: 373 IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRV 552
           + L++GSV+T+   S +   ++ K +D+    R  +       Y +  L F+PY  YWR 
Sbjct: 64  MSLKLGSVTTVVATSVETVRDVLKTYDLECCSRPYMTYPARITYNLKDLVFSPYDKYWRQ 123

Query: 553 LRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS 669
           +R++  VEL+  KR+     +R + +   + + ++ ASS
Sbjct: 124 VRKLTVVELYTAKRVQSFRHIREEEVASFVRFNKQAASS 162



>sp|Q96418|C755_EUSGR Flavonoid 3',5'-hydroxylase (EC 1.14.-.-)
           (F3'5'H) (Cytochrome P450 75A5).>gb:EGU72654_1676529
           Eustoma grandiflorum flavonoid 3'5'-hydroxylase (F3'5'H)
           mRNA, complete cds.
          Length = 510

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 48/174 (27%), Positives = 86/174 (49%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           V+G +  LG  PH  +A M  KYG V++L++GS       + +AA    K  D++F++R 
Sbjct: 46  VLGALPLLGTMPHVALANMAKKYGPVMYLKVGSCGLAVASTPEAAKAFLKTLDMNFSNRP 105

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                    Y    + FA YG  W++LR++  + +   K +     VR+K +  ML  + 
Sbjct: 106 PNAGATHLAYNAQDMVFADYGPRWKLLRKLSNIHILGGKALQGWEEVRKKELGYMLYAM- 164

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM 816
             A S + G  V V+  +  +  N+LG + LS+ +      ++++F D +  +M
Sbjct: 165 --AESGRHGQPVVVSEMLTYAMANMLGQVMLSKRVFGSQGSESNEFKDMVVELM 216



>gb:AP003434_1829312 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0452F10.
          Length = 529

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 38/101 (37%), Positives = 59/101 (58%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++G++  LGA PH+ +  +   +G V+ LR+G V  + + SA AA E+ +  D+ FA R 
Sbjct: 54  LLGHLHLLGALPHRALRSLAAAHGPVLLLRLGRVPVVVVSSAAAAEEVMRTRDLEFASRP 113

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRI 597
            + + +   Y    +AFAPYG YWR  RRIC V L   +R+
Sbjct: 114 RVAMAERLLYGGRDVAFAPYGEYWRQTRRICVVHLLSARRV 154



>gb:AC092559_1735529 Oryza sativa chromosome 3 BAC OSJNBb0096M04
           genomic sequence, complete sequence.>gb:AC096688_1736235
           Oryza sativa chromosome 3 BAC OSJNBa0015N08 genomic
           sequence, complete sequence.
          Length = 527

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 43/159 (27%), Positives = 78/159 (49%), Gaps = 4/159 (2%)
 Frame = +1

Query: 178 EWKYLVWSAIFLIPGLVFLLAR----KKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIA 345
           +W+ L+   +  I  L+ ++ R    ++     R         V+GN+L LGA PH+++ 
Sbjct: 14  QWQLLLLLLLLPIASLLLVIGRNTGGRRRRRHLRLPPGPARLPVLGNLLQLGALPHRSLR 73

Query: 346 EMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAF 525
           ++  ++G V+ LR+G+V  + + S +AA E+ + HD     R          Y    +AF
Sbjct: 74  DLARRHGPVMMLRLGAVPAVVVSSPEAAQEVLRTHDADCCSRPSSPGPMRLSYGYKDVAF 133

Query: 526 APYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDML 642
           APY +Y R  RR+   ELF   R+      R+  ++ ++
Sbjct: 134 APYDAYGRAARRLFVAELFSAPRVQAAWRARQDQVEKLI 172



>gb:AY850933_1630830 Broussonetia papyrifera ferulate-5-hydroxylase
           (F5H) mRNA, complete cds.>gb:AY850934_1630831
           Broussonetia papyrifera ferulate-5-hydroxylase (F5H)
           gene, complete cds.
          Length = 514

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 52/180 (28%), Positives = 89/180 (49%), Gaps = 3/180 (1%)
 Frame = +1

Query: 202 AIFLIPGLVFLLAR-KKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVIW 378
           AIFL+  L+FLL    +S              +IG+M  +    H+ +A +  +YG +  
Sbjct: 19  AIFLVIPLLFLLGHILRSRGRLPYPPGPKGLPIIGSMSMMDQLTHRGLAALAKQYGGIFH 78

Query: 379 LRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLR 558
           L++G +  +AI S + A ++ +  D  F++R     ++   Y    +AFA YG +WR +R
Sbjct: 79  LKMGYLHMVAISSPETARQVLQLQDNIFSNRPANIAIRYLTYDRADMAFAHYGPFWRQMR 138

Query: 559 RICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSV--QRGTGVHVAHFVFLSTFNLL 732
           ++C ++LF  KR      VR +        +EK   SV    GT V+V   VF +T +++
Sbjct: 139 KLCVMKLFSRKRAASWESVRGE--------VEKTVLSVAGSTGTAVNVGELVFKTTMDII 190



>gb:AY072297_1567115 Zea mays cytochrome P450 monooxygenase CYP92A1
           mRNA, complete cds.
          Length = 517

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 47/163 (28%), Positives = 79/163 (48%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  +G  PH+++ E+  +YG ++ LR GS+  +   S + A    K +D +F+DR 
Sbjct: 41  IIGNLNLMGELPHRSMNELSKRYGPLMQLRFGSLPVLVGASVEMAKLFLKTNDAAFSDRP 100

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
              + K   Y    L +AP G Y R  RRIC  ELF   R+     +R + +  ML  + 
Sbjct: 101 RFAIGKYTAYDFSDLLWAPSGPYLRQARRICATELFSATRLESFEHIRDEEVRVMLRQLR 160

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKA 783
           + A    R         + + +  +LGN ++  ++ D   D A
Sbjct: 161 QAAGRTVRLRDYLQMLALGVISRIVLGNKYVMEEVADGEGDSA 203



>sp|P58050|C72D_ARATH Cytochrome P450 71B13 (EC 1.14.-.-).
          Length = 496

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 35/124 (28%), Positives = 68/124 (54%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  LG+ PH+++ ++  KYG +++L++G V ++   + +   ++ K  D     R 
Sbjct: 38  IIGNLHQLGSKPHRSMFKLSEKYGPLVYLKLGKVPSVVASTPETVKDVLKTFDKDCCSRA 97

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
            +       Y +  LAFAPY  YW+ +R++  VEL+  KR+     +R + +   + +I+
Sbjct: 98  FLTYPARISYNLKDLAFAPYSKYWKAVRKMTVVELYTAKRVKSFRNIREEEVASFVEFIK 157

Query: 655 KEAS 666
             AS
Sbjct: 158 HSAS 161



>gb:AP002968_1823977 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0416G11.>gb:AP003204_1825117 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1111C09.
          Length = 518

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 41/117 (35%), Positives = 68/117 (58%), Gaps = 1/117 (0%)
 Frame = +1

Query: 295 VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR 471
           VIG++  + GA PH+ + ++  ++G ++ LR+  +  +   +A+AA E+ K HD++FA R
Sbjct: 46  VIGHLHHVAGALPHRAMRDLARRHGPLMLLRLCELRVVVACTAEAAREVTKTHDLAFATR 105

Query: 472 TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDML 642
            +    KV       + FAPYG  WR LRRICT+EL   +R+     VR + +  +L
Sbjct: 106 PITPTGKVLMADSVGVVFAPYGDGWRTLRRICTLELLSARRVRSFRAVREEEVGRLL 162



>gb:AP003571_1831043 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0458E02.
          Length = 528

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 44/147 (29%), Positives = 75/147 (51%), Gaps = 1/147 (0%)
 Frame = +1

Query: 187 YLVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDL-GAFPHQTIAEMKNKY 363
           YL  + + L+ G++     + +++  R         VIG++  L G  PH  + ++  ++
Sbjct: 17  YLAMALVALL-GVLLTKCSRTATAQRRLPPGPWQLPVIGSLHHLIGKLPHHAMRDLTRRH 75

Query: 364 GSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSY 543
           G V+ LR+G V T+ + S +AA E+ + HD  FA R +   ++        +AFAPYG Y
Sbjct: 76  GPVMMLRLGEVPTLVVSSPEAAQEVMRTHDAVFATRALSATVRAGTMGGRDIAFAPYGDY 135

Query: 544 WRVLRRICTVELFVHKRINETVPVRRK 624
           WR LR+I   EL    R+     +R +
Sbjct: 136 WRQLRKIAATELLSAPRVASFRAIREE 162



>gb:AF488522_1804421 Oryza sativa Cyt-P450 monooxygenase (PM-II)
           mRNA, complete cds.>gb:AP005254_1849646 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBb0064I19.>gb:AP005816_1858334 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:B1168A08.
          Length = 506

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 52/176 (29%), Positives = 85/176 (48%), Gaps = 2/176 (1%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEM-KNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR 471
           VIGN+L L    H  +A + + +YG V+ L++G V+ + + S  AA E F  HD   A R
Sbjct: 43  VIGNVLSLRGNMHHALARLARERYGPVMALKLGLVTAVVVSSPDAAREAFTKHDRRLAAR 102

Query: 472 TVIDVMKVQGYYMGSLAFAPYG-SYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLW 648
            V D  +V+G+   S+ + P   + W+ LR +    +F  + I     VR + + D++ +
Sbjct: 103 AVPDTSRVRGFADRSMIWLPSSDTRWKTLRGVVATHVFSPRSIAAARGVRERKVRDIVGY 162

Query: 649 IEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM 816
                  V     V V   V+    NL+ N F S D+VD   + A    +A+  I+
Sbjct: 163 FAAHVGEV-----VDVGEAVYSGVVNLVSNAFFSGDVVDVGEESAHGLREAVEDII 213



>gb:BT015411_1642239 Arabidopsis thaliana At4g12320 gene, complete
           cds.
          Length = 518

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 42/149 (28%), Positives = 78/149 (52%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+  L    H    ++   YG +  L +GS  T+ + +   A E+ K+ D++F++  
Sbjct: 51  IVGNLPFLDPDLHTYFTKLAESYGPIFKLNLGSKLTVVVNTPSLAREILKDQDINFSNHD 110

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
           V    +   Y    L + PYG+ WR+LR++C ++L  H+ +N    +RRK I +   ++ 
Sbjct: 111 VPLTARAVTYGGLDLVWLPYGAEWRMLRKVCVLKLLSHRTLNSFYELRRKEIRERTRYLY 170

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNL 741
           ++    Q  + V+V   VFL+  NL  N+
Sbjct: 171 QKG---QEESPVNVGEQVFLTMMNLTMNM 196



>gb:AY596979_1617030 Centaurium erythraea clone 2 cytochrome P450
           mRNA, complete cds.
          Length = 449

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 40/146 (27%), Positives = 80/146 (54%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           VIGN+  LG  P+Q++A++   YG ++ L++G+ + +   S+    E+ + HD  F+ RT
Sbjct: 37  VIGNIHQLGKHPNQSLAKLSKIYGPLMSLKLGTQTAIVASSSTVVREILQKHDQVFSSRT 96

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
           +   +    ++  S+A  P  S WR LR+I   ++F  +R++E+  +R+  + ++  ++ 
Sbjct: 97  IPSALHAHDHHKFSMALLPASSRWRHLRKITKEQMFSVQRLDESQGLRQDKLKELRDYLH 156

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLL 732
              S    G  V++    F +T NL+
Sbjct: 157 ---SCCVTGQAVNIGEAAFTTTLNLM 179



>gb:AY566988_1615411 Verbena x hybrida flavonoid 3',5'-hydroxylase
           gene, complete cds.>gb:AY604727_1617490 Verbena x
           hybrida flavonoid 3',5'-hydroxylase mRNA, complete cds.
          Length = 514

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 58/209 (27%), Positives = 98/209 (46%), Gaps = 3/209 (1%)
 Frame = +1

Query: 199 SAIFLIPGLVFL--LARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSV 372
           +AI L   L+ +  L  K S+ S           V+G +  LG  PH  +A+M   YG V
Sbjct: 16  AAILLYVALILVCSLYSKPSTVSRNLPPGPKGFPVVGALPLLGTMPHIALAKMAKTYGPV 75

Query: 373 IWLRIGSVSTMAILSAKAAAELF-KNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR 549
           ++L++G+   MA+ S   AA  F K  D +F+DR       +  Y    + FA YG  WR
Sbjct: 76  MYLKVGTWG-MAVASTPDAARAFLKTLDTTFSDRPPNAGATLLAYNAQDMVFAHYGPRWR 134

Query: 550 VLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNL 729
           +LR++  + +   K + +   VR   +  ML   +   +S  R   V +   +  S  N+
Sbjct: 135 LLRKLSNLHMLGAKALEDWADVRSSEVGHML---QAMLTSSLRHEAVALPEMLIYSMANM 191

Query: 730 LGNLFLSRDLVDPMSDKASKFFDAMTGIM 816
           +G + LSR + +    + ++F D +  +M
Sbjct: 192 IGQVILSRRVFETKGKEVNEFKDMVVELM 220



>gb:AP005419_1851476 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0046G12.>gb:AP005570_1854238 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OJ1344_B01.
          Length = 522

