BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF053O09

Length=860
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011084898.1|  PREDICTED: protein ESKIMO 1-like                   412   2e-140   
ref|XP_006338826.1|  PREDICTED: uncharacterized protein LOC102595587    412   2e-139   Solanum tuberosum [potatoes]
emb|CDP14002.1|  unnamed protein product                                410   2e-138   Coffea canephora [robusta coffee]
ref|XP_004240931.1|  PREDICTED: protein ESKIMO 1-like                   410   2e-138   Solanum lycopersicum
ref|XP_002311231.2|  hypothetical protein POPTR_0008s06990g             411   4e-138   Populus trichocarpa [western balsam poplar]
ref|XP_011076679.1|  PREDICTED: protein ESKIMO 1-like                   412   4e-138   Sesamum indicum [beniseed]
ref|XP_009611478.1|  PREDICTED: protein ESKIMO 1-like                   409   2e-137   Nicotiana tomentosiformis
ref|XP_011085127.1|  PREDICTED: protein ESKIMO 1                        408   4e-137   
gb|ABK92679.1|  unknown                                                 396   2e-136   Populus trichocarpa [western balsam poplar]
ref|XP_007219006.1|  hypothetical protein PRUPE_ppa004236mg             407   6e-136   
gb|EYU26798.1|  hypothetical protein MIMGU_mgv1a004986mg                406   7e-136   Erythranthe guttata [common monkey flower]
ref|XP_009345074.1|  PREDICTED: protein ESKIMO 1-like                   406   8e-136   Pyrus x bretschneideri [bai li]
ref|XP_009369181.1|  PREDICTED: protein ESKIMO 1-like                   406   1e-135   Pyrus x bretschneideri [bai li]
ref|XP_008369267.1|  PREDICTED: protein ESKIMO 1-like                   405   3e-135   Malus domestica [apple tree]
ref|XP_008233772.1|  PREDICTED: protein ESKIMO 1-like                   404   3e-135   Prunus mume [ume]
ref|XP_006356462.1|  PREDICTED: uncharacterized protein LOC102604440    401   2e-134   Solanum tuberosum [potatoes]
ref|XP_006486305.1|  PREDICTED: protein YLS7-like isoform X2            401   2e-134   Citrus sinensis [apfelsine]
ref|XP_006435757.1|  hypothetical protein CICLE_v10031403mg             401   2e-134   Citrus clementina [clementine]
ref|XP_009760656.1|  PREDICTED: protein ESKIMO 1-like                   402   2e-134   Nicotiana sylvestris
ref|XP_004307653.1|  PREDICTED: protein ESKIMO 1-like                   402   2e-134   Fragaria vesca subsp. vesca
gb|EYU20027.1|  hypothetical protein MIMGU_mgv1a005444mg                401   3e-134   Erythranthe guttata [common monkey flower]
ref|XP_008374091.1|  PREDICTED: protein ESKIMO 1-like                   400   1e-133   
gb|KFK34842.1|  hypothetical protein AALP_AA5G200300                    399   1e-133   Arabis alpina [alpine rockcress]
ref|XP_008374103.1|  PREDICTED: protein ESKIMO 1                        399   1e-133   
ref|XP_009785177.1|  PREDICTED: protein ESKIMO 1-like                   399   1e-133   Nicotiana sylvestris
ref|XP_002316205.2|  hypothetical protein POPTR_0010s19490g             399   2e-133   
ref|XP_011035919.1|  PREDICTED: protein ESKIMO 1-like isoform X2        396   1e-132   Populus euphratica
ref|XP_004235241.1|  PREDICTED: protein ESKIMO 1                        396   1e-132   Solanum lycopersicum
ref|XP_011035918.1|  PREDICTED: protein ESKIMO 1-like isoform X1        397   2e-132   Populus euphratica
ref|XP_009611970.1|  PREDICTED: protein ESKIMO 1-like                   396   2e-132   Nicotiana tomentosiformis
ref|XP_004170366.1|  PREDICTED: uncharacterized protein LOC101231933    386   4e-132   
ref|XP_010689520.1|  PREDICTED: protein ESKIMO 1                        395   7e-132   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB76205.1|  hypothetical protein B456_012G077200                    394   2e-131   Gossypium raimondii
ref|XP_002876345.1|  hypothetical protein ARALYDRAFT_907033             394   2e-131   Arabidopsis lyrata subsp. lyrata
emb|CDX67630.1|  BnaA07g16700D                                          392   2e-131   
ref|XP_010504475.1|  PREDICTED: protein ESKIMO 1 isoform X1             394   2e-131   Camelina sativa [gold-of-pleasure]
ref|XP_010427403.1|  PREDICTED: protein ESKIMO 1-like                   394   3e-131   Camelina sativa [gold-of-pleasure]
ref|XP_010516197.1|  PREDICTED: protein ESKIMO 1-like                   394   4e-131   Camelina sativa [gold-of-pleasure]
ref|XP_009103977.1|  PREDICTED: protein ESKIMO 1                        394   4e-131   Brassica rapa
ref|XP_010031198.1|  PREDICTED: protein ESKIMO 1                        393   5e-131   Eucalyptus grandis [rose gum]
dbj|BAC43257.1|  unknown protein                                        392   6e-131   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191158.1|  protein ESKIMO 1                                      392   7e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290951.1|  hypothetical protein CARUB_v10017067mg             392   1e-130   Capsella rubella
gb|KHG17448.1|  CAS1 domain-containing 1                                392   1e-130   Gossypium arboreum [tree cotton]
ref|XP_008441472.1|  PREDICTED: protein ESKIMO 1-like isoform X2        391   2e-130   Cucumis melo [Oriental melon]
ref|XP_008441471.1|  PREDICTED: protein ESKIMO 1-like isoform X1        392   2e-130   Cucumis melo [Oriental melon]
ref|XP_004138419.1|  PREDICTED: uncharacterized protein LOC101203137    391   4e-130   Cucumis sativus [cucumbers]
emb|CDY54603.1|  BnaA05g28590D                                          390   6e-130   Brassica napus [oilseed rape]
ref|XP_009116293.1|  PREDICTED: protein ESKIMO 1                        390   9e-130   Brassica rapa
emb|CDX72182.1|  BnaC08g26920D                                          390   1e-129   
ref|XP_007008938.1|  Uncharacterized protein isoform 1                  390   1e-129   Theobroma cacao [chocolate]
ref|XP_006403037.1|  hypothetical protein EUTSA_v10005901mg             390   2e-129   Eutrema salsugineum [saltwater cress]
ref|XP_002528302.1|  conserved hypothetical protein                     386   1e-128   
gb|KDP44749.1|  hypothetical protein JCGZ_01249                         387   1e-128   Jatropha curcas
ref|XP_010534605.1|  PREDICTED: protein ESKIMO 1-like                   387   2e-128   Tarenaya hassleriana [spider flower]
ref|XP_010101431.1|  hypothetical protein L484_007686                   385   3e-128   Morus notabilis
ref|XP_003616659.1|  hypothetical protein MTR_5g082880                  386   4e-128   Medicago truncatula
emb|CDY46514.1|  BnaC06g15710D                                          385   1e-127   Brassica napus [oilseed rape]
ref|XP_010554669.1|  PREDICTED: protein ESKIMO 1-like                   385   1e-127   Tarenaya hassleriana [spider flower]
ref|XP_004491027.1|  PREDICTED: uncharacterized protein LOC101515...    382   6e-127   
ref|XP_004491026.1|  PREDICTED: uncharacterized protein LOC101515...    383   7e-127   Cicer arietinum [garbanzo]
ref|XP_006355651.1|  PREDICTED: uncharacterized protein LOC102582426    379   2e-126   
ref|XP_007141755.1|  hypothetical protein PHAVU_008G223000g             382   2e-126   Phaseolus vulgaris [French bean]
gb|KHN48573.1|  hypothetical protein glysoja_034196                     382   2e-126   Glycine soja [wild soybean]
gb|KHN20838.1|  hypothetical protein glysoja_009146                     374   6e-126   Glycine soja [wild soybean]
emb|CBI25464.3|  unnamed protein product                                376   8e-126   Vitis vinifera
ref|XP_009607785.1|  PREDICTED: protein ESKIMO 1-like                   378   2e-125   Nicotiana tomentosiformis
ref|XP_002269697.1|  PREDICTED: protein ESKIMO 1 isoform X1             379   2e-125   Vitis vinifera
ref|XP_010658261.1|  PREDICTED: protein ESKIMO 1 isoform X2             378   2e-125   Vitis vinifera
ref|XP_009771554.1|  PREDICTED: protein ESKIMO 1-like                   374   3e-124   Nicotiana sylvestris
ref|XP_004240227.2|  PREDICTED: protein ESKIMO 1-like isoform X1        374   4e-124   Solanum lycopersicum
gb|KJB77004.1|  hypothetical protein B456_012G116300                    375   7e-124   Gossypium raimondii
gb|KHG01595.1|  CAS1 domain-containing 1                                374   1e-123   Gossypium arboreum [tree cotton]
ref|XP_010536111.1|  PREDICTED: protein ESKIMO 1-like isoform X2        372   2e-123   
gb|KJB78764.1|  hypothetical protein B456_013G017400                    372   3e-123   Gossypium raimondii
ref|XP_010536034.1|  PREDICTED: protein ESKIMO 1-like isoform X1        372   3e-123   
gb|KHG25684.1|  CAS1 domain-containing 1                                371   6e-123   Gossypium arboreum [tree cotton]
ref|XP_008792924.1|  PREDICTED: protein ESKIMO 1-like                   374   6e-123   Phoenix dactylifera
ref|XP_011048734.1|  PREDICTED: protein ESKIMO 1-like isoform X1        371   2e-122   Populus euphratica
ref|XP_009772255.1|  PREDICTED: protein ESKIMO 1-like                   369   3e-122   Nicotiana sylvestris
ref|XP_003552838.1|  PREDICTED: protein YLS7-like                       370   3e-122   Glycine max [soybeans]
gb|KHN31286.1|  hypothetical protein glysoja_022940                     370   3e-122   Glycine soja [wild soybean]
ref|XP_009621734.1|  PREDICTED: protein ESKIMO 1-like                   370   4e-122   Nicotiana tomentosiformis
ref|XP_003600921.1|  hypothetical protein MTR_3g070900                  368   7e-122   Medicago truncatula
ref|XP_004500499.1|  PREDICTED: uncharacterized protein LOC101501...    368   2e-121   
ref|XP_004500498.1|  PREDICTED: uncharacterized protein LOC101501...    368   2e-121   Cicer arietinum [garbanzo]
ref|XP_010253784.1|  PREDICTED: protein ESKIMO 1-like                   368   2e-121   Nelumbo nucifera [Indian lotus]
ref|XP_009409562.1|  PREDICTED: protein trichome birefringence-li...    368   4e-121   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010920820.1|  PREDICTED: protein ESKIMO 1-like                   362   2e-118   Elaeis guineensis
gb|KCW50459.1|  hypothetical protein EUGRSUZ_J00196                     359   5e-118   Eucalyptus grandis [rose gum]
ref|XP_010937876.1|  PREDICTED: protein ESKIMO 1-like                   360   7e-118   Elaeis guineensis
ref|XP_009399893.1|  PREDICTED: protein ESKIMO 1-like                   358   1e-117   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010264604.1|  PREDICTED: protein ESKIMO 1-like                   361   2e-117   Nelumbo nucifera [Indian lotus]
ref|XP_008789130.1|  PREDICTED: protein ESKIMO 1                        358   5e-117   Phoenix dactylifera
ref|XP_009414283.1|  PREDICTED: protein ESKIMO 1-like                   357   5e-117   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006411268.1|  hypothetical protein EUTSA_v10016723mg             353   2e-116   Eutrema salsugineum [saltwater cress]
gb|EPS63212.1|  hypothetical protein M569_11574                         353   3e-116   Genlisea aurea
ref|XP_006843597.1|  hypothetical protein AMTR_s00007p00131340          355   7e-115   Amborella trichopoda
ref|XP_010517431.1|  PREDICTED: protein trichome birefringence-li...    349   1e-114   Camelina sativa [gold-of-pleasure]
emb|CDY24925.1|  BnaC03g22470D                                          348   2e-114   Brassica napus [oilseed rape]
ref|XP_009133414.1|  PREDICTED: protein trichome birefringence-li...    347   7e-114   Brassica rapa
ref|XP_010505740.1|  PREDICTED: protein trichome birefringence-li...    346   3e-113   Camelina sativa [gold-of-pleasure]
ref|XP_010508898.1|  PREDICTED: protein trichome birefringence-li...    345   3e-113   Camelina sativa [gold-of-pleasure]
gb|KFK36902.1|  hypothetical protein AALP_AA4G187700                    343   1e-112   Arabis alpina [alpine rockcress]
ref|XP_002316204.1|  hypothetical protein POPTR_0010s19480g             342   2e-112   
ref|XP_011035916.1|  PREDICTED: protein ESKIMO 1-like isoform X1        342   3e-112   Populus euphratica
ref|XP_006295728.1|  hypothetical protein CARUB_v10024847mg             342   6e-112   Capsella rubella
ref|NP_030560.1|  trichome birefringence-like 28 protein                342   9e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007008937.1|  Uncharacterized protein TCM_046947                 340   3e-111   
ref|XP_009380702.1|  PREDICTED: protein trichome birefringence-li...    342   4e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002879849.1|  hypothetical protein ARALYDRAFT_483061             337   2e-110   
ref|XP_007008939.1|  Uncharacterized protein isoform 2                  338   1e-109   
ref|XP_002528303.1|  conserved hypothetical protein                     334   6e-109   Ricinus communis
ref|XP_009406878.1|  PREDICTED: protein trichome birefringence-li...    333   4e-107   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB77003.1|  hypothetical protein B456_012G116200                    328   2e-106   Gossypium raimondii
gb|KDP44747.1|  hypothetical protein JCGZ_01247                         327   3e-106   Jatropha curcas
ref|XP_003558153.1|  PREDICTED: protein trichome birefringence-li...    328   8e-105   Brachypodium distachyon [annual false brome]
ref|XP_002528304.1|  conserved hypothetical protein                     323   3e-104   Ricinus communis
ref|XP_002468038.1|  hypothetical protein SORBIDRAFT_01g038450          323   5e-103   Sorghum bicolor [broomcorn]
gb|EMT15412.1|  hypothetical protein F775_14841                         318   7e-103   
ref|XP_004984857.1|  PREDICTED: uncharacterized protein LOC101774323    322   1e-102   Setaria italica
gb|EEE58859.1|  hypothetical protein OsJ_10454                          321   1e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649910.1|  PREDICTED: protein YLS7-like                       322   2e-102   Oryza brachyantha
gb|ABF95402.1|  expressed protein                                       322   3e-102   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049800.1|  Os03g0291800                                       322   3e-102   
ref|XP_009384920.1|  PREDICTED: protein trichome birefringence-li...    317   2e-101   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO36034.1|  hypothetical protein CISIN_1g038968mg                   307   3e-101   Citrus sinensis [apfelsine]
ref|XP_011095058.1|  PREDICTED: protein ESKIMO 1-like                   315   3e-101   Sesamum indicum [beniseed]
dbj|BAK06255.1|  predicted protein                                      318   5e-101   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP44746.1|  hypothetical protein JCGZ_01246                         310   5e-101   Jatropha curcas
gb|KJB76209.1|  hypothetical protein B456_012G077500                    312   3e-100   Gossypium raimondii
gb|KFK36903.1|  hypothetical protein AALP_AA4G187800                    311   4e-100   Arabis alpina [alpine rockcress]
ref|XP_006655224.1|  PREDICTED: protein YLS7-like                       305   6e-99    
ref|XP_002311232.2|  hypothetical protein POPTR_0008s07000g             309   7e-99    Populus trichocarpa [western balsam poplar]
ref|XP_002316203.2|  hypothetical protein POPTR_0010s19460g             310   9e-99    
ref|XP_004958797.1|  PREDICTED: uncharacterized protein LOC101786797    310   1e-98    Setaria italica
dbj|BAJ91172.1|  predicted protein                                      309   2e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011035915.1|  PREDICTED: protein trichome birefringence-li...    308   3e-98    Populus euphratica
dbj|BAJ96952.1|  predicted protein                                      309   3e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011048808.1|  PREDICTED: protein ESKIMO 1-like isoform X2        307   4e-98    Populus euphratica
gb|EEE63378.1|  hypothetical protein OsJ_18190                          308   5e-98    Oryza sativa Japonica Group [Japonica rice]
gb|EMS47917.1|  hypothetical protein TRIUR3_14971                       302   2e-97    Triticum urartu
ref|XP_009402384.1|  PREDICTED: protein ESKIMO 1-like                   308   5e-97    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY07619.1|  BnaA03g18920D                                          314   6e-97    Brassica napus [oilseed rape]
ref|XP_008654511.1|  PREDICTED: protein trichome birefringence-li...    306   2e-96    Zea mays [maize]
ref|XP_006435758.1|  hypothetical protein CICLE_v10033614mg             300   4e-96    
gb|ACG46935.1|  hypothetical protein                                    304   6e-96    Zea mays [maize]
ref|NP_001130739.1|  putative DUF231 domain containing family pro...    304   6e-96    Zea mays [maize]
gb|KDO68937.1|  hypothetical protein CISIN_1g047865mg                   299   8e-96    Citrus sinensis [apfelsine]
ref|XP_008805163.1|  PREDICTED: protein ESKIMO 1-like                   300   1e-95    Phoenix dactylifera
ref|XP_006486529.1|  PREDICTED: protein YLS7-like                       300   1e-95    Citrus sinensis [apfelsine]
ref|XP_004962376.1|  PREDICTED: uncharacterized protein LOC101758227    302   3e-95    Setaria italica
gb|KDP44745.1|  hypothetical protein JCGZ_01245                         297   4e-95    Jatropha curcas
ref|XP_002440930.1|  hypothetical protein SORBIDRAFT_09g017080          301   9e-95    Sorghum bicolor [broomcorn]
ref|NP_001142969.1|  uncharacterized protein LOC100275422               299   5e-94    Zea mays [maize]
ref|XP_008655378.1|  PREDICTED: uncharacterized protein LOC100501...    296   6e-93    
ref|XP_002463443.1|  hypothetical protein SORBIDRAFT_02g043950          296   1e-92    Sorghum bicolor [broomcorn]
ref|XP_006659001.1|  PREDICTED: protein YLS7-like                       292   1e-91    Oryza brachyantha
gb|EAZ14031.1|  hypothetical protein OsJ_03957                          289   3e-91    Oryza sativa Japonica Group [Japonica rice]
gb|EYU41940.1|  hypothetical protein MIMGU_mgv1a019959mg                287   5e-91    Erythranthe guttata [common monkey flower]
ref|XP_006654530.1|  PREDICTED: protein YLS7-like                       290   7e-91    Oryza brachyantha
ref|XP_010922575.1|  PREDICTED: protein trichome birefringence-li...    286   4e-90    Elaeis guineensis
gb|EAY76370.1|  hypothetical protein OsI_04301                          288   7e-90    Oryza sativa Indica Group [Indian rice]
ref|NP_001044698.1|  Os01g0830700                                       288   7e-90    
ref|XP_009399999.1|  PREDICTED: protein trichome birefringence-li...    288   9e-90    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDM82949.1|  unnamed protein product                                287   3e-89    Triticum aestivum [Canadian hard winter wheat]
ref|XP_003564532.1|  PREDICTED: protein trichome birefringence-li...    287   4e-89    Brachypodium distachyon [annual false brome]
dbj|BAC75569.1|  leaf senescence related protein-like                   285   1e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006378655.1|  hypothetical protein POPTR_0010s19470g             280   3e-88    
dbj|BAK02998.1|  predicted protein                                      278   2e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC82737.1|  hypothetical protein OsI_27441                          284   2e-87    Oryza sativa Indica Group [Indian rice]
ref|NP_001060731.1|  Os07g0693600                                       284   2e-87    
ref|NP_001168900.1|  uncharacterized protein LOC100382706               282   2e-87    Zea mays [maize]
ref|XP_004970448.1|  PREDICTED: uncharacterized protein LOC101759...    282   4e-87    
ref|XP_010233574.1|  PREDICTED: protein trichome birefringence-li...    281   6e-87    Brachypodium distachyon [annual false brome]
ref|XP_004970447.1|  PREDICTED: uncharacterized protein LOC101759...    281   7e-87    Setaria italica
ref|XP_007008936.1|  Uncharacterized protein TCM_042483                 278   2e-86    
ref|XP_002456582.1|  hypothetical protein SORBIDRAFT_03g038800          280   2e-86    Sorghum bicolor [broomcorn]
ref|XP_009397099.1|  PREDICTED: protein trichome birefringence-li...    278   2e-86    Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC79381.1|  hypothetical protein OsI_20293                          277   7e-86    Oryza sativa Indica Group [Indian rice]
gb|AAV43889.1|  unknown protein                                         277   9e-86    Oryza sativa Japonica Group [Japonica rice]
gb|EEE64048.1|  hypothetical protein OsJ_18877                          276   3e-85    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001055807.1|  Os05g0470000                                       276   3e-85    
ref|XP_006644950.1|  PREDICTED: protein YLS7-like                       274   2e-84    Oryza brachyantha
ref|XP_009400772.1|  PREDICTED: protein trichome birefringence-li...    273   5e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009396865.1|  PREDICTED: protein trichome birefringence-li...    273   5e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001168546.1|  putative DUF231 domain containing family pro...    270   1e-83    Zea mays [maize]
gb|KHG17263.1|  Alanine--tRNA ligase                                    269   2e-83    Gossypium arboreum [tree cotton]
gb|KJB76206.1|  hypothetical protein B456_012G077300                    268   5e-83    Gossypium raimondii
ref|XP_004977644.1|  PREDICTED: uncharacterized protein LOC101777232    269   6e-83    Setaria italica
ref|XP_004978594.1|  PREDICTED: uncharacterized protein LOC101782500    269   6e-83    Setaria italica
ref|XP_002441664.1|  hypothetical protein SORBIDRAFT_08g000470          268   1e-82    Sorghum bicolor [broomcorn]
gb|EAY81960.1|  hypothetical protein OsI_37137                          267   2e-82    Oryza sativa Indica Group [Indian rice]
ref|NP_001065927.1|  Os12g0104700                                       267   2e-82    
dbj|BAJ99630.1|  predicted protein                                      266   4e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ93258.1|  predicted protein                                      266   6e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002879850.1|  hypothetical protein ARALYDRAFT_483062             265   8e-82    
ref|XP_002442440.1|  hypothetical protein SORBIDRAFT_08g020080          265   1e-81    Sorghum bicolor [broomcorn]
gb|KJB76211.1|  hypothetical protein B456_012G077600                    264   1e-81    Gossypium raimondii
gb|EEE52598.1|  hypothetical protein OsJ_34909                          264   3e-81    Oryza sativa Japonica Group [Japonica rice]
gb|EEC68689.1|  hypothetical protein OsI_37151                          264   7e-81    Oryza sativa Indica Group [Indian rice]
gb|KJB76212.1|  hypothetical protein B456_012G077600                    262   8e-81    Gossypium raimondii
ref|XP_006294274.1|  hypothetical protein CARUB_v10023271mg             262   1e-80    Capsella rubella
ref|XP_010534606.1|  PREDICTED: protein trichome birefringence-li...    261   4e-80    Tarenaya hassleriana [spider flower]
ref|NP_565924.1|  protein TRICHOME BIREFRINGENCE-LIKE 30                259   1e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003579057.1|  PREDICTED: protein trichome birefringence-li...    260   1e-79    Brachypodium distachyon [annual false brome]
ref|XP_008661696.1|  PREDICTED: protein trichome birefringence-li...    260   1e-79    Zea mays [maize]
gb|ACN29054.1|  unknown                                                 258   2e-79    Zea mays [maize]
gb|AFW64533.1|  putative DUF231 domain containing family protein        259   3e-79    
gb|ACG43011.1|  hypothetical protein                                    259   4e-79    Zea mays [maize]
ref|XP_008679315.1|  PREDICTED: protein trichome birefringence-li...    259   4e-79    
ref|NP_001189720.1|  protein TRICHOME BIREFRINGENCE-LIKE 30             258   4e-79    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001131868.1|  putative DUF231 domain containing family pro...    258   8e-79    Zea mays [maize]
gb|KJB76207.1|  hypothetical protein B456_012G077300                    255   4e-78    Gossypium raimondii
gb|KDP44744.1|  hypothetical protein JCGZ_01244                         251   3e-77    Jatropha curcas
ref|XP_002528307.1|  conserved hypothetical protein                     251   2e-76    Ricinus communis
emb|CDY24924.1|  BnaC03g22480D                                          250   3e-76    Brassica napus [oilseed rape]
gb|KHG12904.1|  DNA ligase                                              249   8e-76    Gossypium arboreum [tree cotton]
ref|XP_009133416.1|  PREDICTED: protein trichome birefringence-li...    248   3e-75    
ref|XP_006411269.1|  hypothetical protein EUTSA_v10016697mg             247   6e-75    Eutrema salsugineum [saltwater cress]
tpg|DAA47343.1|  TPA: putative DUF231 domain containing family pr...    248   1e-74    
gb|KHG07986.1|  Ferrochelatase                                          237   2e-74    Gossypium arboreum [tree cotton]
ref|XP_010517430.1|  PREDICTED: protein trichome birefringence-li...    245   3e-74    Camelina sativa [gold-of-pleasure]
ref|XP_010321451.1|  PREDICTED: protein ESKIMO 1-like isoform X2        244   6e-74    
ref|XP_010505739.1|  PREDICTED: protein trichome birefringence-li...    244   7e-74    Camelina sativa [gold-of-pleasure]
ref|NP_001055286.1|  Os05g0354400                                       248   9e-74    
ref|XP_010508900.1|  PREDICTED: protein trichome birefringence-li...    243   2e-73    Camelina sativa [gold-of-pleasure]
