BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig12
         (535 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY351702_1601692 Ipomoea trifida glycosyltransferase 10 mRNA,...   252   3e-66   
gb:AY351700_1601690 Ipomoea trifida glycosyltransferase 1 mRNA, ...   252   3e-66   
gb:AY351701_1601691 Ipomoea trifida glycosyltransferase 5 mRNA, ...   203   2e-51   
gb:AB006699_1509891 Arabidopsis thaliana genomic DNA, chromosome...   159   3e-38   
pir|T48403|T48403 hypothetical protein F17C15.180 - Arabidopsis ...   158   6e-38   Arabidopsis thaliana [mouse-ear cress]
gb:AP000366_1819728 Oryza sativa (japonica cultivar-group) genom...   134   1e-30   
gb:AY084607_1569695 Arabidopsis thaliana clone 113140 mRNA, comp...   129   3e-29   
gb:AC006068_1533364 Arabidopsis thaliana chromosome 2 clone T20F...   129   3e-29   
gb:AF432499_1799504 Oryza sativa cellulose synthase-like protein...   125   3e-28   
gb:AY372247_1603232 Cyamopsis tetragonoloba beta-1,4-mannan synt...   120   1e-26   
gb:BT004213_1637308 Arabidopsis thaliana clone RAFL15-21-K06 (R2...   116   2e-25   
gb:AE005172_891359 Arabidopsis thaliana chromosome 1, top arm co...   112   3e-24   
gb:AC007945_1536365 Genomic sequence for Arabidopsis thaliana BA...   112   4e-24   
gb:AC073556_1541111 Oryza sativa chromosome 3 BAC OSJNBa0091P11 ...   107   9e-23   
gb:AP004666_1842954 Oryza sativa (japonica cultivar-group) genom...   103   2e-21   
gb:AF432498_1799503 Oryza sativa cellulose synthase-like protein...   103   2e-21   
pir|C84771|C84771 probable glucosyltransferase [imported] - Arab...   102   4e-21   Arabidopsis thaliana [mouse-ear cress]
gb:AP004260_1839306 Oryza sativa (japonica cultivar-group) genom...   101   6e-21   
gb:AC084766_1733777 Oryza sativa chromosome 3 BAC OSJNBb0048D20 ...    99   4e-20   
gb:AP004114_1837781 Oryza sativa (japonica cultivar-group) genom...    98   9e-20   
gb:AP006162_1861143 Oryza sativa (japonica cultivar-group) genom...    96   3e-19   
pir|T06298|T06298 hypothetical protein T9E8.150 - Arabidopsis th...    93   3e-18   Arabidopsis thaliana [mouse-ear cress]
pir|T49212|T49212 hypothetical protein F27K19.180 - Arabidopsis ...    90   2e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AP003509_1830104 Oryza sativa (japonica cultivar-group) genom...    88   7e-17   
gb:BT004569_1637603 Arabidopsis thaliana At3g56000 gene, complet...    88   9e-17   
gb:AF435643_1799836 Oryza sativa CSLA7 mRNA, partial cds.              74   1e-12   
pir|A84639|A84639 probable glucosyltransferase [imported] - Arab...    72   4e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1022506 Oryza sativa (japonica cultivar-group) chrom...    70   2e-11   
pir|T05111|T05111 hypothetical protein F28M20.220 - Arabidopsis ...    70   2e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AP003377_1828777 Oryza sativa (japonica cultivar-group) genom...    68   8e-11   
gb:ATAC009853_1543040 Arabidopsis thaliana chromosome III BAC F2...    66   3e-10   
pir|T51489|T51489 hypothetical protein T21H19_110 - Arabidopsis ...    65   5e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AC108873_1738580 Oryza sativa (japonica cultivar-group) chrom...    63   3e-09   
gb:CAR400859_1645254 Cicer arietinum partial mRNA for putative g...    62   4e-09   
gb:AP005309_1850313 Oryza sativa (japonica cultivar-group) genom...    60   2e-08   
gb:AF435652S2_1799845 Oryza sativa CSLC9 gene, exon 5 and comple...    60   2e-08   
gb:AF435641_1799834 Oryza sativa CSLC9 mRNA, complete cds.             60   2e-08   
gb:AC133450_1741463 Oryza sativa chromosome 3 BAC OSJNBa0072F13 ...    60   2e-08   
pir|B85078|B85078 probable glucosyltransferase [imported] - Arab...    58   1e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AP004013_1836367 Oryza sativa (japonica cultivar-group) genom...    54   1e-06   
gb:AP005568_1854195 Oryza sativa (japonica cultivar-group) genom...    54   2e-06   
gb:AY056286_1563600 Arabidopsis thaliana unknown protein (At3g28...    52   6e-06   
pir|D86368|D86368 hypothetical protein F5O8.4 [imported] - Arabi...    50   3e-05   Arabidopsis thaliana [mouse-ear cress]
gb:DDU83086_1377440 Dictyostelium discoideum LimA (limA) mRNA, p...    49   6e-05   
gb:AC123513_1192410 Dictyostelium discoideum strain AX4 chromoso...    47   2e-04   
gb:AF435650_1799843 Oryza sativa CSLC2 mRNA, partial cds.              46   3e-04   
sp|P04929|HRPX_PLALO|HRPX_PLALO Histidine-rich glycoprotein precursor.>pir|...    43   0.003   Plasmodium lophurae
gb:AE014187_938873 Plasmodium falciparum 3D7 chromosome 14 compl...    41   0.010   
gb:PFAHRPA_1393792 P.lophurae histidine-rich protein mRNA, 3' end.     40   0.022   
pir|A54523|A54523 histidine-rich protein - Plasmodium lophurae (...    40   0.022   Plasmodium lophurae
gb:CS000361_1375670 Sequence 1 from Patent WO2005005472.               40   0.029   
gb:AE014298_1124730 Drosophila melanogaster chromosome X, comple...    40   0.029   
gb:AE014134_1127343 Drosophila melanogaster chromosome 2L, compl...    39   0.038   
sp|P13709|FSH_DROME|FSH_DROME Female sterile homeotic protein (Fragile-cho...    39   0.038   Drosophila melanogaster
gb:AY052652_1562812 Chlamydomonas reinhardtii gamete-specific ho...    37   0.14    
gb:LMFL3180_1387932 Leishmania major Friedlin chromosome 13 cosm...    37   0.14    
gb:AY056469_2510039 Petromyzon marinus homeobox protein hox4x mR...    37   0.19    
gb:BC021240_1977444 Homo sapiens proline rich 7 (synaptic), mRNA...    37   0.19    
gb:AC117075_1207764 Dictyostelium discoideum chromosome 2 map 52...    37   0.25    
gb:CR382136_1668722 Debaryomyces hansenii chromosome D of strain...    36   0.32    
gb:AC116986_1207453 Dictyostelium discoideum chromosome 2 map 22...    36   0.32    
gb:BT003476_1356878 Drosophila melanogaster RE59350 full insert ...    36   0.42    
gb:AC116984_1207263 Dictyostelium discoideum chromosome 2 map 25...    36   0.42    
gb:AC115598_1205798 Dictyostelium discoideum chromosome 2 map 58...    36   0.42    
sp|Q23985|DX_DROME|DX_DROME Deltex protein.>gb:AE014298_1124540 Drosophil...    36   0.42    Drosophila melanogaster
gb:CR382128_1660884 Yarrowia lipolytica chromosome B of strain C...    35   0.55    
gb:BX842634_1644059 Neurospora crassa DNA linkage group I BAC co...    35   0.55    
gb:AE014296_1136891 Drosophila melanogaster chromosome 3L, compl...    35   0.55    
gb:AE014134_1128919 Drosophila melanogaster chromosome 2L, compl...    35   0.55    
gb:AY032926_585581 Streptomyces aureofaciens putative PHA syntha...    35   0.55    
gb:AB026892_4435 Achromobacter xylosoxidans subsp. xylosoxidans ...    35   0.55    
pir|S66936|S66936 probable membrane protein YOR053w - yeast (Sac...    35   0.55    Saccharomyces cerevisiae [brewer's yeast]
sp|P36417|GBF_DICDI|GBF_DICDI G-box binding factor (GBF).>pir|A53185|A5318...    35   0.55    Dictyostelium discoideum
gb:AE014297_1138680 Drosophila melanogaster chromosome 3R, compl...    35   0.71    
gb:AE013599_1130857 Drosophila melanogaster chromosome 2R, compl...    35   0.71    
gb:AE014298_1124279 Drosophila melanogaster chromosome X, comple...    35   0.71    
pir|T13167|T13167 Lola-like protein - fruit fly (Drosophila hyde...    35   0.71    Drosophila hydei
pir|A40213|A40213 optic lobe development omb protein - fruit fly...    35   0.71    Drosophila melanogaster
sp|Q24432|OMB_DROME|OMB_DROME Optomotor-blind protein (Lethal(1)optomotor-...    35   0.71    Drosophila melanogaster
gb:MMU46463_2121571 Mus musculus glutamine repeat protein-1 mRNA...    35   0.93    
gb:BX842633_1644035 Neurospora crassa DNA linkage group I cosmid...    35   0.93    
gb:AY051454_1290048 Drosophila melanogaster GH12043 full length ...    35   0.93    
gb:AE013599_1133058 Drosophila melanogaster chromosome 2R, compl...    35   0.93    
gb:AE014298_1123849 Drosophila melanogaster chromosome X, comple...    35   0.93    
gb:AE014298_1123848 Drosophila melanogaster chromosome X, comple...    35   0.93    
gb:AY382308_1948823 Pongo pygmaeus sperm ion channel (CATSPER1) ...    34   1.2     
gb:NCB13H18_1689185 Neurospora crassa DNA linkage group V BAC co...    34   1.2     
gb:CR382132_1665075 Yarrowia lipolytica chromosome F of strain C...    34   1.2     
gb:CR382128_1660434 Yarrowia lipolytica chromosome B of strain C...    34   1.2     
gb:CEY67H2A_1370922 Caenorhabditis elegans YAC Y67H2A, complete ...    34   1.2     
gb:BT009981_1357347 Drosophila melanogaster RE54443 full insert ...    34   1.2     
gb:AY069429_1294159 Drosophila melanogaster LD13887 full length ...    34   1.2     
gb:AE014296_1135547 Drosophila melanogaster chromosome 3L, compl...    34   1.2     
gb:AE014298_1124397 Drosophila melanogaster chromosome X, comple...    34   1.2     
gb:AE014298_1124347 Drosophila melanogaster chromosome X, comple...    34   1.2     
gb:AF371263_1792416 Zea mays 50kD gamma zein mRNA, complete cds.       34   1.6     
gb:BX842620_1643732 Neurospora crassa DNA linkage group V BAC co...    34   1.6     
gb:AY094737_1297911 Drosophila melanogaster GH28553 full insert ...    34   1.6     
gb:AF254867_1256305 Drosophila melanogaster SNS (sns) mRNA, comp...    34   1.6     
gb:AE014297_1141340 Drosophila melanogaster chromosome 3R, compl...    34   1.6     
pir|I59606|I59606 dihydrolipoamide S-succinyltransferase (EC 2.3...    34   1.6     Homo sapiens [man]
gb:AF190427_1775411 Colletotrichum lindemuthianum putative GAL4-...    33   2.1     
gb:AC108503_1738536 Oryza sativa (japonica cultivar-group) chrom...    33   2.1     
gb:CR382131_1664430 Yarrowia lipolytica chromosome E of strain C...    33   2.1     
gb:AY013869_1287805 Trypanosoma cruzi antigen 38 (AG38) mRNA, co...    33   2.1     
gb:AC116979_1207058 Dictyostelium discoideum chromosome 2 map 64...    33   2.1     
gb:AC116960_1206798 Dictyostelium discoideum chromosome 2 map co...    33   2.1     
gb:AE014296_1135206 Drosophila melanogaster chromosome 3L, compl...    33   2.1     
gb:AE013599_1132052 Drosophila melanogaster chromosome 2R, compl...    33   2.1     
gb:AE014298_1124431 Drosophila melanogaster chromosome X, comple...    33   2.1     
pir|T13071|T13071 CLOCK protein - fruit fly (Drosophila melanoga...    33   2.1     Drosophila melanogaster
pir|T13068|T13068 CLOCK protein - fruit fly (Drosophila melanoga...    33   2.1     Drosophila melanogaster
sp|Q58244|Y834_METJA|Y834_METJA Hypothetical protein MJ0834.>pir|B64404|B64...    33   2.1     Methanocaldococcus jannaschii
sp|O02491|HMEN_ANOGA|HMEN_ANOGA Segmentation polarity homeobox protein engr...    33   2.1     Anopheles gambiae
sp|O61735|CLOC_DROME|CLOC_DROME Circadian locomoter output cycles Kaput pro...    33   2.1     Drosophila melanogaster
gb:AP005405_1851208 Oryza sativa (japonica cultivar-group) genom...    33   2.7     
gb:CR382129_1661358 Yarrowia lipolytica chromosome C of strain C...    33   2.7     
gb:U41538_1404041 Caenorhabditis elegans cosmid R04E5, complete ...    33   2.7     
gb:DMU48402_1380796 Drosophila melanogaster pipsqueak (psq) mRNA...    33   2.7     
gb:DMU48358_1380793 Drosophila melanogaster pipsqueak (psq) mRNA...    33   2.7     
gb:DMPIPSQ1_1379970 D.melanogaster pipsqueak ORF-A short/long OR...    33   2.7     
gb:AY118740_1300462 Drosophila melanogaster GH05220 full insert ...    33   2.7     
gb:AF275687_1257886 Plasmodium falciparum knob-associated histid...    33   2.7     
gb:AC115606_1205895 Dictyostelium discoideum chromosome 2 map 15...    33   2.7     
gb:AE014296_1135097 Drosophila melanogaster chromosome 3L, compl...    33   2.7     
gb:AE013599_1133312 Drosophila melanogaster chromosome 2R, compl...    33   2.7     
gb:AE013599_1132764 Drosophila melanogaster chromosome 2R, compl...    33   2.7     
gb:AE013599_1131125 Drosophila melanogaster chromosome 2R, compl...    33   2.7     
gb:AE013599_1131124 Drosophila melanogaster chromosome 2R, compl...    33   2.7     
gb:AE013599_1131122 Drosophila melanogaster chromosome 2R, compl...    33   2.7     
gb:AE014298_1125626 Drosophila melanogaster chromosome X, comple...    33   2.7     
gb:AE014298_1125625 Drosophila melanogaster chromosome X, comple...    33   2.7     
gb:AE014298_1125089 Drosophila melanogaster chromosome X, comple...    33   2.7     
gb:AE014185_937870 Plasmodium falciparum 3D7 chromosome 10 compl...    33   2.7     
gb:S75490_169047 competence region: iga=IgA protease, comA=trans...    33   2.7     
pir|S66149|S66149 gene pipsqueak protein A long form - fruit fly...    33   2.7     Drosophila melanogaster
pir|T28872|T28872 hypothetical protein R04E5.8 - Caenorhabditis ...    33   2.7     Caenorhabditis elegans [roundworm]
gb:BC032950_1980740 Homo sapiens cation channel, sperm associate...    33   3.5     
gb:AY382307_1948822 Gorilla gorilla sperm ion channel (CATSPER1)...    33   3.5     
gb:AY382305_1948821 Pan paniscus sperm ion channel (CATSPER1) ge...    33   3.5     
gb:AY382304_1948820 Pan troglodytes sperm ion channel (CATSPER1)...    33   3.5     
gb:AF539550_1906422 Pan troglodytes cation channel of sperm (CAT...    33   3.5     
gb:AF407333_1901236 Homo sapiens sperm ion channel mRNA, complet...    33   3.5     
gb:CR382129_1662198 Yarrowia lipolytica chromosome C of strain C...    33   3.5     
gb:PFAKNOBA_1393815 Plasmodium falciparum knob protein mRNA, par...    33   3.5     
gb:AY094826_1298000 Drosophila melanogaster LD39940 full insert ...    33   3.5     
gb:AF362373_1265606 Dictyostelium discoideum histidine kinase Dh...    33   3.5     
gb:AF234186_1253361 Plasmodium falciparum knob-associated histid...    33   3.5     
gb:AE014297_1140890 Drosophila melanogaster chromosome 3R, compl...    33   3.5     
gb:AE014297_1140290 Drosophila melanogaster chromosome 3R, compl...    33   3.5     
gb:AE014187_938608 Plasmodium falciparum 3D7 chromosome 14 compl...    33   3.5     
pir|AI1743|AI1743 hypothetical protein lin2494 [imported] - List...    33   3.5     Listeria innocua
pir|S47857|S47857 basic protein, cytosolic - fruit fly (Drosophi...    33   3.5     Drosophila melanogaster
pir|A54495|A54495 knob protein precursor - malaria parasite (Pla...    33   3.5     Plasmodium falciparum FCR-3/Gambia
pir|A26480|A26480 knob protein - malaria parasite (Plasmodium fa...    33   3.5     Plasmodium falciparum FCR-3/Gambia
pir|A54494|A54494 knob-associated histidine-rich protein precurs...    33   3.5     Plasmodium falciparum
sp|Q62563|SRY_MUSSP|SRY_MUSSP Sex-determining region Y protein (Testis-det...    33   3.5     Mus spretus [Algerian mouse]
sp|P09346|KNOB_PLAFG|KNOB_PLAFG Knob-associated histidine-rich protein prec...    33   3.5     Plasmodium falciparum
sp|P13817|KNOB_PLAFA|KNOB_PLAFA Knob-associated histidine-rich protein prec...    33   3.5     Plasmodium falciparum
gb:AF407332_2065188 Mus musculus sperm ion channel mRNA, complet...    32   4.6     
gb:AB029018_1865874 Homo sapiens mRNA for KIAA1095 protein, part...    32   4.6     
gb:CR382136_1669006 Debaryomyces hansenii chromosome D of strain...    32   4.6     
gb:CR382131_1664806 Yarrowia lipolytica chromosome E of strain C...    32   4.6     
gb:CR382131_1663822 Yarrowia lipolytica chromosome E of strain C...    32   4.6     
gb:AY165552_1305907 Drosophila novamexicana mastermind (mam) gen...    32   4.6     
gb:AY051631_1290225 Drosophila melanogaster GH28016 full length ...    32   4.6     
gb:AF128626_1243381 Dictyostelium discoideum RNA binding protein...    32   4.6     
gb:HSM802495_1186722 Homo sapiens mRNA; cDNA DKFZp434G1812 (from...    32   4.6     
gb:AK044001_1166779 Mus musculus 10 days neonate cortex cDNA, RI...    32   4.6     
gb:AE013599_1130853 Drosophila melanogaster chromosome 2R, compl...    32   4.6     
pir|T47235|T47235 sex determining protein [imported] - western w...    32   4.6     Mus spretus [Algerian mouse]
pir|T46925|T46925 hypothetical protein DKFZp434G1812.1 - human (...    32   4.6     Homo sapiens [man]
pir|T13062|T13062 CLOCK protein - fruit fly (Drosophila melanoga...    32   4.6     Drosophila melanogaster
pir|B71623|B71623 knob-associated His-rich protein PFB0100c - ma...    32   4.6     Plasmodium falciparum 3D7
gb:AY830454_2546586 Petromyzon marinus SoxF (SoxF) mRNA, complet...    32   6.1     
gb:MMU70653_2123289 Mus musculus musculus sex determining protei...    32   6.1     
gb:BC024233_1978294 Homo sapiens proline rich 7 (synaptic), mRNA...    32   6.1     
gb:CR382136_1668864 Debaryomyces hansenii chromosome D of strain...    32   6.1     
gb:ATAC011437_1543270 Arabidopsis thaliana chromosome III BAC F7...    32   6.1     
gb:CET16G12_1367771 Caenorhabditis elegans cosmid T16G12, comple...    32   6.1     
gb:AY075180_1296030 Drosophila melanogaster AT12853 full length ...    32   6.1     
gb:AE014134_1127018 Drosophila melanogaster chromosome 2L, compl...    32   6.1     
gb:AE014134_1127016 Drosophila melanogaster chromosome 2L, compl...    32   6.1     
gb:BX321860_773662 Nitrosomonas europaea ATCC 19718, complete ge...    32   6.1     
pir|S42837|S42837 T16G12.3 protein - Caenorhabditis elegans            32   6.1     Caenorhabditis elegans [roundworm]
pir|T13434|T13434 hypothetical protein T17A13.50 - Arabidopsis t...    32   6.1     Arabidopsis thaliana [mouse-ear cress]
pir|B88573|B88573 protein T16G12.3 [imported] - Caenorhabditis e...    32   6.1     Caenorhabditis elegans [roundworm]
sp|Q03825|YM38_YEAST|YM38_YEAST Hypothetical 85.0 kDa protein in HLJ1-SMP2 ...    32   6.1     Saccharomyces cerevisiae [brewer's yeast]
sp|P06719|KNOB_PLAFN|KNOB_PLAFN Knob-associated histidine-rich protein prec...    32   6.1     Plasmodium falciparum
gb:AY549443_2536971 Danio rerio dapper1 (dpr1) mRNA, complete cds.     32   7.9     
gb:AY521628_2536064 Danio rerio frodo 1 (frd1) mRNA, complete cds.     32   7.9     
gb:MMU70657_2123293 Mus musculus castaneus sex determining prote...    32   7.9     
gb:MMU70652_2123288 Mus musculus musculus sex determining protei...    32   7.9     
gb:MMU70651_2123287 Mus musculus musculus sex determining protei...    32   7.9     
gb:AB089610_2047901 Mus musculus mRNA for hair follicle protein ...    32   7.9     
gb:AE017351_1759503 Cryptococcus neoformans var. neoformans JEC2...    32   7.9     
gb:NCB7F21_1690152 Neurospora crassa DNA linkage group II BAC cl...    32   7.9     
gb:CR382127_1660070 Yarrowia lipolytica chromosome A of strain C...    32   7.9     
gb:AY091073_1574300 Arabidopsis thaliana unknown protein (At5g08...    32   7.9     
gb:ATF8L15_1551232 Arabidopsis thaliana DNA chromosome 5, BAC cl...    32   7.9     
gb:PFASXD_1394091 Plasmodium falciparum sexual stage DNA sequenc...    32   7.9     
gb:M25292_1389320 Drosophila melanogaster dsx mRNA, partial cds.       32   7.9     
gb:CEF56A12_1364572 Caenorhabditis elegans cosmid F56A12, comple...    32   7.9     
gb:AY060257_1292169 Drosophila melanogaster GH08308 full length ...    32   7.9     
gb:AY047554_1289513 Drosophila melanogaster GH06265 full length ...    32   7.9     
gb:CR749302_1180931 Homo sapiens mRNA; cDNA DKFZp779H1622 (from ...    32   7.9     
gb:AE014297_1139732 Drosophila melanogaster chromosome 3R, compl...    32   7.9     
gb:AE014296_1136178 Drosophila melanogaster chromosome 3L, compl...    32   7.9     
gb:AE013599_1131780 Drosophila melanogaster chromosome 2R, compl...    32   7.9     
gb:AE014188_968286 Plasmodium falciparum 3D7 chromosome 12, comp...    32   7.9     
gb:AE014187_938617 Plasmodium falciparum 3D7 chromosome 14 compl...    32   7.9     
gb:BX936398_837302 Yersinia pseudotuberculosis IP32953 genome, c...    32   7.9     
gb:BX571964_789771 Rhodopseudomonas palustris CGA009 plasmid pRPA.     32   7.9     
pir|A32372|A32372 female-specific doublesex protein - fruit fly ...    32   7.9     Drosophila melanogaster
pir|T22761|T22761 hypothetical protein F56A12.1 - Caenorhabditis...    32   7.9     Caenorhabditis elegans [roundworm]
pir|T18414|T18414 protein g377 - malaria parasite (Plasmodium fa...    32   7.9     Plasmodium falciparum
pir|T51023|T51023 hypothetical protein B7F21.40 [imported] - Neu...    32   7.9     Neurospora crassa
sp|Q05738|SRY_MOUSE|SRY_MOUSE Sex-determining region Y protein (Testis-det...    32   7.9     Mus musculus [mouse]
sp|P04196|HRG_HUMAN|HRG_HUMAN Histidine-rich glycoprotein precursor (Histi...    32   7.9     Homo sapiens [man]
sp|P23023|DSX_DROME|DSX_DROME Doublesex protein.>pir|B32372|B32372 male-sp...    32   7.9     Drosophila melanogaster


>gb:AY351702_1601692 Ipomoea trifida glycosyltransferase 10 mRNA,
           complete cds.
          Length = 537

 Score =  252 bits (643), Expect = 3e-66
 Identities = 123/130 (94%), Positives = 126/130 (96%)
 Frame = +2

Query: 146 MAGVAINEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVE 325
           MAG  INEVELMMPELRGPGGD+AAQMRLM+DLVKAPLIVP LRLAVYVCL MS+MLFVE
Sbjct: 1   MAGETINEVELMMPELRGPGGDMAAQMRLMYDLVKAPLIVPVLRLAVYVCLTMSMMLFVE 60

Query: 326 RLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGA 505
           RLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGA
Sbjct: 61  RLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGA 120

Query: 506 VCNFAWPSDR 535
           VCNFAWPSDR
Sbjct: 121 VCNFAWPSDR 130



>gb:AY351700_1601690 Ipomoea trifida glycosyltransferase 1 mRNA,
           complete cds.>gb:AY448010S1_1606573 Ipomoea trifida
           haplotype S1 self-incompatibility (S-) locus, contig
           SR1.
          Length = 537

 Score =  252 bits (643), Expect = 3e-66
 Identities = 123/130 (94%), Positives = 126/130 (96%)
 Frame = +2

Query: 146 MAGVAINEVELMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVE 325
           MAG  INEVELMMPELRGPGGD+AAQMRLM+DLVKAPLIVP LRLAVYVCL MS+MLFVE
Sbjct: 1   MAGETINEVELMMPELRGPGGDMAAQMRLMYDLVKAPLIVPVLRLAVYVCLTMSMMLFVE 60

Query: 326 RLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGA 505
           RLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGA
Sbjct: 61  RLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGA 120

Query: 506 VCNFAWPSDR 535
           VCNFAWPSDR
Sbjct: 121 VCNFAWPSDR 130



>gb:AY351701_1601691 Ipomoea trifida glycosyltransferase 5 mRNA,
           partial cds.
          Length = 508