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 43/156 (27%), Positives = 79/156 (50%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  +GA PH++I E+  +YG +++LR GS   +   S + A    K  D +F DR 
Sbjct: 43  IIGNLNLVGALPHRSIHELSRRYGPLVYLRFGSFPVVVGSSVEMARFFLKTRDAAFIDRP 102

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                K   Y    + ++P  +YWR  RR+   ELF  +RI     +RR+ +  +L  + 
Sbjct: 103 RTAAGKHTAYNYRDITWSPCDAYWRQARRVVLTELFSARRIESYEHIRREEVHALLRDLH 162

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLV 762
             +SS  R   + +  ++  ++ N++  + + +  V
Sbjct: 163 YASSSGGR-RAIVIKDYLSTASLNMITRMVMGKRYV 197



>gb:AP003523_1830355 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0416A11.>gb:AP003571_1831059 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0458E02.
          Length = 520

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 54/211 (25%), Positives = 103/211 (48%), Gaps = 9/211 (4%)
 Frame = +1

Query: 190 LVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDL-GAFPHQTIAEMKNKYG 366
           LV + + ++P + F    ++     R         VIG++  L GA PH  + ++  ++G
Sbjct: 13  LVVALLAIVPLVYFGWVARRRGEGGRLPPSPWGLPVIGHLHHLAGALPHHAMRDLARRHG 72

Query: 367 SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGS--LAFAPYGS 540
            ++ LR+G +  +   SA+AA E+ +  D+ FA R +  + ++  +  G+  + FAPYG 
Sbjct: 73  PLMLLRLGELPVVVASSAEAAREVMRTRDIEFATRPMSRMTRLV-FPAGTEGIIFAPYGD 131

Query: 541 YWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRG------TGVHVAH 702
            WR LR++CTVEL   +R+     VR + +  +L  +   +SS          + +  A+
Sbjct: 132 EWRELRKVCTVELLSARRVQSFRAVREEEVGRLLRAVAATSSSPSPAQAAVNLSALLSAY 191

Query: 703 FVFLSTFNLLGNLFLSRDLVDPMSDKASKFF 795
               +   ++G+ F  RD    + ++  K F
Sbjct: 192 AADSAVHAIIGSRFKDRDKYLMLLERGLKLF 222



>gb:AF368380_1791923 Nicotiana tabacum elicitor-inducible cytochrome
           P450 (CYP92A5) mRNA, complete cds.
          Length = 509

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 42/157 (26%), Positives = 80/157 (50%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  +G  PH++I E+  KYG ++ L+ G+   +   S + A    K+ D++F  R 
Sbjct: 42  IIGNLNLIGNLPHRSIHELSLKYGPIMQLQFGTFPVVVGSSVEMAKVFLKSMDINFVGRP 101

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                K   Y    + ++PYG YWR  RR+C +ELF  KR++    +R + +  +L  + 
Sbjct: 102 KTAAGKYTTYNYSDITWSPYGPYWRQARRMCLMELFSTKRLDSYEYIRAEELHSLLHNLN 161

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVD 765
           K +     G  + +  ++   + N++  + L +  +D
Sbjct: 162 KIS-----GKPIVLKDYLTTLSLNVISRMVLGKRYLD 193



>gb:AF218296_1778151 Pisum sativum cytochrome P450 mRNA, complete
           cds.
          Length = 495

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 40/143 (27%), Positives = 65/143 (45%)
 Frame = +1

Query: 196 WSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVI 375
           W  +F    ++ L +R+     Y          +IGN   +G  PHQ++  +  KYG ++
Sbjct: 11  WVTLFTTFAILLLFSRRLRRRQYNLPPGPKPWPIIGNFNLIGTLPHQSLHGLTQKYGPIM 70

Query: 376 WLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL 555
            L  GS   +   + + A    K HD + A R      K   Y    + ++ YG YWR  
Sbjct: 71  HLWFGSKRVVVGSTVEMAKAFLKTHDATLAGRPKFSAGKYTTYNYSDITWSQYGPYWRQA 130

Query: 556 RRICTVELFVHKRINETVPVRRK 624
           RR+C +ELF  KR+     +R++
Sbjct: 131 RRMCLLELFSAKRLESYEYIRKQ 153



>gb:AC134348_1741777 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0530H10, complete
           sequence.>gb:AC135929_1742923 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone P0692D12, complete
           sequence.
          Length = 535

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 40/110 (36%), Positives = 61/110 (55%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++G++  LG  PH  +  M   +G V+ LR+G V T+ + SA AA E+ +  D +F+ R 
Sbjct: 51  LLGHLHQLGPLPHVALRSMAAAHGPVLRLRLGRVPTVVVSSAAAAEEVLRARDAAFSSRP 110

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRK 624
               M  +  Y   +AFAPYG YWR  RR+C V L   +R++    VR +
Sbjct: 111 -RSAMAERILYGRDIAFAPYGEYWRQARRVCVVHLLSAQRVSSFRRVREE 159



>gb:AE016959_1021701 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC119149_1739608
           Oryza sativa (japonica cultivar-group) chromosome 10
           clone OSJNBb0079E01, complete
           sequence.>gb:AE017074_1751520 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 28 of 77 of the
           complete sequence.
          Length = 535

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 43/123 (34%), Positives = 61/123 (49%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           V+GN+  LG   HQT+ EM   YG +I LR GS   +   SA  AA+  + HD +F+ R 
Sbjct: 50  VLGNLPQLGGKTHQTLHEMTKVYGPLIRLRFGSSDVVVAGSAPVAAQFLRTHDANFSSRP 109

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                +   Y    + F PYG  WR +R+IC V LF             + +DD+  + E
Sbjct: 110 RNSGGEHMAYNGRDVVFGPYGPRWRAMRKICAVNLF-----------SARALDDLRAFRE 158

Query: 655 KEA 663
           +EA
Sbjct: 159 REA 161



>sp|P58049|C72B_ARATH Cytochrome P450 71B11 (EC
           1.14.-.-).>gb:AK176623_1818611 Arabidopsis thaliana mRNA
           for cytochrome P450-like protein, complete cds, clone:
           RAFL25-16-C21.
          Length = 496

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 38/124 (30%), Positives = 66/124 (53%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  LG+ PH ++ ++  KYG ++ LR GSVST+   + +   E+ K  D     R 
Sbjct: 38  IIGNLHQLGSKPHSSMFKLSEKYGPLMALRFGSVSTVVASTPETVKEVLKTFDAECCSRP 97

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
            +       Y +  + F PY  YWR +R++  VEL+  KR+      R++ +  ++ +I 
Sbjct: 98  YMTYPARLTYNLKDIGFCPYTKYWREVRKMTVVELYTAKRVQSFQHTRKEEVASLVDFIT 157

Query: 655 KEAS 666
           + AS
Sbjct: 158 QAAS 161



>sp|P58046|C71F_ARATH Cytochrome P450 71A15 (EC 1.14.-.-).
          Length = 496

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 38/124 (30%), Positives = 66/124 (53%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           VIGN+  L   PH+++  + ++YG ++ L  G V  + + S+  A +L K HD+  A+R 
Sbjct: 41  VIGNLHQLSLHPHRSLRSLSHRYGPLMLLHFGRVPILVVSSSDVAHDLMKTHDLKVANRP 100

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
            + V++        + F+PYG YWR ++ +C V L   K +     VR +    M+  +E
Sbjct: 101 RLKVIETILNGGREVVFSPYGDYWRQIKTVCVVHLLNKKMVQSFAKVREEERSVMMEKVE 160

Query: 655 KEAS 666
           K +S
Sbjct: 161 KASS 164



>sp|P37118|C712_SOLME Cytochrome P450 71A2 (EC 1.14.-.-) (CYPLXXIA2)
           (P-450EG4).>pir|S36806|S36806 cytochrome P450 71A2 -
           eggplant>gb:POTCPEG4_1701083 Eggplant mRNA for
           cytochrome P-450EG4, complete cds.>gb:SMCYP71B3_1715485
           S.melongena CYP71A2 mRNA for hydroxylase.
          Length = 505

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 44/153 (28%), Positives = 74/153 (48%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  LG+ PH+++ ++  KYG V+ L  GS   +   S  AA ++ K HDV +A R 
Sbjct: 46  IIGNLHQLGSLPHRSLHKLSQKYGPVMLLHFGSKPVIVASSVDAARDIMKTHDVVWASRP 105

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
              ++    Y    + F+P+G YWR  + I  + L  + R+     VR +   +M+  I 
Sbjct: 106 KSSIVDRLSYGSKDVGFSPFGEYWRRAKSITVLHLLSNTRVQSYRNVRAEETANMIGKIR 165

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSR 753
           +   S     G H+       T N++  + L R
Sbjct: 166 QGCDSSVINLGEHLCSL----TNNIISRVALGR 194



>gb:AP003711_1832299 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0417G12.
          Length = 528

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 43/145 (29%), Positives = 72/145 (49%), Gaps = 5/145 (3%)
 Frame = +1

Query: 205 IFLIPGLVFLLA-----RKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGS 369
           +  + GL+ L A     R + SS  R         ++G++  L   PHQ +  +  ++G 
Sbjct: 15  LLFVAGLIVLYALRRRRRHRRSSGLRLPPSPFGLPILGHLHLLAPLPHQALHRLAARHGP 74

Query: 370 VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWR 549
           +++LR+GSV  +A  S  AA E+ K H+ +F DR     +    Y     +F+ YG YWR
Sbjct: 75  LLFLRLGSVPCVAACSPDAAREVLKTHEAAFLDRPKPAAVHRLTYGGQDFSFSAYGPYWR 134

Query: 550 VLRRICTVELFVHKRINETVPVRRK 624
            ++R C  EL   + ++    VRR+
Sbjct: 135 FMKRACVHELLAGRTLDRLRHVRRE 159



>gb:AF150881_1772612 Lycopersicon esculentum x Lycopersicon
           peruvianum ferulate-5-hydroxylase (CYP84) mRNA, complete
           cds.
          Length = 521

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 49/175 (28%), Positives = 86/175 (49%)
 Frame = +1

Query: 208 FLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRI 387
           F+IP  +F L    +S   R         +IGNM+ +    H+ +A++  KYG V  L++
Sbjct: 23  FIIP--LFFLYLFSTSRRKRYPPGPLGWPLIGNMMIMDQLTHRGLAKLAQKYGGVFHLKM 80

Query: 388 GSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRIC 567
           G V  + I   + A ++ +  D  +++R     +    Y    +AFA YG +WR +R++C
Sbjct: 81  GYVHKIVISGPEEARQVLQVQDNIYSNRPKTVAISYLTYDRADMAFADYGPFWRQMRKLC 140

Query: 568 TVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLL 732
            ++LF  KR      VR + +D M+  +   A     GT +++   VF  T N++
Sbjct: 141 VMKLFSRKRAESWDSVRDE-VDSMVKIVTTNA-----GTSINLGELVFCLTRNII 189



>gb:PHPET1_1700155 P.hybrida mRNA for P450 hydroxylase.
          Length = 425

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 52/176 (29%), Positives = 91/176 (51%), Gaps = 2/176 (1%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELF-KNHDVSFADR 471
           VIG +  LGA PH ++A+M  KYG++++L++G+   MA+ S   AA+ F K  D++F++R
Sbjct: 42  VIGALPLLGAMPHVSLAKMAKKYGAIMYLKVGTCG-MAVASTPDAAKAFLKTLDINFSNR 100

Query: 472 TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
                     Y    + FA YG  W++LR++  + +   K +     VR   +  ML   
Sbjct: 101 PPNAGATHLAYNAQDMVFAHYGPRWKLLRKLSNLHMLGGKALENWANVRANELGHML--- 157

Query: 652 EKEASSVQR-GTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM 816
            K  S + R G  V VA  +  +  N++G + LS+ +      + ++F D +  +M
Sbjct: 158 -KSMSDMSREGQRVVVAEMLTFAMANMIGQVMLSKRVFVDKGVEVNEFKDMVVELM 212



>gb:AB012925_1511971 Torenia hybrida mRNA for flavonoid
           3',5'-hydroxylase, complete cds.
          Length = 511

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 47/174 (27%), Positives = 85/174 (48%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           V+G +  LG+ PH  +A+M  KYG V++L+ G++  +   +  +A    K  D +F++R 
Sbjct: 50  VVGALPLLGSMPHVALAKMAKKYGPVMYLKTGTLGMVVASTPSSARAFLKTLDSNFSNRP 109

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                    Y    + FAPYG  WR+LRR+  + +   K ++    VR   +  ML   E
Sbjct: 110 ANAGATHLAYGAQDMVFAPYGPRWRLLRRLSNLHMLGGKALDGWANVRASELGHML---E 166

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM 816
               + + G  V V   +  +  N++G + LSR +     ++ ++F D +  +M
Sbjct: 167 AMNRASREGEVVVVPEMLVYAMANMIGQVILSRRVFVTKGEEVNEFKDMVVELM 220