ref|XP_009133417.1|  PREDICTED: protein trichome birefringence-li...    240   2e-72    
ref|XP_004148615.1|  PREDICTED: uncharacterized protein LOC101212899    240   3e-72    Cucumis sativus [cucumbers]
gb|EPS65057.1|  hypothetical protein M569_09721                         236   4e-72    Genlisea aurea
gb|ABA91060.1|  expressed protein                                       242   4e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006429424.1|  hypothetical protein CICLE_v10011779mg             239   8e-72    Citrus clementina [clementine]
ref|XP_006481061.1|  PREDICTED: protein YLS7-like                       239   9e-72    Citrus sinensis [apfelsine]
gb|KDO56693.1|  hypothetical protein CISIN_1g014084mg                   239   1e-71    Citrus sinensis [apfelsine]
ref|XP_008464204.1|  PREDICTED: protein trichome birefringence-li...    238   1e-71    Cucumis melo [Oriental melon]
ref|XP_010999799.1|  PREDICTED: protein trichome birefringence-li...    238   2e-71    Populus euphratica
ref|XP_002323595.1|  hypothetical protein POPTR_0016s12660g             236   7e-71    Populus trichocarpa [western balsam poplar]
ref|XP_011004745.1|  PREDICTED: protein trichome birefringence-li...    236   1e-70    Populus euphratica
ref|XP_010037693.1|  PREDICTED: protein trichome birefringence-li...    236   1e-70    Eucalyptus grandis [rose gum]
ref|XP_011077543.1|  PREDICTED: protein trichome birefringence-li...    235   3e-70    Sesamum indicum [beniseed]
emb|CDP06464.1|  unnamed protein product                                234   4e-70    Coffea canephora [robusta coffee]
ref|XP_002532108.1|  conserved hypothetical protein                     233   8e-70    Ricinus communis
ref|XP_007205758.1|  hypothetical protein PRUPE_ppa010289mg             227   2e-69    
ref|XP_010253783.1|  PREDICTED: protein trichome birefringence-li...    233   3e-69    Nelumbo nucifera [Indian lotus]
ref|XP_006843601.1|  hypothetical protein AMTR_s00007p00135110          232   4e-69    
gb|KDP24428.1|  hypothetical protein JCGZ_24992                         229   4e-69    Jatropha curcas
ref|XP_009409561.1|  PREDICTED: protein trichome birefringence-li...    232   4e-69    Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU41920.1|  hypothetical protein MIMGU_mgv1a007164mg                231   6e-69    Erythranthe guttata [common monkey flower]
gb|EYU26676.1|  hypothetical protein MIMGU_mgv1a006839mg                231   9e-69    Erythranthe guttata [common monkey flower]
ref|XP_002263633.3|  PREDICTED: protein trichome birefringence-li...    232   1e-68    
ref|XP_010553106.1|  PREDICTED: protein trichome birefringence-li...    230   2e-68    Tarenaya hassleriana [spider flower]
ref|XP_008789128.1|  PREDICTED: protein trichome birefringence-li...    228   5e-68    
ref|XP_010505738.1|  PREDICTED: protein trichome birefringence-li...    229   5e-68    Camelina sativa [gold-of-pleasure]
ref|XP_008362345.1|  PREDICTED: protein trichome birefringence-li...    228   1e-67    Malus domestica [apple tree]
ref|XP_008388265.1|  PREDICTED: protein trichome birefringence-li...    228   2e-67    
ref|XP_008243452.1|  PREDICTED: protein trichome birefringence-li...    227   2e-67    Prunus mume [ume]
ref|XP_009338153.1|  PREDICTED: protein trichome birefringence-li...    227   3e-67    Pyrus x bretschneideri [bai li]
ref|XP_009348559.1|  PREDICTED: protein trichome birefringence-li...    227   3e-67    Pyrus x bretschneideri [bai li]
ref|XP_002870926.1|  hypothetical protein ARALYDRAFT_908019             226   5e-67    Arabidopsis lyrata subsp. lyrata
ref|XP_011095031.1|  PREDICTED: protein trichome birefringence-li...    226   7e-67    Sesamum indicum [beniseed]
gb|EAY97673.1|  hypothetical protein OsI_19595                          218   8e-67    Oryza sativa Indica Group [Indian rice]
ref|XP_010032111.1|  PREDICTED: protein trichome birefringence-li...    226   8e-67    
ref|XP_006398622.1|  hypothetical protein EUTSA_v10013592mg             226   9e-67    Eutrema salsugineum [saltwater cress]
ref|XP_009409560.1|  PREDICTED: protein trichome birefringence-li...    226   1e-66    
dbj|BAE99944.1|  hypothetical protein                                   226   1e-66    Arabidopsis thaliana [mouse-ear cress]
emb|CAB81919.1|  putative protein                                       224   1e-66    Arabidopsis thaliana [mouse-ear cress]
gb|KCW88139.1|  hypothetical protein EUGRSUZ_A00530                     226   1e-66    Eucalyptus grandis [rose gum]
ref|XP_009130658.1|  PREDICTED: protein trichome birefringence-li...    225   2e-66    Brassica rapa
emb|CDY11204.1|  BnaA03g00400D                                          225   2e-66    Brassica napus [oilseed rape]
ref|XP_010676766.1|  PREDICTED: protein trichome birefringence-li...    224   2e-66    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_568089.1|  protein TRICHOME BIREFRINGENCE-LIKE 3                 225   2e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009376430.1|  PREDICTED: protein trichome birefringence-li...    224   4e-66    Pyrus x bretschneideri [bai li]
ref|XP_009125424.1|  PREDICTED: protein trichome birefringence-li...    224   6e-66    Brassica rapa
ref|XP_006349533.1|  PREDICTED: uncharacterized protein LOC102582870    223   7e-66    Solanum tuberosum [potatoes]
ref|XP_010101390.1|  hypothetical protein L484_020405                   223   8e-66    Morus notabilis
gb|KDP44700.1|  hypothetical protein JCGZ_01200                         223   1e-65    Jatropha curcas
ref|XP_010490574.1|  PREDICTED: protein trichome birefringence-li...    223   1e-65    Camelina sativa [gold-of-pleasure]
ref|XP_004249070.1|  PREDICTED: protein trichome birefringence-li...    222   1e-65    Solanum lycopersicum
emb|CDX80776.1|  BnaC03g00300D                                          223   2e-65    
ref|XP_009795769.1|  PREDICTED: protein trichome birefringence-li...    223   2e-65    
emb|CDY72032.1|  BnaAnng39690D                                          223   2e-65    
ref|XP_010451996.1|  PREDICTED: protein trichome birefringence-li...    222   3e-65    
ref|XP_006287771.1|  hypothetical protein CARUB_v10000981mg             221   5e-65    
ref|XP_010937874.1|  PREDICTED: protein trichome birefringence-li...    220   1e-64    
ref|XP_010937873.1|  PREDICTED: protein trichome birefringence-li...    221   2e-64    
ref|XP_010558932.1|  PREDICTED: protein trichome birefringence-li...    220   2e-64    
ref|XP_002277384.2|  PREDICTED: protein trichome birefringence-li...    219   2e-64    
ref|XP_010423947.1|  PREDICTED: protein trichome birefringence-li...    219   3e-64    
ref|XP_009592552.1|  PREDICTED: protein trichome birefringence-li...    219   4e-64    
ref|XP_009592544.1|  PREDICTED: protein trichome birefringence-li...    219   5e-64    
ref|XP_004305123.1|  PREDICTED: protein trichome birefringence-li...    218   6e-64    
ref|XP_011466466.1|  PREDICTED: protein trichome birefringence-li...    218   6e-64    
emb|CAN83741.1|  hypothetical protein VITISV_031206                     218   7e-64    
gb|KCW88140.1|  hypothetical protein EUGRSUZ_A00530                     219   8e-64    
emb|CAN73526.1|  hypothetical protein VITISV_027513                     218   9e-64    
ref|XP_007026661.1|  Uncharacterized protein TCM_021670                 218   1e-63    
ref|XP_008804141.1|  PREDICTED: protein trichome birefringence-li...    218   1e-63    
ref|XP_002311248.1|  hypothetical protein POPTR_0008s07330g             217   2e-63    
ref|XP_011003291.1|  PREDICTED: protein trichome birefringence-li...    216   1e-62    
ref|XP_006852469.1|  hypothetical protein AMTR_s00021p00123440          214   2e-62    
ref|XP_010921030.1|  PREDICTED: protein trichome birefringence-li...    214   3e-62    
gb|KJB76971.1|  hypothetical protein B456_012G115400                    214   3e-62    
gb|KHG20482.1|  CAS1 domain-containing 1                                214   3e-62    
ref|XP_002520791.1|  conserved hypothetical protein                     214   3e-62    
ref|XP_006366946.1|  PREDICTED: uncharacterized protein LOC102588894    214   3e-62    
ref|XP_003529163.1|  PREDICTED: protein YLS7 isoform X1                 213   6e-62    
ref|XP_006583661.1|  PREDICTED: protein YLS7 isoform X2                 213   6e-62    
gb|ACF86113.1|  unknown                                                 213   8e-62    
ref|XP_007218045.1|  hypothetical protein PRUPE_ppa006124mg             213   8e-62    
gb|KDO50775.1|  hypothetical protein CISIN_1g023323mg                   208   1e-61    
ref|XP_007008859.1|  Trichome birefringence-like 33 isoform 4           209   1e-61    
ref|XP_004984855.1|  PREDICTED: uncharacterized protein LOC101773511    213   1e-61    
ref|NP_001049798.1|  Os03g0291200                                       212   2e-61    
ref|XP_010087540.1|  hypothetical protein L484_006946                   212   2e-61    
ref|XP_008233815.1|  PREDICTED: protein trichome birefringence-li...    213   2e-61    
ref|XP_004491007.1|  PREDICTED: uncharacterized protein LOC101508931    211   2e-61    
ref|XP_002468039.1|  hypothetical protein SORBIDRAFT_01g038470          210   3e-61    
ref|XP_006649909.1|  PREDICTED: protein YLS7-like                       211   3e-61    
ref|XP_007141732.1|  hypothetical protein PHAVU_008G220700g             211   3e-61    
ref|NP_001143927.1|  uncharacterized protein LOC100276738               211   4e-61    
gb|AFK48925.1|  unknown                                                 206   4e-61    
ref|XP_007008860.1|  Trichome birefringence-like 33                     211   4e-61    
ref|XP_006576523.1|  PREDICTED: protein YLS7-like                       211   5e-61    
ref|XP_011076649.1|  PREDICTED: protein trichome birefringence-li...    211   5e-61    
gb|KDO68853.1|  hypothetical protein CISIN_1g014836mg                   210   6e-61    
ref|XP_007008858.1|  Trichome birefringence-like 33 isoform 3           208   7e-61    
ref|XP_007008857.1|  Trichome birefringence-like 33 isoform 2           209   9e-61    
ref|XP_006353424.1|  PREDICTED: uncharacterized protein LOC102581323    209   1e-60    
gb|EPS70682.1|  hypothetical protein M569_04078                         209   1e-60    
ref|XP_006435817.1|  hypothetical protein CICLE_v10031656mg             209   1e-60    
ref|XP_004246750.1|  PREDICTED: protein trichome birefringence-li...    209   2e-60    
ref|XP_006828125.1|  hypothetical protein AMTR_s00023p00040670          209   2e-60    
emb|CAN66611.1|  hypothetical protein VITISV_017558                     209   2e-60    
ref|XP_010644139.1|  PREDICTED: protein trichome birefringence-li...    209   2e-60    
ref|XP_004172029.1|  PREDICTED: uncharacterized LOC101220068            207   2e-60    
ref|XP_010692926.1|  PREDICTED: protein trichome birefringence-li...    209   2e-60    
gb|KHN04788.1|  hypothetical protein glysoja_031888                     209   2e-60    
ref|XP_003538483.1|  PREDICTED: protein YLS7-like                       209   3e-60    
ref|XP_010031165.1|  PREDICTED: protein trichome birefringence-li...    208   3e-60    
ref|XP_010277749.1|  PREDICTED: protein trichome birefringence-li...    208   4e-60    
ref|XP_007140254.1|  hypothetical protein PHAVU_008G0968001g            205   4e-60    
ref|XP_004240907.1|  PREDICTED: protein trichome birefringence-li...    208   4e-60    
ref|XP_010554690.1|  PREDICTED: protein trichome birefringence-li...    209   5e-60    
ref|XP_009794597.1|  PREDICTED: protein trichome birefringence-li...    207   6e-60    
ref|XP_007008856.1|  Trichome birefringence-like 33 isoform 1           208   7e-60    
ref|XP_008454841.1|  PREDICTED: protein trichome birefringence-li...    207   7e-60    
ref|XP_004148170.1|  PREDICTED: uncharacterized protein LOC101220068    207   8e-60    
ref|XP_006430563.1|  hypothetical protein CICLE_v10011707mg             208   8e-60    
ref|XP_010264537.1|  PREDICTED: protein trichome birefringence-li...    207   9e-60    
ref|XP_006482087.1|  PREDICTED: protein YLS7-like isoform X1            208   1e-59    
ref|XP_007134784.1|  hypothetical protein PHAVU_010G075800g             207   1e-59    
ref|XP_009623098.1|  PREDICTED: protein trichome birefringence-li...    207   1e-59    
gb|EPS69484.1|  hypothetical protein M569_05282                         206   1e-59    
ref|XP_007211792.1|  hypothetical protein PRUPE_ppa006359mg             206   1e-59    
ref|XP_010921534.1|  PREDICTED: protein trichome birefringence-li...    205   2e-59    
gb|KHG29150.1|  CAS1 domain-containing 1                                207   2e-59    
ref|XP_009619687.1|  PREDICTED: protein trichome birefringence-li...    206   2e-59    
ref|XP_004294131.1|  PREDICTED: protein trichome birefringence-li...    206   2e-59    
ref|XP_008783901.1|  PREDICTED: protein trichome birefringence-li...    206   3e-59    
ref|XP_008345314.1|  PREDICTED: LOW QUALITY PROTEIN: protein tric...    202   3e-59    
ref|XP_010921532.1|  PREDICTED: protein trichome birefringence-li...    206   4e-59    
ref|XP_010031166.1|  PREDICTED: protein trichome birefringence-li...    206   4e-59    
ref|XP_003600979.1|  hypothetical protein MTR_3g071650                  206   4e-59    
ref|XP_010921533.1|  PREDICTED: protein trichome birefringence-li...    205   4e-59    
ref|XP_008226504.1|  PREDICTED: protein trichome birefringence-li...    205   5e-59    
ref|XP_010505759.1|  PREDICTED: protein trichome birefringence-li...    205   5e-59    
gb|KJB11209.1|  hypothetical protein B456_001G247300                    205   5e-59    
ref|XP_007021671.1|  F3N23.34 protein                                   205   6e-59    
gb|AES99651.2|  trichome birefringence-like protein                     205   7e-59    
gb|KJB67520.1|  hypothetical protein B456_010G194900                    204   8e-59    
ref|XP_010227750.1|  PREDICTED: protein trichome birefringence-li...    205   9e-59    
ref|XP_003604722.1|  hypothetical protein MTR_4g016940                  204   1e-58    
ref|XP_004506737.1|  PREDICTED: uncharacterized protein LOC101502585    204   1e-58    
gb|AES86919.2|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    204   1e-58    
gb|EYU20063.1|  hypothetical protein MIMGU_mgv1a005748mg                205   1e-58    
ref|XP_009795311.1|  PREDICTED: protein trichome birefringence-li...    204   1e-58    
ref|XP_009345399.1|  PREDICTED: protein trichome birefringence-li...    204   2e-58    
gb|EYU20062.1|  hypothetical protein MIMGU_mgv1a005748mg                205   2e-58    
gb|KDP32509.1|  hypothetical protein JCGZ_14712                         197   2e-58    
ref|XP_003616693.1|  CCP                                                205   2e-58    
ref|XP_009594291.1|  PREDICTED: protein trichome birefringence-li...    204   2e-58    
ref|XP_010915624.1|  PREDICTED: protein trichome birefringence-li...    203   2e-58    
ref|XP_009757747.1|  PREDICTED: protein trichome birefringence-li...    204   2e-58    
ref|XP_010037678.1|  PREDICTED: protein trichome birefringence-li...    204   2e-58    
ref|XP_009799217.1|  PREDICTED: protein trichome birefringence-li...    199   3e-58    
ref|XP_008362749.1|  PREDICTED: protein trichome birefringence-li...    201   3e-58    
ref|XP_008382075.1|  PREDICTED: protein trichome birefringence-li...    202   4e-58    
ref|XP_010922632.1|  PREDICTED: protein trichome birefringence-li...    204   5e-58    
ref|XP_004981275.1|  PREDICTED: uncharacterized protein LOC101774037    203   5e-58    
ref|XP_003552258.1|  PREDICTED: protein YLS7                            203   5e-58    
ref|XP_010517451.1|  PREDICTED: protein trichome birefringence-li...    202   5e-58    
gb|EEC76416.1|  hypothetical protein OsI_14076                          203   5e-58    
gb|KHN20311.1|  hypothetical protein glysoja_034694                     202   6e-58    
emb|CDY18866.1|  BnaC04g04840D                                          202   6e-58    
ref|XP_010922635.1|  PREDICTED: protein trichome birefringence-li...    203   7e-58    
ref|XP_010508880.1|  PREDICTED: protein trichome birefringence-li...    202   7e-58    
ref|XP_011035871.1|  PREDICTED: protein trichome birefringence-li...    202   8e-58    
ref|XP_010108265.1|  hypothetical protein L484_018686                   202   8e-58    
gb|EEE60181.1|  hypothetical protein OsJ_13118                          202   8e-58    
ref|XP_006828123.1|  hypothetical protein AMTR_s00023p00034050          202   9e-58    
emb|CDP13969.1|  unnamed protein product                                202   9e-58    
ref|XP_009369217.1|  PREDICTED: protein trichome birefringence-li...    202   9e-58    
ref|XP_009776954.1|  PREDICTED: protein trichome birefringence-li...    202   9e-58    
ref|XP_009335197.1|  PREDICTED: protein trichome birefringence-li...    201   1e-57    
ref|NP_001051703.1|  Os03g0817900                                       202   1e-57    
ref|XP_008781070.1|  PREDICTED: protein trichome birefringence-li...    201   1e-57    
gb|EMS46414.1|  hypothetical protein TRIUR3_18542                       200   1e-57    
gb|EMT02462.1|  hypothetical protein F775_07079                         200   2e-57    
ref|XP_003552833.2|  PREDICTED: protein YLS7-like                       202   2e-57    
gb|KHN31308.1|  hypothetical protein glysoja_022962                     202   2e-57    
ref|XP_010922626.1|  PREDICTED: protein trichome birefringence-li...    201   2e-57    
gb|KHG01989.1|  putative C7orf58                                        201   2e-57    
ref|XP_004500519.1|  PREDICTED: uncharacterized protein LOC101509409    201   2e-57    
ref|XP_009766298.1|  PREDICTED: protein trichome birefringence-li...    197   3e-57    
ref|XP_006407479.1|  hypothetical protein EUTSA_v10022294mg             201   3e-57    
ref|XP_011469946.1|  PREDICTED: protein trichome birefringence-li...    199   3e-57    
gb|KDO48340.1|  hypothetical protein CISIN_1g015036mg                   200   3e-57    
ref|XP_006485831.1|  PREDICTED: protein YLS7-like                       200   3e-57    
ref|XP_006451733.1|  hypothetical protein CICLE_v10008349mg             201   4e-57    
gb|EEC75022.1|  hypothetical protein OsI_11111                          201   4e-57    
ref|XP_011076821.1|  PREDICTED: protein trichome birefringence-li...    199   4e-57    
ref|XP_008363773.1|  PREDICTED: protein trichome birefringence-li...    201   4e-57    
ref|XP_006297667.1|  hypothetical protein CARUB_v10013691mg             201   4e-57    
gb|ACU23852.1|  unknown                                                 200   4e-57    
gb|KJB78729.1|  hypothetical protein B456_013G016700                    200   4e-57    
emb|CDX74797.1|  BnaA05g05430D                                          200   4e-57    
ref|XP_002316189.2|  hypothetical protein POPTR_0010s19140g             200   5e-57    
ref|XP_008799798.1|  PREDICTED: protein trichome birefringence-li...    200   6e-57    
ref|XP_010067563.1|  PREDICTED: protein trichome birefringence-li...    201   6e-57    
ref|XP_011006720.1|  PREDICTED: protein trichome birefringence-li...    199   6e-57    
gb|KJB67523.1|  hypothetical protein B456_010G195000                    200   6e-57    
ref|XP_007134783.1|  hypothetical protein PHAVU_010G075700g             199   7e-57    
ref|XP_006294281.1|  hypothetical protein CARUB_v10023279mg             200   7e-57    
ref|XP_004307688.1|  PREDICTED: protein trichome birefringence-li...    200   7e-57    
ref|XP_009143222.1|  PREDICTED: protein trichome birefringence-li...    199   8e-57    
ref|XP_004500518.1|  PREDICTED: uncharacterized protein LOC101509082    199   8e-57    
ref|XP_010325769.1|  PREDICTED: protein trichome birefringence-li...    195   8e-57    
gb|KJB61643.1|  hypothetical protein B456_009G372400                    199   1e-56    
gb|KEH19549.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    199   1e-56    
gb|KJB67522.1|  hypothetical protein B456_010G195000                    200   1e-56    
gb|AAO42282.1|  unknown protein                                         199   1e-56    
ref|NP_187714.1|  protein trichome birefringence-like 32                199   1e-56    
ref|XP_008374354.1|  PREDICTED: LOW QUALITY PROTEIN: protein tric...    199   1e-56    
dbj|BAJ94312.1|  predicted protein                                      200   1e-56    
ref|NP_181563.2|  protein trichome birefringence-like 33                199   1e-56    
ref|XP_009384787.1|  PREDICTED: protein trichome birefringence-li...    197   2e-56    
gb|ABK93384.1|  unknown                                                 189   2e-56    
ref|XP_010464799.1|  PREDICTED: protein trichome birefringence-li...    199   2e-56    
ref|XP_010486723.1|  PREDICTED: protein trichome birefringence-li...    199   2e-56    
ref|XP_002884829.1|  steroid hormone receptor/ transcription factor     199   3e-56    
ref|XP_010264536.1|  PREDICTED: protein trichome birefringence-li...    198   3e-56    
ref|NP_001130809.1|  putative DUF231 domain containing family pro...    198   4e-56    
gb|KFK38486.1|  hypothetical protein AALP_AA3G119500                    198   4e-56    
ref|XP_002298909.1|  hypothetical protein POPTR_0001s38580g             197   4e-56    
ref|XP_008799799.1|  PREDICTED: protein trichome birefringence-li...    198   4e-56    
ref|XP_010489322.1|  PREDICTED: protein trichome birefringence-li...    198   4e-56    
gb|KFK36925.1|  hypothetical protein AALP_AA4G190400                    197   5e-56    
gb|KHG20458.1|  putative C7orf58                                        197   5e-56    
ref|XP_009384786.1|  PREDICTED: protein trichome birefringence-li...    197   5e-56    
gb|ACG29811.1|  hypothetical protein                                    197   5e-56    
gb|KJB74361.1|  hypothetical protein B456_011G290400                    194   5e-56    
ref|XP_004240230.1|  PREDICTED: protein trichome birefringence-li...    197   6e-56    
ref|XP_010543705.1|  PREDICTED: protein trichome birefringence-li...    197   8e-56    
ref|XP_009766297.1|  PREDICTED: protein trichome birefringence-li...    196   8e-56    
ref|XP_008799801.1|  PREDICTED: protein trichome birefringence-li...    199   8e-56    
ref|XP_006485832.1|  PREDICTED: protein YLS7-like                       196   8e-56    
emb|CDY00988.1|  BnaC05g42120D                                          197   9e-56    
ref|XP_006411290.1|  hypothetical protein EUTSA_v10016691mg             197   1e-55    
emb|CDY08556.1|  BnaA05g27920D                                          197   1e-55    
ref|XP_009596342.1|  PREDICTED: protein trichome birefringence-li...    197   1e-55    
ref|XP_007163580.1|  hypothetical protein PHAVU_001G246200g             196   1e-55    
gb|KCW89615.1|  hypothetical protein EUGRSUZ_A01898                     195   1e-55    
ref|XP_009146781.1|  PREDICTED: protein trichome birefringence-li...    197   1e-55    
ref|XP_002879865.1|  hypothetical protein ARALYDRAFT_483086             196   1e-55    
ref|XP_009403633.1|  PREDICTED: protein trichome birefringence-li...    196   1e-55    
gb|EPS67561.1|  hypothetical protein M569_07214                         194   1e-55    
ref|XP_009613762.1|  PREDICTED: protein trichome birefringence-li...    196   2e-55    
ref|XP_008799800.1|  PREDICTED: protein trichome birefringence-li...    199   2e-55    
ref|XP_010070323.1|  PREDICTED: protein trichome birefringence-li...    195   2e-55    
emb|CBI20212.3|  unnamed protein product                                195   2e-55    
ref|XP_009591920.1|  PREDICTED: protein trichome birefringence-li...    195   3e-55    
ref|XP_010553117.1|  PREDICTED: protein trichome birefringence-li...    195   3e-55    
ref|XP_010676818.1|  PREDICTED: protein trichome birefringence-li...    196   3e-55    
ref|XP_004246293.1|  PREDICTED: protein trichome birefringence-li...    195   4e-55    
ref|XP_003522066.1|  PREDICTED: protein YLS7-like                       195   5e-55    
gb|AFK45758.1|  unknown                                                 195   5e-55    
gb|KHN10397.1|  hypothetical protein glysoja_045233                     195   5e-55    
gb|KFK41752.1|  hypothetical protein AALP_AA2G167700                    195   5e-55    
ref|XP_002463646.1|  hypothetical protein SORBIDRAFT_01g003510          195   5e-55    
ref|XP_009141885.1|  PREDICTED: protein trichome birefringence-li...    195   6e-55    
gb|KEH23194.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    194   7e-55    
ref|XP_006390590.1|  hypothetical protein EUTSA_v10018630mg             194   7e-55    
gb|KHG22244.1|  CAS1 domain-containing 1                                194   7e-55    
emb|CDX93192.1|  BnaC04g47040D                                          194   8e-55    
ref|XP_004492457.1|  PREDICTED: uncharacterized protein LOC101491...    194   1e-54    
ref|XP_009760197.1|  PREDICTED: protein trichome birefringence-li...    194   1e-54    
ref|XP_004492458.1|  PREDICTED: uncharacterized protein LOC101491...    194   1e-54    
ref|XP_009387820.1|  PREDICTED: protein trichome birefringence-li...    194   1e-54    
emb|CDY52922.1|  BnaA04g29290D                                          194   2e-54    
ref|XP_004493962.1|  PREDICTED: uncharacterized protein LOC101491535    193   2e-54    