 Score =  203 bits (516), Expect = 2e-51
 Identities = 98/102 (96%), Positives = 100/102 (98%)
 Frame = +2

Query: 230 LMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMR 409
           LM+DLVKAPLIVP LRLAVYVCL MS+MLFVERLYMGIVIILVKIFCGKPEKRYKWEPMR
Sbjct: 1   LMYDLVKAPLIVPVLRLAVYVCLTMSMMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMR 60

Query: 410 EDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
           EDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR
Sbjct: 61  EDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 102



>gb:AB006699_1509891 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MDJ22.>gb:AY058158_1564295 Arabidopsis thaliana
           AT5g22740/MDJ22_16 mRNA, complete
           cds.>gb:AY059852_1564696 Arabidopsis thaliana
           glucosyltransferase-like protein (MDJ22.16) mRNA,
           complete cds.>gb:AY093293_1575247 Arabidopsis thaliana
           glucosyltransferase-like protein (MDJ22.16) mRNA,
           complete cds.
          Length = 534

 Score =  159 bits (401), Expect = 3e-38
 Identities = 73/122 (59%), Positives = 99/122 (81%), Gaps = 1/122 (0%)
 Frame = +2

Query: 173 ELMMPE-LRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVI 349
           + ++PE   G   ++  Q+ ++W+LVKAP+IVP L+LAVY+CL MS+ML  ER+YMGIVI
Sbjct: 7   KFVLPETFDGVRMEITGQLGMIWELVKAPVIVPLLQLAVYICLLMSVMLLCERVYMGIVI 66

Query: 350 ILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS 529
           +LVK+F  KP+KRYK+EP+ +D E+G+S FP VL+QIPMFNE+EVYK+SIGA C  +WPS
Sbjct: 67  VLVKLFWKKPDKRYKFEPIHDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPS 126

Query: 530 DR 535
           DR
Sbjct: 127 DR 128



>pir|T48403|T48403 hypothetical protein F17C15.180 - Arabidopsis
           thaliana>gb:AB005235_1509357 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1
           clone:MED24.>gb:ATF17C15_1548902 Arabidopsis thaliana
           DNA chromosome 5, BAC clone F17C15 (ESSA
           project).>gb:AY060563_1564870 Arabidopsis thaliana
           AT5g03760/F17C15_180 mRNA, complete
           cds.>gb:AY149935_1584884 Arabidopsis thaliana
           At5g03760/F17C15_180 mRNA, complete cds.
          Length = 533

 Score =  158 bits (399), Expect = 6e-38
 Identities = 71/109 (65%), Positives = 92/109 (84%)
 Frame = +2

Query: 209 DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR 388
           D+  QM ++ D ++APLIVPALRL VY+CL MS+MLFVER+YMGIVI LVK+F  KP+KR
Sbjct: 20  DITMQMSMVLDQIRAPLIVPALRLGVYICLTMSVMLFVERVYMGIVISLVKLFGRKPDKR 79

Query: 389 YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
           +K+EP+++D E+G S +P VLIQIPMFNE+EVY++SIGA C  +WPSDR
Sbjct: 80  FKYEPIKDDIELGNSAYPMVLIQIPMFNEREVYQLSIGAACGLSWPSDR 128



>gb:AP000366_1819728 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0437H03.>gb:AP005785_1857831 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0453H10.
          Length = 521

 Score =  134 bits (336), Expect = 1e-30
 Identities = 66/111 (59%), Positives = 86/111 (77%), Gaps = 1/111 (0%)
 Frame = +2

Query: 206 GDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEK 385
           G  AA +   W  V+AP+IVP LRLAV VCL MS++LF+ER+YM +VI  VKI   +P++
Sbjct: 5   GGGAAGLPEAWSQVRAPVIVPLLRLAVAVCLTMSVLLFLERMYMAVVISGVKILRRRPDR 64

Query: 386 RYKWEPM-REDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
           RY+ +P+  +D E+GTS FP VLIQIPMFNE+EVY++SIGAVC  +WPSDR
Sbjct: 65  RYRCDPIPDDDPELGTSAFPVVLIQIPMFNEREVYQLSIGAVCGLSWPSDR 115



>gb:AY084607_1569695 Arabidopsis thaliana clone 113140 mRNA,
           complete sequence.
          Length = 556

 Score =  129 bits (324), Expect = 3e-29
 Identities = 57/109 (52%), Positives = 80/109 (73%)
 Frame = +2

Query: 209 DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR 388
           D+ A++ L W L++A ++VP  +  V +CL MS+M FVE +YMGIV++ VK+F  KPEK 
Sbjct: 42  DIIARIGLWWQLIRAVVVVPVFKFLVVLCLVMSVMFFVEVMYMGIVVLYVKLFKRKPEKF 101

Query: 389 YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
           YKWE M +D E G++ +P VL+QIPM+NEKEV + SI A C  +WPS+R
Sbjct: 102 YKWEAMEDDVECGSASYPMVLVQIPMYNEKEVCEQSIAAACKISWPSNR 150



>gb:AC006068_1533364 Arabidopsis thaliana chromosome 2 clone T20F21
           map ve016, complete sequence.>gb:ATH488284_1552686
           Arabidopsis thaliana partial mRNA for
           glycosyltransferase (cslA07 gene).>gb:AY059724_1564582
           Arabidopsis thaliana putative glucosyltransferase
           (At2g35650) mRNA, complete cds.>gb:AY133807_1581627
           Arabidopsis thaliana clone U10384 putative
           glucosyltransferase (At2g35650) mRNA, complete cds.
          Length = 556

 Score =  129 bits (324), Expect = 3e-29
 Identities = 57/109 (52%), Positives = 80/109 (73%)
 Frame = +2

Query: 209 DVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKR 388
           D+ A++ L W L++A ++VP  +  V +CL MS+M FVE +YMGIV++ VK+F  KPEK 
Sbjct: 42  DIIARIGLWWQLIRAVVVVPVFKFLVLLCLVMSVMFFVEVMYMGIVVLYVKLFKRKPEKF 101

Query: 389 YKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
           YKWE M +D E G++ +P VL+QIPM+NEKEV + SI A C  +WPS+R
Sbjct: 102 YKWEAMEDDVECGSASYPMVLVQIPMYNEKEVCEQSIAAACKISWPSNR 150



>gb:AF432499_1799504 Oryza sativa cellulose synthase-like protein
           OsCslA9 gene, complete cds.>gb:AP004737_1844061 Oryza
           sativa (japonica cultivar-group) genomic DNA, chromosome
           6, BAC clone:OSJNBa0072A21.
          Length = 527

 Score =  125 bits (315), Expect = 3e-28
 Identities = 60/119 (50%), Positives = 86/119 (72%), Gaps = 8/119 (6%)
 Frame = +2

Query: 203 GGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPE 382
           G  +  Q+  MW+ VKAP++VP LRL+V  CLAMS+MLFVE++YM +V++ V +F  +P+
Sbjct: 5   GAVLPEQIAAMWEQVKAPVVVPLLRLSVAACLAMSVMLFVEKVYMSVVLVGVHLFGRRPD 64

Query: 383 KRYKWEPM------REDYEI--GTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
           +RY+ +P+       +D E+    + FP VLIQIPM+NE+EVYK+SIGA C  +WPSDR
Sbjct: 65  RRYRCDPIVAAGADNDDPELADANAAFPMVLIQIPMYNEREVYKLSIGAACGLSWPSDR 123



>gb:AY372247_1603232 Cyamopsis tetragonoloba beta-1,4-mannan
           synthase (ManS) mRNA, complete cds.
          Length = 526

 Score =  120 bits (302), Expect = 1e-26
 Identities = 59/120 (49%), Positives = 83/120 (69%)
 Frame = +2

Query: 176 LMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL 355
           L+  E  G  G+ ++ +R  W  ++AP+I+P L+LAV VC  MS+MLFVER+ M  VI++
Sbjct: 4   LIFEEPEGIPGNSSSSLRYAWQSIRAPVIIPLLKLAVIVCSVMSIMLFVERVAMAAVILI 63

Query: 356 VKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
           VK+   K   +Y  E M++  E  +  +P VLIQIPM+NEKEVYK+SIGAVC  +WP+DR
Sbjct: 64  VKVLRKKRYTKYNLEAMKQKLE-RSKKYPMVLIQIPMYNEKEVYKLSIGAVCGLSWPADR 122



>gb:BT004213_1637308 Arabidopsis thaliana clone RAFL15-21-K06
           (R20682) putative cellulose synthase (At4g16590) mRNA,
           complete cds.
          Length = 553

 Score =  116 bits (291), Expect = 2e-25
 Identities = 49/105 (46%), Positives = 74/105 (70%)
 Frame = +2

Query: 221 QMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWE 400
           Q++ +W   ++ +++P  +  V +CL +S+++F E  YM  VI+ VK+F  KP K YKWE
Sbjct: 51  QLQYLWTKTRSVVLLPVFKGLVVMCLVLSIIVFFESFYMNFVILFVKLFKRKPHKVYKWE 110

Query: 401 PMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
            M+ED E+G   +P VLIQIPM+NEKEV+++SI A+C+  WPS R
Sbjct: 111 AMQEDVEVGPDNYPMVLIQIPMYNEKEVFQLSIAAICSLVWPSSR 155



>gb:AE005172_891359 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC002423_1530740 Genomic sequence
           for Arabidopsis thaliana BAC T23E23, complete sequence.
          Length = 533

 Score =  112 bits (281), Expect = 3e-24
 Identities = 49/92 (53%), Positives = 67/92 (72%)
 Frame = +2

Query: 260 IVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVF 439
           IVP  +  V  CL +SL++F+E +YM +V++ VK+F  KPEK Y+WE M+ED E+G   +
Sbjct: 62  IVPLFKCLVAFCLIISLLVFIEGIYMNLVVLYVKVFERKPEKVYRWEAMQEDIELGHETY 121

Query: 440 PSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
           P VL+QIPM+NEKEV ++SIGA C   WP DR
Sbjct: 122 PMVLVQIPMYNEKEVLQLSIGAACRLIWPLDR 153



>gb:AC007945_1536365 Genomic sequence for Arabidopsis thaliana BAC
           F28C11 from chromosome I, complete
           sequence.>gb:AY099769_1576794 Arabidopsis thaliana
           unknown protein (At1g23480) mRNA, complete
           cds.>gb:BT000203_1634481 Arabidopsis thaliana unknown
           protein (At1g23480) mRNA, complete cds.
          Length = 556

 Score =  112 bits (280), Expect = 4e-24
 Identities = 50/109 (45%), Positives = 75/109 (68%), Gaps = 1/109 (0%)
 Frame = +2

Query: 212 VAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRY 391
           +  ++  +W   +  + +P L+  V +CL MSL+LF+ER+YM IV++ VK+    PEK +
Sbjct: 43  IIGEIIYIWKQTRIFVFIPILKCLVTICLVMSLLLFIERVYMSIVVVFVKLLRRTPEKVH 102

Query: 392 KWEPMR-EDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
           KWEP+  +D E+  + +P VLIQIPM+NEKEV ++SIGA C  +WP DR
Sbjct: 103 KWEPINDDDLELANTNYPMVLIQIPMYNEKEVCQLSIGAACRLSWPLDR 151



>gb:AC073556_1541111 Oryza sativa chromosome 3 BAC OSJNBa0091P11
           genomic sequence, complete sequence.
          Length = 549

 Score =  107 bits (268), Expect = 9e-23
 Identities = 56/122 (45%), Positives = 75/122 (61%), Gaps = 17/122 (13%)
 Frame = +2

Query: 221 QMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIV-IILVKIFCGKPEKRYKW 397
           Q+   W +V+A  + P L+ AV+ C+AMS+ML +E  YM +V ++ VK+    PE+RYKW
Sbjct: 22  QIAAAWAVVRARAVAPVLQFAVWACMAMSVMLVLEVAYMSLVSLVAVKLLRRVPERRYKW 81

Query: 398 EPMR-----------EDYEIGT-----SVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPS 529
           EP+            ED E  T     + FP VL+QIPM+NEKEVYK+SIGA C   WP 
Sbjct: 82  EPITTGSGGVGGGDGEDEEAATGGREAAAFPMVLVQIPMYNEKEVYKLSIGAACALTWPP 141

Query: 530 DR 535
           DR
Sbjct: 142 DR 143



>gb:AP004666_1842954 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0431A03.>gb:AP005757_1857327 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0413H11.
          Length = 570

 Score =  103 bits (256), Expect = 2e-21
 Identities = 54/121 (44%), Positives = 76/121 (62%), Gaps = 13/121 (10%)
 Frame = +2

Query: 212 VAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRY 391
           VAAQ        +A ++VPA+R  V V LAM++M+  E+L++  V + V+ F  +P++RY
Sbjct: 29  VAAQWAAAAAAARAAVVVPAVRALVAVSLAMTVMILAEKLFVAAVCLAVRAFRLRPDRRY 88

Query: 392 KWEPM---------REDYEIG----TSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSD 532
           KW P+          +D E G     + FP VL+QIPMFNE+EVYK+SIGA C+  WPSD
Sbjct: 89  KWLPIGAAAAAASSEDDEESGLVAAAAAFPMVLVQIPMFNEREVYKLSIGAACSLDWPSD 148

Query: 533 R 535
           R
Sbjct: 149 R 149



>gb:AF432498_1799503 Oryza sativa cellulose synthase-like protein
           OsCslA6 gene, complete cds.
          Length = 574

 Score =  103 bits (256), Expect = 2e-21
 Identities = 46/102 (45%), Positives = 71/102 (69%), Gaps = 2/102 (1%)
 Frame = +2

Query: 236 WDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPM--R 409
           W  V+  L+VP LR AV  C+ MS+++  E++++G+V  +VK+   +P + Y+ +P+   
Sbjct: 71  WRQVRMELLVPLLRGAVVACMVMSVIVLAEKVFLGVVSAVVKLLRRRPARLYRCDPVVVE 130

Query: 410 EDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
           +D E G + FP VL+QIPM+NEKEVY++SIGA C   WP+DR
Sbjct: 131 DDDEAGRASFPMVLVQIPMYNEKEVYQLSIGAACRLTWPADR 172



>pir|C84771|C84771 probable glucosyltransferase [imported] -
           Arabidopsis thaliana
          Length = 500

 Score =  102 bits (254), Expect = 4e-21
 Identities = 46/78 (58%), Positives = 60/78 (76%)
 Frame = +2

Query: 302 MSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKE 481
           MS+M FVE +YMGIV++ VK+F  KPEK YKWE M +D E G++ +P VL+QIPM+NEKE
Sbjct: 1   MSVMFFVEVMYMGIVVLYVKLFKRKPEKFYKWEAMEDDVECGSASYPMVLVQIPMYNEKE 60

Query: 482 VYKISIGAVCNFAWPSDR 535
           V + SI A C  +WPS+R
Sbjct: 61  VCEQSIAAACKISWPSNR 78



>gb:AP004260_1839306 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0011H09.
          Length = 585

 Score =  101 bits (252), Expect = 6e-21
 Identities = 48/102 (47%), Positives = 67/102 (65%), Gaps = 1/102 (0%)
 Frame = +2

Query: 233 MWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMR- 409
           +W  V+  +I P L++AV+VC+ MS+ML VE  +   V + VK    +PE R+KWEP+  
Sbjct: 79  VWVRVRGGVIAPTLQVAVWVCMVMSVMLVVEATFNSAVSLGVKAIGWRPEWRFKWEPLAG 138

Query: 410 EDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
            D E G   +P V++QIPM+NE EVYK+SIGA C   WP D+
Sbjct: 139 ADEEKGRGEYPMVMVQIPMYNELEVYKLSIGAACELKWPKDK 180



>gb:AC084766_1733777 Oryza sativa chromosome 3 BAC OSJNBb0048D20
           genomic sequence, complete sequence.
          Length = 574

 Score = 99.0 bits (245), Expect = 4e-20
 Identities = 47/120 (39%), Positives = 69/120 (57%), Gaps = 8/120 (6%)
 Frame = +2

Query: 200 PGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKP 379
           PG    A  R  W   ++  + PAL++ V+ C+ MS+ML VE  Y   V +  ++   +P
Sbjct: 46  PGSGGGAWWREAWVGARSRAVAPALQVGVWACMVMSVMLVVEATYNSAVSVAARLVGWRP 105

Query: 380 EKRYKWEPM--------REDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
           E+ +KWEP+         E  E   + +P V++QIPM+NE EVYK+SIGAVC   WP +R
Sbjct: 106 ERWFKWEPLGGGAGAGDEEKGEAAAAAYPMVMVQIPMYNELEVYKLSIGAVCGLKWPKER 165



>gb:AP004114_1837781 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1118_G04.>gb:AP005297_1850095 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1734_E02.
          Length = 577

 Score = 97.8 bits (242), Expect = 9e-20
 Identities = 46/105 (43%), Positives = 71/105 (67%), Gaps = 5/105 (4%)
 Frame = +2

Query: 236 WDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEP--MR 409
           W  V+  L+VP LR AV  C+ MS+++  E++++G+V  +VK+   +P + Y+ +P  + 
Sbjct: 71  WRQVRMELLVPLLRGAVVACMVMSVIVLAEKVFLGVVSAVVKLLRRRPARLYRCDPVVVE 130

Query: 410 EDYEIGTSVFPSVLIQIPMFNEKE---VYKISIGAVCNFAWPSDR 535
           +D E G + FP VL+QIPM+NEKE   VY++SIGA C   WP+DR
Sbjct: 131 DDDEAGRASFPMVLVQIPMYNEKETMQVYQLSIGAACRLTWPADR 175



>gb:AP006162_1861143 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC
           clone:B1331F11.>gb:AP006450_1861834 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:B1130E07.
          Length = 540

 Score = 95.9 bits (237), Expect = 3e-19
 Identities = 48/109 (44%), Positives = 70/109 (64%), Gaps = 9/109 (8%)
 Frame = +2

Query: 236 WDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEP---- 403
           W  V+  +++P L+LAVYVC+AMS+MLF+ERLYM +V+  + +   +  +  + E     
Sbjct: 9   WRAVRCGVVLPTLQLAVYVCVAMSIMLFLERLYMALVVAALWLIRRRRRRSNRREQDDDG 68

Query: 404 -----MREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
                + +D E   S  P VL+QIPMFNEK+VY++SIGA C   WPSD+
Sbjct: 69  AENDQLLQDPEAANS--PMVLVQIPMFNEKQVYRLSIGAACGMTWPSDK 115



>pir|T06298|T06298 hypothetical protein T9E8.150 - Arabidopsis
           thaliana>gb:ATCHRIV36_1545105 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 36.>gb:ATT9E8_1556625
           Arabidopsis thaliana DNA chromosome 4, BAC clone T9E8,
           partial sequence (ESSA project).
          Length = 376

 Score = 92.8 bits (229), Expect = 3e-18
 Identities = 39/67 (58%), Positives = 52/67 (77%)
 Frame = +2

Query: 335 MGIVIILVKIFCGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCN 514
           M +V++ VK+F  KPEK YKWE M+ED E+G   +P VL+QIPM+NE+EV+++SIGA C 
Sbjct: 1   MNLVVLYVKLFNRKPEKVYKWEAMQEDMELGHQNYPMVLVQIPMYNEREVFELSIGAACR 60

Query: 515 FAWPSDR 535
             WPSDR
Sbjct: 61  LTWPSDR 67



>pir|T49212|T49212 hypothetical protein F27K19.180 - Arabidopsis
           thaliana>gb:ATF27K19_1550245 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F27K19.
          Length = 527

 Score = 89.7 bits (221), Expect = 2e-17
 Identities = 45/94 (47%), Positives = 64/94 (68%), Gaps = 2/94 (2%)
 Frame = +2

Query: 260 IVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMR-EDYEIG-TS 433
           +VP L+  V +C  +S++LFV+  YM IV+ +VK+    P+K  KWE  + +D E+  +S
Sbjct: 30  LVPILKRLVNLCQVVSVLLFVDAAYMAIVVAIVKLLGRTPQKVLKWESFKSDDIELAPSS 89

Query: 434 VFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
             P VLIQIP+FNEKEV ++SIGA C  +WP DR
Sbjct: 90  NHPMVLIQIPIFNEKEVCQLSIGAACKLSWPLDR 123



>gb:AP003509_1830104 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0525F01.
          Length = 551

 Score = 88.2 bits (217), Expect = 7e-17
 Identities = 48/129 (37%), Positives = 71/129 (55%), Gaps = 9/129 (6%)
 Frame = +2

Query: 176 LMMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIIL 355
           L++  LR P    +A++   W   +A  + PAL  A   CLA+S ML  + + M      
Sbjct: 25  LLLLLLRWPS---SAELVAAWGAARASAVAPALAAASAACLALSAMLLADAVLMAAACFA 81

Query: 356 VKIFCGKPEKRYKWEPMR---------EDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAV 508
            +    +P++RY+  P+          +D E G   +P VL+QIPM+NE+EVYK+SIGA 
Sbjct: 82  RR----RPDRRYRATPLGAGAGADDDDDDEEAGRVAYPMVLVQIPMYNEREVYKLSIGAA 137

Query: 509 CNFAWPSDR 535
           C  +WPSDR
Sbjct: 138 CGLSWPSDR 146



>gb:BT004569_1637603 Arabidopsis thaliana At3g56000 gene, complete
           cds.
          Length = 535

 Score = 87.8 bits (216), Expect = 9e-17
 Identities = 44/94 (46%), Positives = 63/94 (67%), Gaps = 2/94 (2%)
 Frame = +2

Query: 260 IVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMR-EDYEIG-TS 433
           +VP L+  V +C  +S++LFV+  YM IV+ +VK+    P+K  KWE  + +D E+  +S
Sbjct: 30  LVPILKRLVNLCQVVSVLLFVDAAYMAIVVAIVKLLGRTPQKVLKWESFKSDDIELAPSS 89

Query: 434 VFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
             P VLIQIP+FNEKEV ++ IGA C  +WP DR
Sbjct: 90  NHPMVLIQIPIFNEKEVCQLPIGAACKLSWPLDR 123



>gb:AF435643_1799836 Oryza sativa CSLA7 mRNA, partial cds.
          Length = 479

 Score = 73.9 bits (180), Expect = 1e-12
 Identities = 35/73 (47%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +2

Query: 320 VERLYMGIVIILVKIFCGKPEKRYKWEPMR-EDYEIGTSVFPSVLIQIPMFNEKEVYKIS 496
           VE  +   V + VK    +PE R+KWEP+   D E G   +P V++QIPM+NE EVYK+S
Sbjct: 2   VEATFNSAVSLGVKAIGWRPEWRFKWEPLAGADEEKGRGEYPMVMVQIPMYNELEVYKLS 61

Query: 497 IGAVCNFAWPSDR 535
           IGA C   WP D+
Sbjct: 62  IGAACELKWPKDK 74



>pir|A84639|A84639 probable glucosyltransferase [imported] -
           Arabidopsis thaliana>gb:AC006954_1534900 Arabidopsis
           thaliana chromosome 2 clone F25P17 map mi238, complete
           sequence.
          Length = 690

 Score = 72.4 bits (176), Expect = 4e-12
 Identities = 52/157 (33%), Positives = 77/157 (49%), Gaps = 16/157 (10%)
 Frame = +2

Query: 113 GWSKLFLKIVIMAGVAINEVELMM----------PELRGPGGDVAAQMRLM-----WDLV 247
           GW    +K+ ++A +AI   EL+           P L  P   +  Q  L      W  +
Sbjct: 104 GWLFSAIKLFLVASLAILAFELVAYYRGWHYFKNPNLHIPTSKLEIQSLLHLFYVGWLSL 163

Query: 248 KAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMR-EDYEI 424
           +A  I P ++     C+ + L+  V+RL + +  + +K    KP  R   E  R +D+E 
Sbjct: 164 RADYIAPPIKALSKFCIVLFLVQSVDRLILCLGCLWIKFKKIKP--RIDEEHFRNDDFEG 221

Query: 425 GTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
             S +P VL+QIPM NE+EVY+ SI AVC   WP DR
Sbjct: 222 SGSEYPMVLVQIPMCNEREVYEQSISAVCQLDWPKDR 258



>gb:AE016959_1022506 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC021893_1538826
           Genomic Sequence for Oryza sativa, Nipponbare strain,
           clone OSJNBa0060A14, from chromosome 10, complete
           sequence.>gb:AE017092_1752325 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 46 of 77 of the
           complete sequence.
          Length = 494

 Score = 70.5 bits (171), Expect = 2e-11
 Identities = 36/83 (43%), Positives = 46/83 (55%), Gaps = 5/83 (6%)
 Frame = +2

Query: 302 MSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMREDYEI-----GTSVFPSVLIQIPM 466
           MS ML  E  +MG+  +            Y+WEPM    ++       + FP VL+QIPM
Sbjct: 1   MSAMLVAEAAWMGLASLAAAAARRLRGYGYRWEPMAAPPDVEAPAPAPAEFPMVLVQIPM 60

Query: 467 FNEKEVYKISIGAVCNFAWPSDR 535
           +NEKEVYK+SIGA C   WP DR
Sbjct: 61  YNEKEVYKLSIGAACALTWPPDR 83



>pir|T05111|T05111 hypothetical protein F28M20.220 - Arabidopsis
           thaliana>gb:ATCHRIV75_1547080 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           75.>gb:ATF28M20_1550366 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F28M20 (ESSAII
           project).>gb:BT003334_1636758 Arabidopsis thaliana
           putative protein (At4g31590) mRNA, complete
           cds.>gb:BT008423_1639640 Arabidopsis thaliana At4g31590
           gene, complete cds.
          Length = 692

 Score = 70.1 bits (170), Expect = 2e-11
 Identities = 40/101 (39%), Positives = 57/101 (56%), Gaps = 1/101 (0%)
 Frame = +2

Query: 236 WDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMRED 415
           W  ++A  I P ++     C+ + L+  V+RL + +    +K    KP  R+  EP R D
Sbjct: 160 WLTLRADYIAPPIKALSKFCIVLFLIQSVDRLVLCLGCFWIKYKKIKP--RFDEEPFRND 217

Query: 416 YEIGT-SVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
              G+ S +P VL+QIPM NE+EVY+ SI AVC   WP DR
Sbjct: 218 DAEGSGSEYPMVLVQIPMCNEREVYEQSISAVCQLDWPKDR 258