>gb:A29011_1448320 pCGP602 DNA from patent EP0522880.
          Length = 505

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 52/176 (29%), Positives = 91/176 (51%), Gaps = 2/176 (1%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELF-KNHDVSFADR 471
           VIG +  LGA PH ++A+M  KYG++++L++G+   MA+ S   AA+ F K  D++F++R
Sbjct: 41  VIGALPLLGAMPHVSLAKMAKKYGAIMYLKVGTCG-MAVASTPDAAKAFLKTLDINFSNR 99

Query: 472 TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
                     Y    + FA YG  W++LR++  + +   K +     VR   +  ML   
Sbjct: 100 PPNAGATHLAYNAQDMVFAHYGPRWKLLRKLSNLHMLGGKALENWANVRANELGHML--- 156

Query: 652 EKEASSVQR-GTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM 816
            K  S + R G  V VA  +  +  N++G + LS+ +      + ++F D +  +M
Sbjct: 157 -KSMSDMSREGQRVVVAEMLTFAMANMIGQVMLSKRVFVDKGVEVNEFKDMVVELM 211



>gb:AE016959_1021306 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC105746_1738148
           Oryza sativa chromosome 10 BAC OSJNBb0086I08 genomic
           sequence, complete sequence.>gb:AE017066_1751125 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           20 of 77 of the complete sequence.
          Length = 502

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 40/146 (27%), Positives = 74/146 (50%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+LD+G  PH++ A +  +YG ++ +R+G+ + +   S   A  + + H+ S A R 
Sbjct: 41  LIGNLLDIGDLPHRSFARLAERYGPLMTVRLGAATCVVASSPATARAVLQTHNASLAGRG 100

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
             D     G+   S+   P G  WR+LR++    LF  +++ E  P+R + +  +L  + 
Sbjct: 101 RQDAWHAGGHAENSVFVLPPGRKWRLLRKLGAAHLFSRRKLAELAPLRDEIVGGLLRRVA 160

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLL 732
           + A   + G  V+V      +   LL
Sbjct: 161 ERADH-RGGAPVNVGRLALAANVELL 185



>pir|T14639|T14639 cytochrome P450 CYP99A1 - sorghum (fragment)
          Length = 519

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 39/109 (35%), Positives = 63/109 (57%), Gaps = 1/109 (0%)
 Frame = +1

Query: 295 VIGNMLDLGAF-PHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR 471
           +IGN+L L    PH  + ++  K+G V++LR+G V  + I S  AA E+ ++ D +FA R
Sbjct: 36  LIGNLLHLATSQPHVALRDLAMKHGPVMYLRLGQVDAVVISSPAAAQEVLRDKDTTFASR 95

Query: 472 TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVR 618
             + V  +  Y    ++FAPYG  WR+LR++C  EL    ++ +   VR
Sbjct: 96  PSLLVADIILYGSMDMSFAPYGGNWRMLRKLCMSELLNTHKVRQLAAVR 144



>pir|S36807|S36807 cytochrome P450 71A3 - eggplant (fragment)
          Length = 365

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 49/197 (24%), Positives = 100/197 (50%), Gaps = 5/197 (2%)
 Frame = +1

Query: 211 LIPGLVFLLARKK-----SSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVI 375
           L+P  VF+L   K     S+++ +         +IGN+  LG  PH+++ ++  KYG V+
Sbjct: 1   LVPLFVFILFLHKCFFTTSNNNKKLPPSPRKLPIIGNLHQLGLHPHRSLHKLSKKYGPVM 60

Query: 376 WLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL 555
            L +GS   +   S +A  ++ K +D+ +++R    +     Y    ++F+P+G YWR +
Sbjct: 61  LLHLGSKPVIVASSVEAVRDIMKTNDLVWSNRPKSKMADRLIYGSKDVSFSPHGEYWRQI 120

Query: 556 RRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLG 735
           R I  + L  +KR+      R +   +M+  +++ ++S    T +    F +L+ +N++ 
Sbjct: 121 RSITVLHLLSNKRVQSYRAAREEETSNMIEKLKQMSNSSSSATDLRDL-FCWLA-YNIIN 178

Query: 736 NLFLSRDLVDPMSDKAS 786
            + L +   D +  KA+
Sbjct: 179 RVALGKKYNDEIDAKAT 195



>pir|S32110|S32110 cytochrome P450 PET-1 - garden petunia (fragment)
          Length = 425

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 52/176 (29%), Positives = 91/176 (51%), Gaps = 2/176 (1%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELF-KNHDVSFADR 471
           VIG +  LGA PH ++A+M  KYG++++L++G+   MA+ S   AA+ F K  D++F++R
Sbjct: 42  VIGALPLLGAMPHVSLAKMAKKYGAIMYLKVGTCG-MAVASTPDAAKAFLKTLDINFSNR 100

Query: 472 TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
                     Y    + FA YG  W++LR++  + +   K +     VR   +  ML   
Sbjct: 101 PPNAGATHLAYNAQDMVFAHYGPRWKLLRKLSNLHMLGGKALENWANVRANELGHML--- 157

Query: 652 EKEASSVQR-GTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM 816
            K  S + R G  V VA  +  +  N++G + LS+ +      + ++F D +  +M
Sbjct: 158 -KSMSDMSREGQRVVVAEMLTFAMANMIGQVMLSKRVFVDKGVEVNEFKDMVVELM 212



>sp|O48957|CP99_SORBI Cytochrome P450 CYP99A1 (EC 1.14.-.-)
           (Fragment).>gb:AF029857_1762427 Sorghum bicolor
           cytochrome P450 CYP99A1 (CYP99A1) mRNA, partial cds.
          Length = 519

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 39/109 (35%), Positives = 63/109 (57%), Gaps = 1/109 (0%)
 Frame = +1

Query: 295 VIGNMLDLGAF-PHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR 471
           +IGN+L L    PH  + ++  K+G V++LR+G V  + I S  AA E+ ++ D +FA R
Sbjct: 36  LIGNLLHLATSQPHVALRDLAMKHGPVMYLRLGQVDAVVISSPAAAQEVLRDKDTTFASR 95

Query: 472 TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVR 618
             + V  +  Y    ++FAPYG  WR+LR++C  EL    ++ +   VR
Sbjct: 96  PSLLVADIILYGSMDMSFAPYGGNWRMLRKLCMSELLNTHKVRQLAAVR 144



>sp|P48418|C751_PETHY Flavonoid 3',5'-hydroxylase 1 (EC 1.14.-.-)
           (F3'5'H) (Cytochrome P450 75A1)
           (CYPLXXVA1).>pir|S38985|S38985 flavonoid
           3',5'-hydroxylase Hf1 - garden
           petunia>gb:AY245545_1592552 Petunia x hybrida
           flavonoid-3',5'-hydroxylase mRNA, complete
           cds.>gb:PETHF1_1699850 Petunia hybrida F3'5'H mRNA for
           flavonoid-3',5'-hydroxylase, complete
           cds.>gb:PHFLAHYDB_1700113 P.hybrida flavonoid
           3',5'-hydroxylase mRNA.>gb:AF081575_1766556 Petunia x
           hybrida flavonoid 3',5'-hydroxylase (Hf1) gene, complete
           cds.
          Length = 506

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 52/176 (29%), Positives = 91/176 (51%), Gaps = 2/176 (1%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELF-KNHDVSFADR 471
           VIG +  LGA PH ++A+M  KYG++++L++G+   MA+ S   AA+ F K  D++F++R
Sbjct: 42  VIGALPLLGAMPHVSLAKMAKKYGAIMYLKVGTCG-MAVASTPDAAKAFLKTLDINFSNR 100

Query: 472 TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
                     Y    + FA YG  W++LR++  + +   K +     VR   +  ML   
Sbjct: 101 PPNAGATHLAYNAQDMVFAHYGPRWKLLRKLSNLHMLGGKALENWANVRANELGHML--- 157

Query: 652 EKEASSVQR-GTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM 816
            K  S + R G  V VA  +  +  N++G + LS+ +      + ++F D +  +M
Sbjct: 158 -KSMSDMSREGQRVVVAEMLTFAMANMIGQVMLSKRVFVDKGVEVNEFKDMVVELM 212



>sp|P58051|C72E_ARATH Cytochrome P450 71B14 (EC 1.14.-.-).
          Length = 496

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 41/162 (25%), Positives = 81/162 (50%)
 Frame = +1

Query: 181 WKYLVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNK 360
           W ++V ++ F       L+A+   ++            +IGN+  LG+ P +++ ++  K
Sbjct: 3   WWFIVGASFFFA---FILIAKDTRTTKKNLPPGPPRLPIIGNLHQLGSKPQRSLFKLSEK 59

Query: 361 YGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGS 540
           YGS++ L+ G+VS +   + +   ++ K  D     R  +       Y    LAF+PY  
Sbjct: 60  YGSLMSLKFGNVSAVVASTPETVKDVLKTFDAECCSRPYMTYPARVTYNFNDLAFSPYSK 119

Query: 541 YWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS 666
           YWR +R++  +EL+  KR+     VR++ +   + +I++ AS
Sbjct: 120 YWREVRKMTVIELYTAKRVKSFQNVRQEEVASFVDFIKQHAS 161



>sp|Q9ZU07|C72C_ARATH Cytochrome P450 71B12 (EC
           1.14.-.-).>gb:AC006259_1533877 Arabidopsis thaliana BAC
           F21J6 from chromosome V, containing KNAT3 and mapping
           near 60.5 cM, complete sequence.
          Length = 496

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 38/124 (30%), Positives = 69/124 (55%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  LG+ PH+++ ++   YG ++ L+ GSVST+   + +   E+ K  DV    R 
Sbjct: 38  IIGNLHQLGSKPHRSMFKLSETYGPLMSLKFGSVSTVVASTPETVKEVLKTFDVECCSRP 97

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
            +       Y +  L F+PY  YWR +R++  VEL+  KR+      R++ +  ++ +I+
Sbjct: 98  NMTYPARVTYNLKDLCFSPYSKYWREVRKMTVVELYTAKRVQSFQHTRKEEVAALVDFIK 157

Query: 655 KEAS 666
           + AS
Sbjct: 158 QAAS 161



>sp|Q9STL0|C71N_ARATH Cytochrome P450 71A23 (EC
           1.14.-.-).>pir|T06712|T06712 probable cytochrome P450
           T29H11.180 - Arabidopsis thaliana>gb:ATT29H11_1555642
           Arabidopsis thaliana DNA chromosome 3, BAC clone T29H11.
          Length = 483

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 39/124 (31%), Positives = 68/124 (54%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  L   PH+++  + ++YG ++ L  GSV  +   +A+AA ++ K HD  FA R 
Sbjct: 38  LIGNLHQLSQHPHRSLCYLSHRYGPLMLLHFGSVPVIVASTAEAARDVLKTHDRVFASRP 97

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
              + +   Y   ++A APYG YWR ++ +  + L  +K +     VR++ I  M+  I 
Sbjct: 98  RSKIFEKLLYKSRNMASAPYGEYWRQMKSVSVLHLLSNKMVRSFQDVRQEEITLMMETIR 157

Query: 655 KEAS 666
           K +S
Sbjct: 158 KSSS 161



>sp|P37119|C713_SOLME Cytochrome P450 71A3 (EC 1.14.-.-) (CYPLXXIA3)
           (P-450EG3) (Fragment).>gb:SMCYPEG3_1715487 S.melongena
           CYP71A3 mRNA for P450 hydroxylase.
          Length = 365

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 49/197 (24%), Positives = 100/197 (50%), Gaps = 5/197 (2%)
 Frame = +1

Query: 211 LIPGLVFLLARKK-----SSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVI 375
           L+P  VF+L   K     S+++ +         +IGN+  LG  PH+++ ++  KYG V+
Sbjct: 1   LVPLFVFILFLHKCFFTTSNNNKKLPPSPRKLPIIGNLHQLGLHPHRSLHKLSKKYGPVM 60

Query: 376 WLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVL 555
            L +GS   +   S +A  ++ K +D+ +++R    +     Y    ++F+P+G YWR +
Sbjct: 61  LLHLGSKPVIVASSVEAVRDIMKTNDLVWSNRPKSKMADRLIYGSKDVSFSPHGEYWRQI 120

Query: 556 RRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLG 735
           R I  + L  +KR+      R +   +M+  +++ ++S    T +    F +L+ +N++ 
Sbjct: 121 RSITVLHLLSNKRVQSYRAAREEETSNMIEKLKQMSNSSSSATDLRDL-FCWLA-YNIIN 178

Query: 736 NLFLSRDLVDPMSDKAS 786
            + L +   D +  KA+
Sbjct: 179 RVALGKKYNDEIDAKAT 195



>gb:AF499734_1806170 Glycine max clone Gm-c1053-348 cultivar Harosoy
           defective flavonoid 3'-hydroxylase (T) gene, T-t allele,
           partial cds.
          Length = 298

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 38/110 (34%), Positives = 61/110 (55%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+  +G  PH ++A +   +G ++ LR+G V  +   SA  A +  K HD +F+ R 
Sbjct: 40  IVGNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRP 99

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRK 624
                K   Y    L FAPYG  WR+LR++ +V LF  K +NE   +R++
Sbjct: 100 PNAGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQE 149