>ref|XP_011084898.1| PREDICTED: protein ESKIMO 1-like [Sesamum indicum]
Length=377

 Score =   412 bits (1060),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 189/218 (87%), Positives = 209/218 (96%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDPTMHSILNRIIMPKSIKKHGKNW+N DYL+FNTYIWWMNTF+MKVLRGSF++GATE
Sbjct  160  NSDDPTMHSILNRIIMPKSIKKHGKNWRNADYLVFNTYIWWMNTFTMKVLRGSFEEGATE  219

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEVDR LAYR+VL TW+KWVDKNV+PNRTQVFFMSMSPLHIKSLDW+NP+GIKCAKET+
Sbjct  220  YDEVDRALAYRRVLRTWAKWVDKNVNPNRTQVFFMSMSPLHIKSLDWDNPDGIKCAKETA  279

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILNTSMPLNVGTD RLF++A+N+T++MK PVHFLNIT LSEYRKDAHTSV+TIRQGKML
Sbjct  280  PILNTSMPLNVGTDRRLFALAANVTKSMKVPVHFLNITTLSEYRKDAHTSVYTIRQGKML  339

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            T EQQADP T+ADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  340  TLEQQADPATFADCIHWCLPGLPDTWNEFLYTRIISRS  377



>ref|XP_006338826.1| PREDICTED: uncharacterized protein LOC102595587 [Solanum tuberosum]
Length=443

 Score =   412 bits (1060),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 190/218 (87%), Positives = 205/218 (94%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI KHG NWKNVDYLIFNTYIWWMNTFSMK+LRGSFD+GATE
Sbjct  226  NSDDPNMHSILNRIIMPESIDKHGNNWKNVDYLIFNTYIWWMNTFSMKILRGSFDEGATE  285

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+DRP AY++VL+TWS+WVDKN+DPNRTQVFFMSMSPLHIKSLDWEN +GIKCAKETS
Sbjct  286  YDEIDRPTAYKRVLATWSQWVDKNIDPNRTQVFFMSMSPLHIKSLDWENSDGIKCAKETS  345

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILNTSMPLNVGTD RLF IA+N+TR++  PV+FLNIT LSEYRKDAHTSVHTIRQGKML
Sbjct  346  PILNTSMPLNVGTDKRLFVIAANVTRSINVPVYFLNITTLSEYRKDAHTSVHTIRQGKML  405

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
             PEQQADP TYADCIHWCLPGLPDTWNEFLYS IISRS
Sbjct  406  MPEQQADPATYADCIHWCLPGLPDTWNEFLYSRIISRS  443



>emb|CDP14002.1| unnamed protein product [Coffea canephora]
Length=443

 Score =   410 bits (1054),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 188/217 (87%), Positives = 207/217 (95%), Gaps = 0/217 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFD+GATE
Sbjct  225  NSDDPNMHSILNRIIMPESIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDEGATE  284

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AY +VL TWSKWV+KN+DPNRT+VFFMS SPLHIKSLDW+NP+GIKCAKET 
Sbjct  285  YDEIERPVAYGRVLKTWSKWVNKNIDPNRTKVFFMSTSPLHIKSLDWDNPDGIKCAKETR  344

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LNTSMPLNVGTD RLF IA+N+TR+MK PV+F+NITKLSEYRKDAHTSVHTIRQGKML
Sbjct  345  PVLNTSMPLNVGTDRRLFVIAANVTRSMKVPVNFINITKLSEYRKDAHTSVHTIRQGKML  404

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            TPEQQADP TYADCIHWCLPG+PDTWNEFLY+ IISR
Sbjct  405  TPEQQADPATYADCIHWCLPGVPDTWNEFLYAKIISR  441



>ref|XP_004240931.1| PREDICTED: protein ESKIMO 1-like [Solanum lycopersicum]
Length=436

 Score =   410 bits (1053),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 188/218 (86%), Positives = 203/218 (93%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI KHG NWKNVDYLIFNTYIWWMNTFSMK+LRGSFD+GATE
Sbjct  219  NSDDPNMHSILNRIIMPESIDKHGNNWKNVDYLIFNTYIWWMNTFSMKILRGSFDEGATE  278

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE DRP AY++VL+TWS+WVDKN+DPNRTQVFFMSMSPLHIKS DWENP+GIKCAKETS
Sbjct  279  YDETDRPTAYKRVLTTWSQWVDKNIDPNRTQVFFMSMSPLHIKSFDWENPDGIKCAKETS  338

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILNTSMPLNVGTD RLF IA+N+ R++K PV+FLNIT LSEYRKDAHTSVHTIRQGKML
Sbjct  339  PILNTSMPLNVGTDKRLFVIAANVIRSIKVPVYFLNITTLSEYRKDAHTSVHTIRQGKML  398

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQ DP TYADCIHWCLPGLPDTWNEFLYS I+S S
Sbjct  399  TPEQQDDPATYADCIHWCLPGLPDTWNEFLYSRIVSHS  436



>ref|XP_002311231.2| hypothetical protein POPTR_0008s06990g [Populus trichocarpa]
 gb|EEE88598.2| hypothetical protein POPTR_0008s06990g [Populus trichocarpa]
Length=490

 Score =   411 bits (1057),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 188/218 (86%), Positives = 206/218 (94%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI KHG +WKNVDYLIFNTYIWWMNTFSMKVLRGSFD+G+TE
Sbjct  273  NSDDPNMHSILNRIIMPESIDKHGVDWKNVDYLIFNTYIWWMNTFSMKVLRGSFDEGSTE  332

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AYR+VL+TWSKWV+KNVDPNRT VFF SMSPLHIKSLDWENP+GIKCAKET+
Sbjct  333  YDEIERPVAYRRVLNTWSKWVEKNVDPNRTTVFFSSMSPLHIKSLDWENPDGIKCAKETA  392

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SMPLNVGTD RLF +A+NIT +MK PVHFLNITKLSEYRKDAHTSVHTIRQGKML
Sbjct  393  PILNVSMPLNVGTDRRLFVVAANITGSMKVPVHFLNITKLSEYRKDAHTSVHTIRQGKML  452

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEF+Y+ IISR+
Sbjct  453  TPEQQADPETYADCIHWCLPGLPDTWNEFIYTRIISRT  490



>ref|XP_011076679.1| PREDICTED: protein ESKIMO 1-like [Sesamum indicum]
Length=514

 Score =   412 bits (1059),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 189/218 (87%), Positives = 207/218 (95%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SIKKHGKNWKNVDYLIFNTYIWWMNTF+MKVLRGSFD+G+TE
Sbjct  297  NSDDPNMHSILNRIIMPESIKKHGKNWKNVDYLIFNTYIWWMNTFAMKVLRGSFDEGSTE  356

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+ RP+AY +VL TWSKWVDKNVDP+RT+VFFMSMSPLHIKSLDW+NP+GIKCAKET+
Sbjct  357  YDEIARPVAYGRVLRTWSKWVDKNVDPDRTKVFFMSMSPLHIKSLDWDNPDGIKCAKETA  416

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILNTSMPLNVGTD RLF IA+N+T +MK PV+FLNIT LSEYRKDAHTSVHTIRQGKML
Sbjct  417  PILNTSMPLNVGTDRRLFVIAANVTNSMKVPVNFLNITTLSEYRKDAHTSVHTIRQGKML  476

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP T+ADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  477  TPEQQADPATFADCIHWCLPGLPDTWNEFLYTRIISRS  514



>ref|XP_009611478.1| PREDICTED: protein ESKIMO 1-like [Nicotiana tomentosiformis]
Length=490

 Score =   409 bits (1052),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 205/218 (94%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG NWKNVDYLIFNTYIWWMNTFSMK+LRGSFD+GATE
Sbjct  273  NSDDPNMHSILNRIIMPESIEKHGNNWKNVDYLIFNTYIWWMNTFSMKILRGSFDEGATE  332

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+DRP+AYR+VL+TWS+WVD N++ NRTQVFFMSMSPLHIKSLDWENP+GIKCAKET+
Sbjct  333  YDEIDRPIAYRRVLATWSQWVDNNINQNRTQVFFMSMSPLHIKSLDWENPDGIKCAKETT  392