>gb:AP003377_1828777 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBb0053G03.
          Length = 690

 Score = 68.2 bits (165), Expect = 8e-11
 Identities = 46/146 (31%), Positives = 71/146 (48%), Gaps = 13/146 (8%)
 Frame = +2

Query: 128 FLKIVIMAGVAINEVEL---------MMPELRGPGGDVAAQMRLMWDLVKAPLIVPALRL 280
           FL+  ++  V +  V++         ++P+L    G  AA     W  V+   + P L+ 
Sbjct: 117 FLRAFLLLSVLLLAVDVAAHAQGWHAVVPDLLAVEGLFAAAYA-SWLRVRLEYLAPGLQF 175

Query: 281 AVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWE----PMREDYEIGTSVFPSV 448
               C+ + L+   +RL + +  + +K+   KP  +           +D E G   FP V
Sbjct: 176 LANACVVLFLIQSADRLILCLGCLWIKLKGIKPVPKASGGGGGGKGSDDVEAGADEFPMV 235

Query: 449 LIQIPMFNEKEVYKISIGAVCNFAWP 526
           L+QIPM NEKEVY+ SIGAVCN  WP
Sbjct: 236 LVQIPMCNEKEVYQQSIGAVCNLDWP 261



>gb:ATAC009853_1543040 Arabidopsis thaliana chromosome III BAC F21O3
           genomic sequence, complete sequence.>gb:AY070454_1566838
           Arabidopsis thaliana unknown protein (At3g07330) mRNA,
           complete cds.>gb:AY142677_1583093 Arabidopsis thaliana
           unknown protein (At3g07330) mRNA, complete cds.
          Length = 682

 Score = 66.2 bits (160), Expect = 3e-10
 Identities = 37/110 (33%), Positives = 60/110 (54%), Gaps = 1/110 (0%)
 Frame = +2

Query: 209 DVAAQMRLMWDL-VKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEK 385
           +VA ++   W L ++A  + P L+    VC+ + L+  V+RL + +    +K+   KP  
Sbjct: 143 EVAVEVVYAWWLEIRASYLAPPLQSLTNVCIVLFLIQSVDRLVLVLGCFWIKLRRIKPVA 202

Query: 386 RYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
             ++        +    +P V++QIPM NEKEVY+ SIGAVC   WP +R
Sbjct: 203 SMEYPTKLVGEGVRLEDYPMVIVQIPMCNEKEVYQQSIGAVCMLDWPRER 252



>pir|T51489|T51489 hypothetical protein T21H19_110 - Arabidopsis
           thaliana>gb:ATT21H19_1555120 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T21H19 (ESSA project).
          Length = 335

 Score = 65.5 bits (158), Expect = 5e-10
 Identities = 27/44 (61%), Positives = 34/44 (77%)
 Frame = +2

Query: 404 MREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
           M+ED E+G   FP VL+QIPM+NE+EV+K+SIGA C   WP DR
Sbjct: 1   MQEDLELGNQNFPMVLVQIPMYNEREVFKLSIGAACRLIWPLDR 44



>gb:AC108873_1738580 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1005_B11, complete sequence.
          Length = 688

 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 32/97 (32%), Positives = 53/97 (54%)
 Frame = +2

Query: 236 WDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMRED 415
           W  ++   + P L+     C+A+ ++  ++RL + +    ++    KP  +      + D
Sbjct: 163 WMRLRLDYLAPPLQFLTNACVALFMVQSIDRLVLCLGCFWIRFKGIKPVPQAA-AAGKPD 221

Query: 416 YEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWP 526
            E G   +P VL+Q+PM NE+EVY+ SIGAVCN  WP
Sbjct: 222 VEAGAGDYPMVLVQMPMCNEREVYQQSIGAVCNLDWP 258



>gb:CAR400859_1645254 Cicer arietinum partial mRNA for putative
           glucosyltransferase.
          Length = 589

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 36/101 (35%), Positives = 53/101 (52%), Gaps = 1/101 (0%)
 Frame = +2

Query: 236 WDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMR-E 412
           W   +A  I P ++     C+ + L+  V+R+ + +    +K    KP  R   +P +  
Sbjct: 57  WLTFRAEYIAPPIQALSKFCVVLFLIQSVDRMLLCLGCFWIKFKKVKP--RINGDPFKVN 114

Query: 413 DYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
           D E     +P VL+QIPM NE+EVY+ SI AVC   WP DR
Sbjct: 115 DVEGSLCNYPMVLVQIPMCNEREVYEQSISAVCQIDWPRDR 155



>gb:AP005309_1850313 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0474G09.
          Length = 686

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 45/142 (31%), Positives = 68/142 (47%), Gaps = 9/142 (6%)
 Frame = +2

Query: 128 FLKIVIMAGVAINEVELMMPELRGPGGDVAAQM---RLMWDLVKAPLIVPALRLAVYVCL 298
           F++  ++  V +  VEL      G G  +AA +      W   +A  + P L+L    C+
Sbjct: 117 FIRASLLLSVFLLAVELAA-HANGRGRVLAASVDSFHSSWVRFRAAYVAPPLQLLADACV 175

Query: 299 AMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWE------PMREDYEIGTSVFPSVLIQI 460
            + L+   +RL   +  + + +   KP+            P  ED + G   +P VL+QI
Sbjct: 176 VLFLVQSADRLVQCLGCLYIHLNRIKPKPISSPAAAAAALPDLEDPDAG-DYYPMVLVQI 234

Query: 461 PMFNEKEVYKISIGAVCNFAWP 526
           PM NEKEVY+ SI AVCN  WP
Sbjct: 235 PMCNEKEVYQQSIAAVCNLDWP 256



>gb:AF435652S2_1799845 Oryza sativa CSLC9 gene, exon 5 and complete
           cds.
          Length = 595

 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 33/97 (34%), Positives = 50/97 (51%)
 Frame = +2

Query: 236 WDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMRED 415
           W   +A  + P ++     C+ + L+   +RL   +    + +   KP  +    P  ED
Sbjct: 72  WLRFRATYVAPFIQFLTDACVVLFLIQSADRLIQCLGCFYIHLKRIKPNPKSPALPDAED 131

Query: 416 YEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWP 526
            +   + +P VL+QIPM NEKEVY+ SI AVCN  WP
Sbjct: 132 PD--AAYYPMVLVQIPMCNEKEVYQQSIAAVCNLDWP 166



>gb:AF435641_1799834 Oryza sativa CSLC9 mRNA, complete cds.
          Length = 595

 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 33/97 (34%), Positives = 50/97 (51%)
 Frame = +2

Query: 236 WDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMRED 415
           W   +A  + P ++     C+ + L+   +RL   +    + +   KP  +    P  ED
Sbjct: 72  WLRFRATYVAPFIQFLTDACVVLFLIQSADRLIQCLGCFYIHLKRIKPNPKSPALPHPED 131

Query: 416 YEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWP 526
            +   + +P VL+QIPM NEKEVY+ SI AVCN  WP
Sbjct: 132 PD--AAYYPMVLVQIPMCNEKEVYQQSIAAVCNLDWP 166



>gb:AC133450_1741463 Oryza sativa chromosome 3 BAC OSJNBa0072F13
           genomic sequence, complete sequence.
          Length = 596

 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 33/97 (34%), Positives = 50/97 (51%)
 Frame = +2

Query: 236 WDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMRED 415
           W   +A  + P ++     C+ + L+   +RL   +    + +   KP  +    P  ED
Sbjct: 73  WLRFRATYVAPFIQFLTDACVVLFLIQSADRLIQCLGCFYIHLKRIKPNPKSPALPDAED 132

Query: 416 YEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWP 526
            +   + +P VL+QIPM NEKEVY+ SI AVCN  WP
Sbjct: 133 PD--AAYYPMVLVQIPMCNEKEVYQQSIAAVCNLDWP 167



>pir|B85078|B85078 probable glucosyltransferase [imported] -
           Arabidopsis thaliana>gb:AC006266_1533932 Arabidopsis
           thaliana BAC F1K3 from chromosome IV near 21 cM,
           complete sequence.>gb:ATCHRIV20_1544513 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           20.>gb:AY087066_1572102 Arabidopsis thaliana clone 3126
           mRNA, complete sequence.>gb:BT008770_1639966 Arabidopsis
           thaliana At4g07960 gene, complete
           cds.>gb:AK118480_1816453 Arabidopsis thaliana At4g07960
           mRNA for putative glucosyltransferase, complete cds,
           clone: RAFL19-71-L23.
          Length = 699

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 34/102 (33%), Positives = 52/102 (50%), Gaps = 2/102 (1%)
 Frame = +2

Query: 236 WDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMRED 415
           W L++   + P L+     C+ + L+  ++RL + +    ++    KP  +        D
Sbjct: 174 WVLLRVEYLAPPLQFLANGCIVLFLVQSLDRLILCLGCFWIRFKKIKPVPK---PDSISD 230

Query: 416 YEIGTS--VFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
            E G +    P VL+QIPM NEKEVY+ SI AVCN  WP  +
Sbjct: 231 LESGDNGAFLPMVLVQIPMCNEKEVYQQSIAAVCNLDWPKGK 272



>gb:AP004013_1836367 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1575_B01.>gb:AP004155_1838304 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1112_D12.
          Length = 745

 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 2/102 (1%)
 Frame = +2

Query: 236 WDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKP--EKRYKWEPMR 409
           W   +   I  A++     C+A+ ++  V+RL + +    +K+   KP  +     + + 
Sbjct: 191 WLAFRIDYIAWAIQKLSGFCIALFMVQSVDRLVLCLGCFWIKLRGIKPVADTSISNDDIE 250

Query: 410 EDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
                G   FP VLIQ+PM NEKEVY+ SI  VC   WP +R
Sbjct: 251 ATAGDGGGYFPMVLIQMPMCNEKEVYETSISHVCQIDWPRER 292



>gb:AP005568_1854195 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC
           clone:OJ1299_A11.>gb:AP005886_1859677 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, PAC
           clone:P0689B09.
          Length = 643

 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 45/161 (27%), Positives = 70/161 (43%), Gaps = 5/161 (3%)
 Frame = +2

Query: 68  E*AQSNNRLLCF*VAGWSKL-FLKIVIMAGVAINEVELMMPELRGPGG----DVAAQMRL 232
           E  +   RL+   + G+  L  L + +      N   L  PEL  P        A    +
Sbjct: 54  ELGRGRGRLMYGFIRGFLALSLLALAVELAAYWNGWRLRRPELHVPEAVEIEGWAHSAYI 113

Query: 233 MWDLVKAPLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMRE 412
            W   +A  I   +      C+ + ++  ++RL + +    +K+   KP  R + +P RE
Sbjct: 114 SWMSFRADYIRRPIEFLSKACILLFVIQSMDRLVLCLGCFWIKLRKIKP--RIEGDPFRE 171

Query: 413 DYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
                    P VL+QIPM NEKEVY+ SI A C   WP ++
Sbjct: 172 G---SGYQHPMVLVQIPMCNEKEVYEQSISAACQLDWPREK 209



>gb:AY056286_1563600 Arabidopsis thaliana unknown protein
           (At3g28180) mRNA, complete cds.>gb:AY091433_1574633
           Arabidopsis thaliana unknown protein (At3g28180) mRNA,
           complete cds.>gb:AP000415_1820099 Arabidopsis thaliana
           genomic DNA, chromosome 3, P1 clone: MIG10.
          Length = 673

 Score = 52.0 bits (123), Expect = 6e-06
 Identities = 36/98 (36%), Positives = 48/98 (48%), Gaps = 3/98 (3%)
 Frame = +2

Query: 251 APLIVPALRLAVYVCLAMSLMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMREDYEIGT 430
           APL++   R     C  + L+  ++RL + +    +K          K EP   +  I  
Sbjct: 145 APLVISLSRF----CTVLFLIQSLDRLVLCLGCFWIKF--------KKIEPKLTEESIDL 192

Query: 431 ---SVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
              S FP VLIQIPM NE+EVY+ SIGA     WP DR
Sbjct: 193 EDPSSFPMVLIQIPMCNEREVYEQSIGAASQLDWPKDR 230



>pir|D86368|D86368 hypothetical protein F5O8.4 [imported] -
           Arabidopsis thaliana>gb:AE005172_891300 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:F5O8_1678414 Arabidopsis thaliana
           chromosome 1 BAC F5O8 sequence, complete sequence.
          Length = 448

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 21/30 (70%), Positives = 25/30 (83%)
 Frame = +2

Query: 446 VLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
           VLIQIPM+NEKEV ++SIGA C  +WP DR
Sbjct: 2   VLIQIPMYNEKEVCQLSIGAACRLSWPLDR 31



>gb:DDU83086_1377440 Dictyostelium discoideum LimA (limA) mRNA,
           partial cds.
          Length = 623

 Score = 48.5 bits (114), Expect = 6e-05
 Identities = 27/88 (30%), Positives = 41/88 (46%), Gaps = 13/88 (14%)
 Frame = -1

Query: 361 LDQNDHNPHIKPLHEK--HQRHSQAHIHGQPER-RNDQRRLHQIPHQPHLRRHVPS---- 203
           L +NDH+ H  PL     HQ HS +H H  P+   +  +  H  PHQ H   H  S    
Sbjct: 126 LKENDHHAHPNPLEHSHPHQSHSHSHSHSHPQHPHSHPQHPHSHPHQSHSHSHAHSQPTT 185

Query: 202 --RPPELRHHQLNLI----NRHPRHYYY 137
             +P + + H L+ +    N  P H+++
Sbjct: 186 TVQPQQQQQHSLSTVVHPHNATPSHHHH 213



 Score = 35.8 bits (81), Expect = 0.42
 Identities = 29/108 (26%), Positives = 46/108 (42%), Gaps = 2/108 (1%)
 Frame = -1

Query: 508 NSSNGDLV--DLFFIKHGDLNEDGRENRSANLVILTHRLPFVPFLRLSAENLDQNDHNPH 335
           N++N +L+  D     H   N +GR+       I ++   F+       +N +QN H+ H
Sbjct: 315 NNNNNNLIIEDSTHHSHNLHNNNGRDG------IKSYSKTFITDDPNYHQNQNQNQHHSH 368

Query: 334 IKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPE 191
               H  HQ HS  H H Q +    Q++  ++   P      P RP E
Sbjct: 369 ---QHHSHQHHSHQHHHHQHQPYQQQQQQIKVDSLP------PQRPKE 407



 Score = 34.3 bits (77), Expect = 1.2
 Identities = 21/71 (29%), Positives = 30/71 (42%), Gaps = 15/71 (21%)
 Frame = -1

Query: 343 NPHIKPLH---EKHQRHSQAHIHGQPER--RNDQRRLHQI----------PHQPHLRRHV 209
           +PH  P H     HQ HS +H H QP    +  Q++ H +          P   H  +H 
Sbjct: 158 HPHSHPQHPHSHPHQSHSHSHAHSQPTTTVQPQQQQQHSLSTVVHPHNATPSHHHHHQHS 217

Query: 208 PSRPPELRHHQ 176
            S+P    H+Q
Sbjct: 218 HSQPHSFDHNQ 228



 Score = 31.6 bits (70), Expect = 7.9
 Identities = 20/64 (31%), Positives = 29/64 (45%)
 Frame = -1

Query: 346 HNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNL 167
           H  +  P H  H +HS    H QP   +  +  HQ P Q H   H  S+P  ++H  +  
Sbjct: 202 HPHNATPSHHHHHQHS----HSQPHSFDHNQHQHQ-PLQHH--HHTHSQPISIQHQHIE- 253

Query: 166 INRH 155
            N+H
Sbjct: 254 -NKH 256



>gb:AC123513_1192410 Dictyostelium discoideum strain AX4 chromosome
           2 map 2779865-2840915, *** SEQUENCING IN PROGRESS
           ***.>gb:AC117070_1207608 Dictyostelium discoideum
           chromosome 2 map 2097701-2233941 strain AX4, complete
           sequence.
          Length = 233

 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 25/100 (25%), Positives = 37/100 (37%), Gaps = 6/100 (6%)
 Frame = -1

Query: 418 VILTHRLPFVPFLRLSAENLDQ------NDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQ 257
           V +T++ P +   +L   N         N HNP+  P H  H  H   H H      +  
Sbjct: 28  VTITNQQPKINIYQLDVNNPHNPNNNPHNPHNPNNNPHHPHHLHHHHHHHHHHHHHHHHH 87

Query: 256 RRLHQIPHQPHLRRHVPSRPPELRHHQLNLINRHPRHYYY 137
              H   H PH   H P       HH  +  + H  H+++
Sbjct: 88  HHHHHHHHHPHHPHHHPHHHHHPHHHHHHHHHHHHHHHHH 127



 Score = 44.7 bits (104), Expect = 0.001
 Identities = 21/76 (27%), Positives = 29/76 (38%)
 Frame = -1

Query: 364 NLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELR 185
           N + N H+PH    H  H  H   H H      +     H  PH PH   H    P    
Sbjct: 59  NPNNNPHHPH----HLHHHHHHHHHHHHHHHHHHHHHHHHHHPHHPHHHPHHHHHPHHHH 114

Query: 184 HHQLNLINRHPRHYYY 137
           HH  +  + H  H+++
Sbjct: 115 HHHHHHHHHHHHHHHH 130



 Score = 37.0 bits (84), Expect = 0.19
 Identities = 17/70 (24%), Positives = 24/70 (34%)
 Frame = -1

Query: 346 HNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNL 167
           H+ H    H  H  H   H H  P   +     H  PH  H   H         HH  + 
Sbjct: 74  HHHHHHHHHHHHHHHHHHHHHHHPHHPHHHPHHHHHPHHHHHHHHHHHHHHHHHHHHHHH 133

Query: 166 INRHPRHYYY 137
            + H  H+++
Sbjct: 134 HHHHHHHHHH 143



 Score = 35.8 bits (81), Expect = 0.42
 Identities = 17/68 (25%), Positives = 22/68 (32%)
 Frame = -1

Query: 346 HNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNL 167
           H+ H  P H  H  H   H H      +     H   H  H   H         HH  + 
Sbjct: 91  HHHHHHPHHPHHHPHHHHHPHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH 150

Query: 166 INRHPRHY 143
            + HP H+
Sbjct: 151 HHHHPHHH 158



 Score = 34.3 bits (77), Expect = 1.2
 Identities = 16/70 (22%), Positives = 23/70 (32%)
 Frame = -1

Query: 346 HNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNL 167
           H+ H    H  H  H   H H  P   +     H   H  H   H         HH  + 
Sbjct: 81  HHHHHHHHHHHHHHHHPHHPHHHPHHHHHPHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH 140

Query: 166 INRHPRHYYY 137
            + H  H+++
Sbjct: 141 HHHHHHHHHH 150



 Score = 33.1 bits (74), Expect = 2.7
 Identities = 16/68 (23%), Positives = 21/68 (30%)
 Frame = -1

Query: 346 HNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNL 167
           H+ H    H  H  H   H H  P   +     H   H  H   H         HH  + 
Sbjct: 87  HHHHHHHHHHPHHPHHHPHHHHHPHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH 146

Query: 166 INRHPRHY 143
            + H  H+
Sbjct: 147 HHHHHHHH 154



>gb:AF435650_1799843 Oryza sativa CSLC2 mRNA, partial cds.
          Length = 485

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 24/54 (44%), Positives = 31/54 (57%)
 Frame = +2

Query: 374 KPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDR 535
           K + R + +P RE         P VL+QIPM NEKEVY+ SI A C   WP ++
Sbjct: 1   KIKPRIEGDPFREG---SGYQHPMVLVQIPMCNEKEVYEQSISAACQLDWPREK 51



>sp|P04929|HRPX_PLALO Histidine-rich glycoprotein
           precursor.>pir|A22692|KGZQHL histidine-rich glycoprotein
           precursor - Plasmodium lophurae>gb:PLHRP1_1395337
           Plasmodium gene fragment for histidine-rich protein.
          Length = 351

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 21/76 (27%), Positives = 32/76 (42%)
 Frame = -1

Query: 367 ENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPEL 188
           E+L +  H+ H +   E H+ H + H H  PE  ++        H PH   H    PP  
Sbjct: 55  EHLHEEHHHHHPE---EHHEPHHEEHHHHHPEEHHEPHHEEHHHHHPHPHHHHHHHPPHH 111

Query: 187 RHHQLNLINRHPRHYY 140
            HH    +  H  H++
Sbjct: 112 HHH----LGHHHHHHH 123



 Score = 37.0 bits (84), Expect = 0.19
 Identities = 17/70 (24%), Positives = 25/70 (35%)
 Frame = -1

Query: 346 HNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNL 167
           ++ H  P H  H  H+  H H      +     H  PH  H   H P       HH  + 
Sbjct: 168 YHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHHAP------HHHHHHH 221

Query: 166 INRHPRHYYY 137
              H  H+++
Sbjct: 222 HGHHHHHHHH 231



 Score = 36.2 bits (82), Expect = 0.32
 Identities = 16/70 (22%), Positives = 26/70 (37%)
 Frame = -1

Query: 346 HNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNL 167
           H+ H+   H  H  H+  H H +    +     H    + H   H     P   HH L  
Sbjct: 111 HHHHLG--HHHHHHHAAHHHHHEEHHHHHHAAHHHHHEEHHHHHHAAHHHPWFHHHHLGY 168

Query: 166 INRHPRHYYY 137
            + H  H+++
Sbjct: 169 HHHHAPHHHH 178



 Score = 35.0 bits (79), Expect = 0.71
 Identities = 17/70 (24%), Positives = 25/70 (35%)
 Frame = -1

Query: 346 HNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNL 167
           H+ H  P H  H  H+  H H      +     H  PH  H   H         HH  + 
Sbjct: 178 HHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHH-----GHHHHHHHHH 232

Query: 166 INRHPRHYYY 137
            + H  H+++
Sbjct: 233 GHHHHHHHHH 242



 Score = 33.1 bits (74), Expect = 2.7
 Identities = 17/74 (22%), Positives = 26/74 (35%), Gaps = 4/74 (5%)
 Frame = -1

Query: 346 HNPHIKPLHEKHQRHS----QAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHH 179
           H+ H  P H  H  H+      H HG     +     H   H  H   H      +  HH
Sbjct: 198 HHHHHAPHHHHHHHHAPHHHHHHHHGHHHHHHHHHGHHHHHHHHHGHHHHHHHHHDAHHH 257

Query: 178 QLNLINRHPRHYYY 137
             +  + H  H+++
Sbjct: 258 HHHHHDAHHHHHHH 271



 Score = 32.7 bits (73), Expect = 3.5
 Identities = 16/70 (22%), Positives = 23/70 (32%)
 Frame = -1

Query: 346 HNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNL 167
           H PH    H     H   H HG     +     H   H  H   H      +  HH  + 
Sbjct: 212 HAPHHHHHHHHGHHHHHHHHHGHHHHHHHHHGHHHHHHHHHDAHHHHHHHHDAHHHHHHH 271

Query: 166 INRHPRHYYY 137
            + H  H+++
Sbjct: 272 HDAHHHHHHH 281



 Score = 31.6 bits (70), Expect = 7.9
 Identities = 18/67 (26%), Positives = 26/67 (38%)
 Frame = -1

Query: 337 HIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNLINR 158
           H + LHE+H  H        PE        H  PH      H P    E  H + +  + 
Sbjct: 53  HPEHLHEEHHHH-------HPEE-------HHEPHHEEHHHHHPEEHHEPHHEEHHHHHP 98

Query: 157 HPRHYYY 137
           HP H+++
Sbjct: 99  HPHHHHH 105



>gb:AE014187_938873 Plasmodium falciparum 3D7 chromosome 14 complete
           sequence.>gb:AE014822_1227949 Plasmodium falciparum 3D7
           chromosome 14 section 7 of 13 of the complete sequence.
          Length = 3384

 Score = 41.2 bits (95), Expect = 0.010
 Identities = 20/77 (25%), Positives = 29/77 (37%)
 Frame = -1

Query: 367 ENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPEL 188
           E+   N+HN H +  H  H  H   H H      ++    H   +  +   H        
Sbjct: 635 EHSHHNEHNHHNEHNHHNHHNHHNHHNHHNHHNHHNHHNHHNHHNHHNHHNHHNHHNHHN 694

Query: 187 RHHQLNLINRHPRHYYY 137
            H+ LN I+ H  H YY
Sbjct: 695 EHNHLNSIHLHSNHSYY 711



>gb:PFAHRPA_1393792 P.lophurae histidine-rich protein mRNA, 3' end.
          Length = 140

 Score = 40.0 bits (92), Expect = 0.022
 Identities = 20/74 (27%), Positives = 26/74 (35%), Gaps = 3/74 (4%)
 Frame = -1

Query: 346 HNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVP---SRPPELRHHQ 176
           H+ H  P H  H  H+  H H      +     H  PH  H   H P      P   HH 
Sbjct: 2   HHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHPWFHHHH 61

Query: 175 LNLINRHPRHYYYF 134
            +    H  H+ +F
Sbjct: 62  HHPWFHHHHHHPWF 75



>pir|A54523|A54523 histidine-rich protein - Plasmodium lophurae
           (fragment)
          Length = 140

 Score = 40.0 bits (92), Expect = 0.022
 Identities = 20/74 (27%), Positives = 26/74 (35%), Gaps = 3/74 (4%)
 Frame = -1

Query: 346 HNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVP---SRPPELRHHQ 176
           H+ H  P H  H  H+  H H      +     H  PH  H   H P      P   HH 
Sbjct: 2   HHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHPWFHHHH 61

Query: 175 LNLINRHPRHYYYF 134
            +    H  H+ +F
Sbjct: 62  HHPWFHHHHHHPWF 75



>gb:CS000361_1375670 Sequence 1 from Patent WO2005005472.
          Length = 198

 Score = 39.7 bits (91), Expect = 0.029
 Identities = 22/71 (30%), Positives = 28/71 (39%), Gaps = 1/71 (1%)
 Frame = -1

Query: 346 HNPHIKPLH-EKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLN 170
           H+PH  P H   H  H   H H  P R  D    H  PH  H   +V     +   H  +
Sbjct: 105 HHPHPHPYHPHPHPHHPHPHPHQHPHRHPDHHP-HHHPHHHHHEHNVHVPQHQHAQHNGH 163