>gb:AF499728_1806164 Glycine max cultivar Harosoy gray pubescence
           flavonoid 3'-hydroxylase (T) mRNA, T-t allele, complete
           cds.>gb:AF499729_1806165 Glycine max cultivar Richland
           gray pubescence flavonoid 3'-hydroxylase (T) mRNA, T-t
           allele, complete cds.
          Length = 394

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 38/110 (34%), Positives = 61/110 (55%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+  +G  PH ++A +   +G ++ LR+G V  +   SA  A +  K HD +F+ R 
Sbjct: 40  IVGNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRP 99

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRK 624
                K   Y    L FAPYG  WR+LR++ +V LF  K +NE   +R++
Sbjct: 100 PNAGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQE 149



>gb:AB061212_1521992 Glycine max sf3'h1 mRNA for flavonoid
           3'-hydroxylase, complete cds.>gb:AF499730_1806166
           Glycine max clone Gm-c1019-10961 cultivar Williams
           flavonoid 3'-hydroxylase (T) mRNA, T-T allele, complete
           cds.>gb:AF499731_1806167 Glycine max clone Gm-c1019-7295
           cultivar Williams flavonoid 3'-hydroxylase (T) mRNA, T-T
           allele, complete cds.
          Length = 513

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 38/110 (34%), Positives = 61/110 (55%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+  +G  PH ++A +   +G ++ LR+G V  +   SA  A +  K HD +F+ R 
Sbjct: 40  IVGNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRP 99

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRK 624
                K   Y    L FAPYG  WR+LR++ +V LF  K +NE   +R++
Sbjct: 100 PNAGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQE 149



>gb:AB057672_1521704 Torenia hybrida tht mRNA for flavonoid
           3'-hydroxylase, complete cds.
          Length = 512

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 51/177 (28%), Positives = 83/177 (46%), Gaps = 7/177 (3%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+  LG  PH ++AE+   YG ++ L++G V  +   SA AA +  + HD +F  R 
Sbjct: 43  LVGNLPHLGPKPHASMAELARAYGPLMHLKMGFVHVVVASSASAAEQCLRVHDANFLSRP 102

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                K   Y    L F PYG  WR+LR+IC   +F  K +++   VR           E
Sbjct: 103 PNSGAKHVAYNYEDLVFRPYGPKWRLLRKICAQHIFSVKAMDDFRRVR-----------E 151

Query: 655 KEASSVQRG----TGVHVAHFVFLSTFNLLGNLFLSRDLV---DPMSDKASKFFDAM 804
           +E + + R       V +   + +   N L  + + R +V   D  +D  ++ F AM
Sbjct: 152 EEVAILSRALAGKRAVPIGQMLNVCATNALSRVMMGRRVVGHADGTNDAKAEEFKAM 208



>gb:AX028834_1457178 Sequence 18 from Patent WO9732023.
          Length = 508

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 51/177 (28%), Positives = 83/177 (46%), Gaps = 7/177 (3%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+  LG  PH ++AE+   YG ++ L++G V  +   SA AA +  + HD +F  R 
Sbjct: 43  LVGNLPHLGPKPHASMAELARAYGPLMHLKMGFVHVVVASSASAAEQCLRVHDANFLSRP 102

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                K   Y    L F PYG  WR+LR+IC   +F  K +++   VR           E
Sbjct: 103 PNSGAKHVAYNYEDLVFRPYGPKWRLLRKICAQHIFSVKAMDDFRRVR-----------E 151

Query: 655 KEASSVQRG----TGVHVAHFVFLSTFNLLGNLFLSRDLV---DPMSDKASKFFDAM 804
           +E + + R       V +   + +   N L  + + R +V   D  +D  ++ F AM
Sbjct: 152 EEVAILSRALAGKRAVPIGQMLNVCATNALSRVMMGRRVVGHADGTNDAKAEEFKAM 208



>gb:AF214009_1777815 Brassica napus cytochrome p450-dependent
           monooxygenase (BNF5H3) mRNA, partial cds.
          Length = 513

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 43/145 (29%), Positives = 74/145 (51%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGNML +    H+ +A +  KYG +  LR+G +   A+ S   A ++ +  D  F++R 
Sbjct: 42  IIGNMLMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPHVARQVLQVQDSIFSNRP 101

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
               +    Y    +AFA YG +WR +R++C +++F  KR      VR    D++   I 
Sbjct: 102 ATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVR----DEVDKMIR 157

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNL 729
             +S+V  G  ++V   +F  T N+
Sbjct: 158 SVSSNV--GKSINVGEQIFALTRNI 180



>gb:AC113337_1738992 Genomic sequence for Oryza sativa (japonica
           cultivar-group) cultivar Nipponbare clone OSJNBa0061H20,
           from chromosome 10, complete sequence.
          Length = 354

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 44/168 (26%), Positives = 82/168 (48%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  L   PH+++A +  ++G ++ LR+G+V  +   S + A E+ + H+   A R+
Sbjct: 40  LIGNLHQLDHLPHRSLARLAARHGPLMSLRLGTVRAVVASSPEMAREVLQRHNADIAARS 99

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
             D M+  G+   S+   P    WR LRR+ TV LF  +R++    +  + + ++   + 
Sbjct: 100 FGDSMRAGGHCENSVVCLPPRRRWRALRRLSTVGLFSPRRLDAMRALLEEKVAEL---VR 156

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFD 798
           + +    RG  V V H   ++   +L     S DL    + + S   D
Sbjct: 157 RVSGHAARGEAVDVGHAAHVAALGVLSRTMFSVDLDPEAAREVSDIVD 204



>gb:AE016959_1021165 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC074355_1541397
           Oryza sativa (japonica cultivar-group) chromosome 10
           clone OSJNBa0071I20, complete
           sequence.>gb:AE017062_1750984 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 16 of 77 of the
           complete sequence.
          Length = 433

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 44/168 (26%), Positives = 82/168 (48%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  L   PH+++A +  ++G ++ LR+G+V  +   S + A E+ + H+   A R+
Sbjct: 40  LIGNLHQLDHLPHRSLARLAARHGPLMSLRLGTVRAVVASSPEMAREVLQRHNADIAARS 99

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
             D M+  G+   S+   P    WR LRR+ TV LF  +R++    +  + + ++   + 
Sbjct: 100 FGDSMRAGGHCENSVVCLPPRRRWRALRRLSTVGLFSPRRLDAMRALLEEKVAEL---VR 156

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFD 798
           + +    RG  V V H   ++   +L     S DL    + + S   D
Sbjct: 157 RVSGHAARGEAVDVGHAAHVAALGVLSRTMFSVDLDPEAAREVSDIVD 204



>gb:AY621153_1618349 Camptotheca acuminata ferulate 5-hydroxylase
           (F5H) gene, complete cds.
          Length = 514

 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 45/178 (25%), Positives = 85/178 (47%)
 Frame = +1

Query: 199 SAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVIW 378
           +A+F I  L FL    +               ++GNM+ +    H+ +A++  +YG +  
Sbjct: 15  TALFFIAPLFFLFILSRLRRKLPYPPGPNGLPLVGNMMMMDQLTHRGLAKLAKQYGGIFH 74

Query: 379 LRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLR 558
           LR+G +  +A+ S + A ++ +  D  F++R     +    Y    +AFA YG +WR +R
Sbjct: 75  LRMGFLHMVAVSSPEIARQVLQVQDNIFSNRPATIAISYLTYDRADMAFAHYGPFWRQMR 134

Query: 559 RICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLL 732
           ++C ++LF  KR      VR + +D M+  +         G  V++   VF  T +++
Sbjct: 135 KLCVMKLFSRKRAESWESVRDE-VDSMVRVVVSHT-----GKSVNIGELVFSLTRDII 186



>gb:AP004022_1836496 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1126_B06.>gb:AP005069_1847541 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0654A08.
          Length = 537

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 49/192 (25%), Positives = 88/192 (45%)
 Frame = +1

Query: 187 YLVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYG 366
           +LV     L+    FL  R+ +   Y          VIGN+  +GA P+++I ++  +YG
Sbjct: 17  FLVLVLATLLFVAAFLRRRQGARRKYNIPPGPRPWPVIGNLNLIGALPYRSIRDLSRRYG 76

Query: 367 SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYW 546
            ++ LR GS   +   S   A    + +D++F DR      +   Y    + ++ YG YW
Sbjct: 77  PLMSLRFGSFPVVVGSSVDMARYFLRANDLAFLDRPRTAAGRYTVYNYAGVLWSHYGEYW 136

Query: 547 RVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFN 726
           R  RR+   EL   +R+  T  VR + +  ML  + + A +   GT V +   + + T N
Sbjct: 137 RQARRLWVTELLSARRLASTEHVRAEEVRAMLRGLSRRAGA---GTAVVLKEHMLMVTLN 193

Query: 727 LLGNLFLSRDLV 762
           ++  +   +  +
Sbjct: 194 VISRMVFGKKYI 205



>gb:AP003909_1835058 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1300_E01.>gb:AP004462_1841364 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0450B04.
          Length = 390

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 37/111 (33%), Positives = 66/111 (59%), Gaps = 1/111 (0%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYG-SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR 471
           VIG++  +G+ P+ +  E+  K+G  ++ LR+G+V T+ + SA+AA  + + +D  FA R
Sbjct: 77  VIGHLHLIGSLPYVSFRELAIKHGPDLMLLRLGTVPTLVVSSARAAQAILRTNDHVFASR 136

Query: 472 TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRK 624
           T   V  +  Y    +AF+PYG YWR +++I T  L  +K++      R++
Sbjct: 137 TYSAVTDILFYGSSDVAFSPYGEYWRQVKKIATTHLLTNKKVRSYSRARQQ 187



>gb:AP003909_1835056 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1300_E01.
          Length = 534

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 37/126 (29%), Positives = 74/126 (58%), Gaps = 1/126 (0%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYG-SVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR 471
           VIG+M  + + PH+++ ++  K+G  ++ L +G+V T+ + SA+ A  + + HD  FA R
Sbjct: 73  VIGHMHLISSLPHKSLRDLATKHGPDLMLLHLGAVPTLVVSSARTAQAILRTHDRVFASR 132

Query: 472 TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
               +  +  Y    +AF+PYG YWR +++I T+ L   K+++     R++ +  ++  I
Sbjct: 133 PYNTIADILLYGATDVAFSPYGDYWRQIKKIVTMNLLTIKKVHSYGQTRQQEVRLVMAKI 192

Query: 652 EKEASS 669
            +EA++
Sbjct: 193 VEEAAT 198



>gb:ALY295586_1819129 Arabidopsis lyrata subsp. petraea partial fah1
           gene for ferulate-5-hydroxylase, exons 1-3.
          Length = 453

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 42/145 (28%), Positives = 73/145 (50%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGNML +    H+ +A +  KYG +  LR+G +   A+ S   A ++ +  D  F++R 
Sbjct: 49  IIGNMLMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPDVARQVLQVQDSVFSNRP 108

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
               +    Y    +AFA YG +WR +R++C +++F  KR      VR + +D M+    
Sbjct: 109 ATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDE-VDKMV---- 163

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNL 729
             + S   G  ++V   +F  T N+
Sbjct: 164 -RSVSCNVGKPINVGEHIFALTRNI 187



>gb:ATH492859_1552764 Arabidopsis thaliana partial fah1 gene for
           ferulate-5-hydroxylase, exons 1-2, population variant
           RV2.
          Length = 304

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 42/145 (28%), Positives = 74/145 (51%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGNML +    H+ +A +  KYG +  LR+G +   A+ S + A ++ +  D  F++R 
Sbjct: 39  IIGNMLMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPEVARQVLQVQDSVFSNRP 98

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
               +    Y    +AFA YG +WR +R++C +++F  KR      VR + +D M+    
Sbjct: 99  ATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDE-VDKMV---- 153

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNL 729
             + S   G  ++V   +F  T N+
Sbjct: 154 -RSVSCNVGKPINVGEQIFALTRNI 177



>gb:ATH492840_1552745 Arabidopsis thaliana partial fah1 gene for
           ferulate-5-hydroxylase, exons 1-2, population variant
           TV1.>gb:ATH492841_1552746 Arabidopsis thaliana partial
           fah1 gene for ferulate-5-hydroxylase, exons 1-2,
           population variant TV2.>gb:ATH492842_1552747 Arabidopsis
           thaliana partial fah1 gene for ferulate-5-hydroxylase,
           exons 1-2, population variant TV3.>gb:ATH492843_1552748
           Arabidopsis thaliana partial fah1 gene for
           ferulate-5-hydroxylase, exons 1-2, population variant
           TV4.>gb:ATH492844_1552749 Arabidopsis thaliana partial
           fah1 gene for ferulate-5-hydroxylase, exons 1-2,
           population variant TV5.>gb:ATH492845_1552750 Arabidopsis
           thaliana partial fah1 gene for ferulate-5-hydroxylase,
           exons 1-2, population variant TV6.>gb:ATH492858_1552763
           Arabidopsis thaliana partial fah1 gene for
           ferulate-5-hydroxylase, exons 1-2, population variant
           RV1.>gb:ATH492861_1552766 Arabidopsis thaliana partial
           fah1 gene for ferulate-5-hydroxylase, exons 1-2,
           population variant RV4.>gb:ATH492862_1552767 Arabidopsis
           thaliana partial fah1 gene for ferulate-5-hydroxylase,
           exons 1-2, population variant RV5.
          Length = 304