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILNTSMPL+VGTD RLF IA+N+T +MK PV+F NIT LSEYRKD HTSV+TIRQGKML
Sbjct  393  PILNTSMPLDVGTDKRLFVIAANVTESMKIPVYFQNITALSEYRKDGHTSVYTIRQGKML  452

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLYS IISRS
Sbjct  453  TPEQQADPATYADCIHWCLPGLPDTWNEFLYSRIISRS  490



>ref|XP_011085127.1| PREDICTED: protein ESKIMO 1 [Sesamum indicum]
Length=466

 Score =   408 bits (1048),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 204/216 (94%), Gaps = 0/216 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDPTMHSILNRIIMPKSIKKHGKNW+NVDYL+FNTYIWWMNTF+MKVLRGSF++GATE
Sbjct  249  NSDDPTMHSILNRIIMPKSIKKHGKNWRNVDYLVFNTYIWWMNTFTMKVLRGSFEEGATE  308

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEVDR LAYR+VL TW+KWVDKNV+PNRTQVFFMSMSPLHIKSLDW+NP+GIKCAKET+
Sbjct  309  YDEVDRALAYRRVLRTWAKWVDKNVNPNRTQVFFMSMSPLHIKSLDWDNPDGIKCAKETA  368

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILNTSMPLNVGTD RLF++ +N+T  MK PVHFLNIT LSEYRKDAHTSV+T RQGKML
Sbjct  369  PILNTSMPLNVGTDRRLFALTTNVTNFMKVPVHFLNITTLSEYRKDAHTSVYTTRQGKML  428

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            T EQQADP T+ADCIHWCLPGLPDTWNEFLY+ IIS
Sbjct  429  TSEQQADPATFADCIHWCLPGLPDTWNEFLYTRIIS  464



>gb|ABK92679.1| unknown [Populus trichocarpa]
Length=212

 Score =   396 bits (1018),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -1

Query  842  MHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATEYDEVDR  663
            MHSILNRIIMP+SI KHG +WKNVDYLIFNTYIWWMNTFSMKVLRGSFD+G+TEYDE++R
Sbjct  1    MHSILNRIIMPESIDKHGVDWKNVDYLIFNTYIWWMNTFSMKVLRGSFDEGSTEYDEIER  60

Query  662  PLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETSPILNTS  483
            P+AYR+VL+TWSKWV+KNVDPNRT VFF SMSPLHIKSLDWENP+GIKCAKET+PILN S
Sbjct  61   PVAYRRVLNTWSKWVEKNVDPNRTTVFFSSMSPLHIKSLDWENPDGIKCAKETAPILNVS  120

Query  482  MPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQA  303
            MPLNVGTD RLF +A+NIT +MK PVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQA
Sbjct  121  MPLNVGTDRRLFVVAANITGSMKVPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQA  180

Query  302  DPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            DP TYADCIHWCLPGLPDTWNEF+Y+ IISR+
Sbjct  181  DPETYADCIHWCLPGLPDTWNEFIYTRIISRT  212



>ref|XP_007219006.1| hypothetical protein PRUPE_ppa004236mg [Prunus persica]
 gb|EMJ20205.1| hypothetical protein PRUPE_ppa004236mg [Prunus persica]
Length=521

 Score =   407 bits (1045),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 184/218 (84%), Positives = 203/218 (93%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMPKSIKKHG+NWK VD+LIFNTYIWWMNTF MKVLRGSFD+GATE
Sbjct  304  NSDDPLMHSILNRIIMPKSIKKHGENWKGVDFLIFNTYIWWMNTFKMKVLRGSFDQGATE  363

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DE++RP+AYRKV+ TW+KWVDKN+DPNRT VFF SMSPLHIKSLDW+NP+GIKCAKET+
Sbjct  364  FDEIERPVAYRKVMMTWAKWVDKNIDPNRTTVFFTSMSPLHIKSLDWDNPDGIKCAKETT  423

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LN + PL VGTD RLF IASNITR+MK PV+FLNIT LSE+RKDAHTSVHTIRQGKML
Sbjct  424  PVLNATTPLEVGTDRRLFVIASNITRSMKVPVYFLNITTLSEFRKDAHTSVHTIRQGKML  483

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  484  TPEQQADPETYADCIHWCLPGLPDTWNEFLYTRIISRS  521



>gb|EYU26798.1| hypothetical protein MIMGU_mgv1a004986mg [Erythranthe guttata]
Length=501

 Score =   406 bits (1043),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 204/218 (94%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSIL+RIIMP SIKKHG+NWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE
Sbjct  284  NSDDPKMHSILDRIIMPGSIKKHGRNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  343

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEVDR +AY +VL TW++WVDK+V+PNRT+VFFMSMSPLHIKSLDWENP GIKCAKET+
Sbjct  344  YDEVDRAVAYGRVLRTWARWVDKHVNPNRTKVFFMSMSPLHIKSLDWENPEGIKCAKETA  403

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILNTSMPLNVGTD RL  +A+NIT ++K PV+FLNIT LSEYRKDAHTSVHTIRQGKML
Sbjct  404  PILNTSMPLNVGTDRRLLVLAANITHSIKMPVYFLNITTLSEYRKDAHTSVHTIRQGKML  463

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            +PEQQADP T+ADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  464  SPEQQADPATFADCIHWCLPGLPDTWNEFLYARIISRS  501



>ref|XP_009345074.1| PREDICTED: protein ESKIMO 1-like [Pyrus x bretschneideri]
Length=519

 Score =   406 bits (1044),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 184/218 (84%), Positives = 203/218 (93%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMPKSI KHG+NWK VDYLIFNTYIWWMNTF MKVLRGSFD+GATE
Sbjct  302  NSDDPNMHSILNRIIMPKSINKHGENWKGVDYLIFNTYIWWMNTFKMKVLRGSFDQGATE  361

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+DRP AYR+V+ TW+KWVDKN+DPNRT VFF SMSPLHIKSLDW+NP+GIKCAKET+
Sbjct  362  YDEIDRPSAYRRVMRTWAKWVDKNIDPNRTTVFFSSMSPLHIKSLDWDNPDGIKCAKETT  421

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILNT+ P++VGTD RLF I+SNIT++MK PVHFLNIT LSE+RKDAHTSVHTIRQGK+L
Sbjct  422  PILNTTTPVHVGTDRRLFVISSNITKSMKVPVHFLNITTLSEFRKDAHTSVHTIRQGKLL  481

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  482  TPEQQADPATYADCIHWCLPGLPDTWNEFLYTRIISRS  519



>ref|XP_009369181.1| PREDICTED: protein ESKIMO 1-like [Pyrus x bretschneideri]
Length=529

 Score =   406 bits (1043),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 184/218 (84%), Positives = 203/218 (93%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMPKSIKKHG+NWK VDYLIFNTYIWWMNTF+MKVLRGSFD+GATE
Sbjct  312  NSDDPKMHSILNRIIMPKSIKKHGENWKGVDYLIFNTYIWWMNTFNMKVLRGSFDQGATE  371

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+DRP AYR+V+ TW+KWVDKN+DPNRT VFF SMSPLHIKSLDW+NP+GIKCAKET+
Sbjct  372  YDEIDRPWAYRRVMKTWAKWVDKNIDPNRTTVFFSSMSPLHIKSLDWDNPDGIKCAKETT  431

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LN + PL VGTD RLF I+SNIT++MK PV+FLNIT LSE+RKDAHTSVHTIRQGK+L
Sbjct  432  PVLNMTTPLEVGTDRRLFVISSNITKSMKVPVYFLNITTLSEFRKDAHTSVHTIRQGKLL  491

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLYS IISRS
Sbjct  492  TPEQQADPATYADCIHWCLPGLPDTWNEFLYSRIISRS  529



>ref|XP_008369267.1| PREDICTED: protein ESKIMO 1-like [Malus domestica]
Length=529

 Score =   405 bits (1041),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 184/218 (84%), Positives = 203/218 (93%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMPKSIKKHG+NWK VDYLIFNTYIWWMNTF+MKVLRGSFD+GATE
Sbjct  312  NSDDPNMHSILNRIIMPKSIKKHGENWKGVDYLIFNTYIWWMNTFNMKVLRGSFDQGATE  371

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+DRP AYR+V+ TW+KWVDKN+DPNRT VFF SMSPLHIKSLDW+NPNGIKCAKET+
Sbjct  372  YDEIDRPWAYRRVMKTWAKWVDKNIDPNRTTVFFSSMSPLHIKSLDWDNPNGIKCAKETT  431

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LN + PL VGTD RLF I+SNIT++MK PV+FLNIT LSE+RKDAHTSV+TIRQGK+L
Sbjct  432  PVLNMTTPLEVGTDRRLFVISSNITKSMKVPVYFLNITTLSEFRKDAHTSVYTIRQGKLL  491

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLYS IISRS
Sbjct  492  TPEQQADPATYADCIHWCLPGLPDTWNEFLYSRIISRS  529



>ref|XP_008233772.1| PREDICTED: protein ESKIMO 1-like [Prunus mume]
Length=512

 Score =   404 bits (1039),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 184/218 (84%), Positives = 203/218 (93%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDPTMHSILNRIIMPKSIKKHG+NWK VD+LIFNTYIWWMNTF MKVLRGSFD+GATE
Sbjct  295  NSDDPTMHSILNRIIMPKSIKKHGENWKGVDFLIFNTYIWWMNTFKMKVLRGSFDQGATE  354

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DE++RP+AY KV+ TW+KWVDKN+DPNRT VFF SMSPLHIKSLDW+NP+GIKCAKET+
Sbjct  355  FDEIERPVAYWKVMRTWAKWVDKNIDPNRTTVFFTSMSPLHIKSLDWDNPDGIKCAKETT  414

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LN + PL VGTD RLF IASNITR+MK PV+FLNIT LSE+RKDAHTSVHTIRQGKML
Sbjct  415  PVLNATTPLEVGTDRRLFVIASNITRSMKVPVYFLNITTLSEFRKDAHTSVHTIRQGKML  474

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  475  TPEQQADPETYADCIHWCLPGLPDTWNEFLYTRIISRS  512



>ref|XP_006356462.1| PREDICTED: uncharacterized protein LOC102604440 [Solanum tuberosum]
Length=462

 Score =   401 bits (1030),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 207/218 (95%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHGKNWKNVDYL+FNTYIWWMNTF+MKVLRGSFD+GATE
Sbjct  245  NSDDPNMHSILNRIIMPESIEKHGKNWKNVDYLVFNTYIWWMNTFAMKVLRGSFDEGATE  304

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YD+++RP+AYR+VL+TWS+WV+ NVD NRT+VFFMSMSPLHIKSLDW NP+GIKCAKETS
Sbjct  305  YDDIERPVAYRRVLTTWSQWVENNVDVNRTKVFFMSMSPLHIKSLDWNNPDGIKCAKETS  364

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LNTSMPL+VGTD RLF +A+N+T+++  PV+FLNIT LSEYRKDAHTSVHTIRQGKML
Sbjct  365  PVLNTSMPLSVGTDKRLFVVAANVTQSINVPVYFLNITSLSEYRKDAHTSVHTIRQGKML  424

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQ+ADPTTYADCIHWCLPGLPDTWNEFLYS I+S S
Sbjct  425  TPEQKADPTTYADCIHWCLPGLPDTWNEFLYSRILSHS  462



>ref|XP_006486305.1| PREDICTED: protein YLS7-like isoform X2 [Citrus sinensis]
Length=460

 Score =   401 bits (1030),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI KHG+NWKNVDYLIFNTYIWWMNTFSMKVLRGSFD+GATE
Sbjct  243  NSDDPNMHSILNRIIMPESINKHGQNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDEGATE  302

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AY +VL TWSKWV++NVDPNRT VFF SMSPLHIKSLDWENP+GIKCA ET+
Sbjct  303  YDEIERPVAYARVLKTWSKWVEQNVDPNRTTVFFGSMSPLHIKSLDWENPDGIKCALETT  362

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PI N SMPLNVGTD RLF +ASN+TR+MK PVHF+NIT LSEYRKD HT+V+TIRQGKML
Sbjct  363  PITNLSMPLNVGTDRRLFVVASNVTRSMKVPVHFINITTLSEYRKDGHTAVYTIRQGKML  422

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPG+PDTWNEFLY+ II+R+
Sbjct  423  TPEQQADPATYADCIHWCLPGVPDTWNEFLYTRIIART  460



>ref|XP_006435757.1| hypothetical protein CICLE_v10031403mg [Citrus clementina]
 ref|XP_006486304.1| PREDICTED: protein YLS7-like isoform X1 [Citrus sinensis]
 gb|ESR48997.1| hypothetical protein CICLE_v10031403mg [Citrus clementina]
Length=476

 Score =   401 bits (1031),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI KHG+NWKNVDYLIFNTYIWWMNTFSMKVLRGSFD+GATE
Sbjct  259  NSDDPNMHSILNRIIMPESINKHGQNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDEGATE  318

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AY +VL TWSKWV++NVDPNRT VFF SMSPLHIKSLDWENP+GIKCA ET+
Sbjct  319  YDEIERPVAYARVLKTWSKWVEQNVDPNRTTVFFGSMSPLHIKSLDWENPDGIKCALETT  378

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PI N SMPLNVGTD RLF +ASN+TR+MK PVHF+NIT LSEYRKD HT+V+TIRQGKML
Sbjct  379  PITNLSMPLNVGTDRRLFVVASNVTRSMKVPVHFINITTLSEYRKDGHTAVYTIRQGKML  438

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPG+PDTWNEFLY+ II+R+
Sbjct  439  TPEQQADPATYADCIHWCLPGVPDTWNEFLYTRIIART  476



>ref|XP_009760656.1| PREDICTED: protein ESKIMO 1-like [Nicotiana sylvestris]
Length=489

 Score =   402 bits (1032),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 204/218 (94%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG NWKNVDYLIFNTYIWWMNTF+MK+LRGSFD+GATE
Sbjct  272  NSDDPNMHSILNRIIMPESIEKHGNNWKNVDYLIFNTYIWWMNTFTMKILRGSFDEGATE  331

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y E+DRP+AYR+VL+TWS+WVD N++PNRTQVFFMSMSPLHIKSLDWENP+GIKCAKET+
Sbjct  332  YYEIDRPIAYRRVLTTWSQWVDNNINPNRTQVFFMSMSPLHIKSLDWENPDGIKCAKETT  391

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILNTSMPL+VGTD RLF IA+N+T +MK  V+F NIT LSE+RKD HTSV+TIRQGKML
Sbjct  392  PILNTSMPLDVGTDKRLFVIAANVTESMKVLVYFQNITALSEHRKDGHTSVYTIRQGKML  451

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLYS IISRS
Sbjct  452  TPEQQADPATYADCIHWCLPGLPDTWNEFLYSRIISRS  489



>ref|XP_004307653.1| PREDICTED: protein ESKIMO 1-like [Fragaria vesca subsp. vesca]
Length=502

 Score =   402 bits (1033),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 203/218 (93%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSI NRIIMPKSIKKHGKNWK+VDYL+FNTYIWWMNTF+MK+LRGSFD+GATE
Sbjct  285  NSDDPLMHSIQNRIIMPKSIKKHGKNWKDVDYLVFNTYIWWMNTFNMKILRGSFDQGATE  344

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y E+DRPLAYRKVL+TW+KWVDKN+DPNRT VFF SMSPLHIKSLDW+NP+GIKCAKET+
Sbjct  345  YYEIDRPLAYRKVLTTWAKWVDKNIDPNRTTVFFTSMSPLHIKSLDWDNPDGIKCAKETT  404

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LN + PL VGTD RLF I+S+IT+ MK PV+FLNIT LSE+RKDAHTSVHTIRQGKML
Sbjct  405  PVLNRTTPLEVGTDRRLFVISSDITKAMKVPVYFLNITTLSEFRKDAHTSVHTIRQGKML  464

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  465  TPEQQADPETYADCIHWCLPGLPDTWNEFLYTRIISRS  502



>gb|EYU20027.1| hypothetical protein MIMGU_mgv1a005444mg [Erythranthe guttata]
Length=483

 Score =   401 bits (1030),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 204/218 (94%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG+NWKNVDYL+FNTYIWWMNT +MK+LRGSFD+GATE
Sbjct  266  NSDDPDMHSILNRIIMPESIEKHGRNWKNVDYLVFNTYIWWMNTAAMKILRGSFDEGATE  325

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            ++E+ RP+AY +VL+TWS WVD+NVD NRTQVFFMSMSPLHIKSLDW NP+GIKCAKET+
Sbjct  326  FEEIPRPVAYERVLTTWSNWVDRNVDRNRTQVFFMSMSPLHIKSLDWNNPDGIKCAKETA  385

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILNTSMPLNVGTD RLF++A+N+T++MK  V F+NIT LSEYRKDAHTSVHTIRQGKM+
Sbjct  386  PILNTSMPLNVGTDRRLFAVAANVTKSMKMSVSFMNITALSEYRKDAHTSVHTIRQGKMV  445

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  446  TPEQQADPATYADCIHWCLPGLPDTWNEFLYARIISRS  483



>ref|XP_008374091.1| PREDICTED: protein ESKIMO 1-like [Malus domestica]
Length=519

 Score =   400 bits (1029),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMPKSIKKHG+NWK VDYLIFNTYIWWMNT  MKVLRGSFD+GATE
Sbjct  302  NSDDPNMHSILNRIIMPKSIKKHGENWKGVDYLIFNTYIWWMNTSKMKVLRGSFDQGATE  361

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+DRP AYR V+ TW+KWVDKN+DPNRT VFF SMSPLHIKSLDW NP+GIKCAKET+
Sbjct  362  YDEMDRPSAYRSVIRTWAKWVDKNIDPNRTTVFFSSMSPLHIKSLDWNNPDGIKCAKETT  421

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILNT+ P++VGTD RLF I+SNIT++MK PVHFLNIT LSE+RKDAHTSVHTIRQGK+L
Sbjct  422  PILNTTTPVHVGTDRRLFVISSNITKSMKVPVHFLNITTLSEFRKDAHTSVHTIRQGKLL  481

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            +PEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  482  SPEQQADPATYADCIHWCLPGLPDTWNEFLYTRIISRS  519



>gb|KFK34842.1| hypothetical protein AALP_AA5G200300 [Arabis alpina]
Length=462

 Score =   399 bits (1024),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG NWKNVD+L+FNTYIWWMNTF+MKVLRGSFDKG TE
Sbjct  245  NSDDPNMHSILNRIIMPESIEKHGVNWKNVDFLVFNTYIWWMNTFAMKVLRGSFDKGDTE  304

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            ++E++RP+AYR+VL TW  WV++N+DP RT VFF SMSPLHIKSLDWENP+GIKCA ET+
Sbjct  305  FEEIERPVAYRRVLRTWGDWVERNIDPLRTTVFFASMSPLHIKSLDWENPDGIKCALETT  364

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SMP +VGTDYRLFS+A N+TR++K PV+FLNITKLSEYRKDAHTSVHTIRQGKML
Sbjct  365  PILNMSMPFSVGTDYRLFSVAENVTRSLKTPVYFLNITKLSEYRKDAHTSVHTIRQGKML  424

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  425  TPEQQADPNTYADCIHWCLPGLPDTWNEFLYTRIISRS  462



>ref|XP_008374103.1| PREDICTED: protein ESKIMO 1 [Malus domestica]
Length=479

 Score =   399 bits (1025),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMPKSIKKHG+NWK VDYLIFNTYIWWMNT  MKVLRGSFD+GATE
Sbjct  262  NSDDPNMHSILNRIIMPKSIKKHGENWKGVDYLIFNTYIWWMNTSKMKVLRGSFDQGATE  321

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+DRP AYR V+ TW+KWVDKN+DPNRT VFF SMSPLHIKSLDW NP+GIKCAKET+
Sbjct  322  YDEMDRPSAYRSVIRTWAKWVDKNIDPNRTTVFFSSMSPLHIKSLDWNNPDGIKCAKETT  381

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILNT+ P++VGTD RLF I+SNIT++MK PVHFLNIT LSE+RKDAHTSVHTIRQGK+L
Sbjct  382  PILNTTTPVHVGTDRRLFVISSNITKSMKVPVHFLNITTLSEFRKDAHTSVHTIRQGKLL  441