Query: 169 LINRHPRHYYY 137
             N  P HY++
Sbjct: 164 QNNGGPAHYHH 174



>gb:AE014298_1124730 Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE003442_1209912 Drosophila melanogaster
            chromosome X, section 26 of 74 of the complete sequence.
          Length = 2038

 Score = 39.7 bits (91), Expect = 0.029
 Identities = 17/62 (27%), Positives = 32/62 (51%)
 Frame = -1

Query: 361  LDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRH 182
            L Q  H    +  H++ Q+H Q H   Q +++  Q++L Q   Q   ++H+  +  + +H
Sbjct: 1507 LQQQHHQQQQQQTHQQQQQHQQQHHQQQQQQQLTQQQLQQQQQQQQQQQHLQQQQHQQQH 1566

Query: 181  HQ 176
            HQ
Sbjct: 1567 HQ 1568



>gb:AE014134_1127343 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE003580_1216303 Drosophila melanogaster
            chromosome 2L, section 11 of 83 of the complete sequence.
          Length = 1205

 Score = 39.3 bits (90), Expect = 0.038
 Identities = 19/63 (30%), Positives = 24/63 (38%), Gaps = 3/63 (4%)
 Frame = -1

Query: 355  QNDHNPHIKPLHEK---HQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELR 185
            Q   +PH +  H+    H  H   H HG     +D R  H   HQP L  H    P    
Sbjct: 917  QESRHPHQQDQHQHQHLHMHHHHHHHHGSQHHHHDARHSHHHHHQPLLPHHQQQHPHHWH 976

Query: 184  HHQ 176
            H +
Sbjct: 977  HRK 979



>sp|P13709|FSH_DROME Female sterile homeotic protein (Fragile-chorion
            membrane protein).>pir|A43742|A43742 female sterile
            homeotic protein, 205K - fruit fly  (Drosophila
            melanogaster)>gb:DROFSHA_1382026 D.melanogaster fsh
            membrane protein, 7.6 kb mRNA, complete cds.
          Length = 2038

 Score = 39.3 bits (90), Expect = 0.038
 Identities = 18/62 (29%), Positives = 33/62 (53%)
 Frame = -1

Query: 361  LDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRH 182
            L Q  H    +  H++ Q+H Q H H Q +++  Q++L Q   Q   ++H+  +  + +H
Sbjct: 1508 LQQQHHQQQQQQTHQQQQQHQQQH-HQQQQQQLTQQQLQQQQQQQQQQQHLQQQQHQQQH 1566

Query: 181  HQ 176
            HQ
Sbjct: 1567 HQ 1568



>gb:AY052652_1562812 Chlamydomonas reinhardtii gamete-specific
           homeodomain protein (gsp1) gene, complete
           cds.>gb:AF108140_1768621 Chlamydomonas reinhardtii
           gamete-specific homeodomain protein GSP1 mRNA, complete
           cds.
          Length = 1033

 Score = 37.4 bits (85), Expect = 0.14
 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 2/74 (2%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQP--HLRRHVPSRPPELRH 182
           Q +    +   H+ +Q H Q   H QP+ +  Q+   Q+PHQ   H  +H     P ++H
Sbjct: 231 QQEQQQMLYAYHQHNQYHHQQQ-HLQPQHQQYQQYPPQLPHQQVQHQHQHTALGSPPVQH 289

Query: 181 HQLNLINRHPRHYY 140
           HQ +  ++H   ++
Sbjct: 290 HQHHQHHQHHHQHH 303



 Score = 32.3 bits (72), Expect = 4.6
 Identities = 18/72 (25%), Positives = 29/72 (40%), Gaps = 5/72 (6%)
 Frame = -1

Query: 376 LSAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIP-----HQPHLRRH 212
           L +  +  + H+ H +  H+ HQ H Q H                +P     HQ H ++ 
Sbjct: 282 LGSPPVQHHQHHQHHQHHHQHHQHHHQHHHQQHVPAGAHHAAARPLPPNHQSHQHHQQQM 341

Query: 211 VPSRPPELRHHQ 176
            P  P + +HHQ
Sbjct: 342 PPVVPSQPQHHQ 353



>gb:LMFL3180_1387932 Leishmania major Friedlin chromosome 13 cosmid
           L3180.>gb:LMFP265_1388797 Leishmania major Friedlin
           chromosome 13 PAC P265.
          Length = 1409

 Score = 37.4 bits (85), Expect = 0.14
 Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 14/82 (17%)
 Frame = -1

Query: 355 QNDHNPHIKPLHE--------------KHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLR 218
           +   +PH  P+HE               H+RH QA+  G P  R +Q+  H+  + P  +
Sbjct: 672 RQQQHPHPHPVHEITGQCQPFEPQQQCDHERHEQAYQSGYPHLRPEQQHQHKAHNYP--Q 729

Query: 217 RHVPSRPPELRHHQLNLINRHP 152
           +HV S+  E  H       RHP
Sbjct: 730 QHVNSQQQEQHH-------RHP 744



>gb:AY056469_2510039 Petromyzon marinus homeobox protein hox4x mRNA,
           partial cds.
          Length = 381

 Score = 37.0 bits (84), Expect = 0.19
 Identities = 24/84 (28%), Positives = 35/84 (41%), Gaps = 13/84 (15%)
 Frame = -1

Query: 349 DHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIP-------------HQPHLRRHV 209
           +HN H    H  HQ H Q H H   +R++D  R HQ+              HQ   ++H 
Sbjct: 107 NHNHH----HGHHQDHHQGHHH---QRQHDAHRDHQLDVLPDCDQQQHHDHHQQQHKQHQ 159

Query: 208 PSRPPELRHHQLNLINRHPRHYYY 137
             +     HHQL+   +H    +Y
Sbjct: 160 QHQHNNHHHHQLHQQQQHHHQQHY 183



>gb:BC021240_1977444 Homo sapiens proline rich 7 (synaptic), mRNA
           (cDNA clone MGC:20448 IMAGE:3603954), complete cds.
          Length = 274

 Score = 37.0 bits (84), Expect = 0.19
 Identities = 26/93 (27%), Positives = 37/93 (39%)
 Frame = -1

Query: 379 RLSAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSR 200
           RL A     +  + H+ PL   H   +Q H H  P   +     H +PH PH    VP R
Sbjct: 83  RLEAPAHAHSHPHVHVHPL--LHHGPAQPHAHAHPHPHH-----HALPHPPHTHLSVPPR 135

Query: 199 PPELRHHQLNLINRHPRHYYYF*KQFTPPSYSE 101
           P        + +++ P +         PP YSE
Sbjct: 136 PWSYPRQAESDMSKPPCYEEAVLMAEPPPPYSE 168



>gb:AC117075_1207764 Dictyostelium discoideum chromosome 2 map
            5201047-5455781 strain AX4, complete sequence.
          Length = 1461

 Score = 36.6 bits (83), Expect = 0.25
 Identities = 20/84 (23%), Positives = 35/84 (41%), Gaps = 2/84 (2%)
 Frame = -1

Query: 382  LRLSAENLDQNDHNPHIKPLHEKHQRHSQAH--IHGQPERRNDQRRLHQIPHQPHLRRHV 209
            L+L      Q    PH +P   + Q+H Q H   H Q +   +  + HQ  HQ H     
Sbjct: 932  LQLPQHQHQQQQQQPHQQPHQHQQQQHQQPHQQPHHQQQHHQNNHQQHQ-QHQQHQHHQQ 990

Query: 208  PSRPPELRHHQLNLINRHPRHYYY 137
                 + +  Q    ++H +H+++
Sbjct: 991  QQLQQQQQQQQQQQHHQHQQHHHH 1014



 Score = 35.8 bits (81), Expect = 0.42
 Identities = 19/71 (26%), Positives = 31/71 (43%), Gaps = 1/71 (1%)
 Frame = -1

Query: 355  QNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRH-H 179
            Q  H    +  H++HQ     H H Q + ++  +  HQ  HQ H  +H      + +H H
Sbjct: 1049 QQQHQHQQQHQHQQHQHQQHQHQHQQHQHQHQHQHQHQHQHQ-HQHQHQHQHQHQHQHQH 1107

Query: 178  QLNLINRHPRH 146
            Q     +H +H
Sbjct: 1108 QHQQHQQHQQH 1118



 Score = 34.7 bits (78), Expect = 0.93
 Identities = 19/77 (24%), Positives = 36/77 (46%)
 Frame = -1

Query: 367  ENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPEL 188
            ++  Q+ H  H    H++HQ   Q H H Q + ++  +  HQ  HQ H  +H      + 
Sbjct: 1053 QHQQQHQHQQH---QHQQHQHQHQQHQH-QHQHQHQHQHQHQHQHQ-HQHQHQHQHQHQH 1107

Query: 187  RHHQLNLINRHPRHYYY 137
            +H Q     +H + +++
Sbjct: 1108 QHQQHQQHQQHQQQHHH 1124



 Score = 33.5 bits (75), Expect = 2.1
 Identities = 19/73 (26%), Positives = 30/73 (41%), Gaps = 9/73 (12%)
 Frame = -1

Query: 367  ENLDQNDHNPHIKPLHEK---------HQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRR 215
            ++  Q    PH +P H++         HQ+H Q   H Q + +  Q++  Q  H  H + 
Sbjct: 952  QHQQQQHQQPHQQPHHQQQHHQNNHQQHQQHQQHQHHQQQQLQQQQQQQQQQQHHQHQQH 1011

Query: 214  HVPSRPPELRHHQ 176
            H         HHQ
Sbjct: 1012 H---------HHQ 1015



 Score = 32.0 bits (71), Expect = 6.1
 Identities = 14/60 (23%), Positives = 28/60 (46%)
 Frame = -1

Query: 355  QNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQ 176
            QN+H  H +  H++HQ H Q  +  Q +++  Q+      H  H ++    +  + +  Q
Sbjct: 973  QNNHQQHQQ--HQQHQHHQQQQLQQQQQQQQQQQHHQHQQHHHHQQQQQQQQQQQQQQQQ 1030



 Score = 31.6 bits (70), Expect = 7.9
 Identities = 25/112 (22%), Positives = 47/112 (41%), Gaps = 15/112 (13%)
 Frame = -1

Query: 382  LRLSAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQP----------ERRNDQRRLHQIPH 233
            L  +  N+   DH    +   ++ Q+  Q     QP          + +  Q++ HQ PH
Sbjct: 892  LSTTTTNIPPTDHPIQQQQQQQQQQQQQQQQQQQQPQPQQLQLPQHQHQQQQQQPHQQPH 951

Query: 232  QPHLRRH-VPSRPP--ELRHHQLN--LINRHPRHYYYF*KQFTPPSYSETEQ 92
            Q   ++H  P + P  + +HHQ N     +H +H ++  +Q       + +Q
Sbjct: 952  QHQQQQHQQPHQQPHHQQQHHQNNHQQHQQHQQHQHHQQQQLQQQQQQQQQQ 1003



>gb:CR382136_1668722 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 574

 Score = 36.2 bits (82), Expect = 0.32
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = -1

Query: 379 RLSAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSR 200
           RL++  L++    P I P  +  Q+H Q H H   ++     + H   HQPH       +
Sbjct: 261 RLTSRALNEPQQQPGIHPGQQTQQQHQQQHQHQHQQQHQQHPQPH---HQPH------HQ 311

Query: 199 PPELRH-HQ 176
           PP+ +H HQ
Sbjct: 312 PPQQQHQHQ 320



>gb:AC116986_1207453 Dictyostelium discoideum chromosome 2 map
            2234041-2567370 strain AX4, complete sequence.
          Length = 3417

 Score = 36.2 bits (82), Expect = 0.32
 Identities = 17/70 (24%), Positives = 30/70 (42%)
 Frame = -1

Query: 355  QNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQ 176
            Q  H  H    H+++Q+  Q   H Q +++  Q+   Q   Q H ++H        +H Q
Sbjct: 1836 QQQHQQHQHQQHQQYQQQQQQQQHQQYQQQQHQQYQQQQQQQQHQQQHQHQHQQHQQHQQ 1895

Query: 175  LNLINRHPRH 146
                 +H +H
Sbjct: 1896 HQQHQQHQQH 1905



>gb:BT003476_1356878 Drosophila melanogaster RE59350 full insert
           cDNA.
          Length = 711

 Score = 35.8 bits (81), Expect = 0.42
 Identities = 14/54 (25%), Positives = 30/54 (55%)
 Frame = -1

Query: 322 HEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNLIN 161
           H+  Q+  Q H H   ++++ Q++ HQ+ H     +  P +PP+ +H +++  N
Sbjct: 241 HQHQQQQQQQHHHQHQQQQHQQQQQHQMQHHQIHHQTAPRKPPK-KHSEISTTN 293



>gb:AC116984_1207263 Dictyostelium discoideum chromosome 2 map
           2567470-3108875 strain AX4, complete sequence.
          Length = 680

 Score = 35.8 bits (81), Expect = 0.42
 Identities = 19/92 (20%), Positives = 41/92 (44%)
 Frame = -1

Query: 367 ENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPEL 188
           +  +   H  H +  H++HQ+H Q     Q +++  Q++  Q   Q         +  + 
Sbjct: 487 QQYNSQQHQQHHQQQHQQHQQHQQQQQQQQQQQQQQQQQQQQQQQQ--------QQQQQQ 538

Query: 187 RHHQLNLINRHPRHYYYF*KQFTPPSYSETEQ 92
           ++HQ      H + Y+ + +Q+  PS  + +Q
Sbjct: 539 QYHQ------HQQQYHQYQQQYHQPSQQQQQQ 564



>gb:AC115598_1205798 Dictyostelium discoideum chromosome 2 map
           581427-735498 strain AX4, complete sequence.
          Length = 1264

 Score = 35.8 bits (81), Expect = 0.42
 Identities = 19/59 (32%), Positives = 24/59 (40%)
 Frame = -1

Query: 346 HNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLN 170
           H+PH    H  H  H   H H  P   +     HQ PH PH R      PP+  ++  N
Sbjct: 371 HHPHHPHPHHPHPHHPHPHPHQHPHSHHP----HQHPHHPHQR-----PPPQYGYNNNN 420



>sp|Q23985|DX_DROME Deltex protein.>gb:AE014298_1124540 Drosophila
           melanogaster chromosome X, complete
           sequence.>gb:AE003437_1209722 Drosophila melanogaster
           chromosome X, section 21 of 74 of the complete sequence.
          Length = 738

 Score = 35.8 bits (81), Expect = 0.42
 Identities = 14/54 (25%), Positives = 30/54 (55%)
 Frame = -1

Query: 322 HEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNLIN 161
           H+  Q+  Q H H   ++++ Q++ HQ+ H     +  P +PP+ +H +++  N
Sbjct: 268 HQHQQQQQQQHHHQHQQQQHQQQQQHQMQHHQIHHQTAPRKPPK-KHSEISTTN 320



>gb:CR382128_1660884 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 425

 Score = 35.4 bits (80), Expect = 0.55
 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 3/61 (4%)
 Frame = -1

Query: 361 LDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRR---LHQIPHQPHLRRHVPSRPPE 191
           L++  +N   +P   +     Q H HG P + + Q +   +H +PHQ H  +H P  PP 
Sbjct: 276 LEEEVYNLRYRPGPPQGHAPPQTHTHGPPPQHHHQHQAPPMHHMPHQQH-PQHQPHGPPP 334

Query: 190 L 188
           +
Sbjct: 335 M 335



>gb:BX842634_1644059 Neurospora crassa DNA linkage group I BAC
           contig B16B8.
          Length = 784

 Score = 35.4 bits (80), Expect = 0.55
 Identities = 28/98 (28%), Positives = 42/98 (42%), Gaps = 11/98 (11%)
 Frame = -1

Query: 436 NRSANLVILTHRLPFVPFLRLSAENLDQNDHNPHIKPLH---EKHQRHSQAHI-HGQPER 269
           N   ++ +LT     V  LR   ++  Q  H  H +P H   E  + + Q H+   Q E 
Sbjct: 669 NHEQHISVLTAE---VTALRQQQQHQHQQQHQLHHQPEHHHEENQEANLQEHLPQHQQEH 725

Query: 268 RNDQRRLHQIPHQPHLR-----RHVPSRPPE--LRHHQ 176
           +   ++ HQ  HQP  +      H P   PE   +HHQ
Sbjct: 726 QQGHQQQHQSEHQPEHQPEPQSEHQPGHQPEHQQQHHQ 763



>gb:AE014296_1136891 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003519_1213790 Drosophila melanogaster
           chromosome 3L, section 66 of 83 of the complete
           sequence.
          Length = 2133

 Score = 35.4 bits (80), Expect = 0.55
 Identities = 25/73 (34%), Positives = 32/73 (43%), Gaps = 2/73 (2%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEK-HQRHSQAHIHGQPERRNDQRRLHQ-IPHQPHLRRHVPSRPPELRH 182
           Q  H PH    H   H  H Q H H QP   + Q+ +HQ  P  P  +     +PP+  H
Sbjct: 10  QTHHQPHPSMQHHPTHPHHQQPH-HQQP--HHPQQPIHQHHPPPPPPQPQQQHQPPQQIH 66

Query: 181 HQLNLINRHPRHY 143
            Q     +HP HY
Sbjct: 67  QQQ---QQHPHHY 76



>gb:AE014134_1128919 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003636_1219026 Drosophila melanogaster
           chromosome 2L, section 45 of 83 of the complete
           sequence.
          Length = 300

 Score = 35.4 bits (80), Expect = 0.55
 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 6/73 (8%)
 Frame = -1

Query: 346 HNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPH-----QPHLRRHVPSRPPELRH 182
           H+PH    H  HQ+  Q  +H Q ++   Q+  HQ  H     Q  L++HV +  P    
Sbjct: 98  HHPHHSHRHHHHQQSQQQQLHQQQQQ---QQHHHQQQHQLLLQQQLLQQHVANSSP--LQ 152

Query: 181 HQLNLINRH-PRH 146
           H  NL  +H P H
Sbjct: 153 HLSNLFGQHLPTH 165



>gb:AY032926_585581 Streptomyces aureofaciens putative PHA synthase
           (phaC), putative acetoacetyl CoA reductase (phaB), and
           hypothetical regulatory protein genes, complete cds; and
           unknown genes.
          Length = 579

 Score = 35.4 bits (80), Expect = 0.55
 Identities = 22/51 (43%), Positives = 26/51 (50%), Gaps = 1/51 (1%)
 Frame = -1

Query: 325 LHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRP-PELRHHQ 176
           L E+H R  Q H  GQ E+R  Q   H+ P +PH R   P R  P  R HQ
Sbjct: 91  LRERHLRGRQPHPRGQHEQRRRQVARHRPPLRPHRR---PRRQHPAQRQHQ 138



>gb:AB026892_4435 Achromobacter xylosoxidans subsp. xylosoxidans
           gene for low-specificity D-threonine aldolase, complete
           cds.
          Length = 377

 Score = 35.4 bits (80), Expect = 0.55
 Identities = 23/66 (34%), Positives = 28/66 (42%), Gaps = 10/66 (15%)
 Frame = -1

Query: 322 HEKHQRHSQAHIH----GQPERRNDQRRLHQIP------HQPHLRRHVPSRPPELRHHQL 173
           H   +RH   H H    GQ   R  QRRLH+        H   LRR    RP E+    L
Sbjct: 215 HAARERHRLRHHHRRRYGQRGIRRGQRRLHRAAGRFLRLHGQRLRRQRMERPAEVPEQPL 274

Query: 172 NLINRH 155
             ++RH
Sbjct: 275 RAVHRH 280



>pir|S66936|S66936 probable membrane protein YOR053w - yeast
           (Saccharomyces cerevisiae)>gb:SCXV55KB_1710974
           S.cerevisiae chromosome XV DNA, 54.7 kb
           region.>gb:SCYOR053W_1714278 S.cerevisiae chromosome XV
           reading frame ORF YOR053w.
          Length = 113

 Score = 35.4 bits (80), Expect = 0.55
 Identities = 21/66 (31%), Positives = 29/66 (43%)
 Frame = -1

Query: 337 HIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNLINR 158
           H +     H+RH + H H +  RR  +RR  +  H+ H  RH   R     +HQ      
Sbjct: 31  HRRRRRRHHRRHHRRHHHHRRRRRRRRRRRRR-HHRHHHHRHRRRRHYLHLYHQYRSSYY 89

Query: 157 HPRHYY 140
           HP H Y
Sbjct: 90  HPPHRY 95



>sp|P36417|GBF_DICDI G-box binding factor (GBF).>pir|A53185|A53185
           G-box-binding factor - slime mold (Dictyostelium
           discoideum)>gb:DDIGBF_1377089 Dictyostelium discoideum
           G-box binding factor (GBF) mRNA, complete cds.
          Length = 708

 Score = 35.4 bits (80), Expect = 0.55
 Identities = 12/43 (27%), Positives = 20/43 (46%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQP 227
           Q  H+ H +P  +      Q H H Q + +  Q ++  +P QP
Sbjct: 220 QQQHHQHSQPQQQHQHNQQQQHQHNQQQHQQQQNQIQMVPQQP 262



 Score = 32.7 bits (73), Expect = 3.5
 Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 7/74 (9%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHIHGQPER--RNDQRRLHQIPHQPHLRRH-----VPSRP 197
           Q  H+   +   ++H +  Q H H QP++  +++Q++ HQ   Q H ++      VP +P
Sbjct: 203 QQQHHQQQQQQQQQHHQQQQHHQHSQPQQQHQHNQQQQHQHNQQQHQQQQNQIQMVPQQP 262

Query: 196 PELRHHQLNLINRH 155
             L +   N  N +
Sbjct: 263 QSLSNSGNNNNNNN 276



>gb:AE014297_1138680 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003683_1220673 Drosophila melanogaster
           chromosome 3R, section 21 of 118 of the complete
           sequence.
          Length = 1173

 Score = 35.0 bits (79), Expect = 0.71
 Identities = 21/72 (29%), Positives = 29/72 (40%), Gaps = 1/72 (1%)
 Frame = -1

Query: 352 NDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPH-LRRHVPSRPPELRHHQ 176
           N+   H    +  +  H+Q+HIH           LHQ  H PH  + H P  P      Q
Sbjct: 144 NNSKAHHHHNNSNNNGHTQSHIH-------TNHSLHQGHHHPHHTQMHTPHYPHSSSPQQ 196

Query: 175 LNLINRHPRHYY 140
            N   ++P H Y
Sbjct: 197 SNSYRQYPPHSY 208



>gb:AE013599_1130857 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003833_1226831 Drosophila melanogaster
           chromosome 2R, section 17 of 74 of the complete
           sequence.
          Length = 466

 Score = 35.0 bits (79), Expect = 0.71
 Identities = 17/57 (29%), Positives = 24/57 (42%)
 Frame = -1

Query: 343 NPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQL 173
           +PH  P H  H  H  A+ H     +  Q      PHQ H   H+P    +L + +L
Sbjct: 395 HPHSHPHHSSHHSHHTAYPHSHSHHQQQQ------PHQAHHHHHLPYSKLDLDYPKL 445



>gb:AE014298_1124279 Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE003431_1209461 Drosophila melanogaster
            chromosome X, section 15 of 74 of the complete sequence.
          Length = 972

 Score = 35.0 bits (79), Expect = 0.71
 Identities = 18/54 (33%), Positives = 26/54 (48%)
 Frame = -1

Query: 316  KHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNLINRH 155
            +H  H+QAH   Q  + + Q++ HQ P QPH             HHQ +L + H
Sbjct: 922  QHHHHTQAHHQQQQHQSHHQQQHHQQPAQPH------------PHHQTHLHSHH 963



>pir|T13167|T13167 Lola-like protein - fruit fly (Drosophila
           hydei)>gb:DHLOLA_1377667 Drosophila hydei mRNA for
           Lola-like protein.
          Length = 1010

 Score = 35.0 bits (79), Expect = 0.71
 Identities = 20/80 (25%), Positives = 36/80 (45%)
 Frame = -1

Query: 319 EKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNLINRHPRHYY 140
           ++HQ+  Q H   Q +++  Q+  HQ   Q   + H+   P    H Q     +  +H++
Sbjct: 613 QQHQQQQQQHQQQQQQQQQQQQHHHQQQQQQQQQLHIEEVPQSSHHQQQQQQQQQQQHHH 672

Query: 139 YF*KQFTPPSYSETEQSIIT 80
              +Q      ++  QSIIT
Sbjct: 673 QHQQQL--HQGAQQVQSIIT 690



 Score = 33.1 bits (74), Expect = 2.7
 Identities = 13/67 (19%), Positives = 29/67 (43%)
 Frame = -1

Query: 376 LSAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRP 197
           ++ E   Q+          ++ Q+  Q H H Q +++  Q  + ++P   H ++    + 
Sbjct: 607 VTQETQQQHQQQQQQHQQQQQQQQQQQQHHHQQQQQQQQQLHIEEVPQSSHHQQQQQQQQ 666

Query: 196 PELRHHQ 176
            +  HHQ
Sbjct: 667 QQQHHHQ 673



>pir|A40213|A40213 optic lobe development omb protein - fruit fly
            (Drosophila melanogaster)>gb:DROOPTBA_1382433 Drosophila
            melanogaster optomotor-blind mRNA, complete cds.
          Length = 974

 Score = 35.0 bits (79), Expect = 0.71
 Identities = 18/54 (33%), Positives = 26/54 (48%)
 Frame = -1

Query: 316  KHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNLINRH 155
            +H  H+QAH   Q  + + Q++ HQ P QPH             HHQ +L + H
Sbjct: 924  QHHHHTQAHHQQQQHQSHHQQQHHQQPAQPH------------PHHQTHLHSHH 965



>sp|Q24432|OMB_DROME Optomotor-blind protein
            (Lethal(1)optomotor-blind) (L(1)omb) (Bifid protein).
          Length = 972

 Score = 35.0 bits (79), Expect = 0.71
 Identities = 18/54 (33%), Positives = 26/54 (48%)
 Frame = -1

Query: 316  KHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNLINRH 155
            +H  H+QAH   Q  + + Q++ HQ P QPH             HHQ +L + H
Sbjct: 922  QHHHHTQAHHQQQQHQSHHQQQHHQQPAQPH------------PHHQTHLHSHH 963