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 42/145 (28%), Positives = 74/145 (51%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGNML +    H+ +A +  KYG +  LR+G +   A+ S + A ++ +  D  F++R 
Sbjct: 39  IIGNMLMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPEVARQVLQVQDSVFSNRP 98

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
               +    Y    +AFA YG +WR +R++C +++F  KR      VR + +D M+    
Sbjct: 99  ATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDE-VDKMV---- 153

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNL 729
             + S   G  ++V   +F  T N+
Sbjct: 154 -RSVSCNVGKTINVGEQIFALTRNI 177



>gb:ATH492832_1552737 Arabidopsis thaliana partial fah1 gene for
           ferulate-5-hydroxylase, exons 1-2, population variant
           Gran1.>gb:ATH492833_1552738 Arabidopsis thaliana partial
           fah1 gene for ferulate-5-hydroxylase, exons 1-2,
           population variant Gran2.>gb:ATH492834_1552739
           Arabidopsis thaliana partial fah1 gene for
           ferulate-5-hydroxylase, exons 1-2, population variant
           Gran3.>gb:ATH492835_1552740 Arabidopsis thaliana partial
           fah1 gene for ferulate-5-hydroxylase, exons 1-2,
           population variant Gran4.>gb:ATH492836_1552741
           Arabidopsis thaliana partial fah1 gene for
           ferulate-5-hydroxylase, exons 1-2, population variant
           Gran6.>gb:ATH492837_1552742 Arabidopsis thaliana partial
           fah1 gene for ferulate-5-hydroxylase, exons 1-2,
           population variant Gran7.>gb:ATH492838_1552743
           Arabidopsis thaliana partial fah1 gene for
           ferulate-5-hydroxylase, exons 1-2, population variant
           Gran8.>gb:ATH492839_1552744 Arabidopsis thaliana partial
           fah1 gene for ferulate-5-hydroxylase, exons 1-2,
           population variant Gran9.>gb:ATH492846_1552751
           Arabidopsis thaliana partial fah1 gene for
           ferulate-5-hydroxylase, exons 1-2, population variant
           WLP1.>gb:ATH492847_1552752 Arabidopsis thaliana partial
           fah1 gene for ferulate-5-hydroxylase, exons 1-2,
           population variant WLP2.>gb:ATH492848_1552753
           Arabidopsis thaliana partial fah1 gene for
           ferulate-5-hydroxylase, exons 1-2, population variant
           WLP3.>gb:ATH492849_1552754 Arabidopsis thaliana partial
           fah1 gene for ferulate-5-hydroxylase, exons 1-2,
           population variant WLP4.>gb:ATH492850_1552755
           Arabidopsis thaliana partial fah1 gene for
           ferulate-5-hydroxylase, exons 1-2, population variant
           WLP5.>gb:ATH492851_1552756 Arabidopsis thaliana partial
           fah1 gene for ferulate-5-hydroxylase, exons 1-2,
           population variant WLP6.>gb:ATH492852_1552757
           Arabidopsis thaliana partial fah1 gene for
           ferulate-5-hydroxylase, exons 1-2, population variant
           ED1.>gb:ATH492853_1552758 Arabidopsis thaliana partial
           fah1 gene for ferulate-5-hydroxylase, exons 1-2,
           population variant ED2.>gb:ATH492854_1552759 Arabidopsis
           thaliana partial fah1 gene for ferulate-5-hydroxylase,
           exons 1-2, population variant ED3.>gb:ATH492855_1552760
           Arabidopsis thaliana partial fah1 gene for
           ferulate-5-hydroxylase, exons 1-2, population variant
           ED4.>gb:ATH492856_1552761 Arabidopsis thaliana partial
           fah1 gene for ferulate-5-hydroxylase, exons 1-2,
           population variant ED5.>gb:ATH492857_1552762 Arabidopsis
           thaliana partial fah1 gene for ferulate-5-hydroxylase,
           exons 1-2, population variant ED6.>gb:ATH492860_1552765
           Arabidopsis thaliana partial fah1 gene for
           ferulate-5-hydroxylase, exons 1-2, population variant
           RV3.>gb:ATH492863_1552768 Arabidopsis thaliana partial
           fah1 gene for ferulate-5-hydroxylase, exons 1-2,
           population variant RV6.>gb:ATH492864_1552769 Arabidopsis
           thaliana partial fah1 gene for ferulate-5-hydroxylase,
           exons 1-2, population variant LU1.>gb:ATH492865_1552770
           Arabidopsis thaliana partial fah1 gene for
           ferulate-5-hydroxylase, exons 1-2, population variant
           LU2.>gb:ATH492866_1552771 Arabidopsis thaliana partial
           fah1 gene for ferulate-5-hydroxylase, exons 1-2,
           population variant LU3.>gb:ATH492867_1552772 Arabidopsis
           thaliana partial fah1 gene for ferulate-5-hydroxylase,
           exons 1-2, population variant LU4.>gb:ATH492868_1552773
           Arabidopsis thaliana partial fah1 gene for
           ferulate-5-hydroxylase, exons 1-2, population variant
           LU5.>gb:ATH492869_1552774 Arabidopsis thaliana partial
           fah1 gene for ferulate-5-hydroxylase, exons 1-2,
           population variant LU6.
          Length = 304

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 42/145 (28%), Positives = 74/145 (51%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGNML +    H+ +A +  KYG +  LR+G +   A+ S + A ++ +  D  F++R 
Sbjct: 39  IIGNMLMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPEVARQVLQVQDSVFSNRP 98

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
               +    Y    +AFA YG +WR +R++C +++F  KR      VR + +D M+    
Sbjct: 99  ATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDE-VDKMV---- 153

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNL 729
             + S   G  ++V   +F  T N+
Sbjct: 154 -RSVSCNVGKPINVGEQIFALTRNI 177



>gb:ATH295580_1552363 Arabidopsis thaliana fah1 gene for
           ferulate-5-hydroxylase, exons 1-3 MH-0
           ecotype.>gb:ATH295581_1552364 Arabidopsis thaliana fah1
           gene for ferulate-5-hydroxylase, exons 1-3 CVI-0
           ecotype.>gb:ATH295582_1552365 Arabidopsis thaliana fah1
           gene for ferulate-5-hydroxylase, exons 1-3 ITA-0
           ecotype.>gb:ATH295583_1552366 Arabidopsis thaliana fah1
           gene for ferulate-5-hydroxylase, exons 1-3 KAS-1
           ecotype.>gb:ATH295584_1552367 Arabidopsis thaliana fah1
           gene for ferulate-5-hydroxylase, exons 1-3 MR-0
           ecotype.>gb:ATH295585_1552368 Arabidopsis thaliana fah1
           gene for ferulate-5-hydroxylase, exons 1-3 WS-0 ecotype.
          Length = 520

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 42/145 (28%), Positives = 74/145 (51%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGNML +    H+ +A +  KYG +  LR+G +   A+ S + A ++ +  D  F++R 
Sbjct: 49  IIGNMLMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPEVARQVLQVQDSVFSNRP 108

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
               +    Y    +AFA YG +WR +R++C +++F  KR      VR + +D M+    
Sbjct: 109 ATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDE-VDKMV---- 163

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNL 729
             + S   G  ++V   +F  T N+
Sbjct: 164 -RSVSCNVGKTINVGEQIFALTRNI 187



>gb:ATH295576_1552359 Arabidopsis thaliana fah1 gene for
           ferulate-5-hydroxylase, exons 1-3 RI-0
           ecotype.>gb:ATH295577_1552360 Arabidopsis thaliana fah1
           gene for ferulate-5-hydroxylase, exons 1-3 RSCH-0
           ecotype.
          Length = 520

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 42/145 (28%), Positives = 74/145 (51%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGNML +    H+ +A +  KYG +  LR+G +   A+ S + A ++ +  D  F++R 
Sbjct: 49  IIGNMLMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPEVARQVLQVQDSVFSNRP 108

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
               +    Y    +AFA YG +WR +R++C +++F  KR      VR + +D M+    
Sbjct: 109 ATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDE-VDKMV---- 163

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNL 729
             + S   G  ++V   +F  T N+
Sbjct: 164 -RSVSCNVGKPINVGEQIFALTRNI 187



>pir|T04566|T04566 cytochrome P450 homolog T12H17.100 - Arabidopsis
           thaliana>gb:ATCHRIV57_1546108 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           57.>gb:ATT12H17_1554356 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T12H17 (ESSAII
           project).>gb:AK175743_1817731 Arabidopsis thaliana mRNA
           for cytochrome P450-like protein, complete cds, clone:
           RAFL22-29-D13.>gb:AK175975_1817963 Arabidopsis thaliana
           mRNA for cytochrome P450-like protein, complete cds,
           clone: RAFL22-67-E24.
          Length = 526

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 39/147 (26%), Positives = 81/147 (55%), Gaps = 1/147 (0%)
 Frame = +1

Query: 295 VIGNMLDLGA-FPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR 471
           ++GN+  L +   H     +  KYG ++ + +GS   + + S   A E+ K HD++FA+ 
Sbjct: 62  IVGNLPFLNSDVLHTQFQALTLKYGPLMKIHLGSKLAIVVSSPDMAREVLKTHDITFANH 121

Query: 472 TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
            + +V K+  Y    + ++PYG++WR LR++C +++F    +  +   RR+     ++ +
Sbjct: 122 DLPEVGKINTYGGEDILWSPYGTHWRRLRKLCVMKMFTTPSLEASYSTRREETRQTIVHM 181

Query: 652 EKEASSVQRGTGVHVAHFVFLSTFNLL 732
            + A   + G+ V++   +FLS FN++
Sbjct: 182 SEMA---REGSPVNLGEQIFLSIFNVV 205



>sp|Q42600|C84A_ARATH Cytochrome P450 84A1 (Ferulate-5-hydroxylase)
           (EC 1.14.-.-) (F5H).>pir|T04591|T04591
           ferulate-5-hydroxylase (EC 1.-.-.-) - Arabidopsis
           thaliana>gb:ATCHRIV85_1547582 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           85.>gb:ATF23E13_1549750 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F23E13 (ESSAII
           project).>gb:ATH295566_1552349 Arabidopsis thaliana fah1
           gene for ferulate-5-hydroxylase, exons 1-3 CAN-0
           ecotype.>gb:ATH295567_1552350 Arabidopsis thaliana fah1
           gene for ferulate-5-hydroxylase, exons 1-3 YO-0
           ecotype.>gb:ATH295568_1552351 Arabidopsis thaliana fah1
           gene for ferulate-5-hydroxylase, exons 1-3 LA-0
           ecotype.>gb:ATH295569_1552352 Arabidopsis thaliana fah1
           gene for ferulate-5-hydroxylase, exons 1-3 COL-2
           ecotype.>gb:ATH295570_1552353 Arabidopsis thaliana fah1
           gene for ferulate-5-hydroxylase, exons 1-3 COND
           ecotype.>gb:ATH295571_1552354 Arabidopsis thaliana fah1
           gene for ferulate-5-hydroxylase, exons 1-3 ME-0
           ecotype.>gb:ATH295572_1552355 Arabidopsis thaliana fah1
           gene for ferulate-5-hydroxylase, exons 1-3 RUB-1
           ecotype.>gb:ATH295573_1552356 Arabidopsis thaliana fah1
           gene for ferulate-5-hydroxylase, exons 1-3 TUL-0
           ecotype.>gb:ATH295574_1552357 Arabidopsis thaliana fah1
           gene for ferulate-5-hydroxylase, exons 1-3 GR-5
           ecotype.>gb:ATH295575_1552358 Arabidopsis thaliana fah1
           gene for ferulate-5-hydroxylase, exons 1-3 NC-1
           ecotype.>gb:ATH295578_1552361 Arabidopsis thaliana fah1
           gene for ferulate-5-hydroxylase, exons 1-3 CHA-0
           ecotype.>gb:ATH295579_1552362 Arabidopsis thaliana fah1
           gene for ferulate-5-hydroxylase, exons 1-3 PER-1
           ecotype.>gb:ATU38416_1556950 Arabidopsis thaliana
           ferulate-5-hydroxylase (FAH1) mRNA, complete
           cds.>gb:AF068574_1765642 Arabidopsis thaliana
           ferulate-5-hydroxylase (F5H) gene, complete cds.
          Length = 520

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 42/145 (28%), Positives = 74/145 (51%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGNML +    H+ +A +  KYG +  LR+G +   A+ S + A ++ +  D  F++R 
Sbjct: 49  IIGNMLMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPEVARQVLQVQDSVFSNRP 108

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
               +    Y    +AFA YG +WR +R++C +++F  KR      VR + +D M+    
Sbjct: 109 ATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDE-VDKMV---- 163

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNL 729
             + S   G  ++V   +F  T N+
Sbjct: 164 -RSVSCNVGKPINVGEQIFALTRNI 187



>gb:AY596978_1617029 Centaurium erythraea coniferylalcohol
           5-hydroxylase mRNA, complete cds.
          Length = 519