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            +PEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  442  SPEQQADPATYADCIHWCLPGLPDTWNEFLYTRIISRS  479



>ref|XP_009785177.1| PREDICTED: protein ESKIMO 1-like [Nicotiana sylvestris]
Length=476

 Score =   399 bits (1025),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 206/218 (94%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHGK+WKNVDYL+FNTYIWWMNTF+MKVLRGSFD+GATE
Sbjct  259  NSDDPNMHSILNRIIMPESIEKHGKHWKNVDYLVFNTYIWWMNTFAMKVLRGSFDEGATE  318

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AYR+VL+TWS+W+D NVD NRT+VFFMSMSPLHIKSLDW NP+GIKCAKET+
Sbjct  319  YDEIERPVAYRRVLTTWSQWIDNNVDTNRTRVFFMSMSPLHIKSLDWNNPDGIKCAKETT  378

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LNTSMPL+VGTD RLF IA+N+T+++  PV+FLNIT LSEYRKDAHTSVHTIRQGKML
Sbjct  379  PVLNTSMPLSVGTDKRLFVIAANVTQSINVPVYFLNITTLSEYRKDAHTSVHTIRQGKML  438

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
             PEQQADPTTYADCIHWCLPGLPDTWNEF+YS I+S S
Sbjct  439  KPEQQADPTTYADCIHWCLPGLPDTWNEFIYSRILSHS  476



>ref|XP_002316205.2| hypothetical protein POPTR_0010s19490g, partial [Populus trichocarpa]
 gb|EEF02376.2| hypothetical protein POPTR_0010s19490g, partial [Populus trichocarpa]
Length=476

 Score =   399 bits (1025),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 203/218 (93%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI KHG NWKNVDYL+FNTYIWWMNTF MKVLRGSFD+G+TE
Sbjct  259  NSDDPNMHSILNRIIMPESIDKHGVNWKNVDYLVFNTYIWWMNTFKMKVLRGSFDEGSTE  318

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AYR+VL+TWSKWV+KNVD NRT VFF SMSPLHIKSLDWENP+GIKCAKET+
Sbjct  319  YDEIERPVAYRRVLTTWSKWVEKNVDTNRTTVFFSSMSPLHIKSLDWENPDGIKCAKETA  378

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PIL+ SM  N+GTD RLF++A+NIT +MK PVHF+NITKLSEYRKDAHTSV+TIRQGKML
Sbjct  379  PILDVSMKFNLGTDRRLFAVAANITGSMKVPVHFINITKLSEYRKDAHTSVYTIRQGKML  438

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISR+
Sbjct  439  TPEQQADPATYADCIHWCLPGLPDTWNEFLYTRIISRT  476



>ref|XP_011035919.1| PREDICTED: protein ESKIMO 1-like isoform X2 [Populus euphratica]
Length=470

 Score =   396 bits (1018),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 203/218 (93%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP  HSILNRIIMP+SI KHG NWKNVDYL+FNTYIWWMNTF+MKVLRGSFD+G+TE
Sbjct  253  NSDDPNRHSILNRIIMPESIDKHGVNWKNVDYLVFNTYIWWMNTFNMKVLRGSFDEGSTE  312

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AYR+VL+TWSKWV+KNVD NRT VFF SMSPLHIKSLDWENP+GIKCAKET+
Sbjct  313  YDEIERPVAYRRVLTTWSKWVEKNVDTNRTTVFFSSMSPLHIKSLDWENPDGIKCAKETA  372

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PIL+ +M  NVGTD RLF++A+NIT +MK PVHF+NITKLSEYRKDAHTSV+TIRQGKML
Sbjct  373  PILDVNMKFNVGTDRRLFAVAANITGSMKVPVHFINITKLSEYRKDAHTSVYTIRQGKML  432

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISR+
Sbjct  433  TPEQQADPATYADCIHWCLPGLPDTWNEFLYARIISRT  470



>ref|XP_004235241.1| PREDICTED: protein ESKIMO 1 [Solanum lycopersicum]
Length=470

 Score =   396 bits (1018),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 205/218 (94%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHGKNWKNVDYL+FNTYIWWMNTF+MKVLRGSFD+GATE
Sbjct  253  NSDDPNMHSILNRIIMPESIEKHGKNWKNVDYLVFNTYIWWMNTFAMKVLRGSFDEGATE  312

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AYR+VL+TWS+WV+ NVD N T+VFFMSMSPLHIKSLDW NP+GIKCAKET+
Sbjct  313  YDEIERPVAYRRVLTTWSQWVENNVDVNSTKVFFMSMSPLHIKSLDWNNPDGIKCAKETT  372

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LNTSMPL+VGTD RLF +A+N+T+++  PV+FLNIT LSEYRKDAHTSVHTIRQGKML
Sbjct  373  PVLNTSMPLSVGTDKRLFVVAANVTQSINVPVYFLNITSLSEYRKDAHTSVHTIRQGKML  432

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            T EQ+ADPTTYADCIHWCLPGLPDTWNEFLYS I+S S
Sbjct  433  TAEQKADPTTYADCIHWCLPGLPDTWNEFLYSRILSHS  470



>ref|XP_011035918.1| PREDICTED: protein ESKIMO 1-like isoform X1 [Populus euphratica]
Length=487

 Score =   397 bits (1019),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 203/218 (93%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP  HSILNRIIMP+SI KHG NWKNVDYL+FNTYIWWMNTF+MKVLRGSFD+G+TE
Sbjct  270  NSDDPNRHSILNRIIMPESIDKHGVNWKNVDYLVFNTYIWWMNTFNMKVLRGSFDEGSTE  329

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AYR+VL+TWSKWV+KNVD NRT VFF SMSPLHIKSLDWENP+GIKCAKET+
Sbjct  330  YDEIERPVAYRRVLTTWSKWVEKNVDTNRTTVFFSSMSPLHIKSLDWENPDGIKCAKETA  389

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PIL+ +M  NVGTD RLF++A+NIT +MK PVHF+NITKLSEYRKDAHTSV+TIRQGKML
Sbjct  390  PILDVNMKFNVGTDRRLFAVAANITGSMKVPVHFINITKLSEYRKDAHTSVYTIRQGKML  449

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISR+
Sbjct  450  TPEQQADPATYADCIHWCLPGLPDTWNEFLYARIISRT  487



>ref|XP_009611970.1| PREDICTED: protein ESKIMO 1-like [Nicotiana tomentosiformis]
Length=483

 Score =   396 bits (1018),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 204/218 (94%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHGK+WKN DYL+FNTYIWWMNTF+MKVLRGSFD+GATE
Sbjct  266  NSDDPNMHSILNRIIMPESIEKHGKHWKNADYLVFNTYIWWMNTFAMKVLRGSFDEGATE  325

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AYR+VL+TWS W+D NVD NRT+VFFMSMSPLHIKSLDW NP+GIKCAKET+
Sbjct  326  YDEIERPVAYRRVLTTWSLWIDNNVDTNRTKVFFMSMSPLHIKSLDWNNPDGIKCAKETT  385

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LNTSMPL+VGTD RLF IA+N+T+++  PV+FLNIT LSEYRKDAHTSVHTIRQGKML
Sbjct  386  PVLNTSMPLSVGTDKRLFVIAANVTQSINVPVYFLNITTLSEYRKDAHTSVHTIRQGKML  445

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
             PEQQADPTTYADCIHWCLPGLPDTWNEF+YS I+S S
Sbjct  446  MPEQQADPTTYADCIHWCLPGLPDTWNEFIYSRILSHS  483



>ref|XP_004170366.1| PREDICTED: uncharacterized protein LOC101231933, partial [Cucumis 
sativus]
Length=235

 Score =   386 bits (992),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 178/218 (82%), Positives = 199/218 (91%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI KHG+NWKNVDYL+FNTYIWWMNTFSMKVLRGSFD+G+TE
Sbjct  18   NSDDPKMHSILNRIIMPESINKHGENWKNVDYLVFNTYIWWMNTFSMKVLRGSFDEGSTE  77

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEV+RPLAY +VL+TW KWV++NV+PNRT VFF SMSPLHIKSLDW NP GIKCAKET 
Sbjct  78   YDEVERPLAYGRVLTTWQKWVEENVNPNRTTVFFSSMSPLHIKSLDWNNPEGIKCAKETM  137

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN + PL VGTD RLF IA N+T+T+K PVHF+NIT LSEYRKDAHTSV+TIRQGKML
Sbjct  138  PILNMTTPLEVGTDRRLFYIAMNVTQTIKVPVHFINITALSEYRKDAHTSVYTIRQGKML  197

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TP+QQADP+TYADCIHWCLPGLPDTWNEF+Y+ IIS S
Sbjct  198  TPDQQADPSTYADCIHWCLPGLPDTWNEFIYTRIISDS  235



>ref|XP_010689520.1| PREDICTED: protein ESKIMO 1 [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   395 bits (1015),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 181/219 (83%), Positives = 204/219 (93%), Gaps = 1/219 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SIKKHG +WKN DYL+FNTYIWWMNTFSMKVLRGSFD+GATE
Sbjct  268  NSDDPKMHSILNRIIMPESIKKHGVHWKNADYLVFNTYIWWMNTFSMKVLRGSFDEGATE  327

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEV+RP+AY +V++TWSKWVDKN+DPNRT VFFMSMSPLHIKSLDW+NP+GIKCA ET+
Sbjct  328  YDEVERPVAYARVMNTWSKWVDKNIDPNRTTVFFMSMSPLHIKSLDWDNPDGIKCALETT  387

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            PILNTSMPL VGTD RLF +A N+T++MK+ PV FLNIT LSEYRKDAHTSVHTI+QGK+
Sbjct  388  PILNTSMPLEVGTDKRLFRLAHNVTQSMKRVPVSFLNITALSEYRKDAHTSVHTIKQGKL  447

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            LTPEQQADP T+ADCIHWCLPGLPDTWNEFLY+ IISR+
Sbjct  448  LTPEQQADPETFADCIHWCLPGLPDTWNEFLYTRIISRN  486



>gb|KJB76205.1| hypothetical protein B456_012G077200 [Gossypium raimondii]
Length=490

 Score =   394 bits (1012),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 182/218 (83%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMPKSI+ HGKNWK+VDYL+FNTYIWWMNTF+MKVLRGSFD+G TE
Sbjct  273  NSDDPDMHSILNRIIMPKSIQNHGKNWKDVDYLVFNTYIWWMNTFNMKVLRGSFDQGDTE  332

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+DRP+AY+KVL+TWSKWVDKNV+PNRT VFF SMSPLHIKSLDWENP+GIKCA ET+
Sbjct  333  YDEIDRPVAYQKVLTTWSKWVDKNVNPNRTTVFFSSMSPLHIKSLDWENPDGIKCALETT  392

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SM LNVGTD RL+ IASNIT+ MK PVHF++IT LSEYRKDAHTSV+TIRQGKML
Sbjct  393  PILNQSMHLNVGTDRRLYVIASNITQNMKVPVHFIDITSLSEYRKDAHTSVYTIRQGKML  452

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP T+ADCIHWCLPGLPDTWNEFLY+ II+ S
Sbjct  453  TPEQQADPATFADCIHWCLPGLPDTWNEFLYARIIAHS  490



>ref|XP_002876345.1| hypothetical protein ARALYDRAFT_907033 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52604.1| hypothetical protein ARALYDRAFT_907033 [Arabidopsis lyrata subsp. 
lyrata]
Length=487

 Score =   394 bits (1012),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 177/218 (81%), Positives = 200/218 (92%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG NWK VD+L+FNTYIWWMNTF+MKVLRGSFDKG TE
Sbjct  270  NSDDPNMHSILNRIIMPESIEKHGVNWKGVDFLVFNTYIWWMNTFAMKVLRGSFDKGDTE  329

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E++RP+AYR+V+ TW  WV++N+DP RT VFF SMSPLHIKSLDWENP+GIKCA ET+
Sbjct  330  YEEIERPVAYRRVMRTWGDWVERNIDPLRTTVFFASMSPLHIKSLDWENPDGIKCALETT  389

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SMP +VGTDYRLFS+A N+T ++K PV+FLNITKLSEYRKDAHTSVHTIRQGKML
Sbjct  390  PILNMSMPFSVGTDYRLFSVAENVTHSLKVPVYFLNITKLSEYRKDAHTSVHTIRQGKML  449

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  450  TPEQQADPNTYADCIHWCLPGLPDTWNEFLYTRIISRS  487



>emb|CDX67630.1| BnaA07g16700D [Brassica napus]
Length=427

 Score =   392 bits (1006),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 178/218 (82%), Positives = 199/218 (91%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG NWK VD+L+FNTYIWWMNTF+MKVLRGSFDKG TE
Sbjct  210  NSDDPNMHSILNRIIMPESIEKHGVNWKGVDFLVFNTYIWWMNTFAMKVLRGSFDKGDTE  269

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E+ RP+AY++VL TW  WVD+N+DP RT VFF SMSPLHIKSLDWENP+GIKCA ET+
Sbjct  270  YEEIPRPVAYQRVLRTWGDWVDRNIDPLRTTVFFASMSPLHIKSLDWENPDGIKCALETT  329

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SMP +VGTDYRLFS+A N+T ++K PV+FLNITKLSEYRKDAHTSVHTIRQGKML
Sbjct  330  PILNMSMPFSVGTDYRLFSVAENVTHSLKVPVYFLNITKLSEYRKDAHTSVHTIRQGKML  389

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  390  TPEQQADPNTYADCIHWCLPGLPDTWNEFLYTRIISRS  427



>ref|XP_010504475.1| PREDICTED: protein ESKIMO 1 isoform X1 [Camelina sativa]
 ref|XP_010504476.1| PREDICTED: protein ESKIMO 1 isoform X2 [Camelina sativa]
Length=502

 Score =   394 bits (1012),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 177/218 (81%), Positives = 200/218 (92%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG NWK VD+L+FNTYIWWMNTF+MKVLRGSFDKG TE
Sbjct  285  NSDDPNMHSILNRIIMPESIEKHGVNWKGVDFLVFNTYIWWMNTFAMKVLRGSFDKGDTE  344

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E++RP+AYR+V+ TW  WV++N+DP RT VFF SMSPLHIKSLDWENP+GIKCA ET+
Sbjct  345  YEEIERPVAYRRVMRTWGDWVERNIDPLRTTVFFASMSPLHIKSLDWENPDGIKCALETT  404

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SMP +VGTDYRLFS+A N+T ++K PV+FLNITKLSEYRKDAHTSVHTIRQGKML
Sbjct  405  PILNMSMPFSVGTDYRLFSVAENVTHSLKVPVYFLNITKLSEYRKDAHTSVHTIRQGKML  464

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  465  TPEQQADPNTYADCIHWCLPGLPDTWNEFLYTRIISRS  502



>ref|XP_010427403.1| PREDICTED: protein ESKIMO 1-like [Camelina sativa]
Length=505

 Score =   394 bits (1012),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 177/218 (81%), Positives = 200/218 (92%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG NWK VD+L+FNTYIWWMNTF+MKVLRGSFDKG TE
Sbjct  288  NSDDPNMHSILNRIIMPESIEKHGVNWKGVDFLVFNTYIWWMNTFAMKVLRGSFDKGDTE  347

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E++RP+AYR+V+ TW  WV++N+DP RT VFF SMSPLHIKSLDWENP+GIKCA ET+
Sbjct  348  YEEIERPVAYRRVMRTWGDWVERNIDPLRTTVFFASMSPLHIKSLDWENPDGIKCALETT  407

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SMP +VGTDYRLFS+A N+T ++K PV+FLNITKLSEYRKDAHTSVHTIRQGKML
Sbjct  408  PILNMSMPFSVGTDYRLFSVAENVTHSLKVPVYFLNITKLSEYRKDAHTSVHTIRQGKML  467

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  468  TPEQQADPNTYADCIHWCLPGLPDTWNEFLYTRIISRS  505



>ref|XP_010516197.1| PREDICTED: protein ESKIMO 1-like [Camelina sativa]
Length=501

 Score =   394 bits (1011),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 177/218 (81%), Positives = 200/218 (92%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG NWK VD+L+FNTYIWWMNTF+MKVLRGSFDKG TE
Sbjct  284  NSDDPNMHSILNRIIMPESIEKHGVNWKGVDFLVFNTYIWWMNTFAMKVLRGSFDKGDTE  343

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E++RP+AYR+V+ TW  WV++N+DP RT VFF SMSPLHIKSLDWENP+GIKCA ET+
Sbjct  344  YEEIERPVAYRRVMRTWGDWVERNIDPLRTTVFFASMSPLHIKSLDWENPDGIKCALETT  403

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SMP +VGTDYRLFS+A N+T ++K PV+FLNITKLSEYRKDAHTSVHTIRQGKML
Sbjct  404  PILNMSMPFSVGTDYRLFSVAENVTHSLKVPVYFLNITKLSEYRKDAHTSVHTIRQGKML  463

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  464  TPEQQADPNTYADCIHWCLPGLPDTWNEFLYTRIISRS  501



>ref|XP_009103977.1| PREDICTED: protein ESKIMO 1 [Brassica rapa]
Length=494

 Score =   394 bits (1011),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 178/218 (82%), Positives = 199/218 (91%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG NWK VD+L+FNTYIWWMNTF+MKVLRGSFDKG TE
Sbjct  277  NSDDPNMHSILNRIIMPESIEKHGVNWKGVDFLVFNTYIWWMNTFAMKVLRGSFDKGDTE  336

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E+ RP+AY++VL TW  WVD+N+DP RT VFF SMSPLHIKSLDWENP+GIKCA ET+
Sbjct  337  YEEIPRPVAYQRVLRTWGDWVDRNIDPLRTTVFFASMSPLHIKSLDWENPDGIKCALETT  396

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SMP +VGTDYRLFS+A N+T ++K PV+FLNITKLSEYRKDAHTSVHTIRQGKML
Sbjct  397  PILNMSMPFSVGTDYRLFSVAENVTHSLKVPVYFLNITKLSEYRKDAHTSVHTIRQGKML  456

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  457  TPEQQADPNTYADCIHWCLPGLPDTWNEFLYTRIISRS  494



>ref|XP_010031198.1| PREDICTED: protein ESKIMO 1 [Eucalyptus grandis]
 gb|KCW50460.1| hypothetical protein EUGRSUZ_J00196 [Eucalyptus grandis]
Length=484

 Score =   393 bits (1009),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI KHG+NWK VDYLIFNTYIWWMNTFSMKVLRGSFDKG+TE
Sbjct  267  NSDDPNMHSILNRIIMPESINKHGRNWKGVDYLIFNTYIWWMNTFSMKVLRGSFDKGSTE  326

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+DRP  Y +VL TW+KWVD+NVDPN T VFF SMSPLHIKSLDW+NP+GIKCAKET 
Sbjct  327  YDEIDRPTVYGRVLKTWAKWVDQNVDPNHTTVFFSSMSPLHIKSLDWDNPDGIKCAKETM  386

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LNT+  LNVGTD RLF IA N+TR+MK PVHF+NIT LSEYRKDAHTSVHTIRQGKML
Sbjct  387  PVLNTTAQLNVGTDRRLFVIADNVTRSMKLPVHFMNITTLSEYRKDAHTSVHTIRQGKML  446

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEF+Y+ I+  S
Sbjct  447  TPEQQADPQTYADCIHWCLPGLPDTWNEFIYTRILQHS  484



>dbj|BAC43257.1| unknown protein [Arabidopsis thaliana]
Length=487

 Score =   392 bits (1008),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 176/218 (81%), Positives = 199/218 (91%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG NWK VD+L+FNTYIWWMNTF+MKVLRGSFDKG TE
Sbjct  270  NSDDPNMHSILNRIIMPESIEKHGVNWKGVDFLVFNTYIWWMNTFAMKVLRGSFDKGDTE  329

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E++RP+AYR+V+ TW  WV++N+DP RT VFF SMSPLHIKSLDWENP+GIKCA ET+
Sbjct  330  YEEIERPVAYRRVIRTWGDWVERNIDPLRTTVFFASMSPLHIKSLDWENPDGIKCALETT  389

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SMP +VGTDYRLFS+A N+T ++  PV+FLNITKLSEYRKDAHTSVHTIRQGKML
Sbjct  390  PILNMSMPFSVGTDYRLFSVAENVTHSLNVPVYFLNITKLSEYRKDAHTSVHTIRQGKML  449