>gb:MMU46463_2121571 Mus musculus glutamine repeat protein-1 mRNA,
           complete cds.
          Length = 171

 Score = 34.7 bits (78), Expect = 0.93
 Identities = 19/78 (24%), Positives = 38/78 (48%), Gaps = 2/78 (2%)
 Frame = -1

Query: 367 ENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLH--QIPHQPHLRRHVPSRPP 194
           ++     H  H +  H++HQ+H Q   H Q  +++ Q + H  Q  HQ H +     +  
Sbjct: 63  QHQQHQQHQQHQQ--HQQHQQHQQHQQH-QQHQQHQQHQQHQQQQQHQQHQQHQQQQQQQ 119

Query: 193 ELRHHQLNLINRHPRHYY 140
           + + HQ +  ++H +H +
Sbjct: 120 QHQQHQQHQQHQHQQHQH 137



 Score = 34.3 bits (77), Expect = 1.2
 Identities = 16/74 (21%), Positives = 34/74 (45%)
 Frame = -1

Query: 367 ENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPEL 188
           ++     H  H +  H++HQ+H Q   H Q +++   ++  Q   Q   ++H   +  + 
Sbjct: 72  QHQQHQQHQQHQQ--HQQHQQHQQHQQHQQHQQQQQHQQHQQHQQQQQQQQHQQHQQHQQ 129

Query: 187 RHHQLNLINRHPRH 146
             HQ +   +H +H
Sbjct: 130 HQHQQHQHQQHQQH 143



 Score = 33.9 bits (76), Expect = 1.6
 Identities = 17/70 (24%), Positives = 34/70 (48%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQ 176
           +  H  H +   ++HQ+H Q     Q ++++ Q + HQ  HQ H +     +  + + HQ
Sbjct: 31  KEQHQQHQQHQQDQHQQHQQQQQQQQQQQQHQQHQQHQ-QHQQHQQHQQHQQHQQHQQHQ 89

Query: 175 LNLINRHPRH 146
            +   +H +H
Sbjct: 90  QH--QQHQQH 97



>gb:BX842633_1644035 Neurospora crassa DNA linkage group I cosmid
            contig 53H1.
          Length = 1159

 Score = 34.7 bits (78), Expect = 0.93
 Identities = 20/59 (33%), Positives = 25/59 (42%)
 Frame = -1

Query: 355  QNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHH 179
            Q  H  H +  H + Q+H   H H    R  DQ   H   HQ H  R + S  P+  HH
Sbjct: 1031 QEHHQEHSQSQHHQQQQHHHHHQH-HYARFQDQYHSHPSQHQ-HQHRSLTSNSPKEGHH 1087



>gb:AY051454_1290048 Drosophila melanogaster GH12043 full length
           cDNA.>gb:BT001258_1356031 Drosophila melanogaster
           AT02070 full insert cDNA.
          Length = 397

 Score = 34.7 bits (78), Expect = 0.93
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 3/61 (4%)
 Frame = -1

Query: 397 PFVPFLRLSAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQ---PERRNDQRRLHQIPHQP 227
           P  P L LSA    Q          H++HQ+H Q   H Q    + +  Q++ HQ  HQ 
Sbjct: 252 PSSPMLSLSAAQEYQQHQQHQQHQQHQQHQQHQQHQQHQQQQHQQHQQHQQQQHQQQHQQ 311

Query: 226 H 224
           H
Sbjct: 312 H 312



>gb:AE013599_1133058 Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE013599_1133059 Drosophila melanogaster
            chromosome 2R, complete sequence.>gb:AE003453_1210357
            Drosophila melanogaster chromosome 2R, section 61 of 74
            of the complete sequence.>gb:AE003453_1210358 Drosophila
            melanogaster chromosome 2R, section 61 of 74 of the
            complete sequence.
          Length = 980

 Score = 34.7 bits (78), Expect = 0.93
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 3/61 (4%)
 Frame = -1

Query: 397  PFVPFLRLSAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQ---PERRNDQRRLHQIPHQP 227
            P  P L LSA    Q          H++HQ+H Q   H Q    + +  Q++ HQ  HQ 
Sbjct: 835  PSSPMLSLSAAQEYQQHQQHQQHQQHQQHQQHQQHQQHQQQQHQQHQQHQQQQHQQQHQQ 894

Query: 226  H 224
            H
Sbjct: 895  H 895



>gb:AE014298_1123849 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003420_1209031 Drosophila melanogaster
           chromosome X, section 4 of 74 of the complete
           sequence.>gb:BT001477_1356250 Drosophila melanogaster
           LD21345 full insert cDNA.>gb:BT003171_1356682 Drosophila
           melanogaster SD07604 full insert cDNA.
          Length = 443

 Score = 34.7 bits (78), Expect = 0.93
 Identities = 22/66 (33%), Positives = 27/66 (40%)
 Frame = -1

Query: 352 NDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQL 173
           N HNPH+ P H     H   H H  P+      +LH + H  H   H  +  P   HH  
Sbjct: 305 NHHNPHMPPHH-----HQPQHPHQHPQH---HPQLHHMQHH-HPNNH-NNNHPNNHHHNN 354

Query: 172 NLINRH 155
           N  N H
Sbjct: 355 NNNNHH 360



>gb:AE014298_1123848 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003420_1209030 Drosophila melanogaster
           chromosome X, section 4 of 74 of the complete
           sequence.>gb:DMC132E8_1378304 Drosophila melanogaster
           cosmid clone 132E8.
          Length = 485

 Score = 34.7 bits (78), Expect = 0.93
 Identities = 22/66 (33%), Positives = 27/66 (40%)
 Frame = -1

Query: 352 NDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQL 173
           N HNPH+ P H     H   H H  P+      +LH + H  H   H  +  P   HH  
Sbjct: 305 NHHNPHMPPHH-----HQPQHPHQHPQH---HPQLHHMQHH-HPNNH-NNNHPNNHHHNN 354

Query: 172 NLINRH 155
           N  N H
Sbjct: 355 NNNNHH 360



>gb:AY382308_1948823 Pongo pygmaeus sperm ion channel (CATSPER1)
           gene, exon 1 and partial cds.
          Length = 443

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 19/74 (25%), Positives = 27/74 (36%), Gaps = 4/74 (5%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHIHGQPERR----NDQRRLHQIPHQPHLRRHVPSRPPEL 188
           Q+D + H +  H     H +AH HG P       +D    H+  H      H        
Sbjct: 203 QHDESHHHQAHHHDWSHHHEAHHHGWPHHHQAHHHDWSHHHEAHHHGWPHHHQAHHHDWS 262

Query: 187 RHHQLNLINRHPRH 146
            HH+ +   R P H
Sbjct: 263 HHHEAHQHGRSPHH 276



>gb:NCB13H18_1689185 Neurospora crassa DNA linkage group V BAC
           contig B13H18.
          Length = 529

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 20/62 (32%), Positives = 27/62 (43%)
 Frame = -1

Query: 361 LDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRH 182
           L Q+++ P+I   H  H  H Q H H Q      Q+ L    H PH + H    P +   
Sbjct: 11  LFQDENYPNIDD-HITHDSHHQHH-HSQTTHDTQQQELEHPLHDPHSQAHDAHHPHDSNS 68

Query: 181 HQ 176
           HQ
Sbjct: 69  HQ 70



>gb:CR382132_1665075 Yarrowia lipolytica chromosome F of strain CLIB99
            of Yarrowia lipolytica.
          Length = 1013

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 6/47 (12%)
 Frame = -1

Query: 346  HNPHIKPLHEKHQRHSQAHIHGQPERRN------DQRRLHQIPHQPH 224
            H       H+  Q+ + A  H QP  ++       Q  +HQ+PHQPH
Sbjct: 965  HTQQQAQTHQGQQQQTHAQPHAQPHTQHTGAQQIQQHHVHQLPHQPH 1011



>gb:CR382128_1660434 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 916

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 2/66 (3%)
 Frame = -1

Query: 328 PLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRH--HQLNLINRH 155
           P H   Q+  Q     Q ++   Q + HQ  HQ   ++H    PP+L H  H  +  ++H
Sbjct: 11  PPHNTPQQQQQQQQQQQAQQHQQQAQQHQ-QHQQQQQQH----PPQLHHPQHHPHPQHQH 65

Query: 154 PRHYYY 137
           P++ YY
Sbjct: 66  PQYMYY 71



>gb:CEY67H2A_1370922 Caenorhabditis elegans YAC Y67H2A, complete
           sequence.
          Length = 558

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 16/95 (16%)
 Frame = -1

Query: 328 PLHEKHQRHSQAHIHG------QPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNL 167
           P+++  Q+  Q    G       P+++  Q++ HQ+P QP   +H P    +  HHQ  +
Sbjct: 391 PINQMGQQGQQQQQMGPLPSLQHPQQQQQQQQYHQMPPQP---QHSPYPQQQQMHHQ--M 445

Query: 166 INRHPRHY--------YYF*KQFTP--PSYSETEQ 92
           +   P HY        Y    Q +P  PSY ++ Q
Sbjct: 446 VQHSPHHYQQQQQQQQYQQQHQQSPQFPSYQQSPQ 480



>gb:BT009981_1357347 Drosophila melanogaster RE54443 full insert
           cDNA.
          Length = 1281

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 21/70 (30%), Positives = 27/70 (38%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQ 176
           + D +PH +  H  H  HSQ H H            HQ   Q HL++    +     HH 
Sbjct: 59  EQDDDPH-QHTHVHHHHHSQHHPHSHS---------HQQQQQQHLQQQQQQQQHHHPHHH 108

Query: 175 LNLINRHPRH 146
           L L N    H
Sbjct: 109 LKLDNSSNNH 118



>gb:AY069429_1294159 Drosophila melanogaster LD13887 full length
           cDNA.
          Length = 479

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 21/76 (27%), Positives = 30/76 (39%), Gaps = 1/76 (1%)
 Frame = -1

Query: 367 ENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQ-PHLRRHVPSRPPE 191
           ++L Q       +   ++ Q+H   H H  P         H +PH  PH  +  P  P  
Sbjct: 312 QHLHQQHQQQQQQQQQQQQQQHMLQHPHTHPHPHAQHSHPHTLPHSLPHHLQ--PGTPTR 369

Query: 190 LRHHQLNLINRHPRHY 143
             H QL    +HP HY
Sbjct: 370 SSHPQL----QHPHHY 381



>gb:AE014296_1135547 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE014296_1135548 Drosophila melanogaster
           chromosome 3L, complete sequence.>gb:AE003552_1215208
           Drosophila melanogaster chromosome 3L, section 33 of 83
           of the complete sequence.>gb:AE003552_1215209 Drosophila
           melanogaster chromosome 3L, section 33 of 83 of the
           complete sequence.
          Length = 783

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 21/76 (27%), Positives = 30/76 (39%), Gaps = 1/76 (1%)
 Frame = -1

Query: 367 ENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQ-PHLRRHVPSRPPE 191
           ++L Q       +   ++ Q+H   H H  P         H +PH  PH  +  P  P  
Sbjct: 616 QHLHQQHQQQQQQQQQQQQQQHMLQHPHTHPHPHAQHSHPHTLPHSLPHHLQ--PGTPTR 673

Query: 190 LRHHQLNLINRHPRHY 143
             H QL    +HP HY
Sbjct: 674 SSHPQL----QHPHHY 685



>gb:AE014298_1124397 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003434_1209579 Drosophila melanogaster
           chromosome X, section 18 of 74 of the complete sequence.
          Length = 198

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 19/56 (33%), Positives = 23/56 (41%)
 Frame = -1

Query: 313 HQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNLINRHPRH 146
           HQ  +  H H Q +    Q   H  PH PH     P  PP ++HH       HP H
Sbjct: 130 HQLAAAVHHHHQHQH---QHHPHHHPHHPHGAVGGPPPPPPMQHHH----PHHPHH 178



>gb:AE014298_1124347 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE014298_1124348 Drosophila melanogaster
           chromosome X, complete sequence.>gb:AE003433_1209529
           Drosophila melanogaster chromosome X, section 17 of 74
           of the complete sequence.>gb:AE003433_1209530 Drosophila
           melanogaster chromosome X, section 17 of 74 of the
           complete sequence.
          Length = 1281

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 21/70 (30%), Positives = 27/70 (38%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQ 176
           + D +PH +  H  H  HSQ H H            HQ   Q HL++    +     HH 
Sbjct: 59  EQDDDPH-QHTHVHHHHHSQHHPHSHS---------HQQQQQQHLQQQQQQQQHHHPHHH 108

Query: 175 LNLINRHPRH 146
           L L N    H
Sbjct: 109 LKLDNSSNNH 118



>gb:AF371263_1792416 Zea mays 50kD gamma zein mRNA, complete cds.
          Length = 295

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 2/60 (3%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLH--QIPHQPHLRRHVPSRPPELRH 182
           +  H P   P H + Q+H Q  +H QP++   Q+ +H  Q   QP  ++    +  + +H
Sbjct: 46  KQQHQP--PPQHHQQQQHQQQQVHMQPQKHQQQQEVHVQQQQQQPQHQQQQQQQQHQQQH 103



>gb:BX842620_1643732 Neurospora crassa DNA linkage group V BAC
           contig B11E5.
          Length = 629

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 17/46 (36%), Positives = 22/46 (47%)
 Frame = -1

Query: 313 HQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQ 176
           H +H+Q     QPE   DQ   HQ  HQ H+  H+ +      HHQ
Sbjct: 36  HHQHNQQQGQLQPEEELDQTP-HQHQHQHHIHNHIHTHNHARYHHQ 80



>gb:AY094737_1297911 Drosophila melanogaster GH28553 full insert
           cDNA.
          Length = 828

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 5/63 (7%)
 Frame = -1

Query: 328 PLHEKHQRHSQAHIHGQPE-----RRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNLI 164
           P H+ HQ H Q H H  P+     +++ Q + HQ  HQ HL +    +     H Q +L 
Sbjct: 147 PQHQAHQPHQQPHQHQHPQHQQQHQQHQQHQQHQ-QHQQHLHQQ-QQQQANFLHIQQSLQ 204

Query: 163 NRH 155
           + H
Sbjct: 205 HNH 207



 Score = 32.3 bits (72), Expect = 4.6
 Identities = 15/59 (25%), Positives = 26/59 (44%)
 Frame = -1

Query: 346 HNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLN 170
           H PH +P   +H +H Q H   Q  +++ Q + H    Q      +  +     +HQL+
Sbjct: 152 HQPHQQPHQHQHPQHQQQHQQHQQHQQHQQHQQHLHQQQQQQANFLHIQQSLQHNHQLS 210



>gb:AF254867_1256305 Drosophila melanogaster SNS (sns) mRNA,
           complete cds.
          Length = 1482

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 16/51 (31%), Positives = 26/51 (50%)
 Frame = -1

Query: 325 LHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQL 173
           L ++HQRH Q   H Q +++  Q++   I  Q H  +    R   ++H QL
Sbjct: 3   LQQQHQRHQQHQQHQQQQQQQQQQQQQHIKWQQHATKRRRCRQHWIKHLQL 53



>gb:AE014297_1141340 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003750_1223333 Drosophila melanogaster
           chromosome 3R, section 88 of 118 of the complete
           sequence.
          Length = 828

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 5/63 (7%)
 Frame = -1

Query: 328 PLHEKHQRHSQAHIHGQPE-----RRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNLI 164
           P H+ HQ H Q H H  P+     +++ Q + HQ  HQ HL +    +     H Q +L 
Sbjct: 147 PQHQAHQPHQQPHQHQHPQHQQQHQQHQQHQQHQ-QHQQHLHQQ-QQQQANFLHIQQSLQ 204

Query: 163 NRH 155
           + H
Sbjct: 205 HNH 207



 Score = 32.3 bits (72), Expect = 4.6
 Identities = 15/59 (25%), Positives = 26/59 (44%)
 Frame = -1

Query: 346 HNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLN 170
           H PH +P   +H +H Q H   Q  +++ Q + H    Q      +  +     +HQL+
Sbjct: 152 HQPHQQPHQHQHPQHQQQHQQHQQHQQHQQHQQHLHQQQQQQANFLHIQQSLQHNHQLS 210



>pir|I59606|I59606 dihydrolipoamide S-succinyltransferase (EC
           2.3.1.61) - human>gb:S72422_2041236
           E2k=alpha-ketoglutarate dehydrogenase complex
           dihydrolipoyl succinyltransferase [human, fetal brain,
           mRNA, 2987 nt].
          Length = 451

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 21/66 (31%), Positives = 31/66 (46%)
 Frame = -2

Query: 210 SPPGPRSSGIINSTSLIATPAIITIFKNNLLHPATQKQSNRLLLCAYS*LKTPSNTVPLL 31
           SP  P SS  +++    A P +        LH   +++ NR+  C    LK   NTVP+L
Sbjct: 188 SPSQPPSSKPVSAVKPTAVPPLAEPGAGKGLHSEHREKMNRMRQCIAQRLKEAQNTVPML 247

Query: 30  RIPSSI 13
            I + I
Sbjct: 248 TIFNEI 253



>gb:AF190427_1775411 Colletotrichum lindemuthianum putative
           GAL4-like transcriptional activator (CLTA1) gene,
           complete cds.
          Length = 746

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 24/101 (23%), Positives = 40/101 (39%), Gaps = 8/101 (7%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQ 176
           Q   +PH    H+  Q   Q H   Q +++  Q++ HQ+ HQ    +  P  PP   HH 
Sbjct: 612 QQQQHPH---QHQHQQHQQQQHQPQQHQQQQHQQQQHQLQHQ----QFSPGPPPPHPHHH 664

Query: 175 LNLIN--------RHPRHYYYF*KQFTPPSYSETEQSIITL 77
            +  +         HP H  +    + PP +     S + +
Sbjct: 665 QSHASYPTPQPPQPHPHHQPH--PSYPPPQHQPHPHSQVIM 703



>gb:AC108503_1738536 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1387_F08, complete
           sequence.>gb:AC121361_1740129 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBa0009E21,
           complete sequence.
          Length = 257

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 19/63 (30%), Positives = 23/63 (36%)
 Frame = -1

Query: 328 PLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNLINRHPR 149
           P H +H  H   H H  P         H  PH PH     P   P   HH     + HP 
Sbjct: 28  PPHLRHPHHHPPHHHPHPPH-------HHPPHHPH-----PPHHPHPPHHPHPPHHPHPP 75

Query: 148 HYY 140
           H++
Sbjct: 76  HHH 78



>gb:CR382131_1664430 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 301

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 16/51 (31%), Positives = 23/51 (45%)
 Frame = -1

Query: 328 PLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQ 176
           PL E+HQ         Q + +N  +  HQ  HQ H  +H      + +HHQ
Sbjct: 146 PLQEQHQHQQHQQHQHQNQHQNQHQNQHQNQHQQHQHQH------QEQHHQ 190



>gb:AY013869_1287805 Trypanosoma cruzi antigen 38 (AG38) mRNA,
           complete cds.
          Length = 552

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 23/95 (24%), Positives = 38/95 (40%), Gaps = 4/95 (4%)
 Frame = -1

Query: 367 ENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIP--HQPHLRRHVPSRPP 194
           E   Q++  P   P HE+ Q++ Q   H QP+     +   Q     QP      P  PP
Sbjct: 338 EQPQQHEPPPPPPPPHEQPQQYEQPQQHEQPQHYEQPQHYEQPQQHEQPQQHEQPPPPPP 397

Query: 193 --ELRHHQLNLINRHPRHYYYF*KQFTPPSYSETE 95
             + +H++       P+HY    +   P  Y + +
Sbjct: 398 HEQPQHYEQPQHYEQPQHYEQPQQHEQPQHYEQPQ 432



 Score = 32.3 bits (72), Expect = 4.6
 Identities = 21/83 (25%), Positives = 35/83 (42%), Gaps = 6/83 (7%)
 Frame = -1

Query: 373 SAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQI-PHQPHLRRHVPSRP 197
           S   L+Q   +P I    E +Q   + H+  Q +++  Q++  Q  P     ++H P  P
Sbjct: 289 SRRTLNQEVESPRILLFPEGNQEEIRRHVQQQQQQQQQQQQQQQQQPQHEQPQQHEPPPP 348

Query: 196 PELRHHQLNLI-----NRHPRHY 143
           P   H Q         +  P+HY
Sbjct: 349 PPPPHEQPQQYEQPQQHEQPQHY 371



>gb:AC116979_1207058 Dictyostelium discoideum chromosome 2 map
           6445720-6776760 strain AX4, complete sequence.
          Length = 1734

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 28/93 (30%), Positives = 44/93 (47%)
 Frame = -1

Query: 508 NSSNGDLVDLFFIKHGDLNEDGRENRSANLVILTHRLPFVPFLRLSAENLDQNDHNPHIK 329
           NSSN  L   F I   +L+ D  EN ++N     + L      R S+ +L  +  N +IK
Sbjct: 373 NSSNNLLP--FLIPSVNLSSDNSENSNSN-----NYLSNPMGGRASSLSLGSSSDNAYIK 425

Query: 328 PLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQ 230
            LH     H+Q H +   +++  Q++L Q   Q
Sbjct: 426 NLHHGGGYHNQQHHNYNQQQQQQQQQLQQQQQQ 458



>gb:AC116960_1206798 Dictyostelium discoideum chromosome 2 map
           complement(1004496-821614) strain AX4, complete
           sequence.
          Length = 726

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 14/71 (19%), Positives = 33/71 (46%)
 Frame = -1

Query: 388 PFLRLSAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHV 209
           P+ ++     +QN  + H     ++HQ+H Q H+  Q +++  Q++  Q   Q   ++  
Sbjct: 621 PYYQIQNNQYNQNIQHQHQHQQSQQHQQHQQQHLQQQQQQQQQQQQQQQQQQQQQQQQQQ 680

Query: 208 PSRPPELRHHQ 176
             +  + +  Q
Sbjct: 681 QQQQQQQQQQQ 691



>gb:AE014296_1135206 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE014296_1135207 Drosophila melanogaster
           chromosome 3L, complete sequence.>gb:AE003557_1215444
           Drosophila melanogaster chromosome 3L, section 28 of 83
           of the complete sequence.>gb:AE003557_1215445 Drosophila
           melanogaster chromosome 3L, section 28 of 83 of the
           complete sequence.
          Length = 1023

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 17/63 (26%), Positives = 28/63 (44%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQ 176
           QN H  H   L ++HQ HSQ   H Q + +  Q++  Q   Q   ++    +  + +  Q
Sbjct: 769 QNLHTQHQHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 828

Query: 175 LNL 167
             L
Sbjct: 829 QQL 831



>gb:AE013599_1132052 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003809_1225624 Drosophila melanogaster
           chromosome 2R, section 41 of 74 of the complete
           sequence.
          Length = 1263

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 19/61 (31%), Positives = 26/61 (42%), Gaps = 4/61 (6%)
 Frame = -1

Query: 322 HEKHQRHSQAHIHGQPERRNDQRRLHQIPHQP----HLRRHVPSRPPELRHHQLNLINRH 155
           H++ Q+  Q     Q  +   +RR  Q   Q     H RRH P  PP   H   +L + H
Sbjct: 765 HQQQQQQQQIRTREQRRKERRERRQQQQQQQQFQPHHARRHPPPPPPPQLHPPPHLHHPH 824

Query: 154 P 152
           P
Sbjct: 825 P 825



>gb:AE014298_1124431 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003435_1209613 Drosophila melanogaster
           chromosome X, section 19 of 74 of the complete
           sequence.>gb:AY058413_1291567 Drosophila melanogaster
           GH18971 full length cDNA.
          Length = 259

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 16/64 (25%), Positives = 32/64 (50%)
 Frame = -1

Query: 337 HIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNLINR 158
           H +   ++HQ+H Q     Q  +++ Q++  Q  HQ   ++H+  +    +HHQL    +
Sbjct: 36  HQQHQQQQHQQHQQQQHQQQQHQQHQQQQQQQHQHQQQQQQHLQQQ----QHHQLQQQQQ 91

Query: 157 HPRH 146
             +H
Sbjct: 92  QQQH 95



>pir|T13071|T13071 CLOCK protein - fruit fly (Drosophila
           melanogaster)>gb:AF069997_1238540 Drosophila
           melanogaster CLOCK mRNA, complete cds.
          Length = 1027

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 17/63 (26%), Positives = 28/63 (44%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQ 176
           QN H  H   L ++HQ HSQ   H Q + +  Q++  Q   Q   ++    +  + +  Q
Sbjct: 773 QNLHTQHQHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 832

Query: 175 LNL 167
             L
Sbjct: 833 QQL 835



>pir|T13068|T13068 CLOCK protein - fruit fly (Drosophila
           melanogaster)>gb:AF067207_1237869 Drosophila
           melanogaster CLOCK mRNA, complete cds.
          Length = 1023

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 17/63 (26%), Positives = 28/63 (44%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQ 176
           QN H  H   L ++HQ HSQ   H Q + +  Q++  Q   Q   ++    +  + +  Q
Sbjct: 769 QNLHTQHQHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 828

Query: 175 LNL 167
             L
Sbjct: 829 QQL 831



>sp|Q58244|Y834_METJA Hypothetical protein MJ0834.>pir|B64404|B64404
           hypothetical protein MJ0834 - Methanococcus
           jannaschii>gb:U67527_206941 Methanocaldococcus
           jannaschii DSM 2661 section 69 of 150 of the complete
           genome.>gb:L77117_1099699 Methanocaldococcus jannaschii
           DSM 2661, complete genome.
          Length = 238

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = +2

Query: 314 LFVERLYMGIVIILVKIFCGKPEKRYKWEPMREDYEI 424
           +F++  Y  I IIL+ IFCG  EK Y +      YE+
Sbjct: 1   MFMDYKYFFITIILISIFCGCYEKSYSFVEYNRHYEL 37



>sp|O02491|HMEN_ANOGA Segmentation polarity homeobox protein
           engrailed.>gb:AGU42214_1282038 Anopheles gambiae
           engrailed gene, complete cds.>gb:AGU42429_1282039
           Anopheles gambiae engrailed mRNA, complete cds.
          Length = 596

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%)
 Frame = -1

Query: 334 IKPLHEKHQR-HSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRP 197
           I PLH K +   S   +  QP   +     HQ+PH PH + H   +P
Sbjct: 71  ISPLHIKQEPLGSDGPMPAQPPHHHQHPHHHQLPHHPHHQHHPQQQP 117