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 42/139 (30%), Positives = 74/139 (53%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGNM  +    H+ +A++  KYG ++ LR+G V T+A+ S   A ++ +  D  F++R 
Sbjct: 50  LIGNMTMMDQLTHRGLAKLAGKYGGILHLRMGFVHTVAVSSPDIARQVLQVQDNIFSNRP 109

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
               +    Y    +AFA YG +WR +R++C ++LF  KR      VR    D++     
Sbjct: 110 ATIAISYLTYDRADMAFADYGPFWRQMRKLCVMKLFSRKRAESWDSVR----DEVERMTH 165

Query: 655 KEASSVQRGTGVHVAHFVF 711
             A+++  G+ V++   VF
Sbjct: 166 IVATNI--GSPVNIGEMVF 182



>gb:AY217351_1590137 Manihot esculenta cytochrome P450 protein
           CYP71E (c15) mRNA, complete cds.
          Length = 511

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 45/150 (30%), Positives = 73/150 (48%), Gaps = 3/150 (2%)
 Frame = +1

Query: 202 AIFLIPGLVFLLARKKSSSSYRXXXXX---XXXXVIGNMLDLGAFPHQTIAEMKNKYGSV 372
           A+FL+P L  LL R K  +  +            +IGN+  LG  P+    +M  KYG V
Sbjct: 18  AVFLLPILTLLLFRGKDDNQKKGLKLPPGPRQLPLIGNLHQLGGQPYVDFWKMAKKYGPV 77

Query: 373 IWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRV 552
           ++L++G   T+ + S + + EL K+ DV    R +        Y    +AF+PY  YWR 
Sbjct: 78  MYLQLGRCPTVVLSSTETSKELMKDRDVECCSRPLSVGPGQLSYNFLDVAFSPYSDYWRE 137

Query: 553 LRRICTVELFVHKRINETVPVRRKCIDDML 642
           +R++   EL   +R+      R + +D M+
Sbjct: 138 MRKLFIFELLSMRRVQTFWYAREEQMDKMI 167



>gb:AB045593_1520404 Perilla frutescens SHT12 mRNA for flavonoid
           3'-hydroxylase, complete cds.
          Length = 523

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 37/110 (33%), Positives = 60/110 (54%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+  LG  PHQ++A +   +G ++ L++G V  +   SA  A +  K HD +F  R 
Sbjct: 44  IVGNLPQLGPKPHQSMAALARVHGPLMHLKMGFVHVVVAASATVAEKFLKVHDTNFLSRP 103

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRK 624
                +   Y    L FAP+G  WR+LR+IC + LF  K +++   VR +
Sbjct: 104 PNSGAEHIAYNYNDLVFAPHGPRWRLLRKICALHLFSSKALDDFRHVREE 153



>gb:AX146629_1462494 Sequence 5 from Patent WO0134817.
          Length = 526

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 33/111 (29%), Positives = 62/111 (55%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GNM  +    H+ +A +  +YG ++ LR+G +   A+ + + A E+ +  D +F++R 
Sbjct: 48  IVGNMAMMDQLTHRGLAALAERYGGLLHLRLGRLHAFAVSTPEYAREVLQAQDGAFSNRP 107

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKC 627
               +    Y    +AFA YG +WR +R++C ++LF  +R    V VR +C
Sbjct: 108 ATIAIAYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRRRAETWVAVRDEC 158



>pir|JC7886|JC7886 cytochrome P450 92B1 - garden petunia
          Length = 510

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 35/108 (32%), Positives = 59/108 (54%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           VIGN+  +G+ PH+++  +  KYG ++ L+ GS   + + S + A E  K HD  FA R 
Sbjct: 41  VIGNLNLVGSNPHESLHYLSQKYGDLMLLKFGSKPVLIVSSPEMAKEFLKTHDAIFASRP 100

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVR 618
            +   K   +    + +APYG +WR  R++   E+F  KR++    +R
Sbjct: 101 PLAAGKFTSFNFSDMTWAPYGRFWRQARKLYLSEIFNPKRLDSFKHIR 148



>sp|Q96581|C754_GENTR Flavonoid 3',5'-hydroxylase (EC 1.14.-.-)
           (F3'5'H) (Cytochrome P450 75A4).>gb:D85184_1674874
           Gentiana triflora mRNA for flavonoid 3',5'-hydroxylase,
           complete cds.
          Length = 516

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 51/175 (29%), Positives = 88/175 (50%), Gaps = 1/175 (0%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELF-KNHDVSFADR 471
           ++G +  LG  PH T A M  KYGSV++L++GS   +AI S   AA+ F K  D++F++R
Sbjct: 50  ILGALPLLGNMPHVTFANMAKKYGSVMYLKVGS-HGLAIASTPDAAKAFLKTLDLNFSNR 108

Query: 472 TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
                     Y    + FA YG  W++LR++  + +   K +     VR+  +  ML   
Sbjct: 109 PPNAGATHLAYNAQDMVFAHYGPKWKLLRKLSNLHMLGGKALENWADVRKTELGYML--- 165

Query: 652 EKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM 816
           +    S Q    V ++  +  +  N+L  + LSR + +    K+++F D +  +M
Sbjct: 166 KAMFESSQNNEPVMISEMLTYAMANMLSQVILSRRVFNKKGAKSNEFKDMVVELM 220



>sp|Q9LTM1|C72M_ARATH Cytochrome P450 71B22 (EC
           1.14.-.-).>gb:AB024038_1515898 Arabidopsis thaliana
           genomic DNA, chromosome 3, P1 clone:
           MTC11.>gb:AY040080_1560577 Arabidopsis thaliana putative
           cytochrome P450 protein (At3g26200) mRNA, complete
           cds.>gb:AF360271_1791219 Arabidopsis thaliana putative
           cytochrome P450 protein (At3g26200) mRNA, complete cds.
          Length = 500

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 50/192 (26%), Positives = 90/192 (46%), Gaps = 5/192 (2%)
 Frame = +1

Query: 205 IFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVIWLR 384
           + L+P L  +  +K S S  +         +IGN+  LG   H++  ++   YG V++L 
Sbjct: 8   LLLLP-LFLIFFKKLSPSKGKLPPGPLGLPIIGNLHQLGKSLHRSFHKLSQNYGPVMFLH 66

Query: 385 IGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRI 564
            G V  + + + +AA E+ K HD+    R  +   K+  Y    + FA YG  WR +R++
Sbjct: 67  FGVVPVVVVSTREAAEEVLKTHDLETCTRPKLTATKLFSYNYKDIGFAQYGDDWREMRKL 126

Query: 565 CTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLL---- 732
             +ELF  K++     +R    ++  + + K + S +  T V +   +F  T +++    
Sbjct: 127 AMLELFSSKKLKAFRYIRE---EESEVLVNKLSKSAETRTMVDLRKALFSYTASIVCRLA 183

Query: 733 -GNLFLSRDLVD 765
            G  F   D VD
Sbjct: 184 FGQNFHECDFVD 195



>gb:AC120537_1739927 Oryza sativa chromosome 3 BAC OSJNBb0042N11
           genomic sequence, complete sequence.
          Length = 512

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 35/90 (38%), Positives = 53/90 (58%)
 Frame = +1

Query: 328 PHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYY 507
           PH+ + E+  KYG ++ LR G+V T+ + SA+AA E+ K +D +FA R +   + V    
Sbjct: 69  PHRALRELAGKYGPLMMLRFGAVPTLVVSSAEAAREVLKTYDAAFASRYLTPTLAVLSRG 128

Query: 508 MGSLAFAPYGSYWRVLRRICTVELFVHKRI 597
              + F+PY   WR LRRIC  EL   +R+
Sbjct: 129 GRDILFSPYCDLWRQLRRICVHELLSARRV 158



>gb:AC109595_1738719 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1212_B02, complete sequence.
          Length = 519

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 49/172 (28%), Positives = 84/172 (48%), Gaps = 5/172 (2%)
 Frame = +1

Query: 169 MEWEWKYLVWSAIFLIPGLVFL---LARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQT 339
           ME E   ++    FL+ G ++L   + R   ++  R         VIGN+  +GA PH+ 
Sbjct: 1   MEIELSPVLLLLPFLLLGFLYLTGGVLRSGGNARRRLAPAPRGLPVIGNLHQVGALPHRA 60

Query: 340 IAEMKNKYGS--VIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMG 513
           +  +    G+  ++ LR+G V+ +   S  AAA + + HD  FA R      ++  Y   
Sbjct: 61  LRALAAATGAPHLLRLRLGHVTALVASSPAAAAAVMREHDHVFATRPYFRTAEILTYGFK 120

Query: 514 SLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS 669
            L FAPYG +WR  RR+C+  +    R +   P+R + +  ++  I  EA++
Sbjct: 121 DLVFAPYGEHWRHARRLCSEHVLSAARSHRYGPMREQEVALLVNAIRTEAAA 172



>gb:AY596975_1617026 Centaurium erythraea clone 1 cytochrome P450
           mRNA, complete cds.
          Length = 501

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 46/165 (27%), Positives = 77/165 (46%), Gaps = 3/165 (1%)
 Frame = +1

Query: 295 VIGNMLDL---GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFA 465
           ++GN+  L   G  PH+ + ++   YG ++ LR+G VS + + S + A E+ K  D  FA
Sbjct: 44  IVGNLPQLALAGTLPHRAMRDLAKTYGPLMHLRLGEVSQLVVSSPEMAKEVLKTLDPMFA 103

Query: 466 DRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLL 645
            R  + +  +  Y    L FA YG YWR L++I   EL   KR+     +R +   + + 
Sbjct: 104 SRPDLILADIMLYDNAGLTFAKYGDYWRQLKKIFATELLSAKRVKSFRSLREEETLNTIR 163

Query: 646 WIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDK 780
           WI     S   G  +++ + +    F +L      +    P  DK
Sbjct: 164 WI-----SSNEGKPINMTNTLLNLVFGVLSRATFGKK--SPEQDK 201



>sp|O81973|C933_SOYBN Cytochrome P450 93A3 (EC 1.14.-.-) (P450
           CP5).>pir|T07119|T07119 cytochrome P450 CP5 -
           soybean>gb:GMC450CP5_1680416 G.max mRNA for putative
           cytochrome P450, clone CP5.
          Length = 510

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 44/142 (30%), Positives = 76/142 (53%), Gaps = 3/142 (2%)
 Frame = +1

Query: 205 IFLIPGLVF--LLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVIW 378
           I LI  +VF  +L RK++ +            +IG++  L   PHQ   ++  +YG +I 
Sbjct: 8   ICLISTIVFASILWRKQNKNKTLLPPSPMPLPIIGHLHLLSPTPHQDFHKLSLRYGPIIH 67

Query: 379 LRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDV-MKVQGYYMGSLAFAPYGSYWRVL 555
           L +GSV  +   +A+AA E  K H+ +F++R    V ++   Y      FAPYG YW+ +
Sbjct: 68  LFLGSVPCVVASTAEAAKEFLKTHEPAFSNRPANTVAVETLTYGFQDFLFAPYGPYWKFM 127

Query: 556 RRICTVELFVHKRINETVPVRR 621
           +++C  EL     +++ +PVR+
Sbjct: 128 KKLCMSELLGGHMLDQFLPVRQ 149



>sp|P37120|C752_SOLME Flavonoid 3',5'-hydroxylase (EC 1.14.-.-)
           (F3'5'H) (Cytochrome P450 75A2) (CYPLXXVA2)
           (P-450EG1).>pir|S43342|S43342 flavonoid
           3',5'-hydroxylase (EC 1.14.-.-) cytochrome P450 -
           eggplant>gb:SMPEG1_1715518 S.melongena pEG1 mRNA for
           hydroxylase P450.
          Length = 513

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 46/174 (26%), Positives = 86/174 (49%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           VIG +  LG  PH  +A+M  KYG +++L++G+   +   +  AA    K  D++F++R 
Sbjct: 45  VIGALPLLGGMPHVALAKMAKKYGPIMYLKVGTCGMVVASTPNAAKAFLKTLDINFSNRP 104

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                    Y    + FAPYG  W++LR++  + +   K +     VR   +  ML  + 
Sbjct: 105 PNAGATHMAYNAQDMVFAPYGPRWKLLRKLSNLHMLGGKALENWANVRANELGHMLKSM- 163

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM 816
            +AS V  G  + VA  +  +  N++G + LS+ +      + ++F + +  +M
Sbjct: 164 FDASHV--GERIVVADMLTFAMANMIGQVMLSKRVFVEKGKEVNEFKNMVVELM 215



>sp|P37117|C714_SOLME Cytochrome P450 71A4 (EC 1.14.-.-) (CYPLXXIA4)
           (P-450EG2).>pir|S36805|S36805 cytochrome P450 71A4 -
           eggplant>gb:SMCYPEG2_1715486 S.melongena CYP71A1 mRNA
           for P450 hydroxylase.
          Length = 507

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 47/155 (30%), Positives = 77/155 (49%), Gaps = 2/155 (1%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  LG+ PH+++ ++  KYG V+ L +GS   +   S  AA ++ K HD  +A R 
Sbjct: 45  IIGNLHQLGSHPHRSLRKLSQKYGPVMLLHLGSKPVIVASSVDAARDILKTHDHVWATRP 104