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  450  TPEQQADPNTYADCIHWCLPGLPDTWNEFLYTRIISRS  487



>ref|NP_191158.1| protein ESKIMO 1 [Arabidopsis thaliana]
 sp|Q9LY46.1|TBL29_ARATH RecName: Full=Protein ESKIMO 1; AltName: Full=Protein trichome 
birefringence-like 29 [Arabidopsis thaliana]
 emb|CAB87853.1| putative protein [Arabidopsis thaliana]
 gb|AEE79464.1| uncharacterized protein AT3G55990 [Arabidopsis thaliana]
Length=487

 Score =   392 bits (1008),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 176/218 (81%), Positives = 199/218 (91%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG NWK VD+L+FNTYIWWMNTF+MKVLRGSFDKG TE
Sbjct  270  NSDDPNMHSILNRIIMPESIEKHGVNWKGVDFLVFNTYIWWMNTFAMKVLRGSFDKGDTE  329

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E++RP+AYR+V+ TW  WV++N+DP RT VFF SMSPLHIKSLDWENP+GIKCA ET+
Sbjct  330  YEEIERPVAYRRVMRTWGDWVERNIDPLRTTVFFASMSPLHIKSLDWENPDGIKCALETT  389

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SMP +VGTDYRLFS+A N+T ++  PV+FLNITKLSEYRKDAHTSVHTIRQGKML
Sbjct  390  PILNMSMPFSVGTDYRLFSVAENVTHSLNVPVYFLNITKLSEYRKDAHTSVHTIRQGKML  449

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  450  TPEQQADPNTYADCIHWCLPGLPDTWNEFLYTRIISRS  487



>ref|XP_006290951.1| hypothetical protein CARUB_v10017067mg [Capsella rubella]
 gb|EOA23849.1| hypothetical protein CARUB_v10017067mg [Capsella rubella]
Length=501

 Score =   392 bits (1008),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 176/218 (81%), Positives = 199/218 (91%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG NWK VD+L+FNTYIWWMNTF+MKVLRGSFDKG TE
Sbjct  284  NSDDPNMHSILNRIIMPESIEKHGVNWKGVDFLVFNTYIWWMNTFAMKVLRGSFDKGDTE  343

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E++RP+AYR+V+ TW  WV++N+DP RT VFF SMSPLHIKSLDWENP+GIKCA ET+
Sbjct  344  YEEIERPVAYRRVMRTWGDWVERNIDPLRTTVFFASMSPLHIKSLDWENPDGIKCALETT  403

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SMP +VGTDYRLFS+A N+T ++  PV+FLNITKLSEYRKDAHTSVHTIRQGKML
Sbjct  404  PILNMSMPFSVGTDYRLFSVAENVTHSLNVPVYFLNITKLSEYRKDAHTSVHTIRQGKML  463

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  464  TPEQQADPNTYADCIHWCLPGLPDTWNEFLYTRIISRS  501



>gb|KHG17448.1| CAS1 domain-containing 1 [Gossypium arboreum]
Length=486

 Score =   392 bits (1006),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMPKSI+ HGKNWK+VDYL+FNTYIWWMNTF+MKVLRGSFD+G TE
Sbjct  269  NSDDPDMHSILNRIIMPKSIQNHGKNWKDVDYLVFNTYIWWMNTFTMKVLRGSFDQGDTE  328

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+DRP+AY+KVL+TWSKWVDKN++PNRT VFF SMSPLHIKSLDWENP+GIKCA ET+
Sbjct  329  YDEIDRPVAYQKVLTTWSKWVDKNLNPNRTTVFFSSMSPLHIKSLDWENPDGIKCALETT  388

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SM LNVGTD RL+ IASNIT+ MK PVHF++IT LSEYRKDAHTSV+TIRQGKML
Sbjct  389  PILNQSMYLNVGTDRRLYVIASNITQNMKVPVHFIDITSLSEYRKDAHTSVYTIRQGKML  448

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP T+ADCIHWCLPGLPDTWNEF+Y+ II+ S
Sbjct  449  TPEQQADPATFADCIHWCLPGLPDTWNEFIYARIIAHS  486



>ref|XP_008441472.1| PREDICTED: protein ESKIMO 1-like isoform X2 [Cucumis melo]
Length=483

 Score =   391 bits (1005),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI KHG+NWKNVDYL+FNTYIWWMNTFSMKVLRGSFD G+TE
Sbjct  266  NSDDPKMHSILNRIIMPESINKHGENWKNVDYLVFNTYIWWMNTFSMKVLRGSFDDGSTE  325

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEVDRPLAY +VL+TW KWV++NV+PNRT VFF SMSPLHIKSLDW NP GIKCAKET 
Sbjct  326  YDEVDRPLAYGRVLTTWQKWVEENVNPNRTTVFFSSMSPLHIKSLDWNNPEGIKCAKETL  385

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LN + PL VGTD RLF IA N+T+T+K PVHF+NIT LSEYRKDAHTSV+TIRQGKML
Sbjct  386  PVLNMTTPLEVGTDRRLFYIAMNVTQTIKVPVHFINITALSEYRKDAHTSVYTIRQGKML  445

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP+TYADCIHWCLPGLPDTWNEF+Y+ IIS S
Sbjct  446  TPEQQADPSTYADCIHWCLPGLPDTWNEFIYTRIISDS  483



>ref|XP_008441471.1| PREDICTED: protein ESKIMO 1-like isoform X1 [Cucumis melo]
Length=497

 Score =   392 bits (1006),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI KHG+NWKNVDYL+FNTYIWWMNTFSMKVLRGSFD G+TE
Sbjct  280  NSDDPKMHSILNRIIMPESINKHGENWKNVDYLVFNTYIWWMNTFSMKVLRGSFDDGSTE  339

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEVDRPLAY +VL+TW KWV++NV+PNRT VFF SMSPLHIKSLDW NP GIKCAKET 
Sbjct  340  YDEVDRPLAYGRVLTTWQKWVEENVNPNRTTVFFSSMSPLHIKSLDWNNPEGIKCAKETL  399

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LN + PL VGTD RLF IA N+T+T+K PVHF+NIT LSEYRKDAHTSV+TIRQGKML
Sbjct  400  PVLNMTTPLEVGTDRRLFYIAMNVTQTIKVPVHFINITALSEYRKDAHTSVYTIRQGKML  459

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP+TYADCIHWCLPGLPDTWNEF+Y+ IIS S
Sbjct  460  TPEQQADPSTYADCIHWCLPGLPDTWNEFIYTRIISDS  497



>ref|XP_004138419.1| PREDICTED: uncharacterized protein LOC101203137 [Cucumis sativus]
 gb|KGN45794.1| hypothetical protein Csa_6G011700 [Cucumis sativus]
Length=497

 Score =   391 bits (1004),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 178/218 (82%), Positives = 199/218 (91%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI KHG+NWKNVDYL+FNTYIWWMNTFSMKVLRGSFD+G+TE
Sbjct  280  NSDDPKMHSILNRIIMPESINKHGENWKNVDYLVFNTYIWWMNTFSMKVLRGSFDEGSTE  339

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEV+RPLAY +VL+TW KWV++NV+PNRT VFF SMSPLHIKSLDW NP GIKCAKET 
Sbjct  340  YDEVERPLAYGRVLTTWQKWVEENVNPNRTTVFFSSMSPLHIKSLDWNNPEGIKCAKETM  399

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN + PL VGTD RLF IA N+T+T+K PVHF+NIT LSEYRKDAHTSV+TIRQGKML
Sbjct  400  PILNMTTPLEVGTDRRLFYIAMNVTQTIKVPVHFINITALSEYRKDAHTSVYTIRQGKML  459

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TP+QQADP+TYADCIHWCLPGLPDTWNEF+Y+ IIS S
Sbjct  460  TPDQQADPSTYADCIHWCLPGLPDTWNEFIYTRIISDS  497



>emb|CDY54603.1| BnaA05g28590D [Brassica napus]
Length=492

 Score =   390 bits (1002),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 175/218 (80%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG NWK VD+L+FNTYIWWMNTF MKVLRGSFDKG TE
Sbjct  275  NSDDPNMHSILNRIIMPESIQKHGVNWKGVDFLVFNTYIWWMNTFDMKVLRGSFDKGDTE  334

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E+ RP+AY++VL TW  WV++N+DP  T VFF SMSPLHIKSLDWENP+GIKCA ET+
Sbjct  335  YEEIQRPVAYQRVLKTWGDWVEQNIDPLHTTVFFASMSPLHIKSLDWENPDGIKCALETT  394

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SMP +VGTDYRLFS+A N+TR++K PV+FLNIT+LSE+RKDAHTSVHTIRQGKML
Sbjct  395  PILNMSMPFSVGTDYRLFSVAENVTRSLKVPVYFLNITRLSEFRKDAHTSVHTIRQGKML  454

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  455  TPEQQADPNTYADCIHWCLPGLPDTWNEFLYTRIISRS  492



>ref|XP_009116293.1| PREDICTED: protein ESKIMO 1 [Brassica rapa]
Length=492

 Score =   390 bits (1001),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 175/218 (80%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG NWK VD+L+FNTYIWWMNTF MKVLRGSFDKG TE
Sbjct  275  NSDDPNMHSILNRIIMPESIEKHGVNWKGVDFLVFNTYIWWMNTFDMKVLRGSFDKGDTE  334

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E+ RP+AY++VL TW  WV++N+DP  T VFF SMSPLHIKSLDWENP+GIKCA ET+
Sbjct  335  YEEIQRPVAYQRVLRTWGDWVEQNIDPLHTTVFFASMSPLHIKSLDWENPDGIKCALETT  394

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SMP +VGTDYRLFS+A N+TR++K PV+FLNIT+LSE+RKDAHTSVHTIRQGKML
Sbjct  395  PILNMSMPFSVGTDYRLFSVAENVTRSLKVPVYFLNITRLSEFRKDAHTSVHTIRQGKML  454

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  455  TPEQQADPNTYADCIHWCLPGLPDTWNEFLYTRIISRS  492



>emb|CDX72182.1| BnaC08g26920D [Brassica napus]
Length=492

 Score =   390 bits (1001),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 175/218 (80%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG NWK VD+L+FNTYIWWMNTF MKVLRGSFDKG TE
Sbjct  275  NSDDPNMHSILNRIIMPESIEKHGVNWKGVDFLVFNTYIWWMNTFDMKVLRGSFDKGDTE  334

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E+ RP+AY++VL TW  WV++N+DP  T VFF SMSPLHIKSLDWENP+GIKCA ET+
Sbjct  335  YEEIQRPVAYQRVLRTWGDWVEQNIDPLHTTVFFASMSPLHIKSLDWENPDGIKCALETT  394

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SMP +VGTDYRLFS+A N+TR++K PV+FLNIT+LSE+RKDAHTSVHTIRQGKML
Sbjct  395  PILNMSMPFSVGTDYRLFSVAENVTRSLKVPVYFLNITRLSEFRKDAHTSVHTIRQGKML  454

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  455  TPEQQADPNTYADCIHWCLPGLPDTWNEFLYTRIISRS  492



>ref|XP_007008938.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY17748.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=515

 Score =   390 bits (1002),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 178/218 (82%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SIKKHGKNWK+VDYL+FNTYIWWMNTF+MKVLRGSFDKG TE
Sbjct  298  NSDDPNMHSILNRIIMPESIKKHGKNWKDVDYLVFNTYIWWMNTFTMKVLRGSFDKGDTE  357

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AY +VL+TWSKWVDKNV+PNRT VFF SMSPLHIKSLDW NP+GIKCA ET+
Sbjct  358  YDEIERPVAYNRVLTTWSKWVDKNVNPNRTTVFFSSMSPLHIKSLDWNNPDGIKCALETT  417

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SM LNVGTD RL+ +A+NIT+ MK PVHF++IT LSEYRKDAHTSV+TIRQGKML
Sbjct  418  PILNQSMYLNVGTDRRLYVVATNITQNMKVPVHFIDITSLSEYRKDAHTSVYTIRQGKML  477

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            +PEQ+ADP TYADCIHWCLPGLPDTWNEF+Y+ IIS S
Sbjct  478  SPEQKADPATYADCIHWCLPGLPDTWNEFIYTRIISHS  515



>ref|XP_006403037.1| hypothetical protein EUTSA_v10005901mg [Eutrema salsugineum]
 gb|ESQ44490.1| hypothetical protein EUTSA_v10005901mg [Eutrema salsugineum]
Length=512

 Score =   390 bits (1001),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 175/218 (80%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG NWK VD+L+FNTYIWWMNTF+MKVLRGSFDKG TE
Sbjct  295  NSDDPNMHSILNRIIMPESIEKHGVNWKGVDFLVFNTYIWWMNTFAMKVLRGSFDKGDTE  354

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E+ RP+AY++VL TW  WV++N+DP RT VFF SMSPLHIKSLDWENP+G KCA ET+
Sbjct  355  YEEIQRPVAYQRVLRTWGNWVERNIDPLRTTVFFASMSPLHIKSLDWENPDGTKCALETT  414

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SMP +VGTDYRLFS+A N+T ++K PV+FLNIT+LSEYRKDAHTSVHTIRQGKML
Sbjct  415  PILNMSMPFSVGTDYRLFSVAENVTHSLKVPVYFLNITRLSEYRKDAHTSVHTIRQGKML  474

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  475  TPEQQADPDTYADCIHWCLPGLPDTWNEFLYTRIISRS  512



>ref|XP_002528302.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34060.1| conserved hypothetical protein [Ricinus communis]
Length=469

 Score =   386 bits (992),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 176/218 (81%), Positives = 199/218 (91%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI KHG NWK+VDYLIFNTYIWWMNTFSMKVLRGSFD+G+TE
Sbjct  252  NSDDPNMHSILNRIIMPESINKHGVNWKDVDYLIFNTYIWWMNTFSMKVLRGSFDEGSTE  311

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AY++VL TWS+WVD+N+DPNRT VFF SMSPLHIKSLDW NP+GIKCAKET+
Sbjct  312  YDEIERPVAYQRVLKTWSEWVDENIDPNRTTVFFSSMSPLHIKSLDWNNPDGIKCAKETT  371

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILNT+  +NVGTD RL  +A N+T +MK PVHF+NIT LSEYRKDAHTSV+TIRQGKML
Sbjct  372  PILNTTKRVNVGTDRRLLVLAQNVTNSMKIPVHFINITALSEYRKDAHTSVYTIRQGKML  431

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEF+Y+ IIS S
Sbjct  432  TPEQQADPATYADCIHWCLPGLPDTWNEFIYTRIISSS  469



>gb|KDP44749.1| hypothetical protein JCGZ_01249 [Jatropha curcas]
Length=487

 Score =   387 bits (993),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 177/218 (81%), Positives = 200/218 (92%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRII P+SI KHG NWKNVDYLIFNTYIWWMNT +MKVLRGSFD+GATE
Sbjct  270  NSDDPKMHSILNRIINPESINKHGVNWKNVDYLIFNTYIWWMNTANMKVLRGSFDEGATE  329

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+ RP+AY++VL+TWSKWVD+N+D NRT VFF SMSPLHIKSLDW+NP+GIKCAKET+
Sbjct  330  YDEIQRPVAYQRVLNTWSKWVDENIDANRTTVFFSSMSPLHIKSLDWDNPDGIKCAKETT  389

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LNT+  LNVGTD RL  IA+N+T++MK PVHF+NIT LSE+RKDAHTSV+TIRQGKML
Sbjct  390  PVLNTTRHLNVGTDRRLLVIAANVTKSMKVPVHFINITTLSEFRKDAHTSVYTIRQGKML  449

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  450  TPEQQADPATYADCIHWCLPGLPDTWNEFLYTRIISRS  487



>ref|XP_010534605.1| PREDICTED: protein ESKIMO 1-like [Tarenaya hassleriana]
Length=503

 Score =   387 bits (994),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 173/218 (79%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSI NRIIMP+SI+KHG NWK VDYL+FNTYIWWMNTFSMKVLRGSFD G TE
Sbjct  286  NSDDPNMHSIQNRIIMPESIQKHGVNWKGVDYLVFNTYIWWMNTFSMKVLRGSFDNGDTE  345

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEV RP+AY +VL TW +W+D+N+DPN T VFF SMSPLHIKSLDWENP+G+KCA ET+
Sbjct  346  YDEVARPVAYGRVLKTWGEWIDQNIDPNHTTVFFTSMSPLHIKSLDWENPDGVKCALETT  405

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SMP +VGTDYRLF++A N+T++++ PV+FLNIT+LSEYRKDAHTSV+TIRQGKML
Sbjct  406  PILNMSMPFSVGTDYRLFAVAKNVTQSLRIPVNFLNITRLSEYRKDAHTSVYTIRQGKML  465

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IIS S
Sbjct  466  TPEQQADPATYADCIHWCLPGLPDTWNEFLYTRIISLS  503



>ref|XP_010101431.1| hypothetical protein L484_007686 [Morus notabilis]
 gb|EXB88403.1| hypothetical protein L484_007686 [Morus notabilis]
Length=482

 Score =   385 bits (990),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 174/218 (80%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI KHG NWK+VDYL+FNTYIWWMNTF+MK+LRGSFD+GATE
Sbjct  265  NSDDPNMHSILNRIIMPESINKHGVNWKDVDYLVFNTYIWWMNTFTMKILRGSFDEGATE  324

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AY++VLSTW+ W ++NVDPNRT VFF SMSPLHIKSLDW NP+GIKCAKET 
Sbjct  325  YDEIERPVAYQRVLSTWANWANQNVDPNRTTVFFSSMSPLHIKSLDWNNPDGIKCAKETM  384

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+ N + PL VGTD RLF I+ NIT+++K PVHFLNIT LSEYRKDAHTSV+TIRQGKML
Sbjct  385  PVTNMTTPLEVGTDRRLFVISHNITQSLKVPVHFLNITALSEYRKDAHTSVYTIRQGKML  444

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IIS S
Sbjct  445  TPEQQADPATYADCIHWCLPGLPDTWNEFLYTRIISHS  482



>ref|XP_003616659.1| hypothetical protein MTR_5g082880 [Medicago truncatula]
 gb|AES99617.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=515

 Score =   386 bits (992),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 176/218 (81%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG NWK  DYLIFNTYIWWMNTF+MKVLRGSFD+GATE
Sbjct  298  NSDDPNMHSILNRIIMPESIEKHGVNWKEADYLIFNTYIWWMNTFNMKVLRGSFDEGATE  357

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEV RP+AY +V+ TWSKWVD N+DPN+T+VFF   SPLHIKS DW NP+GIKCAKET+
Sbjct  358  YDEVSRPVAYERVMKTWSKWVDDNIDPNKTKVFFTGTSPLHIKSEDWNNPDGIKCAKETT  417

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LN S PLNVGTD RLF IA+N+T++MK PV+FLNIT LSEYRKDAHTSV+TIRQGKML
Sbjct  418  PVLNMSTPLNVGTDRRLFVIANNVTKSMKVPVYFLNITTLSEYRKDAHTSVYTIRQGKML  477

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADPTTYADCIHWCLPGLPD WNEFLY+ IIS+S
Sbjct  478  TPEQQADPTTYADCIHWCLPGLPDIWNEFLYTQIISQS  515



>emb|CDY46514.1| BnaC06g15710D [Brassica napus]
Length=494

 Score =   385 bits (988),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 174/218 (80%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG NWK VD+L+FNTYIWWMNTF+MKVLRGSFDK  TE
Sbjct  277  NSDDPNMHSILNRIIMPESIEKHGVNWKGVDFLVFNTYIWWMNTFAMKVLRGSFDKEDTE  336

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E+ RP+AY++VL TW  WVD+N+DP RT VFF SMSPLHIKSLDWENP+GIKCA ET+
Sbjct  337  YEEIPRPVAYQRVLRTWGDWVDRNIDPLRTTVFFASMSPLHIKSLDWENPDGIKCALETT  396

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SM  +VGTDYRLFS+A N+T +++ PV+FLNITKLSEYRKDAHTSVHTIRQGKML
Sbjct  397  PILNMSMLFSVGTDYRLFSVAENVTHSLEVPVYFLNITKLSEYRKDAHTSVHTIRQGKML  456