>sp|O61735|CLOC_DROME Circadian locomoter output cycles Kaput
           protein (dCLOCK) (dPAS1).>gb:AE014296_1135208 Drosophila
           melanogaster chromosome 3L, complete
           sequence.>gb:AE003557_1215446 Drosophila melanogaster
           chromosome 3L, section 28 of 83 of the complete
           sequence.
          Length = 1027

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 17/63 (26%), Positives = 28/63 (44%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQ 176
           QN H  H   L ++HQ HSQ   H Q + +  Q++  Q   Q   ++    +  + +  Q
Sbjct: 773 QNLHTQHQHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 832

Query: 175 LNL 167
             L
Sbjct: 833 QQL 835



>gb:AP005405_1851208 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:B1111C03.>gb:AP005871_1859385 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:B1116H04.
          Length = 239

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = -1

Query: 259 QRRLHQIPHQPHLRRHVPSRPPELRHHQLNLINRH 155
           +R + ++ HQP LR   PS P  L HH  NL   H
Sbjct: 66  ERAICRVWHQPRLRHRPPSHPIHLLHHASNLRRCH 100



>gb:CR382129_1661358 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 674

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 18/70 (25%), Positives = 35/70 (50%), Gaps = 2/70 (2%)
 Frame = +2

Query: 77  QSNNRLLCF*VAGWSKLFLKIVIMAGVAINEVELMMPELRG--PGGDVAAQMRLMWDLVK 250
           +  N+ L + + G   +F  + +  G + +++EL++ E+ G      V  ++R+ WD  K
Sbjct: 445 EMTNKFLRYQIDGKKLVFGYVTLFQGTSTSDLELLIEEVAGLMQNSGVKHKLRIAWDEHK 504

Query: 251 APLIVPALRL 280
                P LRL
Sbjct: 505 KSKTAPTLRL 514



>gb:U41538_1404041 Caenorhabditis elegans cosmid R04E5, complete
           sequence.
          Length = 142

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 25/85 (29%), Positives = 32/85 (37%), Gaps = 14/85 (16%)
 Frame = -1

Query: 358 DQNDHNP--HIKPL--HEKHQRHSQAHIHGQPERRNDQRRLH------QIPHQPHLRRHV 209
           D+   +P  HI P   H + Q H++ H HG P   N  R  H      +  +Q   R H 
Sbjct: 48  DRRHRSPGKHIAPARAHNRGQHHNRGHHHGPPRNHNQDRNRHRNHDGNRHQNQDRSRHHN 107

Query: 208 PSRPPELRH----HQLNLINRHPRH 146
             R     H    HQ    NR   H
Sbjct: 108 QDRNRRQNHDRNRHQSQGRNRQQDH 132



>gb:DMU48402_1380796 Drosophila melanogaster pipsqueak (psq) mRNA,
           alternative ovarian transcript psq-2, complete cds.
          Length = 646

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 2/51 (3%)
 Frame = -1

Query: 322 HEKHQRHSQAHIHGQPERRNDQRRLH--QIPHQPHLRRHVPSRPPELRHHQ 176
           H  HQ H Q   H Q + +  Q+ LH  Q+  Q  L++    +  + +HHQ
Sbjct: 122 HAHHQAHQQHQQHQQQQHQQQQQHLHAQQLLAQSQLQQQQQQQQQQQQHHQ 172



>gb:DMU48358_1380793 Drosophila melanogaster pipsqueak (psq) mRNA,
           primary ovarian transcript psq-1, complete cds.
          Length = 1065

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 2/51 (3%)
 Frame = -1

Query: 322 HEKHQRHSQAHIHGQPERRNDQRRLH--QIPHQPHLRRHVPSRPPELRHHQ 176
           H  HQ H Q   H Q + +  Q+ LH  Q+  Q  L++    +  + +HHQ
Sbjct: 541 HAHHQAHQQHQQHQQQQHQQQQQHLHAQQLLAQSQLQQQQQQQQQQQQHHQ 591



>gb:DMPIPSQ1_1379970 D.melanogaster pipsqueak ORF-A short/long
           ORF-B.
          Length = 660

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 2/51 (3%)
 Frame = -1

Query: 322 HEKHQRHSQAHIHGQPERRNDQRRLH--QIPHQPHLRRHVPSRPPELRHHQ 176
           H  HQ H Q   H Q + +  Q+ LH  Q+  Q  L++    +  + +HHQ
Sbjct: 116 HAHHQAHQQHQQHQQQQHQQQQQHLHAQQLLAQSQLQQQQQQQQQQQQHHQ 166



>gb:AY118740_1300462 Drosophila melanogaster GH05220 full insert
           cDNA.
          Length = 399

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 5/48 (10%)
 Frame = -1

Query: 343 NPHIKPLHEKHQRHSQAHIHGQP-----ERRNDQRRLHQIPHQPHLRR 215
           +PH    H++HQ+H Q H H  P      ++  Q+  H   HQ H  +
Sbjct: 186 HPHPHQHHQQHQQHQQHHAHLHPAHAHGNQQQQQQVQHHHSHQAHFHQ 233



>gb:AF275687_1257886 Plasmodium falciparum knob-associated
           histidine-rich protein (KAHRP) gene, complete cds.
          Length = 634

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 22/89 (24%), Positives = 36/89 (40%), Gaps = 3/89 (3%)
 Frame = -1

Query: 373 SAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRH---VPS 203
           S ++ D  +     +  HE H  H   H H            HQ PHQ H   H   V  
Sbjct: 44  SGDSFDFRNKRTLAQKQHEHHHHHHHQHQH-----------QHQAPHQAHHHHHHGEVNH 92

Query: 202 RPPELRHHQLNLINRHPRHYYYF*KQFTP 116
           + P++ H Q++  ++   H+++   Q  P
Sbjct: 93  QAPQV-HQQVHRQDQAHHHHHHHHHQLQP 120



>gb:AC115606_1205895 Dictyostelium discoideum chromosome 2 map
           159760-209066 strain AX4, complete sequence.
          Length = 1829

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 26/125 (20%), Positives = 48/125 (38%)
 Frame = -1

Query: 511 TNSSNGDLVDLFFIKHGDLNEDGRENRSANLVILTHRLPFVPFLRLSAENLDQNDHNPHI 332
           +N++NG     +F  +G++N D           L H       + L +++ +        
Sbjct: 85  SNNNNGASDKSYFTIYGNINNDAHNQTLTQHTDLEH-------VDLESDSKNIKYQQQQQ 137

Query: 331 KPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNLINRHP 152
           +  H++HQ++ Q H   Q +  N+    +  PH     +   S P       LN +   P
Sbjct: 138 QHQHQQHQQYQQQHQQHQQQNNNNNNNGYINPHLTESSQLFSSVP-------LNSLPNSP 190

Query: 151 RHYYY 137
            H  Y
Sbjct: 191 YHINY 195



>gb:AE014296_1135097 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003560_1215633 Drosophila melanogaster
           chromosome 3L, section 25 of 83 of the complete
           sequence.
          Length = 152

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 4/49 (8%)
 Frame = -1

Query: 325 LHEKHQRHSQAHIHGQPERRN----DQRRLHQIPHQPHLRRHVPSRPPE 191
           L ++HQ+  Q   H Q +++      Q++  Q P QPH R H  S  P+
Sbjct: 73  LQQEHQQQQQQQKHHQQQQQQHHQQQQQQQQQAPQQPHKRAHSKSPQPQ 121



>gb:AE013599_1133312 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003457_1210611 Drosophila melanogaster
           chromosome 2R, section 65 of 74 of the complete
           sequence.
          Length = 464

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 5/48 (10%)
 Frame = -1

Query: 343 NPHIKPLHEKHQRHSQAHIHGQP-----ERRNDQRRLHQIPHQPHLRR 215
           +PH    H++HQ+H Q H H  P      ++  Q+  H   HQ H  +
Sbjct: 219 HPHPHQHHQQHQQHQQHHAHLHPAHAHGNQQQQQQVQHHHSHQAHFHQ 266



>gb:AE013599_1132764 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003796_1224875 Drosophila melanogaster
           chromosome 2R, section 54 of 74 of the complete
           sequence.
          Length = 1218

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 15/50 (30%), Positives = 23/50 (46%)
 Frame = -1

Query: 322 HEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQL 173
           H +HQ+H Q H H        Q + HQ+P Q   + H  ++     HH +
Sbjct: 439 HHQHQQHHQHHHH---PNHLHQHQSHQLPQQQQQQSHQAAQQEHHHHHPM 485



>gb:AE013599_1131125 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE013599_1131126 Drosophila melanogaster
           chromosome 2R, complete sequence.>gb:AE013599_1131127
           Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE013599_1131128 Drosophila melanogaster
           chromosome 2R, complete sequence.>gb:AE013599_1131129
           Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003829_1226629 Drosophila melanogaster
           chromosome 2R, section 21 of 74 of the complete
           sequence.>gb:AE003829_1226630 Drosophila melanogaster
           chromosome 2R, section 21 of 74 of the complete
           sequence.>gb:AE003829_1226631 Drosophila melanogaster
           chromosome 2R, section 21 of 74 of the complete
           sequence.>gb:AE003829_1226632 Drosophila melanogaster
           chromosome 2R, section 21 of 74 of the complete
           sequence.>gb:AE003829_1226633 Drosophila melanogaster
           chromosome 2R, section 21 of 74 of the complete
           sequence.
          Length = 645

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 2/51 (3%)
 Frame = -1

Query: 322 HEKHQRHSQAHIHGQPERRNDQRRLH--QIPHQPHLRRHVPSRPPELRHHQ 176
           H  HQ H Q   H Q + +  Q+ LH  Q+  Q  L++    +  + +HHQ
Sbjct: 122 HAHHQAHQQHQQHQQQQHQQQQQHLHAQQLLAQSQLQQQQQQQQQQQQHHQ 172



>gb:AE013599_1131124 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003829_1226628 Drosophila melanogaster
           chromosome 2R, section 21 of 74 of the complete
           sequence.
          Length = 1046

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 2/51 (3%)
 Frame = -1

Query: 322 HEKHQRHSQAHIHGQPERRNDQRRLH--QIPHQPHLRRHVPSRPPELRHHQ 176
           H  HQ H Q   H Q + +  Q+ LH  Q+  Q  L++    +  + +HHQ
Sbjct: 541 HAHHQAHQQHQQHQQQQHQQQQQHLHAQQLLAQSQLQQQQQQQQQQQQHHQ 591



>gb:AE013599_1131122 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE013599_1131123 Drosophila melanogaster
           chromosome 2R, complete sequence.>gb:AE003829_1226626
           Drosophila melanogaster chromosome 2R, section 21 of 74
           of the complete sequence.>gb:AE003829_1226627 Drosophila
           melanogaster chromosome 2R, section 21 of 74 of the
           complete sequence.>gb:AY069588_1294318 Drosophila
           melanogaster LD33470 full length cDNA.
          Length = 1064

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 2/51 (3%)
 Frame = -1

Query: 322 HEKHQRHSQAHIHGQPERRNDQRRLH--QIPHQPHLRRHVPSRPPELRHHQ 176
           H  HQ H Q   H Q + +  Q+ LH  Q+  Q  L++    +  + +HHQ
Sbjct: 541 HAHHQAHQQHQQHQQQQHQQQQQHLHAQQLLAQSQLQQQQQQQQQQQQHHQ 591



>gb:AE014298_1125626 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003495_1212635 Drosophila melanogaster
           chromosome X, section 47 of 74 of the complete sequence.
          Length = 2148

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 18/54 (33%), Positives = 22/54 (40%), Gaps = 3/54 (5%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHI--HGQPERRNDQRRLHQIPHQ-PHLRRHVPS 203
           Q   +PH +  H  H  H Q H   H  P   +     H  PH  PHLR   P+
Sbjct: 113 QQQQHPHHQSHHGHHYAHHQQHTHHHAPPHSHHPHPHPHGHPHSYPHLRHSQPA 166



>gb:AE014298_1125625 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003495_1212634 Drosophila melanogaster
           chromosome X, section 47 of 74 of the complete sequence.
          Length = 2196

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 18/54 (33%), Positives = 22/54 (40%), Gaps = 3/54 (5%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHI--HGQPERRNDQRRLHQIPHQ-PHLRRHVPS 203
           Q   +PH +  H  H  H Q H   H  P   +     H  PH  PHLR   P+
Sbjct: 113 QQQQHPHHQSHHGHHYAHHQQHTHHHAPPHSHHPHPHPHGHPHSYPHLRHSQPA 166



>gb:AE014298_1125089 Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE003451_1210271 Drosophila melanogaster
            chromosome X, section 35 of 74 of the complete sequence.
          Length = 2090

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 18/69 (26%), Positives = 28/69 (40%), Gaps = 3/69 (4%)
 Frame = -1

Query: 379  RLSAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQ---PERRNDQRRLHQIPHQPHLRRHV 209
            +L  + L Q     H +  H  HQ+H Q H   Q   P+    Q   H +PHQ   ++  
Sbjct: 975  QLQHQQLQQQHAQQHQQQQHHLHQQHQQLHHDPQQQHPQYHPHQLHAHALPHQQQQQQQQ 1034

Query: 208  PSRPPELRH 182
              +  +  H
Sbjct: 1035 QQQQQQQLH 1043



>gb:AE014185_937870 Plasmodium falciparum 3D7 chromosome 10 complete
           sequence.>gb:AE014833_1228604 Plasmodium falciparum 3D7
           chromosome 10 section 5 of 7 of the complete sequence.
          Length = 1290

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 16/71 (22%), Positives = 27/71 (38%)
 Frame = -1

Query: 349 DHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLN 170
           +H+   K  H K  RHS+ H+H +    +++       H  +   H        +HH   
Sbjct: 229 EHHHSNKHRHSKEHRHSKEHLHSKEHHHSNKHHHSNDHHHSNDHHHSKDHHHSNKHHHRR 288

Query: 169 LINRHPRHYYY 137
            I+      YY
Sbjct: 289 HISSSSDSSYY 299



>gb:S75490_169047 competence region: iga=IgA protease,
           comA=transformation competence [Neisseria gonorrhoeae,
           MS11, Genomic, 3 genes, 2664 nt].
          Length = 456

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 2/64 (3%)
 Frame = -1

Query: 340 PHIKPLHEKHQRHSQAHIHGQPERRNDQ--RRLHQIPHQPHLRRHVPSRPPELRHHQLNL 167
           P  +P   +HQ   Q     Q  +R +Q  RR    P +P  +     RP E R HQ   
Sbjct: 305 PCTRPYQGRHQTERQPSTDTQNRQRVEQQHRRQRLPPRRPRRQSSPAPRPRERRQHQNTA 364

Query: 166 INRH 155
           + RH
Sbjct: 365 LRRH 368



>pir|S66149|S66149 gene pipsqueak protein A long form - fruit fly
           (Drosophila melanogaster)>gb:DMPIPSQ1_1379968
           D.melanogaster pipsqueak ORF-A short/long ORF-B.
          Length = 1085

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 2/51 (3%)
 Frame = -1

Query: 322 HEKHQRHSQAHIHGQPERRNDQRRLH--QIPHQPHLRRHVPSRPPELRHHQ 176
           H  HQ H Q   H Q + +  Q+ LH  Q+  Q  L++    +  + +HHQ
Sbjct: 541 HAHHQAHQQHQQHQQQQHQQQQQHLHAQQLLAQSQLQQQQQQQQQQQQHHQ 591



>pir|T28872|T28872 hypothetical protein R04E5.8 - Caenorhabditis
            elegans>gb:U41538_1404040 Caenorhabditis elegans cosmid
            R04E5, complete sequence.
          Length = 997

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 25/85 (29%), Positives = 32/85 (37%), Gaps = 14/85 (16%)
 Frame = -1

Query: 358  DQNDHNP--HIKPL--HEKHQRHSQAHIHGQPERRNDQRRLH------QIPHQPHLRRHV 209
            D+   +P  HI P   H + Q H++ H HG P   N  R  H      +  +Q   R H 
Sbjct: 892  DRRHRSPGKHIAPARAHNRGQHHNRGHHHGPPRNHNQDRNRHRNHDGNRHQNQDRSRHHN 951

Query: 208  PSRPPELRH----HQLNLINRHPRH 146
              R     H    HQ    NR   H
Sbjct: 952  QDRNRRQNHDRNRHQSQGRNRQQDH 976



>gb:BC032950_1980740 Homo sapiens cation channel, sperm associated
           1, mRNA (cDNA clone MGC:33335 IMAGE:4822261), complete
           cds.
          Length = 780

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 1/67 (1%)
 Frame = -1

Query: 343 NPHIKPLHEKHQRHSQA-HIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNL 167
           NP+ +  H     HS+A H+ G    ++D+ + HQ+PH+     H        RHH+ + 
Sbjct: 185 NPYSESFH-----HSEASHLSGL---QHDESQHHQVPHRGWPHHHQVHHHGRSRHHEAHQ 236

Query: 166 INRHPRH 146
             + P H
Sbjct: 237 HGKSPHH 243



 Score = 32.7 bits (73), Expect = 3.5
 Identities = 17/64 (26%), Positives = 24/64 (37%), Gaps = 15/64 (23%)
 Frame = -1

Query: 340 PHIKPLHEKHQRHSQAHIHGQPERRNDQR---------------RLHQIPHQPHLRRHVP 206
           PH +P H +   H + H HG P +R +                  +HQ  H    R HV 
Sbjct: 30  PHHRPGHSRALHHYELHHHGVPHQRGESHHPPEFQDFHDQALSSHVHQSHHHSEARNHVR 89

Query: 205 SRPP 194
           +  P
Sbjct: 90  AHGP 93



>gb:AY382307_1948822 Gorilla gorilla sperm ion channel (CATSPER1)
           gene, exon 1 and partial cds.
          Length = 405

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 1/67 (1%)
 Frame = -1

Query: 343 NPHIKPLHEKHQRHSQA-HIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNL 167
           NP+ +  H     HS+A H+ G    ++D+ + HQ+PH+     H        RHH+ + 
Sbjct: 185 NPYSESFH-----HSEASHLSGL---QHDESQHHQVPHRGWPHHHQVHHHGRSRHHEAHQ 236

Query: 166 INRHPRH 146
             + P H
Sbjct: 237 HGKSPHH 243



>gb:AY382305_1948821 Pan paniscus sperm ion channel (CATSPER1) gene,
           exon 1 and partial cds.
          Length = 405

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 1/67 (1%)
 Frame = -1

Query: 343 NPHIKPLHEKHQRHSQA-HIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNL 167
           NP+ +  H     HS+A H+ G    ++D+ + HQ+PH+     H        RHH+ + 
Sbjct: 185 NPYSESFH-----HSEASHLSGL---QHDESQHHQVPHRGWPHHHQVHHHGRSRHHEAHQ 236

Query: 166 INRHPRH 146
             + P H
Sbjct: 237 HGKSPHH 243



>gb:AY382304_1948820 Pan troglodytes sperm ion channel (CATSPER1)
           gene, exon 1 and partial cds.
          Length = 405

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 1/67 (1%)
 Frame = -1

Query: 343 NPHIKPLHEKHQRHSQA-HIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNL 167
           NP+ +  H     HS+A H+ G    ++D+ + HQ+PH+     H        RHH+ + 
Sbjct: 185 NPYSESFH-----HSEASHLSGL---QHDESQHHQVPHRGWPHHHQVHHHGRSRHHEAHQ 236

Query: 166 INRHPRH 146
             + P H
Sbjct: 237 HGKSPHH 243



>gb:AF539550_1906422 Pan troglodytes cation channel of sperm
           (CATSPER) gene, exon 1 and partial cds.
          Length = 401

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 1/67 (1%)
 Frame = -1

Query: 343 NPHIKPLHEKHQRHSQA-HIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNL 167
           NP+ +  H     HS+A H+ G    ++D+ + HQ+PH+     H        RHH+ + 
Sbjct: 185 NPYSESFH-----HSEASHLSGL---QHDESQHHQVPHRGWPHHHQVHHHGRSRHHEAHQ 236

Query: 166 INRHPRH 146
             + P H
Sbjct: 237 HGKSPHH 243



>gb:AF407333_1901236 Homo sapiens sperm ion channel mRNA, complete
           cds.>gb:BC036522_1981963 Homo sapiens cation channel,
           sperm associated 1, mRNA (cDNA clone MGC:33368
           IMAGE:5268567), complete cds.
          Length = 780

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 1/67 (1%)
 Frame = -1

Query: 343 NPHIKPLHEKHQRHSQA-HIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNL 167
           NP+ +  H     HS+A H+ G    ++D+ + HQ+PH+     H        RHH+ + 
Sbjct: 185 NPYSESFH-----HSEASHLSGL---QHDESQHHQVPHRGWPHHHQVHHHGRSRHHEAHQ 236

Query: 166 INRHPRH 146
             + P H
Sbjct: 237 HGKSPHH 243



>gb:CR382129_1662198 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 931

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 23/92 (25%), Positives = 39/92 (42%), Gaps = 7/92 (7%)
 Frame = -1

Query: 349 DHNPHIKPLHEKHQRHSQAHIHGQPER-------RNDQRRLHQIPHQPHLRRHVPSRPPE 191
           +H  H +   E HQ HS++H HG  E         N    +++  H+ +L  H     PE
Sbjct: 671 EHEEHQEDHQELHQEHSESH-HGGEEHVLINDGTLNLNNEVNEHHHEHNLEYHEEYHIPE 729

Query: 190 LRHHQLNLINRHPRHYYYF*KQFTPPSYSETE 95
             H + +L    P +++     +  P Y E +
Sbjct: 730 -PHQEPSLHEPEPEYHHDSEPDYHEPDYHEPD 760



>gb:PFAKNOBA_1393815 Plasmodium falciparum knob protein mRNA,
           partial cds.
          Length = 270

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 23/95 (24%), Positives = 37/95 (38%), Gaps = 3/95 (3%)
 Frame = -1

Query: 373 SAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRH---VPS 203
           S ++ D  +     +  HE H  H   H H            HQ PHQ H   H   V  
Sbjct: 44  SGDSFDFRNKRTLAQKQHEHHHHHHHQHQH-----------QHQAPHQAHHHHHHGEVNH 92

Query: 202 RPPELRHHQLNLINRHPRHYYYF*KQFTPPSYSET 98
           + P++ H Q++  ++   H+++   Q  P     T
Sbjct: 93  QAPQV-HQQVHGQDQAHHHHHHHHHQLQPQQLQGT 126



>gb:AY094826_1298000 Drosophila melanogaster LD39940 full insert
           cDNA.
          Length = 1266

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 20/74 (27%), Positives = 33/74 (44%)
 Frame = -1

Query: 373 SAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPP 194
           S+    Q+      + +  + QR  +     Q +++  Q++  Q PH  H RRH P  PP
Sbjct: 758 SSNMQQQHQQQQQQQQIRTREQRRKERRERRQQQQQQQQQQQFQ-PH--HARRHPPPPPP 814

Query: 193 ELRHHQLNLINRHP 152
              H   +L + HP
Sbjct: 815 PQLHPPPHLHHPHP 828



>gb:AF362373_1265606 Dictyostelium discoideum histidine kinase DhkL
            (dhkL) gene, complete cds.
          Length = 1709

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 29/135 (21%), Positives = 55/135 (40%), Gaps = 18/135 (13%)
 Frame = -1

Query: 493  DLVDLFFIKHGDLNEDGRENRSANLVILTHRLPFVPFLRLSAENL---------DQNDHN 341
            +LV L F  +G+++ + +    +    +   L F  FL   ++NL          Q    
Sbjct: 1029 ELVHLAF--NGEISVESQYGHGSTFTCI---LKFKKFLPSDSQNLLPASSPLQQQQQQQQ 1083

Query: 340  PHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPH---------QPHLRRHVPSRPPEL 188
               +    +HQ+ +Q H H Q + ++ Q + HQ            Q  L++H   +  + 
Sbjct: 1084 HQQQTQFHQHQQQTQFHQHQQQQLQHQQHQQHQQLQQQQQQQQQLQQQLQQHQQHQLQQR 1143

Query: 187  RHHQLNLINRHPRHY 143
            +HHQ  L  +   H+
Sbjct: 1144 QHHQQQLQQQQHHHH 1158



>gb:AF234186_1253361 Plasmodium falciparum knob-associated
           histidine-rich protein mRNA, partial cds.
          Length = 597

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 23/95 (24%), Positives = 37/95 (38%), Gaps = 3/95 (3%)
 Frame = -1

Query: 373 SAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRH---VPS 203
           S ++ D  +     +  HE H  H   H H            HQ PHQ H   H   V  
Sbjct: 7   SGDSFDFRNKRTLAQKQHEHHHHHHHQHQH-----------QHQAPHQAHHHHHHGEVNH 55

Query: 202 RPPELRHHQLNLINRHPRHYYYF*KQFTPPSYSET 98
           + P++ H Q++  ++   H+++   Q  P     T
Sbjct: 56  QAPQV-HQQVHGQDQAHHHHHHHHHQLQPQQLQGT 89



>gb:AE014297_1140890 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003740_1222883 Drosophila melanogaster
           chromosome 3R, section 78 of 118 of the complete
           sequence.
          Length = 453

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 26/81 (32%), Positives = 36/81 (44%), Gaps = 7/81 (8%)
 Frame = -1

Query: 397 PFVPFLRLSAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLR 218
           P  P  R   E+L  + H+P+ +      QRH Q     QPE R  Q        QPHL+
Sbjct: 212 PANPVKRQQEESL--SSHHPNREQSQPLEQRHYQ-----QPESRQLQ--------QPHLQ 256

Query: 217 RHVPSR-------PPELRHHQ 176
           +H+  +       P + RHHQ
Sbjct: 257 QHLQQKRPHALQYPQDQRHHQ 277



>gb:AE014297_1140290 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003724_1222283 Drosophila melanogaster
           chromosome 3R, section 62 of 118 of the complete
           sequence.
          Length = 1542

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 18/69 (26%), Positives = 36/69 (52%)
 Frame = -1