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
              +     Y    + F+P+G YW  +R I  + L  +KR+     VR +   +M+  I 
Sbjct: 105 KYSIADSLLYGSKDVGFSPFGEYWWQVRSIVVLHLLSNKRVQSYRDVREEETANMIEKIR 164

Query: 655 K--EASSVQRGTGVHVAHFVFLSTFNLLGNLFLSR 753
           +  +AS +  G      H  FL T N+   + L R
Sbjct: 165 QGCDASVINLG-----EHLCFL-TNNITSRVALGR 193



>gb:AP006446_1861782 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:B1097H10.
          Length = 519

 Score = 73.6 bits (179), Expect = 4e-12
 Identities = 45/194 (23%), Positives = 91/194 (46%), Gaps = 4/194 (2%)
 Frame = +1

Query: 196 WSAIF--LIPGLVFLLARK--KSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKY 363
           W+  F  ++  +VFLL     +   +Y+         +IGN+  + + PH++I E+  ++
Sbjct: 7   WATFFAVVLATVVFLLRAVLLRRRRAYKLPPGPKPWPIIGNLNLISSLPHRSIHEISKRH 66

Query: 364 GSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSY 543
           G ++ L  GS   +   S + A    + +D  FADR      K   Y    + ++PYG+Y
Sbjct: 67  GPIVQLWFGSCPVVVGSSVEMAKLFLQTNDAVFADRPRTAAGKYTAYDCTDITWSPYGAY 126

Query: 544 WRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTF 723
           WR  R++C  ELF  +R+     +R + +  +L  +    ++   G  V +   + ++  
Sbjct: 127 WRQARKMCAAELFSARRLESLEHIRHEEVRALLRELHGSGAA---GNAVQLRDHLSMAAL 183

Query: 724 NLLGNLFLSRDLVD 765
            ++  + L +  V+
Sbjct: 184 GVISRMVLGKKYVE 197



>gb:AF501293S1_1806526 Glycine max cultivar Williams flavonoid
           3'-hydroxylase gene, partial cds.>gb:AF501295S1_1806528
           Glycine max cultivar XB22A flavonoid 3'-hydroxylase
           gene, partial cds.>gb:AF501297S1_1806530 Glycine max
           cultivar XB22A cell-line mutant 37609 flavonoid
           3'-hydroxylase gene, partial cds.>gb:AF501299S1_1806532
           Glycine max cultivar XB22A cell-line mutant 37643
           flavonoid 3'-hydroxylase gene, partial
           cds.>gb:AF501301S1_1806534 Glycine max cultivar Richland
           truncated flavonoid 3'-hydroxylase gene, partial
           cds.>gb:AF501303S1_1806536 Glycine max cultivar Richland
           cell-line mutant T157 truncated flavonoid 3'-hydroxylase
           gene, partial cds.
          Length = 141

 Score = 73.6 bits (179), Expect = 4e-12
 Identities = 36/102 (35%), Positives = 56/102 (54%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+  +G  PH ++A +   +G ++ LR+G V  +   SA  A +  K HD +F+ R 
Sbjct: 40  IVGNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRP 99

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRIN 600
                K   Y    L FAPYG  WR+LR++ +V LF  K +N
Sbjct: 100 PNAGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMN 141



>gb:OSJN00014_1693289 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0068L06, complete
           sequence.>gb:OSJN00294_1698095 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: B1160F02, complete sequence.
          Length = 499

 Score = 73.6 bits (179), Expect = 4e-12
 Identities = 40/128 (31%), Positives = 70/128 (54%), Gaps = 2/128 (1%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           VIG++  L    H+T  E+  + G ++ +R+GS   +   SA+ AAEL ++H+   ++R 
Sbjct: 35  VIGHLHLLRPPVHRTFHELAARLGPLMHVRLGSTHCVVASSAEVAAELIRSHEAKISERP 94

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI- 651
           +  V +   Y     AFAPY  +WR ++R+C  EL   + + +  PVRR  +  +L  + 
Sbjct: 95  LTAVARQFAYESAGFAFAPYSPHWRFMKRLCMSELLGPRTVEQLRPVRRAGLVSLLRHVL 154

Query: 652 -EKEASSV 672
            + EA +V
Sbjct: 155 SQPEAEAV 162



>sp|Q9LTM2|C72L_ARATH Cytochrome P450 71B21 (EC
           1.14.-.-).>gb:AB024038_1515897 Arabidopsis thaliana
           genomic DNA, chromosome 3, P1 clone: MTC11.
          Length = 499

 Score = 73.6 bits (179), Expect = 4e-12
 Identities = 46/162 (28%), Positives = 79/162 (48%), Gaps = 5/162 (3%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  LG   H++  ++  +YG V++LR G V  +   + +AA E+ K HD+    R 
Sbjct: 37  IIGNLHQLGKSLHRSFYKLSQEYGPVMFLRFGVVPVVVFSTKEAAEEVLKTHDLETCTRP 96

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
            +    +  Y    + FA YG  WR +R++  +ELF  K++     +R    ++  L ++
Sbjct: 97  KLSATGLFTYNFKDIGFAQYGEDWREMRKLAMLELFSSKKLKAFRYIRE---EESELLVK 153

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLL-----GNLFLSRDLVD 765
           K   S Q  T V +   +F  T +++     G  F   D VD
Sbjct: 154 KVTESAQTQTLVDLRKALFSYTASIVCRLAFGQNFHECDFVD 195



>gb:AF313490_1785223 Lycianthes rantonnei flavonoid
           3',5'-hydroxylase mRNA, complete cds.
          Length = 511

 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 48/174 (27%), Positives = 86/174 (49%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           VIG +  LG  PH  +A+M  KYG +++L++G+   +   +  AA    K  D++F++R 
Sbjct: 46  VIGALPLLGTMPHVALAKMAKKYGPIMYLKVGTCGMVVASTPNAAKAFLKTLDINFSNRP 105

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                    Y    + FA YG  W++LR++  + +   K + +   VR   +  ML  + 
Sbjct: 106 PNAGATHLAYDAQDMVFAHYGPRWKLLRKLSNLHMLGGKALEDWANVRANELGHMLKSM- 164

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM 816
            +AS V  G  V VA  +  +  N++G + LS+ +      + +KF D +  +M
Sbjct: 165 FDASRV--GGRVVVADMLTFAMANMIGQVILSKRVFVEKGAEVNKFKDMVVELM 216



>gb:AF214008_1777814 Brassica napus cytochrome p450-dependent
           monooxygenase (BNF5H2) mRNA, complete cds.
          Length = 520

 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 42/145 (28%), Positives = 73/145 (50%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGNM  +    H+ +A +  KYG +  LR+G +   A+ S   A ++ +  D  F++R 
Sbjct: 49  IIGNMSMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPDVAKQVLQVQDSVFSNRP 108

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
               +    Y    +AFA YG +WR +R++C +++F  KR      VR    D++   I 
Sbjct: 109 ATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVR----DEVDKMIR 164

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNL 729
             +S+V  G  ++V   +F  T N+
Sbjct: 165 SVSSNV--GKSINVGEQIFALTRNI 187



>gb:AF214007_1777813 Brassica napus cytochrome p450-dependent
           monooxygenase (BNF5H1) mRNA, complete cds.
          Length = 520

 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 42/145 (28%), Positives = 73/145 (50%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGNM  +    H+ +A +  KYG +  LR+G +   A+ S   A ++ +  D  F++R 
Sbjct: 49  IIGNMSMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPDVAKQVLQVQDSVFSNRP 108

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
               +    Y    +AFA YG +WR +R++C +++F  KR      VR    D++   I 
Sbjct: 109 ATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVR----DEVDKMIR 164

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNL 729
             +S+V  G  ++V   +F  T N+
Sbjct: 165 SVSSNV--GKSINVGEQIFALTRNI 187



>gb:AF139532_1771438 Liquidambar styraciflua aldehyde 5-hydroxylase
           (Ald5H) mRNA, complete cds.
          Length = 511

 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 42/145 (28%), Positives = 77/145 (53%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           VIGNML +    H+ +A++  +YG +  L++G +  +A+ +   A ++ +  D  F++R 
Sbjct: 47  VIGNMLMMDQLTHRGLAKLAKQYGGLFHLKMGFLHMVAVSTPDMARQVLQVQDNIFSNRP 106

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
               +    Y    +AFA YG +WR +R++C ++LF  KR      VR    D++   + 
Sbjct: 107 ATIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVR----DEVDSAVR 162

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNL 729
             AS++  G+ V++   VF  T N+
Sbjct: 163 VVASNI--GSTVNIGELVFALTKNI 185



>gb:AC096855_1736364 Oryza sativa chromosome 3 BAC OJ1365_D05
           genomic sequence, complete sequence.
          Length = 333

 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 44/145 (30%), Positives = 76/145 (52%), Gaps = 1/145 (0%)
 Frame = +1

Query: 295 VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR 471
           VIG+M  L  A PH+ + ++   +G ++ LR+G    +   S  AA  + K HD +FA R
Sbjct: 44  VIGSMHHLVNALPHRAMRDLAGVHGPLMMLRLGETPVVVASSRGAARAVLKTHDANFATR 103

Query: 472 TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
             +   ++ GY    + F+P G YWR LR++C  E+   KR+     +R    D++   +
Sbjct: 104 PRLLAGEIVGYGWADILFSPSGDYWRKLRQLCAAEILSPKRVLSFRHIRE---DEVTARV 160

Query: 652 EKEASSVQRGTGVHVAHFVFLSTFN 726
           E+  ++    T V+++  +F ST N
Sbjct: 161 EEIRAAAAPSTPVNLS-VLFHSTTN 184



>gb:AY675560_1621949 Solanum tuberosum flavonoid 3',5'-hydroxylase
           (P) gene, P-recessive allele, partial cds.
          Length = 308

 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 43/174 (24%), Positives = 84/174 (48%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           VIG +  LG+ PH  +A+M   YG +++L++G+   +   +  AA    K  D++F++R 
Sbjct: 35  VIGALSLLGSMPHVALAKMAKNYGPIMYLKVGTCGMVVASTPNAAKAFLKTLDINFSNRP 94

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                    Y    + FAPYG  W++LR++  + +   K +     VR   +  ML   +
Sbjct: 95  PNAGATHLAYNAQDMVFAPYGPRWKLLRKLSNLHMLGGKALENWANVRANELGHML---K 151

Query: 655 KEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM 816
               + Q G  V +A  +  +  N++G + LS+ +      + ++F + +  +M
Sbjct: 152 SMFDASQEGECVVIADMLTFAMANMIGQVMLSKRVFVEKGVEVNEFKNMVVELM 205



>gb:AF313492_1785225 Matthiola incana putative cytochrome P450 mRNA,
           complete cds.
          Length = 504

 Score = 72.8 bits (177), Expect = 7e-12
 Identities = 44/150 (29%), Positives = 79/150 (52%), Gaps = 1/150 (0%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GN+  L    H     +   +GS+  L +GS  T+ I S   A E+ K+ D++FA+  
Sbjct: 39  IVGNLPFLDPDLHTYFTSLAQTHGSIFKLNLGSKLTVVISSPSLAREILKDQDINFANHD 98

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
           V    +   Y    + ++PYG+ WR+LR++C ++L   K ++    +RRK I +   ++ 
Sbjct: 99  VPLTGRAATYGGLDILWSPYGAEWRMLRKVCLLKLLSRKTLDSFYELRRKEIRERTRFLY 158

Query: 655 KEASSVQRGTG-VHVAHFVFLSTFNLLGNL 741
           K++    RG   V+V   +FL+  NL  N+
Sbjct: 159 KQS----RGEAPVNVGDQLFLTMMNLTMNM 184



>gb:AY278229_1594517 Medicago truncatula CYP81E8 mRNA, complete cds.
          Length = 499

 Score = 72.8 bits (177), Expect = 7e-12
 Identities = 47/147 (31%), Positives = 72/147 (48%), Gaps = 1/147 (0%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           +IGN+  L    H T   +  KYG +  L  GS   + + S   A E F  +D+  A+R 
Sbjct: 41  IIGNLHQLKQPLHHTFHTLSQKYGQIFSLWFGSRLVVVVSSLTIAQECFTKNDIVLANRP 100

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
                K  GY   ++A +PYG +WR LRRI ++E+    R+N  + +RR   D+++  I+
Sbjct: 101 HFLTGKYIGYNNTTVAQSPYGDHWRNLRRILSIEILSSHRLNSFLEIRR---DEIMRLIQ 157

Query: 655 KEASSVQRG-TGVHVAHFVFLSTFNLL 732
           K A     G T V +       TFN +
Sbjct: 158 KLAQKSYNGFTEVELRPMFSEMTFNTI 184



>gb:AY056209_1563532 Arabidopsis thaliana putative cytochrome P450
           protein (At4g22690) mRNA, complete cds.
          Length = 524

 Score = 72.8 bits (177), Expect = 7e-12
 Identities = 38/147 (25%), Positives = 81/147 (55%), Gaps = 1/147 (0%)
 Frame = +1

Query: 295 VIGNMLDLGA-FPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR 471
           ++GN+  L +   H     +  K+G ++ + +GS   + + S   A E+ K HD++FA+ 
Sbjct: 60  IVGNLPFLNSDVLHTQFQALTLKHGPLMKIHLGSKLAIVVSSPDMAREVLKTHDITFANH 119