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLY+ I+SRS
Sbjct  457  TPEQQADPNTYADCIHWCLPGLPDTWNEFLYTRIVSRS  494



>ref|XP_010554669.1| PREDICTED: protein ESKIMO 1-like [Tarenaya hassleriana]
Length=500

 Score =   385 bits (988),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 174/218 (80%), Positives = 195/218 (89%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG NW+ VD+L+FNTYIWWMNTFSMKVLRGSFD G TE
Sbjct  279  NSDDPNMHSILNRIIMPESIQKHGVNWRGVDFLVFNTYIWWMNTFSMKVLRGSFDNGDTE  338

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E++RP AY +VL TW  WVD+N+DPN T VFF SMSPLHIKSLDWENP+GIKCA ET 
Sbjct  339  YEEIERPTAYGRVLKTWGDWVDQNIDPNHTTVFFSSMSPLHIKSLDWENPDGIKCALETR  398

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SMP +VGTDYRLF++A N+T ++K PV FLNIT+LSEYRKDAHTSV+TIRQGKML
Sbjct  399  PILNMSMPFSVGTDYRLFAVAKNVTHSLKVPVRFLNITRLSEYRKDAHTSVYTIRQGKML  458

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            T EQQADPTTYADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  459  TAEQQADPTTYADCIHWCLPGLPDTWNEFLYAGIISRS  496



>ref|XP_004491027.1| PREDICTED: uncharacterized protein LOC101515072 isoform X2 [Cicer 
arietinum]
Length=492

 Score =   382 bits (982),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 174/218 (80%), Positives = 199/218 (91%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG NWKNVDYLIFNTYIWWMNTF+MKVLRGSFD+G+TE
Sbjct  275  NSDDPNMHSILNRIIMPESIEKHGVNWKNVDYLIFNTYIWWMNTFNMKVLRGSFDEGSTE  334

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEV RP+AY +VL TWS WVD N+DPN+T+V+F S SPLHIKS DW NP+GIKCAKET+
Sbjct  335  YDEVPRPIAYERVLRTWSNWVDNNIDPNKTKVYFTSTSPLHIKSEDWNNPDGIKCAKETT  394

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LN S PL+VGTD RLF I++N+T++MK PV+FLNIT +SEYRKDAHTSV+TIRQGKML
Sbjct  395  PVLNMSTPLDVGTDRRLFVISNNVTKSMKVPVYFLNITTMSEYRKDAHTSVYTIRQGKML  454

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADPTTYADCIHWCLPGLPD WNEFLY+ IIS+S
Sbjct  455  TPEQQADPTTYADCIHWCLPGLPDIWNEFLYTSIISQS  492



>ref|XP_004491026.1| PREDICTED: uncharacterized protein LOC101515072 isoform X1 [Cicer 
arietinum]
Length=512

 Score =   383 bits (984),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 174/218 (80%), Positives = 199/218 (91%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG NWKNVDYLIFNTYIWWMNTF+MKVLRGSFD+G+TE
Sbjct  295  NSDDPNMHSILNRIIMPESIEKHGVNWKNVDYLIFNTYIWWMNTFNMKVLRGSFDEGSTE  354

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEV RP+AY +VL TWS WVD N+DPN+T+V+F S SPLHIKS DW NP+GIKCAKET+
Sbjct  355  YDEVPRPIAYERVLRTWSNWVDNNIDPNKTKVYFTSTSPLHIKSEDWNNPDGIKCAKETT  414

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LN S PL+VGTD RLF I++N+T++MK PV+FLNIT +SEYRKDAHTSV+TIRQGKML
Sbjct  415  PVLNMSTPLDVGTDRRLFVISNNVTKSMKVPVYFLNITTMSEYRKDAHTSVYTIRQGKML  474

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADPTTYADCIHWCLPGLPD WNEFLY+ IIS+S
Sbjct  475  TPEQQADPTTYADCIHWCLPGLPDIWNEFLYTSIISQS  512



>ref|XP_006355651.1| PREDICTED: uncharacterized protein LOC102582426 [Solanum tuberosum]
Length=415

 Score =   379 bits (972),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 168/218 (77%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +HSIL R+IMP+SI+KHG NWKNVDYLIFNTY+WWMN  +MKVLRGSFD+G+ E
Sbjct  198  NSDDPAVHSILTRLIMPESIEKHGNNWKNVDYLIFNTYVWWMNGGTMKVLRGSFDEGSIE  257

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+DR +AY +VL+TWS+WV  NVDP RT+VFFMSMSP+HIKS+DW NPNGIKCAKET+
Sbjct  258  YDEIDRTIAYTRVLTTWSQWVQNNVDPKRTRVFFMSMSPMHIKSMDWNNPNGIKCAKETA  317

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LN SMPLNVGTD RLF+IASN+T++MK PV+F+NIT++SEYRKDAHTS++TIRQGKML
Sbjct  318  PVLNMSMPLNVGTDKRLFAIASNVTKSMKFPVYFMNITRISEYRKDAHTSLYTIRQGKML  377

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP  YADCIHWCLPGLPDTWNE LY+ I+S S
Sbjct  378  TPEQQADPAMYADCIHWCLPGLPDTWNELLYTRIMSSS  415



>ref|XP_007141755.1| hypothetical protein PHAVU_008G223000g [Phaseolus vulgaris]
 gb|ESW13749.1| hypothetical protein PHAVU_008G223000g [Phaseolus vulgaris]
Length=519

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 173/218 (79%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG NWK+ DYLIFNTYIWWMNTF+MKVLRGSFD+G+TE
Sbjct  302  NSDDPKMHSILNRIIMPESIQKHGVNWKDADYLIFNTYIWWMNTFTMKVLRGSFDEGSTE  361

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEV RP+AY +VL TWSKWVD N+DPNRT+VFF S SPLHIK  +W NP+GIKCAKET+
Sbjct  362  YDEVPRPIAYERVLKTWSKWVDDNIDPNRTKVFFSSTSPLHIKPENWNNPDGIKCAKETT  421

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P++N S PLNVGTD RLF+IA+N+T +MK PV+F+NIT LSE RKDAHTSV+TIRQGKML
Sbjct  422  PVVNMSTPLNVGTDRRLFAIANNVTESMKVPVYFINITTLSELRKDAHTSVYTIRQGKML  481

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADPT YADCIHWCLPGLPDTWNEFLY+ IIS+S
Sbjct  482  TPEQQADPTNYADCIHWCLPGLPDTWNEFLYARIISQS  519



>gb|KHN48573.1| hypothetical protein glysoja_034196 [Glycine soja]
Length=521

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 174/218 (80%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG NWK+VDYLIFNTYIWWMNTFSMKVLRGSFD+G+TE
Sbjct  304  NSDDPNMHSILNRIIMPESIEKHGVNWKDVDYLIFNTYIWWMNTFSMKVLRGSFDEGSTE  363

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEV RP+AY +V++TWSKW+D N+DPNRT+VFF S SPLHIKS +W NP+GIKCAKE +
Sbjct  364  YDEVPRPIAYGRVINTWSKWIDDNIDPNRTKVFFSSTSPLHIKSENWNNPDGIKCAKEIT  423

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LN S PL+VGTD RLF+IA+N+T++MK PV+F+NIT LSE RKDAHTSV+TIRQGKML
Sbjct  424  PVLNMSTPLDVGTDRRLFTIANNVTQSMKVPVYFINITSLSELRKDAHTSVYTIRQGKML  483

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADPTTYADCIHWCLPGLPDTWNEFLY+ IIS+S
Sbjct  484  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYTRIISQS  521



>gb|KHN20838.1| hypothetical protein glysoja_009146 [Glycine soja]
Length=318

 Score =   374 bits (960),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 174/218 (80%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KHG NWK+VDYLIFNTYIWWMNTFSMKVLRGSFD+G+T 
Sbjct  101  NSDDPNMHSILNRIIMPESIEKHGMNWKDVDYLIFNTYIWWMNTFSMKVLRGSFDEGSTA  160

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEV RP+AY +VL TWSKWVD N+D NRT+VFF S SPLHIKS DW NP+GIKCAKET+
Sbjct  161  YDEVPRPIAYGRVLKTWSKWVDDNIDSNRTKVFFSSTSPLHIKSEDWNNPDGIKCAKETT  220

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN S PL+VGTD RLF+I +N+ ++MK  V+F+NIT LSE RKDAHTSV+TIRQGKML
Sbjct  221  PILNMSTPLDVGTDRRLFAIVNNVIQSMKVSVYFINITSLSELRKDAHTSVYTIRQGKML  280

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADPTTYADCIHWCLPGLPDTWNEFLY+ IIS+S
Sbjct  281  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYTQIISQS  318



>emb|CBI25464.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   376 bits (966),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDPTMHSILNRIIMP+SI KHG+NWK VDYLIFNTYIWWMNTF MK+LRGSFD+G+TE
Sbjct  180  NSDDPTMHSILNRIIMPESIDKHGQNWKGVDYLIFNTYIWWMNTFKMKILRGSFDQGSTE  239

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AY +VL TW++WVD+NVDPNRT VFF SMSPLHIKSLDW+NP+GIKCAKET 
Sbjct  240  YDEIERPIAYGRVLRTWAQWVDQNVDPNRTSVFFSSMSPLHIKSLDWDNPDGIKCAKETY  299

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PI N +  L+VGTD R+F++A N+T++MK PV+F+NIT LSE RKDAHTSVHTIRQGK+L
Sbjct  300  PIFNLTTRLDVGTDRRVFAVAVNVTQSMKVPVYFVNITSLSELRKDAHTSVHTIRQGKLL  359

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP  +ADCIHWCLPGLPD WNEFLYS IIS S
Sbjct  360  TPEQQADPMNFADCIHWCLPGLPDMWNEFLYSRIISHS  397



>ref|XP_009607785.1| PREDICTED: protein ESKIMO 1-like [Nicotiana tomentosiformis]
Length=457

 Score =   378 bits (970),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 169/219 (77%), Positives = 198/219 (90%), Gaps = 1/219 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +HS+  R IMP+SI+KHG NWKNVDYLIFNTY+WWM    MKVLRGSFD+G+TE
Sbjct  239  NSDDPALHSVSTRFIMPESIEKHGNNWKNVDYLIFNTYVWWMGGGKMKVLRGSFDEGSTE  298

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+DR +AYR+VL+TWS+W++ NVDPNRTQVFFMSMSP+HIKS+DW NPNGIKCAKET+
Sbjct  299  YDEIDRTIAYRRVLTTWSQWIENNVDPNRTQVFFMSMSPMHIKSMDWNNPNGIKCAKETT  358

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMK-KPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P+LN S PLNVGTD RLF+IAS++T++MK  PV+F+NIT LSEYRKDAHTS++TIRQGKM
Sbjct  359  PVLNMSRPLNVGTDKRLFAIASDVTQSMKVVPVYFMNITSLSEYRKDAHTSLYTIRQGKM  418

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            LTPEQQADP  YADCIHWCLPGLPDTWNEFLY+ I+SRS
Sbjct  419  LTPEQQADPAIYADCIHWCLPGLPDTWNEFLYTRIMSRS  457



>ref|XP_002269697.1| PREDICTED: protein ESKIMO 1 isoform X1 [Vitis vinifera]
Length=492

 Score =   379 bits (973),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDPTMHSILNRIIMP+SI KHG+NWK VDYLIFNTYIWWMNTF MK+LRGSFD+G+TE
Sbjct  275  NSDDPTMHSILNRIIMPESIDKHGQNWKGVDYLIFNTYIWWMNTFKMKILRGSFDQGSTE  334

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AY +VL TW++WVD+NVDPNRT VFF SMSPLHIKSLDW+NP+GIKCAKET 
Sbjct  335  YDEIERPIAYGRVLRTWAQWVDQNVDPNRTSVFFSSMSPLHIKSLDWDNPDGIKCAKETY  394

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PI N +  L+VGTD R+F++A N+T++MK PV+F+NIT LSE RKDAHTSVHTIRQGK+L
Sbjct  395  PIFNLTTRLDVGTDRRVFAVAVNVTQSMKVPVYFVNITSLSELRKDAHTSVHTIRQGKLL  454

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP  +ADCIHWCLPGLPD WNEFLYS IIS S
Sbjct  455  TPEQQADPMNFADCIHWCLPGLPDMWNEFLYSRIISHS  492



>ref|XP_010658261.1| PREDICTED: protein ESKIMO 1 isoform X2 [Vitis vinifera]
Length=475

 Score =   378 bits (971),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDPTMHSILNRIIMP+SI KHG+NWK VDYLIFNTYIWWMNTF MK+LRGSFD+G+TE
Sbjct  258  NSDDPTMHSILNRIIMPESIDKHGQNWKGVDYLIFNTYIWWMNTFKMKILRGSFDQGSTE  317

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AY +VL TW++WVD+NVDPNRT VFF SMSPLHIKSLDW+NP+GIKCAKET 
Sbjct  318  YDEIERPIAYGRVLRTWAQWVDQNVDPNRTSVFFSSMSPLHIKSLDWDNPDGIKCAKETY  377

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PI N +  L+VGTD R+F++A N+T++MK PV+F+NIT LSE RKDAHTSVHTIRQGK+L
Sbjct  378  PIFNLTTRLDVGTDRRVFAVAVNVTQSMKVPVYFVNITSLSELRKDAHTSVHTIRQGKLL  437

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP  +ADCIHWCLPGLPD WNEFLYS IIS S
Sbjct  438  TPEQQADPMNFADCIHWCLPGLPDMWNEFLYSRIISHS  475



>ref|XP_009771554.1| PREDICTED: protein ESKIMO 1-like [Nicotiana sylvestris]
Length=452

 Score =   374 bits (961),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 166/219 (76%), Positives = 199/219 (91%), Gaps = 1/219 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +HS+  R IMP+SI+KHG NWKNVDYLIFNTY+WWM +  MKVLRGSFD+G+TE
Sbjct  234  NSDDPALHSVSTRFIMPESIEKHGNNWKNVDYLIFNTYVWWMGSGKMKVLRGSFDEGSTE  293

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++R +AYR+VL+TWS+W++ NVDPNRTQVFFMSMSP+HIKS+DW NPNGIKCAKET+
Sbjct  294  YDEIERTIAYRRVLTTWSQWIESNVDPNRTQVFFMSMSPMHIKSMDWNNPNGIKCAKETT  353

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMK-KPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P+LN + PLNVGTD +LF+IA+N+T++MK  PV+F+NIT LSEYRKDAHTS++TIRQGKM
Sbjct  354  PVLNMTKPLNVGTDKKLFAIATNVTQSMKVVPVYFMNITSLSEYRKDAHTSLYTIRQGKM  413

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            LTPEQQADP  YADCIHWCLPGLPDTWNEFLY+ I+SRS
Sbjct  414  LTPEQQADPAIYADCIHWCLPGLPDTWNEFLYTRIMSRS  452



>ref|XP_004240227.2| PREDICTED: protein ESKIMO 1-like isoform X1 [Solanum lycopersicum]
Length=460

 Score =   374 bits (961),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 166/218 (76%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +H+IL R+IMP+SI+KHG +WKNVDYLIFNTY+WWMN  +MKVLRGSFDKG+ E
Sbjct  243  NSDDPAVHNILTRLIMPESIEKHGNSWKNVDYLIFNTYVWWMNGGTMKVLRGSFDKGSKE  302

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+DR +AY +VL+TWS+WV  NVDP RT+VFFMSMSP+HIKS+DW NPNGIKCAKET+
Sbjct  303  YDEIDRTIAYTRVLTTWSQWVQNNVDPKRTRVFFMSMSPMHIKSMDWNNPNGIKCAKETT  362

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LN SMPLNVGTD RLF IASN+T+++K PV+F+NIT++SEYRKDAHTS++TIRQGK+L
Sbjct  363  PVLNMSMPLNVGTDKRLFDIASNVTKSIKLPVYFMNITRISEYRKDAHTSLYTIRQGKIL  422

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNE LY+ I+S S
Sbjct  423  TPEQQADPATYADCIHWCLPGLPDTWNELLYTRIMSSS  460



>gb|KJB77004.1| hypothetical protein B456_012G116300 [Gossypium raimondii]
Length=488

 Score =   375 bits (962),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 169/218 (78%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            N+D+P MH+IL+RIIMP SIKKHGK+WKNVDYL+FNTYIWWMNT +MKVLRGSFD+G TE
Sbjct  271  NADNPDMHAILDRIIMPGSIKKHGKHWKNVDYLVFNTYIWWMNTVTMKVLRGSFDRGDTE  330

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AY+KVL+TWSKWV+KNV+PNRT VF  SMSPLHI+SLDW NP+GIKCA ET+
Sbjct  331  YDEIERPIAYKKVLTTWSKWVNKNVNPNRTTVFLNSMSPLHIRSLDWNNPDGIKCALETT  390

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SM LNVGTD RL+ +A NIT+  K PVHF++IT LSEYRKDAHT++HTIRQGK+L
Sbjct  391  PILNQSMHLNVGTDRRLYVVAKNITQNTKIPVHFIDITTLSEYRKDAHTAIHTIRQGKIL  450

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQ+ADP  YADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  451  TPEQKADPAIYADCIHWCLPGLPDTWNEFLYTRIISRS  488



>gb|KHG01595.1| CAS1 domain-containing 1 [Gossypium arboreum]
 gb|KHG15684.1| CAS1 domain-containing 1 [Gossypium arboreum]
Length=488

 Score =   374 bits (960),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 168/218 (77%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            N+D+P MH+IL+RIIMP SIKKHGK+W+NVDYL+FNTYIWWMNT +MKVLRGSFD+G TE
Sbjct  271  NADNPNMHAILDRIIMPGSIKKHGKHWENVDYLVFNTYIWWMNTVTMKVLRGSFDRGDTE  330

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AY+KVL+TWSKWV+KNV+PNRT VF  SMSPLHI+S+DW NP+GIKCA ET+
Sbjct  331  YDEIERPIAYKKVLTTWSKWVNKNVNPNRTTVFLNSMSPLHIRSMDWNNPDGIKCALETT  390

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SM LNVGTD RL+ +A NITR  K PVHF++IT LSEYRKDAHT++HTIRQGK+L
Sbjct  391  PILNQSMHLNVGTDRRLYVVAKNITRNTKIPVHFIDITTLSEYRKDAHTAIHTIRQGKIL  450

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQ+ADP  YADCIHWCLPGLPDTWNEFLY+ IISRS
Sbjct  451  TPEQKADPAIYADCIHWCLPGLPDTWNEFLYTRIISRS  488



>ref|XP_010536111.1| PREDICTED: protein ESKIMO 1-like isoform X2 [Tarenaya hassleriana]
Length=444

 Score =   372 bits (955),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 170/216 (79%), Positives = 188/216 (87%), Gaps = 0/216 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP  HS LNRIIM +SI+KHG NWK VD+L+FNTYIWWMNTFS+K LRGSFD G TE
Sbjct  227  NSDDPKKHSNLNRIIMAESIQKHGVNWKGVDFLVFNTYIWWMNTFSIKALRGSFDNGDTE  286

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++R  AY +V+ TW  WVD+N+DPNRT VFF SMSPLHIKSLDWENP+GIKCA E  
Sbjct  287  YDEIERSAAYERVMKTWGDWVDQNIDPNRTTVFFNSMSPLHIKSLDWENPDGIKCALERM  346

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SMP NVGTDYRLFSIA N+T ++K PVHFLNIT+LSEYRKDAHTSV+TIRQGKM+
Sbjct  347  PILNMSMPFNVGTDYRLFSIAENVTHSLKVPVHFLNITRLSEYRKDAHTSVYTIRQGKMM  406

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            T EQQADPTTYADCIHWCLPGLPDTWNEFLY  IIS
Sbjct  407  TSEQQADPTTYADCIHWCLPGLPDTWNEFLYIRIIS  442



>gb|KJB78764.1| hypothetical protein B456_013G017400 [Gossypium raimondii]
Length=464

 Score =   372 bits (956),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 194/218 (89%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP  HSIL+RIIMP+SI++HGKNWK+VDYLIFNTYIWWMNTF+MKVLRGSFD+G TE
Sbjct  247  NSDDPKRHSILDRIIMPESIREHGKNWKDVDYLIFNTYIWWMNTFTMKVLRGSFDRGDTE  306