Query: 382 LRLSAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPS 203
           L+L  ++LD+  H P+ + L ++ Q+  Q     Q  ++  Q++  Q  HQ H ++H+  
Sbjct: 414 LQLEKQHLDKQKH-PYQQQLEKQQQQQQQQQ--QQHHQQQHQQQHQQQQHQQHQQQHIQQ 470

Query: 202 RPPELRHHQ 176
           +    + HQ
Sbjct: 471 QHQHQQQHQ 479



>gb:AE014187_938608 Plasmodium falciparum 3D7 chromosome 14 complete
            sequence.>gb:AE014818_1227684 Plasmodium falciparum 3D7
            chromosome 14 section 3 of 13 of the complete sequence.
          Length = 2770

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 18/67 (26%), Positives = 22/67 (32%)
 Frame = -1

Query: 358  DQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHH 179
            D N+ + H    H  H  H+  H H      N     H   H  H   H         HH
Sbjct: 1201 DHNNDDVHHHNNHNNHNNHNHHHNHHHNHHHNHHHNHHHNHHHNHHHNH------HHHHH 1254

Query: 178  QLNLINR 158
              N IN+
Sbjct: 1255 HDNNINK 1261



>pir|AI1743|AI1743 hypothetical protein lin2494 [imported] -
           Listeria innocua  (strain Clip11262)>gb:AL596172_539835
           Listeria innocua Clip11262 complete genome, segment
           10/12.
          Length = 124

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 17/51 (33%), Positives = 22/51 (43%)
 Frame = -1

Query: 343 NPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPE 191
           NP  K L    + H    IH QPE  +  R +   P+ P    H PS  P+
Sbjct: 71  NPSSKALPPNKKPHPSKSIHHQPEILHPIRPIQSKPNPPKTNTHSPSPKPQ 121



>pir|S47857|S47857 basic protein, cytosolic - fruit fly (Drosophila
           melanogaster)>gb:DMU09789_1380399 Drosophila
           melanogaster Oregon R cytoplasmic basic protein (deltex)
           mRNA, complete cds.
          Length = 737

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 13/53 (24%), Positives = 29/53 (54%)
 Frame = -1

Query: 319 EKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNLIN 161
           +  Q+  Q H H   ++++ Q++ HQ+ H     +  P +PP+ +H +++  N
Sbjct: 268 QHQQQQQQQHHHQHQQQQHQQQQQHQMQHHQIHHQTAPRKPPK-KHSEISTTN 319



>pir|A54495|A54495 knob protein precursor - malaria parasite
           (Plasmodium falciparum) (strain FCR-3
           Gambia)>gb:PFAKPA_1393816 P.falciparum knop protein (KP)
           gene, complete cds.
          Length = 634

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 23/95 (24%), Positives = 37/95 (38%), Gaps = 3/95 (3%)
 Frame = -1

Query: 373 SAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRH---VPS 203
           S ++ D  +     +  HE H  H   H H            HQ PHQ H   H   V  
Sbjct: 44  SGDSFDFRNKRTLAQKQHEHHHHHHHQHQH-----------QHQAPHQAHHHHHHGEVNH 92

Query: 202 RPPELRHHQLNLINRHPRHYYYF*KQFTPPSYSET 98
           + P++ H Q++  ++   H+++   Q  P     T
Sbjct: 93  QAPQV-HQQVHGQDQAHHHHHHHHHQLQPQQLQGT 126



>pir|A26480|A26480 knob protein - malaria parasite (Plasmodium
           falciparum)  (fragments)
          Length = 270

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 23/95 (24%), Positives = 37/95 (38%), Gaps = 3/95 (3%)
 Frame = -1

Query: 373 SAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRH---VPS 203
           S ++ D  +     +  HE H  H   H H            HQ PHQ H   H   V  
Sbjct: 44  SGDSFDFRNKRTLAQKQHEHHHHHHHQHQH-----------QHQAPHQAHHHHHHGEVNH 92

Query: 202 RPPELRHHQLNLINRHPRHYYYF*KQFTPPSYSET 98
           + P++ H Q++  ++   H+++   Q  P     T
Sbjct: 93  QAPQV-HQQVHGQDQAHHHHHHHHHQLQPQQLQGT 126



>pir|A54494|A54494 knob-associated histidine-rich protein precursor
           - malaria parasite (Plasmodium falciparum) (fragments)
          Length = 473

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 23/95 (24%), Positives = 37/95 (38%), Gaps = 3/95 (3%)
 Frame = -1

Query: 373 SAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRH---VPS 203
           S ++ D  +     +  HE H  H   H H            HQ PHQ H   H   V  
Sbjct: 44  SGDSFDFRNKRTLAQKQHEHHHHHHHQHQH-----------QHQAPHQAHHHHHHGEVNH 92

Query: 202 RPPELRHHQLNLINRHPRHYYYF*KQFTPPSYSET 98
           + P++ H Q++  ++   H+++   Q  P     T
Sbjct: 93  QAPQV-HQQVHGQDQAHHHHHHHHHQLQPQQLQGT 126



>sp|Q62563|SRY_MUSSP Sex-determining region Y protein
           (Testis-determining factor).>gb:MSU70659_2124830 Mus
           spretus sex determining protein (Sry) gene, complete
           cds.
          Length = 355

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 19/74 (25%), Positives = 29/74 (39%), Gaps = 3/74 (4%)
 Frame = -1

Query: 358 DQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPEL--- 188
           D + H    +  H+ HQ+  Q H H Q ++   Q++ H  P Q       P +  +    
Sbjct: 224 DHHHHQQQQQQFHDHHQQKQQFHDHHQQQQ---QQQFHDHPQQQQQFHDHPQQKQQFHDH 280

Query: 187 RHHQLNLINRHPRH 146
            HHQ      H  H
Sbjct: 281 HHHQQQKQQFHDHH 294



 Score = 32.3 bits (72), Expect = 4.6
 Identities = 17/72 (23%), Positives = 28/72 (38%), Gaps = 3/72 (4%)
 Frame = -1

Query: 352 NDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQP---HLRRHVPSRPPELRH 182
           +DH+   +  H+ HQ+  Q   H  P++   Q++ H  P Q    H   H   +  +   
Sbjct: 236 HDHHQQKQQFHDHHQQQQQQQFHDHPQQ---QQQFHDHPQQKQQFHDHHHHQQQKQQFHD 292

Query: 181 HQLNLINRHPRH 146
           H       H  H
Sbjct: 293 HHQQKQQFHDHH 304



>sp|P09346|KNOB_PLAFG Knob-associated histidine-rich protein
           precursor (KAHRP) (KP).>pir|A28412|A28412 histidine-rich
           protein precursor - malaria parasite  (Plasmodium
           falciparum)>gb:PFAKAHRPA_1393813 P.falciparum
           knob-associated histidine rich protein.
          Length = 634

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 23/95 (24%), Positives = 37/95 (38%), Gaps = 3/95 (3%)
 Frame = -1

Query: 373 SAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRH---VPS 203
           S ++ D  +     +  HE H  H   H H            HQ PHQ H   H   V  
Sbjct: 44  SGDSFDFRNKRTLAQKQHEHHHHHHHQHQH-----------QHQAPHQAHHHHHHGEVNH 92

Query: 202 RPPELRHHQLNLINRHPRHYYYF*KQFTPPSYSET 98
           + P++ H Q++  ++   H+++   Q  P     T
Sbjct: 93  QAPQV-HQQVHGQDQAHHHHHHHHHQLQPQQLQGT 126



>sp|P13817|KNOB_PLAFA Knob-associated histidine-rich protein
           precursor (KAHRP) (HRPI) (Fragment).>gb:PFAKNOB_1393814
           P.falciparum knob-associated histidine-rich protein
           (HRPI) mRNA, 5' end.
          Length = 473

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 23/95 (24%), Positives = 37/95 (38%), Gaps = 3/95 (3%)
 Frame = -1

Query: 373 SAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRH---VPS 203
           S ++ D  +     +  HE H  H   H H            HQ PHQ H   H   V  
Sbjct: 44  SGDSFDFRNKRTLAQKQHEHHHHHHHQHQH-----------QHQAPHQAHHHHHHGEVNH 92

Query: 202 RPPELRHHQLNLINRHPRHYYYF*KQFTPPSYSET 98
           + P++ H Q++  ++   H+++   Q  P     T
Sbjct: 93  QAPQV-HQQVHGQDQAHHHHHHHHHQLQPQQLQGT 126



>gb:AF407332_2065188 Mus musculus sperm ion channel mRNA, complete
           cds.
          Length = 686

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 18/68 (26%), Positives = 28/68 (41%), Gaps = 3/68 (4%)
 Frame = -1

Query: 340 PHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPP---ELRHHQLN 170
           PH+   H     H+ +H HG+     +QR      H  H+  H+  R P   +L H   +
Sbjct: 202 PHLHADHHHEGHHAHSH-HGEHPHHKEQRHY----HGDHMHHHIHHRSPSASQLSHKSHS 256

Query: 169 LINRHPRH 146
            +   P H
Sbjct: 257 TLATSPSH 264



>gb:AB029018_1865874 Homo sapiens mRNA for KIAA1095 protein, partial
            cds.
          Length = 1098

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 21/100 (21%), Positives = 41/100 (41%)
 Frame = -1

Query: 373  SAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPP 194
            S + LD N      +PL  K +R S       P ++     L    H P+   H+P+   
Sbjct: 857  SLKELDPN------QPLESKERRASDGSRSPTPSQKLGSAYLPSYHHSPYKHAHIPAHA- 909

Query: 193  ELRHHQLNLINRHPRHYYYF*KQFTPPSYSETEQSIITLC 74
                       +H + Y    +Q +   Y++++ S++++C
Sbjct: 910  -----------QHYQSYMQLIQQKSAVEYAQSQMSLVSMC 938



>gb:CR382136_1669006 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 753

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 18/73 (24%), Positives = 30/73 (41%), Gaps = 1/73 (1%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQ 176
           Q     H +  H++ Q+  Q     QP++   Q++     HQP   +     P +  H Q
Sbjct: 324 QQQQQQHQQQQHQQQQQQHQQQQQHQPQQHQQQQQHQPQQHQPQQHQPQQHTPQQQAHQQ 383

Query: 175 LNLINRH-PRHYY 140
             L N+  P+  Y
Sbjct: 384 HQLQNQQLPQQSY 396



>gb:CR382131_1664806 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 700

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 14/59 (23%), Positives = 29/59 (49%), Gaps = 12/59 (20%)
 Frame = -1

Query: 340 PHIKPLHEKHQRHSQAHIHGQPERRN------------DQRRLHQIPHQPHLRRHVPSR 200
           PH + ++   Q+  Q H+H Q ++++             Q++ HQ+ H  H ++H  +R
Sbjct: 441 PHAEQMYHMQQQQQQQHLHQQQQQQHHQQSQNQHIQQQQQQQQHQMHHPHHTQQHFQAR 499



>gb:CR382131_1663822 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 1449

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 24/92 (26%), Positives = 38/92 (41%), Gaps = 3/92 (3%)
 Frame = -1

Query: 409 THRLPFVPFLRLSAENLDQNDHNPHIKPL--HEKHQRHSQAHIHGQ-PERRNDQRRLHQI 239
           TH+ P +     S ++  QN H     P+  HE+H    Q   H Q P++++        
Sbjct: 61  THQAPHI-----SPQHSPQNGHTMPGPPMMGHEQHYMQQQHPQHPQHPQQQSPPMLPQHH 115

Query: 238 PHQPHLRRHVPSRPPELRHHQLNLINRHPRHY 143
            H PH   H P   P +  HQ +     P ++
Sbjct: 116 QHHPH-PHHSPQHSPPMLQHQHHSSTSPPMYH 146



 Score = 32.0 bits (71), Expect = 6.1
 Identities = 20/72 (27%), Positives = 26/72 (36%), Gaps = 2/72 (2%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRR--LHQIPHQPHLRRHVPSRPPELRH 182
           Q+  +PH  P H       Q H    P   + Q+    HQ P  PH     P   P +  
Sbjct: 116 QHHPHPHHSPQHSPPMLQHQHHSSTSPPMYHKQQPHPQHQHPPPPHPGHMSPQGHPNMSP 175

Query: 181 HQLNLINRHPRH 146
           H +     HP H
Sbjct: 176 HPVQHQGPHPGH 187



>gb:AY165552_1305907 Drosophila novamexicana mastermind (mam) gene,
           exon 1 and partial cds.
          Length = 299

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 15/48 (31%), Positives = 28/48 (58%)
 Frame = -1

Query: 319 EKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQ 176
           ++HQ+H Q   H Q  +++ Q++ HQ  HQ   ++H   +  + +HHQ
Sbjct: 32  QQHQQHQQQQ-HQQQHQQHQQQQQHQ-QHQQQQQQHQQQQHQQQQHHQ 77



>gb:AY051631_1290225 Drosophila melanogaster GH28016 full length
           cDNA.
          Length = 506

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 19/64 (29%), Positives = 26/64 (40%), Gaps = 7/64 (10%)
 Frame = -1

Query: 322 HEKHQRHSQAHIHGQPERRNDQRRLHQIPHQP-------HLRRHVPSRPPELRHHQLNLI 164
           H++ Q+  Q     Q  +   +RR  Q   Q        H RRH P  PP   H   +L 
Sbjct: 5   HQQQQQQQQIRTREQRRKERRERRQQQQQQQQQQQFQPHHARRHPPPPPPPQLHPPPHLH 64

Query: 163 NRHP 152
           + HP
Sbjct: 65  HPHP 68



>gb:AF128626_1243381 Dictyostelium discoideum RNA binding protein
           PufA (pufA) gene, complete cds.
          Length = 795

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 19/77 (24%), Positives = 31/77 (40%), Gaps = 7/77 (9%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRH-- 182
           Q+   P+I  +H  HQ       H  P+++     LH   H   +R   P R P   +  
Sbjct: 107 QHAQKPYITSIHNGHQVGVSQQTHMVPQQQQQTTSLHH-QHPQQIREFQPKRKPLTNNTV 165

Query: 181 -----HQLNLINRHPRH 146
                  +N+IN H ++
Sbjct: 166 SQSPPQPVNIINNHTQY 182



>gb:HSM802495_1186722 Homo sapiens mRNA; cDNA DKFZp434G1812 (from
           clone DKFZp434G1812).
          Length = 480

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 21/100 (21%), Positives = 41/100 (41%)
 Frame = -1

Query: 373 SAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPP 194
           S + LD N      +PL  K +R S       P ++     L    H P+   H+P+   
Sbjct: 239 SLKELDPN------QPLESKERRASDGSRSPTPSQKLGSAYLPSYHHSPYKHAHIPAHA- 291

Query: 193 ELRHHQLNLINRHPRHYYYF*KQFTPPSYSETEQSIITLC 74
                      +H + Y    +Q +   Y++++ S++++C
Sbjct: 292 -----------QHYQSYMQLIQQKSAVEYAQSQMSLVSMC 320



>gb:AK044001_1166779 Mus musculus 10 days neonate cortex cDNA, RIKEN
           full-length enriched library, clone:A830080D01
           product:hypothetical P-loop containing nucleotide
           triphosphate hydrolases structure containing protein,
           full insert sequence.
          Length = 572

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 4/65 (6%)
 Frame = -1

Query: 334 IKPLHEKHQRHSQAHIHGQ--PERRNDQRR--LHQIPHQPHLRRHVPSRPPELRHHQLNL 167
           + P     + H + H HG   PE R+DQ+R    ++  + H  ++ P  PP +  +  + 
Sbjct: 16  LSPQSRNFEYHEERHFHGHYDPEYRHDQQRPFTWRMDDEKH-GQNKPRIPPRVNSYHRSY 74

Query: 166 INRHP 152
           +NR P
Sbjct: 75  VNRSP 79



>gb:AE013599_1130853 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003833_1226827 Drosophila melanogaster
           chromosome 2R, section 17 of 74 of the complete
           sequence.
          Length = 254

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 19/79 (24%), Positives = 30/79 (37%), Gaps = 6/79 (7%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRL------HQIPHQPHLRRHVPSRPP 194
           Q+    H+   H   Q+HSQ H   Q +    Q+        H +  Q HL++       
Sbjct: 136 QHQQQQHLGQHHT--QQHSQQHAQQQQQLMTHQQHSVAQQQHHHLQQQQHLQQQQQQHHH 193

Query: 193 ELRHHQLNLINRHPRHYYY 137
              HH    ++ H  H Y+
Sbjct: 194 HHHHHHHQQLSLHQNHLYF 212



>pir|T47235|T47235 sex determining protein [imported] - western wild
           mouse>gb:AF009521_2050489 Mus spretus sex determining
           protein (Sry) gene, complete cds.
          Length = 355

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 19/74 (25%), Positives = 29/74 (39%), Gaps = 3/74 (4%)
 Frame = -1

Query: 358 DQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPEL--- 188
           D + H    +  H+ HQ+  Q H H Q ++   Q++ H  P Q       P +  +    
Sbjct: 224 DHHHHQQQQQQFHDHHQQKQQFHDHHQQQQ---QQQFHDHPQQQQQFHDHPQQRQQFHDH 280

Query: 187 RHHQLNLINRHPRH 146
            HHQ      H  H
Sbjct: 281 HHHQQQKQQFHDHH 294



 Score = 32.0 bits (71), Expect = 6.1
 Identities = 17/72 (23%), Positives = 28/72 (38%), Gaps = 3/72 (4%)
 Frame = -1

Query: 352 NDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQP---HLRRHVPSRPPELRH 182
           +DH+   +  H+ HQ+  Q   H  P++   Q++ H  P Q    H   H   +  +   
Sbjct: 236 HDHHQQKQQFHDHHQQQQQQQFHDHPQQ---QQQFHDHPQQRQQFHDHHHHQQQKQQFHD 292

Query: 181 HQLNLINRHPRH 146
           H       H  H
Sbjct: 293 HHQQKQQFHDHH 304



>pir|T46925|T46925 hypothetical protein DKFZp434G1812.1 - human
           (fragment)
          Length = 480

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 21/100 (21%), Positives = 41/100 (41%)
 Frame = -1

Query: 373 SAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPP 194
           S + LD N      +PL  K +R S       P ++     L    H P+   H+P+   
Sbjct: 239 SLKELDPN------QPLESKERRASDGSRSPTPSQKLGSAYLPSYHHSPYKHAHIPAHA- 291

Query: 193 ELRHHQLNLINRHPRHYYYF*KQFTPPSYSETEQSIITLC 74
                      +H + Y    +Q +   Y++++ S++++C
Sbjct: 292 -----------QHYQSYMQLIQQKSAVEYAQSQMSLVSMC 320



>pir|T13062|T13062 CLOCK protein - fruit fly (Drosophila
           melanogaster)>gb:AF065133_1237741 Drosophila
           melanogaster CLOCK (Clk) mRNA, complete cds.
          Length = 1015

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 15/42 (35%), Positives = 21/42 (50%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQ 230
           QN H  H   L ++HQ HSQ   H Q + +  Q++  Q   Q
Sbjct: 769 QNLHTQHQHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQ 810



>pir|B71623|B71623 knob-associated His-rich protein PFB0100c -
           malaria parasite (Plasmodium
           falciparum)>gb:AE001362_939257 Plasmodium falciparum 3D7
           chromosome 2 complete sequence.>gb:AE001372_1208568
           Plasmodium falciparum 3D7 chromosome 2 section 9 of 73
           of the complete sequence.
          Length = 654

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 22/89 (24%), Positives = 36/89 (40%), Gaps = 3/89 (3%)
 Frame = -1

Query: 373 SAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRH---VPS 203
           S ++ D  +     +  HE H  H   H H            HQ PHQ H   H   V  
Sbjct: 44  SGDSFDFRNKRTLAQKQHEHHHHHHHQHQH-----------QHQAPHQAHHHHHHGEVNH 92

Query: 202 RPPELRHHQLNLINRHPRHYYYF*KQFTP 116
           + P++ H Q++  ++   H+++   Q  P
Sbjct: 93  QAPQV-HQQVHGQDQAHHHHHHHHHQLQP 120



>gb:AY830454_2546586 Petromyzon marinus SoxF (SoxF) mRNA, complete
           cds.
          Length = 482

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 14/47 (29%), Positives = 24/47 (51%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRR 215
           Q+DH+ H    H+ H    Q HIH Q + +  Q+   ++  +  +RR
Sbjct: 45  QHDHHHH---QHQHHHHQQQNHIHQQQQHQQQQQPCGKLKSESRIRR 88



>gb:MMU70653_2123289 Mus musculus musculus sex determining protein
           (Sry) gene, complete cds.>gb:MMU70654_2123290 Mus
           musculus musculus sex determining protein (Sry) gene,
           complete cds.
          Length = 416

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 5/74 (6%)
 Frame = -1

Query: 352 NDHNPHIKP--LHEKHQRHSQAHIHGQPERRNDQRRL---HQIPHQPHLRRHVPSRPPEL 188
           +DH+ H +    H+ HQ+  Q H H Q +++  Q++    HQ   Q H   H   +  + 
Sbjct: 211 HDHHHHHQQQQFHDHHQQQQQFHDHHQQQQQQQQQQFHDHHQQKQQFHDHHH-QQQQQQF 269

Query: 187 RHHQLNLINRHPRH 146
             HQ      H  H
Sbjct: 270 HDHQQQQQQFHDHH 283



>gb:BC024233_1978294 Homo sapiens proline rich 7 (synaptic), mRNA
           (cDNA clone MGC:27428 IMAGE:4697841), complete
           cds.>gb:BC033649_1980974 Homo sapiens proline rich 7
           (synaptic), mRNA (cDNA clone MGC:44943 IMAGE:5538503),
           complete cds.
          Length = 274

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 24/84 (28%), Positives = 32/84 (38%)
 Frame = -1

Query: 340 PHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHHQLNLIN 161
           PH   L      HS  H+H  P        LH  P QPH   H     P   HH L   +
Sbjct: 79  PHRSRLEAPAHAHSHPHVHVHP-------LLHHGPAQPHAHAH-----PHPHHHALP--H 124

Query: 160 RHPRHYYYF*KQFTPPSYSETEQS 89
             P H     + ++ P  +E++ S
Sbjct: 125 PPPTHLSVPPRPWSYPRQAESDMS 148



>gb:CR382136_1668864 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 386

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 20/74 (27%), Positives = 31/74 (41%)
 Frame = -1

Query: 391 VPFLRLSAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRH 212
           +P L L  + L    HN       + H    Q H H Q ++++ Q+ +    H PH +R 
Sbjct: 79  IPPLGLPPQALQPKTHNGQQFFQEQLHSLQQQQH-HHQHQQQHYQQHIQHPQHLPHRQRQ 137

Query: 211 VPSRPPELRHHQLN 170
                P L  H +N
Sbjct: 138 HQLHNPTLVEHPVN 151



>gb:ATAC011437_1543270 Arabidopsis thaliana chromosome III BAC F7O18
           genomic sequence, complete sequence.
          Length = 418

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 6/40 (15%)
 Frame = -1

Query: 322 HEKHQRHSQAHIHGQPERRNDQRRL------HQIPHQPHL 221
           H  HQ+    H+H Q +++  Q+RL      HQ+ H  HL
Sbjct: 7   HHHHQQQQLHHLHQQQQQQQQQQRLTSPYFHHQLQHHHHL 46



>gb:CET16G12_1367771 Caenorhabditis elegans cosmid T16G12, complete
           sequence.
          Length = 477

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 8/59 (13%)
 Frame = -1

Query: 373 SAENLDQNDHNPHIKPLHEKH-------QRH-SQAHIHGQPERRNDQRRLHQIPHQPHL 221
           SA++  +N H    K LHE+H       QRH S+A  HG P  +  +R  H++ + P L
Sbjct: 65  SAQSEGRNAH----KDLHERHVHPSQGYQRHGSKAPAHGHPSSQGARRSQHELSNFPKL 119



>gb:AY075180_1296030 Drosophila melanogaster AT12853 full length
           cDNA.
          Length = 398

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 21/77 (27%), Positives = 32/77 (41%), Gaps = 14/77 (18%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHIHGQPER--------RNDQRRLHQIPHQP--HLRRHVP 206
           Q+    H +   +KHQ+  Q H   QP R        RN  +  ++IP     H  RH  
Sbjct: 176 QHHQQQHHQHQQQKHQQQQQQHQQQQPHRQLGTESHNRNSVKNFNEIPFPQFYHQMRHQA 235

Query: 205 SRPPELR----HHQLNL 167
              P+L     HH +++
Sbjct: 236 PPQPQLNAPRSHHHIHM 252



>gb:AE014134_1127018 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE014134_1127019 Drosophila melanogaster
           chromosome 2L, complete sequence.>gb:AE003586_1216620
           Drosophila melanogaster chromosome 2L, section 5 of 83
           of the complete sequence.>gb:AE003586_1216621 Drosophila
           melanogaster chromosome 2L, section 5 of 83 of the
           complete sequence.
          Length = 401

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 21/77 (27%), Positives = 32/77 (41%), Gaps = 14/77 (18%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHIHGQPER--------RNDQRRLHQIPHQP--HLRRHVP 206
           Q+    H +   +KHQ+  Q H   QP R        RN  +  ++IP     H  RH  
Sbjct: 176 QHHQQQHHQHQQQKHQQQQQQHQQQQPHRQLGTESHNRNSVKNFNEIPFPQFYHQMRHQA 235

Query: 205 SRPPELR----HHQLNL 167
              P+L     HH +++
Sbjct: 236 PPQPQLNAPRSHHHIHM 252



>gb:AE014134_1127016 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003586_1216618 Drosophila melanogaster
           chromosome 2L, section 5 of 83 of the complete sequence.
          Length = 471

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 21/77 (27%), Positives = 32/77 (41%), Gaps = 14/77 (18%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHIHGQPER--------RNDQRRLHQIPHQP--HLRRHVP 206
           Q+    H +   +KHQ+  Q H   QP R        RN  +  ++IP     H  RH  
Sbjct: 246 QHHQQQHHQHQQQKHQQQQQQHQQQQPHRQLGTESHNRNSVKNFNEIPFPQFYHQMRHQA 305

Query: 205 SRPPELR----HHQLNL 167
              P+L     HH +++
Sbjct: 306 PPQPQLNAPRSHHHIHM 322



>gb:BX321860_773662 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 5/10.
          Length = 508

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 21/80 (26%), Positives = 37/80 (46%), Gaps = 6/80 (7%)
 Frame = +2