Query: 472 TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
            + +V K+  Y    + ++PYG++WR LR++C +++F    +  +   RR+     ++ +
Sbjct: 120 DLPEVGKINTYGGEDILWSPYGTHWRRLRKLCVMKMFTTPTLEASYSTRREETRQTIVHM 179

Query: 652 EKEASSVQRGTGVHVAHFVFLSTFNLL 732
            + A   + G+ V++   +FLS FN++
Sbjct: 180 SEMA---REGSPVNLGEQIFLSIFNVV 203



>gb:AB078514_1523730 Nierembergia sp. NB17 f3',5'h mRNA for
           flavonoid 3',5'-hydroxylase, complete cds.
          Length = 503

 Score = 72.8 bits (177), Expect = 7e-12
 Identities = 54/204 (26%), Positives = 99/204 (48%), Gaps = 3/204 (1%)
 Frame = +1

Query: 214 IPGLVFLLARK--KSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVIWLRI 387
           I  ++FLLA      +S  R         VIG +  LG  PH ++A+M  KYG +++L++
Sbjct: 10  IAAIIFLLAHILISKTSGRRLPPGPRGWPVIGALPLLGDMPHVSLAKMAKKYGPIMYLKV 69

Query: 388 GSVSTMAILSAKAAAELF-KNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRI 564
           G+   MA+ S   AA+ F K  D++F++R          Y    + FAPYG  W++LR++
Sbjct: 70  GTCG-MAVASTPHAAKAFLKTLDINFSNRPPNAGATHFAYNAQDMVFAPYGPRWKLLRKL 128

Query: 565 CTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLLGNLF 744
             + +   K + +   VR   +  ML   +      + G  V +A  +  +  N++G + 
Sbjct: 129 SNLHMLGGKALEDWSNVRANELGHML---KSMLDLSREGQRVVIADMLTFAMANMIGQVI 185

Query: 745 LSRDLVDPMSDKASKFFDAMTGIM 816
           LS+ +      + ++F + +  +M
Sbjct: 186 LSKRVFVDKGVEVNEFKNMVVELM 209



>gb:AE016959_1023401 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC073867_1541148
           Oryza sativa chromosome 10 BAC OSJNBa0055O03 genomic
           sequence, complete sequence.>gb:AE017111_1753220 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           65 of 77 of the complete sequence.
          Length = 326

 Score = 72.8 bits (177), Expect = 7e-12
 Identities = 41/147 (27%), Positives = 77/147 (52%), Gaps = 1/147 (0%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRT 474
           ++GNM  +    H+ +A +  +YG ++ LR+G +   A+ + + A E+ +  D +F++R 
Sbjct: 48  IVGNMAMMDQLTHRGLAALAKEYGGLMHLRLGRLHAFAVSTPEYAREVLQAQDGAFSNRP 107

Query: 475 VIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE 654
               +    Y    +AFA YG +WR +R++C V+LF  +R    + VR    D+    + 
Sbjct: 108 ATTAIAYLTYDRADMAFAHYGPFWRQMRKLCVVKLFSRRRAETWLAVR----DESAALVR 163

Query: 655 KEASSVQRG-TGVHVAHFVFLSTFNLL 732
             A+S  RG   V++   +F  T N++
Sbjct: 164 AVAAS--RGEAAVNLGELIFNLTKNVI 188



>gb:AE016959_1020912 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC074105_1541187
           Oryza sativa chromosome 10 clone OSJNBa0030B02, complete
           sequence.>gb:AE017055_1750731 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 9 of 77 of the
           complete sequence.
          Length = 515

 Score = 72.8 bits (177), Expect = 7e-12
 Identities = 49/155 (31%), Positives = 79/155 (50%), Gaps = 5/155 (3%)
 Frame = +1

Query: 295 VIGNMLDL-GAFPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR 471
           VIGN+LD+ G  PH+++A +  +YG ++ LR+G++  +   S   A ++   H  S  DR
Sbjct: 40  VIGNLLDVAGELPHRSLACVAERYGPLVTLRLGTMLAVVASSPATARDVLHRHGASITDR 99

Query: 472 TVIDVMKVQGYYMGSL-AFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLW 648
              D     G+   S+ AF      WR LRR+   +LF  +R+ E  P+RR  +  +L  
Sbjct: 100 GTPDAWSTDGHDGNSIFAFPTRHHRWRALRRLGAEQLFSPRRVEEQRPLRRDAVRGLLRH 159

Query: 649 IEKEASSVQRGTG--VHVAHFVFLSTFNLL-GNLF 744
           + + A++   G    V V    F +  +LL G LF
Sbjct: 160 VAELAAASGGGGAAVVDVGRAAFAAMASLLFGALF 194



>pir|T49141|T49141 cytochrome P450-like protein - Arabidopsis
           thaliana>gb:ATT10D17_1554216 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T10D17.
          Length = 499

 Score = 72.8 bits (177), Expect = 7e-12
 Identities = 51/192 (26%), Positives = 90/192 (46%), Gaps = 5/192 (2%)
 Frame = +1

Query: 205 IFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVIWLR 384
           + L+P L  +L +K   S  +         +IGN+  LG   +++  ++  +YG V+ LR
Sbjct: 8   LLLLP-LSLILFKKLLPSKGKLPPGPIGLPIIGNLHQLGKLLYKSFHKISQEYGPVVLLR 66

Query: 385 IGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRI 564
           +G V  + + S + A E+ K HD+    R       +  Y    + FAP+G  WR +R+I
Sbjct: 67  LGVVPVIVVSSKEGAEEVLKTHDLETCTRPKTAATGLFTYNFKDIGFAPFGDDWREMRKI 126

Query: 565 CTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLL---- 732
            T+ELF  K++     +R +  + ++  I K     Q  + V +   +F  T +++    
Sbjct: 127 TTLELFSVKKLKSFRYIREEESELLVKKISKSVDETQ-NSSVDLRKVLFSFTASIICRLA 185

Query: 733 -GNLFLSRDLVD 765
            G  F   D VD
Sbjct: 186 FGQNFHQCDFVD 197



>pir|T04564|T04564 cytochrome P450 homolog T12H17.80 - Arabidopsis
           thaliana>gb:ATCHRIV57_1546106 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           57.>gb:ATT12H17_1554354 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T12H17 (ESSAII project).
          Length = 524

 Score = 72.8 bits (177), Expect = 7e-12
 Identities = 38/147 (25%), Positives = 81/147 (55%), Gaps = 1/147 (0%)
 Frame = +1

Query: 295 VIGNMLDLGA-FPHQTIAEMKNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR 471
           ++GN+  L +   H     +  K+G ++ + +GS   + + S   A E+ K HD++FA+ 
Sbjct: 60  IVGNLPFLNSDVLHTQFQALTLKHGPLMKIHLGSKLAIVVSSPDMAREVLKTHDITFANH 119

Query: 472 TVIDVMKVQGYYMGSLAFAPYGSYWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWI 651
            + +V K+  Y    + ++PYG++WR LR++C +++F    +  +   RR+     ++ +
Sbjct: 120 DLPEVGKINTYGGEDILWSPYGTHWRRLRKLCVMKMFTTPTLEASYSTRREETRQTIVHM 179

Query: 652 EKEASSVQRGTGVHVAHFVFLSTFNLL 732
            + A   + G+ V++   +FLS FN++
Sbjct: 180 SEMA---REGSPVNLGEQIFLSIFNVV 203



>sp|Q9LXM3|C72Z_ARATH Cytochrome P450 71B38 (EC 1.14.-.-).
          Length = 500

 Score = 72.8 bits (177), Expect = 7e-12
 Identities = 51/192 (26%), Positives = 90/192 (46%), Gaps = 5/192 (2%)
 Frame = +1

Query: 205 IFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVIWLR 384
           + L+P L  +L +K   S  +         +IGN+  LG   +++  ++  +YG V+ LR
Sbjct: 8   LLLLP-LSLILFKKLLPSKGKLPPGPIGLPIIGNLHQLGKLLYKSFHKISQEYGPVVLLR 66

Query: 385 IGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGSYWRVLRRI 564
           +G V  + + S + A E+ K HD+    R       +  Y    + FAP+G  WR +R+I
Sbjct: 67  LGVVPVIVVSSKEGAEEVLKTHDLETCTRPKTAATGLFTYNFKDIGFAPFGDDWREMRKI 126

Query: 565 CTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLL---- 732
            T+ELF  K++     +R +  + ++  I K     Q  + V +   +F  T +++    
Sbjct: 127 TTLELFSVKKLKSFRYIREEESELLVKKISKSVDETQ-NSSVDLRKVLFSFTASIICRLA 185

Query: 733 -GNLFLSRDLVD 765
            G  F   D VD
Sbjct: 186 FGQNFHQCDFVD 197



>gb:AF488521_1804420 Oryza sativa Cyt-P450 monooxygenase (PM-I)
           mRNA, complete cds.>gb:AP005245_1849459 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBa0025J22.>gb:AP005254_1849639 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBb0064I19.
          Length = 505

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 48/176 (27%), Positives = 82/176 (46%), Gaps = 2/176 (1%)
 Frame = +1

Query: 295 VIGNMLDLGAFPHQTIAEM-KNKYGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADR 471
           VIGN+L L    H  +A + + +YG V+ L++G  + + + S  AA E F  HD   A R
Sbjct: 44  VIGNVLSLSGDMHHELARLAREQYGPVMTLKLGLFTAVVVSSPDAAREAFTKHDRRLAAR 103

Query: 472 TVIDVMKVQGYYMGSLAFAPYGS-YWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLW 648
           TV D+ + +G    S+ + P     W+ LR       F  + +     VR + + D++ +
Sbjct: 104 TVPDISRARGLTGRSMIWLPSSDPRWKTLRSAVATHFFSPRSLAAARGVRERKVRDIVNY 163

Query: 649 IEKEASSVQRGTGVHVAHFVFLSTFNLLGNLFLSRDLVDPMSDKASKFFDAMTGIM 816
               A+ V     + V   V+    N++ N F S D+VD   + A    + +  I+
Sbjct: 164 FAGHAAEV-----IDVGEAVYGGVINIVSNAFFSADVVDVGKESAHGLRETLEDII 214



>gb:AF188612_1775231 Callistephus chinensis flavone synthase II
           (CYP93B5) mRNA, complete cds.
          Length = 514

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 46/186 (24%), Positives = 93/186 (50%), Gaps = 3/186 (1%)
 Frame = +1

Query: 202 AIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIAEMKNKYGSVIWL 381
           AIF I  L   L   ++  S           +IG++  LG   H +  ++  +YG +I L
Sbjct: 16  AIFFISSLFIYLVLIRNQKSLSLPPSPPALPIIGHLHHLGPLIHHSFHDLSTRYGPLIHL 75

Query: 382 RIGSVSTMAILSAKAAAELFKNHDVSFADR---TVIDVMKVQGYYMGSLAFAPYGSYWRV 552
           R+GSV  +   +   A +  K ++++F+ R     ID +     Y  S AFAPYG YW+ 
Sbjct: 76  RLGSVPCVVASTPDLARDFLKTNELAFSSRKHSLAIDHVT----YGVSFAFAPYGPYWKF 131

Query: 553 LRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNLL 732
           +++   VEL  ++ ++  +P+R + + ++L  +  ++   ++   V+++  +   T N++
Sbjct: 132 IKKTSIVELLGNQNLSNFLPIRTQEVHELLQTLMVKS---KKNESVNLSEELLKLTNNVI 188

Query: 733 GNLFLS 750
             + +S
Sbjct: 189 CQMMMS 194



>gb:CRO295719_1673475 Catharanthus roseus partial mRNA for
           cytochrome P450 (cyp71 gene).
          Length = 514

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 49/160 (30%), Positives = 75/160 (46%), Gaps = 2/160 (1%)
 Frame = +1

Query: 187 YLVWSAIFLIPGLVFLLARKKSSSSYRXXXXXXXXXVIGNMLDLGAFPHQTIA--EMKNK 360
           +L+ S++FLI  L  L+   K     +         +IGN+   G F    +    +  K
Sbjct: 12  FLLLSSLFLIILLNKLMRGNKIQKGKKLPPGPKKIAIIGNLPSNGRFTSLIVFLNNLAEK 71

Query: 361 YGSVIWLRIGSVSTMAILSAKAAAELFKNHDVSFADRTVIDVMKVQGYYMGSLAFAPYGS 540
           YG ++ LRIG +S + I SA+ A E+   H V  ADR    V K+  Y    + FAPYG 
Sbjct: 72  YGPIMHLRIGQLSAVIISSAEKAKEILNTHGVRVADRPQTTVAKIMLYNSLGVTFAPYGD 131

Query: 541 YWRVLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKE 660
           Y + LR+I  +EL   K +     +    +  M+  I+ E
Sbjct: 132 YLKQLRQIYAMELLSPKTVKSFWTIMDDELSTMITSIKSE 171


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 957,233,415
Number of Sequences: 1806583
Number of extensions: 22031937
Number of successful extensions: 68129
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 62405
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 67767
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 53596531634
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)