Query: 311 MLFVERLYMGIVIILVK--IFCGKPEKRYKW----EPMREDYEIGTSVFPSVLIQIPMFN 472
           + FV   Y  + ++L    +F  +  +R K     E ++    +G    PSV + +P+ N
Sbjct: 25  VFFVVVAYFALYVLLELRILFISRRVERCKLTELTEAVQPSLRVGDDYKPSVSVLLPVHN 84

Query: 473 EKEVYKISIGAVCNFAWPSD 532
           E  V +  I A C   +P+D
Sbjct: 85  ESFVVERLIDAACRLRYPAD 104



>pir|S42837|S42837 T16G12.3 protein - Caenorhabditis elegans
          Length = 372

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 8/59 (13%)
 Frame = -1

Query: 373 SAENLDQNDHNPHIKPLHEKH-------QRH-SQAHIHGQPERRNDQRRLHQIPHQPHL 221
           SA++  +N H    K LHE+H       QRH S+A  HG P  +  +R  H++ + P L
Sbjct: 65  SAQSEGRNAH----KDLHERHVHPSQGYQRHGSKAPAHGHPSSQGARRSQHELSNFPKL 119



>pir|T13434|T13434 hypothetical protein T17A13.50 - Arabidopsis
           thaliana>gb:ATCHRIV70_1546844 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 70.
          Length = 498

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 27/121 (22%), Positives = 48/121 (39%), Gaps = 15/121 (12%)
 Frame = -1

Query: 403 RLPFVPFLR----LSAENLDQNDHNPHIKPLHEKHQR---------HSQAHIHGQPERRN 263
           +L FVPF++    ++     Q  H      + E+H+          H  AH H     + 
Sbjct: 309 QLSFVPFMKSFDEVARRETPQTGHATCEDVMAEQHRHRHQPSSSTSHHMAHDHHHHHHQQ 368

Query: 262 DQRRLH--QIPHQPHLRRHVPSRPPELRHHQLNLINRHPRHYYYF*KQFTPPSYSETEQS 89
            Q+R H   I    H    + S    L H  +N+++ +P H +   +   P    +T+Q 
Sbjct: 369 QQQRHHAFNISQPTHPISTIISPSTSLHHASINILDDNPYHVH---RILLPNENYQTQQQ 425

Query: 88  I 86
           +
Sbjct: 426 L 426



>pir|B88573|B88573 protein T16G12.3 [imported] - Caenorhabditis
           elegans
          Length = 406

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 8/59 (13%)
 Frame = -1

Query: 373 SAENLDQNDHNPHIKPLHEKH-------QRH-SQAHIHGQPERRNDQRRLHQIPHQPHL 221
           SA++  +N H    K LHE+H       QRH S+A  HG P  +  +R  H++ + P L
Sbjct: 65  SAQSEGRNAH----KDLHERHVHPSQGYQRHGSKAPAHGHPSSQGARRSQHELSNFPKL 119



>sp|Q03825|YM38_YEAST Hypothetical 85.0 kDa protein in HLJ1-SMP2
           intergenic region.>pir|S54522|S54522 hypothetical
           protein YMR164c - yeast (Saccharomyces
           cerevisiae)>gb:SC8520X_1705672 S.cerevisiae chromosome
           XIII cosmid 8520.
          Length = 758

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 15/65 (23%), Positives = 29/65 (44%)
 Frame = -1

Query: 373 SAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPP 194
           S + + Q  H P  +P  ++ Q+  Q     Q +++  Q++  Q  HQ   +   P   P
Sbjct: 278 SQQQIQQPQHQPQHQPQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHQQQQQTPYPIVNP 337

Query: 193 ELRHH 179
           ++  H
Sbjct: 338 QMVPH 342



>sp|P06719|KNOB_PLAFN Knob-associated histidine-rich protein
           precursor (KAHRP).>pir|A29454|A29454 knob-associated
           histidine-rich protein precursor - malaria parasite
           (Plasmodium falciparum) (strain
           NF7/Ghana)>gb:PFKAHRP_1394235 P. falciparum SD17 gene
           for knob-associated histidine-rich protein.
          Length = 657

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 20/84 (23%), Positives = 33/84 (39%), Gaps = 5/84 (5%)
 Frame = -1

Query: 373 SAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRH---VPS 203
           S ++ D  +     +  HE H  H   H H         +  HQ PHQ H   H   V  
Sbjct: 44  SGDSFDFRNKRTLAQKQHEHHHHHHHHHHH-------QHQAPHQAPHQAHHHHHHGEVNH 96

Query: 202 RPPELRH--HQLNLINRHPRHYYY 137
           + P++    H  +  + H  H+++
Sbjct: 97  QAPQVHQQVHGQDQAHHHHHHHHH 120



>gb:AY549443_2536971 Danio rerio dapper1 (dpr1) mRNA, complete cds.
          Length = 815

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 4/60 (6%)
 Frame = -1

Query: 322 HEKHQRHSQAHIHGQPERRNDQRR----LHQIPHQPHLRRHVPSRPPELRHHQLNLINRH 155
           H  H RH +A +     +RND  R    LH+IP++   RR    +  E+  H     N H
Sbjct: 636 HHGHHRHHEAVLAKPKYKRNDFHRRPRGLHEIPYEEAYRRAHRRQKREMLSHMYLPSNAH 695



>gb:AY521628_2536064 Danio rerio frodo 1 (frd1) mRNA, complete cds.
          Length = 821

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 4/60 (6%)
 Frame = -1

Query: 322 HEKHQRHSQAHIHGQPERRNDQRR----LHQIPHQPHLRRHVPSRPPELRHHQLNLINRH 155
           H  H RH +A +     +RND  R    LH+IP++   RR    +  E+  H     N H
Sbjct: 642 HHGHHRHHEAVLAKPKYKRNDFHRRPRGLHEIPYEEAYRRAHRRQKREMLSHMYLPSNAH 701



>gb:MMU70657_2123293 Mus musculus castaneus sex determining protein
           (Sry) gene, complete cds.
          Length = 399

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 2/61 (3%)
 Frame = -1

Query: 352 NDHNPHIKP--LHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHH 179
           +DH+ H +    H+ HQ+  Q H H Q +++  Q++ H   HQ   + H      +  HH
Sbjct: 205 HDHHHHHQEQQFHDHHQQQQQFHDHHQQQQQQQQQQFHD-HHQQKQQFH------DHHHH 257

Query: 178 Q 176
           Q
Sbjct: 258 Q 258



 Score = 31.6 bits (70), Expect = 7.9
 Identities = 20/80 (25%), Positives = 35/80 (43%), Gaps = 3/80 (3%)
 Frame = -1

Query: 352 NDHNPHIKPLHEKHQRHSQ---AHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRH 182
           +DH+   +  H+ HQ+  Q    H H Q ++ +D  +  Q  H  H ++    +     H
Sbjct: 185 HDHHQQKQQFHDHHQQQQQFHDHHHHHQEQQFHDHHQQQQQFHDHHQQQQQQQQQQFHDH 244

Query: 181 HQLNLINRHPRHYYYF*KQF 122
           HQ      H  H++   +QF
Sbjct: 245 HQQKQ-QFHDHHHHQQQQQF 263



>gb:MMU70652_2123288 Mus musculus musculus sex determining protein
           (Sry) gene, complete cds.
          Length = 418

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 2/61 (3%)
 Frame = -1

Query: 352 NDHNPHIKP--LHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHH 179
           +DH+ H +    H+ HQ+  Q H H Q +++  Q++ H   HQ   + H      +  HH
Sbjct: 211 HDHHHHHQQQQFHDHHQQQQQFHDHQQQQQQQQQQQFHD-HHQQKQQFH------DHHHH 263

Query: 178 Q 176
           Q
Sbjct: 264 Q 264



>gb:MMU70651_2123287 Mus musculus musculus sex determining protein
           (Sry) gene, complete cds.
          Length = 420

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 2/61 (3%)
 Frame = -1

Query: 352 NDHNPHIKP--LHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHH 179
           +DH+ H +    H+ HQ+  Q H H Q +++  Q++ H   HQ   + H      +  HH
Sbjct: 215 HDHHHHHQQQQFHDHHQQQQQFHDHQQQQQQQQQQQFHD-HHQQKQQFH------DHHHH 267

Query: 178 Q 176
           Q
Sbjct: 268 Q 268



>gb:AB089610_2047901 Mus musculus mRNA for hair follicle protein
           AHF, partial cds.
          Length = 336

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 3/71 (4%)
 Frame = -1

Query: 388 PFLRLSAENLDQNDHNPHIKPLH---EKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLR 218
           PF R     L++ +     +P     E+HQ   +  +  +P RR  +RRL +   +  LR
Sbjct: 8   PFRREQERRLEREEEQLRDRPSRREQERHQEREEEQLRDRPSRREQERRLER--EEEQLR 65

Query: 217 RHVPSRPPELR 185
                R  ELR
Sbjct: 66  DRSFRREQELR 76



>gb:AE017351_1759503 Cryptococcus neoformans var. neoformans JEC21
           chromosome 11, complete sequence.
          Length = 1101

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 15/45 (33%), Positives = 17/45 (37%)
 Frame = -1

Query: 343 NPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHV 209
           +PH   LH  H   S  H +  P   N        PH  H  RHV
Sbjct: 8   HPHSHHLHSAHHHSSHPHSYQHPPPPNYSSSHPSYPHHHHTPRHV 52



>gb:NCB7F21_1690152 Neurospora crassa DNA linkage group II BAC clone
           B7F21.
          Length = 2592

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 23/81 (28%), Positives = 28/81 (34%), Gaps = 14/81 (17%)
 Frame = -1

Query: 313 HQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPP--------------ELRHHQ 176
           H  H   H H     R+D      +PH  HL    PS PP               L HH 
Sbjct: 5   HHHHHHHHHHQDNHHRHDH-----VPHPRHLATTSPSYPPLPPPPPPPPPPPSLPLPHHH 59

Query: 175 LNLINRHPRHYYYF*KQFTPP 113
               NR P +++    Q  PP
Sbjct: 60  RGQHNRTPSYHH---SQHYPP 77



>gb:CR382127_1660070 Yarrowia lipolytica chromosome A of strain CLIB99
            of Yarrowia lipolytica.
          Length = 1644

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 4/68 (5%)
 Frame = -1

Query: 337  HIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQP----HLRRHVPSRPPELRHHQLN 170
            H  P   ++ +H Q   H Q  +     +  Q+P  P    HL+    S+PP+   H L+
Sbjct: 1554 HRYPQMPQYTQHPQLPPHPQYSQYPQHVQYPQLPQLPQHLQHLQHSQHSQPPQHVQHPLH 1613

Query: 169  LINRHPRH 146
              + HP+H
Sbjct: 1614 PQHPHPQH 1621



>gb:AY091073_1574300 Arabidopsis thaliana unknown protein
           (At5g08450) mRNA, complete cds.>gb:AY122935_1579813
           Arabidopsis thaliana unknown protein (At5g08450) mRNA,
           complete cds.
          Length = 918

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHIHGQPERRND-QRRLHQIPHQPHLRRH 212
           ++ H P   P  + H  H Q H H Q + ++  Q  L  +PH PH   H
Sbjct: 35  KSPHQPVTPPPAQVHHNHQQPHQHPQSQSQSQPQPHLQALPH-PHSHSH 82



>gb:ATF8L15_1551232 Arabidopsis thaliana DNA chromosome 5, BAC clone
           F8L15 (ESSA project).
          Length = 917

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%)
 Frame = -1

Query: 355 QNDHNPHIKPLHEKHQRHSQAHIHGQPERRND-QRRLHQIPHQPHLRRH 212
           ++ H P   P  + H  H Q H H Q + ++  Q  L  +PH PH   H
Sbjct: 35  KSPHQPVTPPPAQVHHNHQQPHQHPQSQSQSQPQPHLQALPH-PHSHSH 82



>gb:PFASXD_1394091 Plasmodium falciparum sexual stage DNA sequence,
           open reading frame.
          Length = 1048

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 20/74 (27%), Positives = 31/74 (41%)
 Frame = -1

Query: 367 ENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPEL 188
           +++DQ+DH+      H  H  H   H +   +  N     H I HQ H   H+      +
Sbjct: 194 QHMDQHDHHIDHHNHHIDHHNHHIDHHNHHIDHHN-----HHIDHQDH---HIDHHNHHI 245

Query: 187 RHHQLNLINRHPRH 146
            HH  + I+ H  H
Sbjct: 246 DHHN-HHIDHHDHH 258



>gb:M25292_1389320 Drosophila melanogaster dsx mRNA, partial cds.
          Length = 397

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 18/50 (36%), Positives = 22/50 (44%)
 Frame = -1

Query: 373 SAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPH 224
           +A ++ Q+ H  H    H  HQ H Q H H QP     Q  L   PH  H
Sbjct: 196 AAASVAQHQHQSHPHSHHHHHQNHHQ-HPHQQPA---TQTALRSPPHSDH 241



>gb:CEF56A12_1364572 Caenorhabditis elegans cosmid F56A12, complete
           sequence.
          Length = 335

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 17/51 (33%), Positives = 32/51 (62%), Gaps = 1/51 (1%)
 Frame = -2

Query: 297 KHTYTASLSAGTISGAFTKSHIS-LICAATSPPGPRSSGIINSTSLIATPA 148
           ++T+T+S ++ T + + + SHIS    ++  PP   SS I+  +S+I TP+
Sbjct: 24  QYTFTSSSNSNTSNSSTSPSHISDQFSSSGGPPYELSSHILTPSSVIPTPS 74



>gb:AY060257_1292169 Drosophila melanogaster GH08308 full length
           cDNA.
          Length = 427

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 18/50 (36%), Positives = 22/50 (44%)
 Frame = -1

Query: 373 SAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPH 224
           +A ++ Q+ H  H    H  HQ H Q H H QP     Q  L   PH  H
Sbjct: 196 AAASVAQHQHQSHPHSHHHHHQNHHQ-HPHQQPA---TQTALRSPPHSDH 241



>gb:AY047554_1289513 Drosophila melanogaster GH06265 full length
           cDNA.
          Length = 1478

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 6/53 (11%)
 Frame = -1

Query: 322 HEKHQRH-----SQAHIHGQPERRNDQR-RLHQIPHQPHLRRHVPSRPPELRH 182
           H+ HQ+H      Q H+H Q  + + Q+ +  Q+PH   L+ H P  P    H
Sbjct: 23  HQNHQQHHAGHHQQQHMHHQHHQNHHQQLQQQQLPHLHTLQLHGPPSPCPSEH 75



>gb:CR749302_1180931 Homo sapiens mRNA; cDNA DKFZp779H1622 (from
           clone DKFZp779H1622).
          Length = 312

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 16/49 (32%), Positives = 22/49 (44%)
 Frame = -1

Query: 370 AENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPH 224
           + N + +D +PH    HE+H      H H   E  +D  R H   H PH
Sbjct: 128 SHNNNSSDLHPHKHHSHEQHPHGHHPHAHHPHE--HDTHRQHPHGHHPH 174



>gb:AE014297_1139732 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003708_1221725 Drosophila melanogaster
           chromosome 3R, section 46 of 118 of the complete
           sequence.
          Length = 943

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 24/85 (28%), Positives = 37/85 (43%), Gaps = 4/85 (4%)
 Frame = -1

Query: 337 HIKPLHEKHQR--HSQAHIHGQPERRNDQRRLHQI--PHQPHLRRHVPSRPPELRHHQLN 170
           H+   H+  Q+  H Q   H Q + +  Q++ HQ+  PHQPH  R  PS PP        
Sbjct: 277 HMLQQHQLQQQLQHQQQQQH-QQQLQQQQQQHHQLAHPHQPHTPR--PSTPPTTAQQIHI 333

Query: 169 LINRHPRHYYYF*KQFTPPSYSETE 95
              +H        +Q   PS+ + +
Sbjct: 334 TATQHQAAQQQLHQQQQQPSHKQQQ 358



>gb:AE014296_1136178 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003536_1214472 Drosophila melanogaster
           chromosome 3L, section 49 of 83 of the complete
           sequence.
          Length = 231

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 19/85 (22%), Positives = 31/85 (36%), Gaps = 6/85 (7%)
 Frame = -1

Query: 382 LRLSAENLDQNDHNPHIKPLHEK------HQRHSQAHIHGQPERRNDQRRLHQIPHQPHL 221
           L+   +     D   H +   E+      H+   + H H    R + ++  HQ  HQ H 
Sbjct: 140 LQREQQQQHHRDRQQHFREQREQREREYQHEHEHEQHHHHHHHREHHEQHQHQHGHQHH- 198

Query: 220 RRHVPSRPPELRHHQLNLINRHPRH 146
                  P    HHQ +   +H R+
Sbjct: 199 -------PQHQHHHQYSSQQQHQRY 216



>gb:AE013599_1131780 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003816_1225953 Drosophila melanogaster
           chromosome 2R, section 34 of 74 of the complete
           sequence.
          Length = 1843

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 6/53 (11%)
 Frame = -1

Query: 322 HEKHQRH-----SQAHIHGQPERRNDQR-RLHQIPHQPHLRRHVPSRPPELRH 182
           H+ HQ+H      Q H+H Q  + + Q+ +  Q+PH   L+ H P  P    H
Sbjct: 388 HQNHQQHHAGHHQQQHMHHQHHQNHHQQLQQQQLPHLHTLQLHGPPSPCPSEH 440



>gb:AE014188_968286 Plasmodium falciparum 3D7 chromosome 12, complete
            sequence.>gb:AE014852_1229678 Plasmodium falciparum 3D7
            chromosome 12, section 9 of 9 of the complete sequence.
          Length = 3119

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 20/74 (27%), Positives = 31/74 (41%)
 Frame = -1

Query: 367  ENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPEL 188
            +++DQ+DH+      H  H  H   H +   +  N     H I HQ H   H+      +
Sbjct: 863  QHMDQHDHHIDHHNHHIDHHNHHIDHHNHHIDHHN-----HHIDHQDH---HIDHHNHHI 914

Query: 187  RHHQLNLINRHPRH 146
             HH  + I+ H  H
Sbjct: 915  DHHN-HHIDHHDHH 927



>gb:AE014187_938617 Plasmodium falciparum 3D7 chromosome 14 complete
            sequence.>gb:AE014818_1227693 Plasmodium falciparum 3D7
            chromosome 14 section 3 of 13 of the complete sequence.
          Length = 1474

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 18/72 (25%), Positives = 29/72 (40%)
 Frame = -1

Query: 358  DQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHH 179
            + N HN H     + H  H   H H Q +++  Q++  Q  H PH   H  +      + 
Sbjct: 1238 NMNHHNQH-----QHHHLHPHQHHHHQQQQQQQQQQ--QTHHHPHTHTHTHTHQMYHDNR 1290

Query: 178  QLNLINRHPRHY 143
            +   IN    +Y
Sbjct: 1291 KNTSINNDKNNY 1302



>gb:BX936398_837302 Yersinia pseudotuberculosis IP32953 genome,
            complete sequence.
          Length = 970

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 22/67 (32%), Positives = 28/67 (41%), Gaps = 2/67 (2%)
 Frame = -1

Query: 340  PHIKPLHEKHQRHSQAHIHGQPER-RNDQRRLHQIPHQPHLRRHVPSR-PPELRHHQLNL 167
            P  K  H + QRH Q   H Q +R R  QR   +  H+   R     R   + RH +   
Sbjct: 870  PRRKQRHRQKQRHRQKQRHRQKQRHRQRQRHRRKQRHRQRQRHRQRQRHRRKQRHRRKQR 929

Query: 166  INRHPRH 146
              R PRH
Sbjct: 930  HRRKPRH 936



>gb:BX571964_789771 Rhodopseudomonas palustris CGA009 plasmid pRPA.
          Length = 192

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 24/65 (36%), Positives = 31/65 (47%)
 Frame = -1

Query: 364 NLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELR 185
           +LDQ    PH      +HQR  +AH   +   R  QRR    PH+ HLR+       E  
Sbjct: 113 HLDQRQQPPH----GHQHQR-DRAHRQWRRHHRQQQRR----PHRQHLRK---CGGGEWW 160

Query: 184 HHQLN 170
           HHQL+
Sbjct: 161 HHQLH 165



>pir|A32372|A32372 female-specific doublesex protein - fruit fly
           (Drosophila melanogaster)>gb:AE014297_1138396 Drosophila
           melanogaster chromosome 3R, complete
           sequence.>gb:AE014297_1138397 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003676_1220389
           Drosophila melanogaster chromosome 3R, section 14 of 118
           of the complete sequence.>gb:AE003676_1220390 Drosophila
           melanogaster chromosome 3R, section 14 of 118 of the
           complete sequence.
          Length = 427

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 18/50 (36%), Positives = 22/50 (44%)
 Frame = -1

Query: 373 SAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPH 224
           +A ++ Q+ H  H    H  HQ H Q H H QP     Q  L   PH  H
Sbjct: 196 AAASVAQHQHQSHPHSHHHHHQNHHQ-HPHQQPA---TQTALRSPPHSDH 241



>pir|T22761|T22761 hypothetical protein F56A12.1 - Caenorhabditis
           elegans
          Length = 348

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 17/51 (33%), Positives = 32/51 (62%), Gaps = 1/51 (1%)
 Frame = -2

Query: 297 KHTYTASLSAGTISGAFTKSHIS-LICAATSPPGPRSSGIINSTSLIATPA 148
           ++T+T+S ++ T + + + SHIS    ++  PP   SS I+  +S+I TP+
Sbjct: 24  QYTFTSSSNSNTSNSSTSPSHISDQFSSSGGPPYELSSHILTPSSVIPTPS 74



>pir|T18414|T18414 protein g377 - malaria parasite (Plasmodium
            falciparum)>gb:PFAGAMSPEC_1393772 Plasmodium falciparum
            (clone Pfg377 [PfsXLX]) DNA sequence, complete cds.
          Length = 3119

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 20/74 (27%), Positives = 31/74 (41%)
 Frame = -1

Query: 367  ENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPEL 188
            +++DQ+DH+      H  H  H   H +   +  N     H I HQ H   H+      +
Sbjct: 863  QHMDQHDHHIDHHNHHIDHHNHHIDHHNHHIDHHN-----HHIDHQDH---HIDHHNHHI 914

Query: 187  RHHQLNLINRHPRH 146
             HH  + I+ H  H
Sbjct: 915  DHHN-HHIDHHDHH 927



>pir|T51023|T51023 hypothetical protein B7F21.40 [imported] -
           Neurospora crassa
          Length = 2649

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 23/81 (28%), Positives = 28/81 (34%), Gaps = 14/81 (17%)
 Frame = -1

Query: 313 HQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPP--------------ELRHHQ 176
           H  H   H H     R+D      +PH  HL    PS PP               L HH 
Sbjct: 5   HHHHHHHHHHQDNHHRHDH-----VPHPRHLATTSPSYPPLPPPPPPPPPPPSLPLPHHH 59

Query: 175 LNLINRHPRHYYYF*KQFTPP 113
               NR P +++    Q  PP
Sbjct: 60  RGQHNRTPSYHH---SQHYPP 77



>sp|Q05738|SRY_MOUSE Sex-determining region Y protein
           (Testis-determining factor).>pir|S43344|S43344
           sex-determining protein Sry - mouse>pir|S35565|S35565
           sex-determining protein SRY - mouse>gb:MMSRYLOC_2117453
           Mus musculus Sry gene for sex determining region of Y
           protein.>gb:MMU70655_2123291 Mus musculus sex
           determining protein (Sry) gene, complete
           cds.>gb:MMU70656_2123292 Mus musculus sex determining
           protein (Sry) gene, complete cds.
          Length = 395

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 2/61 (3%)
 Frame = -1

Query: 352 NDHNPHIKP--LHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPHLRRHVPSRPPELRHH 179
           +DH+ H +    H+ HQ+  Q H H Q +++  Q++ H   HQ   + H      +  HH
Sbjct: 203 HDHHHHHQEQQFHDHHQQQQQFHDHQQQQQQQQQQQFHD-HHQQKQQFH------DHHHH 255

Query: 178 Q 176
           Q
Sbjct: 256 Q 256



>sp|P04196|HRG_HUMAN Histidine-rich glycoprotein precursor
           (Histidine-proline rich glycoprotein)
           (HPRG).>pir|A01287|KGHUGH histidine-rich glycoprotein
           precursor - human>gb:AB005803_1863812 Homo sapiens DNA
           for histidine-rich glycoprotein, complete
           cds.>gb:BC069574_1988176 Homo sapiens histidine-rich
           glycoprotein, mRNA (cDNA clone MGC:97078 IMAGE:7262290),
           complete cds.>gb:HUMHRGA_2032177 Human histidine-rich
           glycoprotein mRNA, complete cds.
          Length = 525

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 16/49 (32%), Positives = 22/49 (44%)
 Frame = -1

Query: 370 AENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPH 224
           + N + +D +PH    HE+H      H H   E  +D  R H   H PH
Sbjct: 341 SHNNNSSDLHPHKHHSHEQHPHGHHPHAHHPHE--HDTHRQHPHGHHPH 387



>sp|P23023|DSX_DROME Doublesex protein.>pir|B32372|B32372
           male-specific doublesex protein - fruit fly (Drosophila
           melanogaster)>gb:AE014297_1138395 Drosophila
           melanogaster chromosome 3R, complete
           sequence.>gb:AE003676_1220388 Drosophila melanogaster
           chromosome 3R, section 14 of 118 of the complete
           sequence.
          Length = 549

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 18/50 (36%), Positives = 22/50 (44%)
 Frame = -1

Query: 373 SAENLDQNDHNPHIKPLHEKHQRHSQAHIHGQPERRNDQRRLHQIPHQPH 224
           +A ++ Q+ H  H    H  HQ H Q H H QP     Q  L   PH  H
Sbjct: 196 AAASVAQHQHQSHPHSHHHHHQNHHQ-HPHQQPA---TQTALRSPPHSDH 241


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 568,836,528
Number of Sequences: 1806583
Number of extensions: 11465388
Number of successful extensions: 38846
Number of sequences better than 10.0: 220
Number of HSP's better than 10.0 without gapping: 34950
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37845
length of database: 581,917,975
effective HSP length: 116
effective length of database: 372,354,347
effective search space used: 22713615167
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)