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AY++VL TWSKWV+KNV+ NRT VFF SMSPLHIKSLDW NPNGIKCA ET+
Sbjct  307  YDEIERPVAYKRVLETWSKWVEKNVNSNRTTVFFNSMSPLHIKSLDWNNPNGIKCALETT  366

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SM L+VGTD RL  IA+NIT+ M   VHF+NIT LSEYRKDAHTSV+TIRQGKML
Sbjct  367  PILNQSMYLDVGTDRRLLVIANNITQNMNVKVHFVNITSLSEYRKDAHTSVYTIRQGKML  426

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP  +ADCIHWCLPGLPD WNEFLY+ II+ S
Sbjct  427  TPEQQADPENFADCIHWCLPGLPDIWNEFLYTRIITNS  464



>ref|XP_010536034.1| PREDICTED: protein ESKIMO 1-like isoform X1 [Tarenaya hassleriana]
Length=455

 Score =   372 bits (955),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 170/216 (79%), Positives = 188/216 (87%), Gaps = 0/216 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP  HS LNRIIM +SI+KHG NWK VD+L+FNTYIWWMNTFS+K LRGSFD G TE
Sbjct  238  NSDDPKKHSNLNRIIMAESIQKHGVNWKGVDFLVFNTYIWWMNTFSIKALRGSFDNGDTE  297

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++R  AY +V+ TW  WVD+N+DPNRT VFF SMSPLHIKSLDWENP+GIKCA E  
Sbjct  298  YDEIERSAAYERVMKTWGDWVDQNIDPNRTTVFFNSMSPLHIKSLDWENPDGIKCALERM  357

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SMP NVGTDYRLFSIA N+T ++K PVHFLNIT+LSEYRKDAHTSV+TIRQGKM+
Sbjct  358  PILNMSMPFNVGTDYRLFSIAENVTHSLKVPVHFLNITRLSEYRKDAHTSVYTIRQGKMM  417

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            T EQQADPTTYADCIHWCLPGLPDTWNEFLY  IIS
Sbjct  418  TSEQQADPTTYADCIHWCLPGLPDTWNEFLYIRIIS  453



>gb|KHG25684.1| CAS1 domain-containing 1 [Gossypium arboreum]
Length=464

 Score =   371 bits (953),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 195/218 (89%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP  HSIL+RIIMP+SIK+HGKNWK+VDYLIFNTYIWWMNTF+MKVLRGSFD+G TE
Sbjct  247  NSDDPKRHSILDRIIMPESIKEHGKNWKDVDYLIFNTYIWWMNTFTMKVLRGSFDRGDTE  306

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AY++VL TWSKWV++NV+PN+T VFF SMSPLHIKSLDW NPNGIKCA ET+
Sbjct  307  YDEIERPVAYKRVLETWSKWVEENVNPNQTTVFFNSMSPLHIKSLDWNNPNGIKCALETT  366

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SM L+VGTD RL  IA+NIT+ M   VHF+NIT LSEYRKDAHTSV+TIRQGKML
Sbjct  367  PILNQSMYLDVGTDRRLLVIANNITQNMNVKVHFVNITSLSEYRKDAHTSVYTIRQGKML  426

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQ+DP  +ADCIHWCLPGLPD WNEFLY+ II+ S
Sbjct  427  TPEQQSDPENFADCIHWCLPGLPDIWNEFLYTRIIANS  464



>ref|XP_008792924.1| PREDICTED: protein ESKIMO 1-like [Phoenix dactylifera]
Length=539

 Score =   374 bits (960),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 193/217 (89%), Gaps = 1/217 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +HSI NRIIMP+SI KHGKNWK VDYLIFNTYIWWMNTF+MKVLRGSFD+GATE
Sbjct  318  NSDDPNLHSIQNRIIMPESINKHGKNWKGVDYLIFNTYIWWMNTFNMKVLRGSFDEGATE  377

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEVDRP AYR+VL TW+KWV+KNVDP RT VFFMSMSP HIKS +W+NPNGIKCA+ET 
Sbjct  378  YDEVDRPKAYRRVLKTWAKWVEKNVDPQRTMVFFMSMSPNHIKSEEWDNPNGIKCAQETQ  437

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P++N    L+VGTD+RLF +A+N+TR+M+K PV FL+IT LSE RKDAHTSVHT+RQGK+
Sbjct  438  PVMNLPHALDVGTDWRLFDVATNVTRSMRKVPVWFLSITALSELRKDAHTSVHTLRQGKL  497

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            LTPEQQADP TYADCIHWCLPGLPD WNEFLY+ I S
Sbjct  498  LTPEQQADPATYADCIHWCLPGLPDIWNEFLYARIAS  534



>ref|XP_011048734.1| PREDICTED: protein ESKIMO 1-like isoform X1 [Populus euphratica]
Length=490

 Score =   371 bits (953),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 165/218 (76%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI KHG NWKNVDYLIFNTYIWWMNTFSMKVLRGSFD+G+TE
Sbjct  273  NSDDPNMHSILNRIIMPESIDKHGVNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDEGSTE  332

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AYR+VL+TWSKWV++NVDPNRT VFF SMSPLHIK+LDW+NP GIKC+ ET 
Sbjct  333  YDEIERPVAYRRVLNTWSKWVERNVDPNRTTVFFSSMSPLHIKNLDWDNPAGIKCSNETK  392

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN S P +VGT+ +LF+IA N+TR+MK PV+FLN+T LSEYRKDAHTS++T  +GK+L
Sbjct  393  PILNKSKPFDVGTNRQLFAIAVNVTRSMKVPVNFLNVTTLSEYRKDAHTSIYTAIEGKLL  452

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            +PE+++DP  YADC+HWCLPGLPDTWNE LY++IISR+
Sbjct  453  SPEKKSDPLKYADCLHWCLPGLPDTWNELLYTYIISRT  490



>ref|XP_009772255.1| PREDICTED: protein ESKIMO 1-like [Nicotiana sylvestris]
Length=454

 Score =   369 bits (948),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 169/218 (78%), Positives = 193/218 (89%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P  HSI++RIIMP+SI+KHG NWKNVDYLIFNTYIWWMNTF+MK+LRGSFD+GA E
Sbjct  235  NSDNPNFHSIIDRIIMPESIEKHGNNWKNVDYLIFNTYIWWMNTFAMKILRGSFDEGAIE  294

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEV+RP+AYR+VL+TWS+WV+ NVD N T+VFFMSMSPLH+KS DW NP GIKCAKET+
Sbjct  295  YDEVERPVAYRRVLTTWSQWVENNVDSNHTKVFFMSMSPLHMKSSDWGNPEGIKCAKETT  354

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LNTSMPLNVGTD RLF IASN+++++   V FLNIT LSEYRKDAHTSV+  R GK L
Sbjct  355  PVLNTSMPLNVGTDKRLFVIASNVSQSINVSVDFLNITSLSEYRKDAHTSVYITRYGKTL  414

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP T ADCIHWCLPGLPDTWNEFLYS IIS S
Sbjct  415  TPEQQADPATSADCIHWCLPGLPDTWNEFLYSRIISHS  452



>ref|XP_003552838.1| PREDICTED: protein YLS7-like [Glycine max]
Length=473

 Score =   370 bits (950),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 173/219 (79%), Positives = 196/219 (89%), Gaps = 1/219 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KH  NWKNVDYLIFNTYIWWMNT +MKVLRGSFD+G+TE
Sbjct  255  NSDDPKMHSILNRIIMPESIEKHAVNWKNVDYLIFNTYIWWMNTATMKVLRGSFDEGSTE  314

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEV RP+AY +VL+TWSKWV+ N++PNRT+VFF SMSPLHIKS  W NP+GIKCAKET 
Sbjct  315  YDEVPRPIAYGRVLNTWSKWVEDNINPNRTKVFFSSMSPLHIKSEAWNNPDGIKCAKETI  374

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMK-KPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            PILN S  L VGTD RLF +A+N+T++MK  PV+FLNIT LSE+RKDAHTSV+TIRQGKM
Sbjct  375  PILNMSTTLQVGTDRRLFVVANNVTQSMKVVPVNFLNITTLSEFRKDAHTSVYTIRQGKM  434

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            LTPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IIS+S
Sbjct  435  LTPEQQADPATYADCIHWCLPGLPDTWNEFLYTRIISQS  473



>gb|KHN31286.1| hypothetical protein glysoja_022940 [Glycine soja]
Length=476

 Score =   370 bits (950),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 173/219 (79%), Positives = 196/219 (89%), Gaps = 1/219 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI+KH  NWKNVDYLIFNTYIWWMNT +MKVLRGSFD+G+TE
Sbjct  258  NSDDPKMHSILNRIIMPESIEKHAVNWKNVDYLIFNTYIWWMNTATMKVLRGSFDEGSTE  317

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEV RP+AY +VL+TWSKWV+ N++PNRT+VFF SMSPLHIKS  W NP+GIKCAKET 
Sbjct  318  YDEVPRPIAYGRVLNTWSKWVEDNINPNRTKVFFSSMSPLHIKSEAWNNPDGIKCAKETI  377

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMK-KPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            PILN S  L VGTD RLF +A+N+T++MK  PV+FLNIT LSE+RKDAHTSV+TIRQGKM
Sbjct  378  PILNMSTTLQVGTDRRLFVVANNVTQSMKVVPVNFLNITTLSEFRKDAHTSVYTIRQGKM  437

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            LTPEQQADP TYADCIHWCLPGLPDTWNEFLY+ IIS+S
Sbjct  438  LTPEQQADPATYADCIHWCLPGLPDTWNEFLYTRIISQS  476



>ref|XP_009621734.1| PREDICTED: protein ESKIMO 1-like [Nicotiana tomentosiformis]
Length=486

 Score =   370 bits (950),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 167/218 (77%), Positives = 193/218 (89%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P  HSIL+RIIMP+SI+KHGKNWKNVDYLIFNTYIWWMNTF+MK+LRGSFD+GA E
Sbjct  267  NSDNPNFHSILDRIIMPESIEKHGKNWKNVDYLIFNTYIWWMNTFAMKILRGSFDEGAIE  326

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AYR+VL+TWS+WV+ NVD N T+VFFMSMSPLH+KS DW NP GIKCAKET+
Sbjct  327  YDEIERPVAYRRVLTTWSQWVENNVDSNHTKVFFMSMSPLHMKSSDWGNPEGIKCAKETT  386

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LNTSMPLNVGTD RLF I SN+++++   + FL IT LSEYRKDAHTSV+  R GK L
Sbjct  387  PVLNTSMPLNVGTDKRLFVITSNVSQSIDVSIDFLKITSLSEYRKDAHTSVYITRYGKTL  446

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNEFLYS II+ S
Sbjct  447  TPEQQADPATYADCIHWCLPGLPDTWNEFLYSRIIAHS  484



>ref|XP_003600921.1| hypothetical protein MTR_3g070900 [Medicago truncatula]
 gb|AES71172.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=453

 Score =   368 bits (945),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 169/218 (78%), Positives = 194/218 (89%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +HSILNRIIMP+SI+KHG +WKNVDYLIFNTYIWWMNT +MKVLRGSFD+G+ E
Sbjct  236  NSDDPKLHSILNRIIMPESIEKHGVHWKNVDYLIFNTYIWWMNTGTMKVLRGSFDEGSKE  295

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEV RP+AYR+VL TWS++VD N+DPNRT+VFF SMSPLHIKS DW NPNGIKCAKET+
Sbjct  296  YDEVPRPIAYRRVLETWSRFVDNNIDPNRTKVFFNSMSPLHIKSEDWNNPNGIKCAKETT  355

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN S P+ VGTD+RLF IA N+T++ K  V F+ ITKLSEYRKDAHTSV+TIRQGK+L
Sbjct  356  PILNMSTPVQVGTDHRLFVIAKNVTKSTKVKVDFIYITKLSEYRKDAHTSVYTIRQGKVL  415

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQA+P TYADCIHWCLPGLPDTWNE LY+ I+S S
Sbjct  416  TPEQQANPATYADCIHWCLPGLPDTWNELLYTRIVSLS  453



>ref|XP_004500499.1| PREDICTED: uncharacterized protein LOC101501820 isoform X2 [Cicer 
arietinum]
Length=476

 Score =   368 bits (945),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 169/218 (78%), Positives = 194/218 (89%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDPT+HSILNRIIMP SI+KHG +WKNVDYLIFNTYIWWMNT +MKVLRGSFD+G TE
Sbjct  259  NSDDPTIHSILNRIIMPDSIEKHGVHWKNVDYLIFNTYIWWMNTITMKVLRGSFDEGDTE  318

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEV RP+AYR+VL TWS++VD N+DPNRT+VFF SMSPLHIKS DW NPNGIKCAKET+
Sbjct  319  YDEVPRPIAYRRVLETWSRFVDNNIDPNRTKVFFNSMSPLHIKSEDWNNPNGIKCAKETT  378

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN S+P +VGTD RLF IA N+T + K  V+FLNIT LSE+RKDAHTS++TIRQG +L
Sbjct  379  PILNMSIPFSVGTDRRLFIIAKNVTDSTKVKVNFLNITTLSEFRKDAHTSIYTIRQGNVL  438

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQA+P +YA+CIHWCLPGLPDTWNE LY+HIIS S
Sbjct  439  TPEQQANPASYANCIHWCLPGLPDTWNELLYTHIISMS  476



>ref|XP_004500498.1| PREDICTED: uncharacterized protein LOC101501820 isoform X1 [Cicer 
arietinum]
Length=480

 Score =   368 bits (945),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 169/218 (78%), Positives = 194/218 (89%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDPT+HSILNRIIMP SI+KHG +WKNVDYLIFNTYIWWMNT +MKVLRGSFD+G TE
Sbjct  263  NSDDPTIHSILNRIIMPDSIEKHGVHWKNVDYLIFNTYIWWMNTITMKVLRGSFDEGDTE  322

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEV RP+AYR+VL TWS++VD N+DPNRT+VFF SMSPLHIKS DW NPNGIKCAKET+
Sbjct  323  YDEVPRPIAYRRVLETWSRFVDNNIDPNRTKVFFNSMSPLHIKSEDWNNPNGIKCAKETT  382

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN S+P +VGTD RLF IA N+T + K  V+FLNIT LSE+RKDAHTS++TIRQG +L
Sbjct  383  PILNMSIPFSVGTDRRLFIIAKNVTDSTKVKVNFLNITTLSEFRKDAHTSIYTIRQGNVL  442

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQA+P +YA+CIHWCLPGLPDTWNE LY+HIIS S
Sbjct  443  TPEQQANPASYANCIHWCLPGLPDTWNELLYTHIISMS  480



>ref|XP_010253784.1| PREDICTED: protein ESKIMO 1-like [Nelumbo nucifera]
Length=495

 Score =   368 bits (945),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 166/212 (78%), Positives = 187/212 (88%), Gaps = 0/212 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDPTMHSIL+RIIMP+SI KHG+NWK VDYLIFNTYIWWMNT  MKVLRGSFD+G TE
Sbjct  275  NSDDPTMHSILDRIIMPESISKHGENWKEVDYLIFNTYIWWMNTLQMKVLRGSFDEGDTE  334

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AY +VL TW+KWVD+NVDP RT VFF SMSPLHIKS DW+NPNGIKCAKET+
Sbjct  335  YDEIERPIAYERVLRTWAKWVDENVDPRRTAVFFSSMSPLHIKSTDWDNPNGIKCAKETT  394

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LN +  L VGTD RLF    N+  +MK PV+FLNIT LSEYRKDAHTSV+TIRQGKML
Sbjct  395  PVLNRTSRLEVGTDRRLFGAGRNVFESMKVPVYFLNITTLSEYRKDAHTSVYTIRQGKML  454

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYS  225
            TPEQ+ADP T+ADCIHWCLPGLPDTWNEFLY+
Sbjct  455  TPEQKADPATFADCIHWCLPGLPDTWNEFLYT  486



>ref|XP_009409562.1| PREDICTED: protein trichome birefringence-like 28 [Musa acuminata 
subsp. malaccensis]
Length=507

 Score =   368 bits (945),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 191/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P MHSILNRIIMPKSI KHGK+WKNVDYLIFNTYIWW+NT +MKVLRGSFD+G+TE
Sbjct  286  NSDNPKMHSILNRIIMPKSIAKHGKHWKNVDYLIFNTYIWWLNTPTMKVLRGSFDQGSTE  345

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEVDRPLAYR+VL+TWSKWV KNVD NRT VFFMSMSP HI+S DW++P GIKCA ET 
Sbjct  346  YDEVDRPLAYRRVLTTWSKWVQKNVDLNRTMVFFMSMSPNHIRSTDWDDPKGIKCALETQ  405

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+ N S PL+VGTD+RLF +A N+ + MK PV F+ IT +SEYRKDAHTSVHT+RQGK+L
Sbjct  406  PVANLSHPLDVGTDWRLFVVAENVIKKMKVPVTFVRITGMSEYRKDAHTSVHTLRQGKLL  465

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            T EQQADP TYADCIHWCLPGLPDTWNEFLY+ I SR
Sbjct  466  TAEQQADPATYADCIHWCLPGLPDTWNEFLYARIASR  502



>ref|XP_010920820.1| PREDICTED: protein ESKIMO 1-like [Elaeis guineensis]
Length=529

 Score =   362 bits (929),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 190/217 (88%), Gaps = 1/217 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +HSI NRIIMP+SIKKHGKNWK VDYLIFNTYIWWMNTF+MKVLRGSFD+GATE
Sbjct  308  NSDDPNLHSIQNRIIMPESIKKHGKNWKGVDYLIFNTYIWWMNTFNMKVLRGSFDEGATE  367

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+DRP  YR+VL TW+KWV+KNVDP RT VFFMSMSP HIKS +W+NPNGIKCA+ET 
Sbjct  368  YDEMDRPKTYRRVLKTWAKWVEKNVDPKRTMVFFMSMSPNHIKSEEWDNPNGIKCAQETE  427

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P+++    L+VGTD+RLF +A N+TR+M+K PV FL+IT LSE RKDAHTSVHT+RQGK+
Sbjct  428  PVMSLPHALDVGTDWRLFDVAVNVTRSMRKVPVWFLSITALSELRKDAHTSVHTLRQGKL  487

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            LT EQQADP  YADCIHWCLPGLPD WNEFLY+ I S
Sbjct  488  LTREQQADPANYADCIHWCLPGLPDVWNEFLYARIAS  524



>gb|KCW50459.1| hypothetical protein EUGRSUZ_J00196 [Eucalyptus grandis]
Length=463

 Score =   359 bits (921),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -1

Query  806  SIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATEYDEVDRPLAYRKVLSTWS  627
            SI KHG+NWK VDYLIFNTYIWWMNTFSMKVLRGSFDKG+TEYDE+DRP  Y +VL TW+
Sbjct  264  SINKHGRNWKGVDYLIFNTYIWWMNTFSMKVLRGSFDKGSTEYDEIDRPTVYGRVLKTWA  323

Query  626  KWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETSPILNTSMPLNVGTDYRLF  447
            KWVD+NVDPN T VFF SMSPLHIKSLDW+NP+GIKCAKET P+LNT+  LNVGTD RLF
Sbjct  324  KWVDQNVDPNHTTVFFSSMSPLHIKSLDWDNPDGIKCAKETMPVLNTTAQLNVGTDRRLF  383

Query  446  SIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPTTYADCIHWC  267
             IA N+TR+MK PVHF+NIT LSEYRKDAHTSVHTIRQGKMLTPEQQADP TYADCIHWC
Sbjct  384  VIADNVTRSMKLPVHFMNITTLSEYRKDAHTSVHTIRQGKMLTPEQQADPQTYADCIHWC  443

Query  266  LPGLPDTWNEFLYSHIISRS  207
            LPGLPDTWNEF+Y+ I+  S
Sbjct  444  LPGLPDTWNEFIYTRILQHS  463



>ref|XP_010937876.1| PREDICTED: protein ESKIMO 1-like [Elaeis guineensis]
Length=521

 Score =   360 bits (925),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 191/217 (88%), Gaps = 1/217 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +HSI NRIIMP+SIKKHGKNWK VDYLIFNTYIWWMNTF+MKVL+GSFD+GATE
Sbjct  300  NSDDPNVHSIQNRIIMPESIKKHGKNWKGVDYLIFNTYIWWMNTFNMKVLKGSFDEGATE  359

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEVDRP AYR+VL TW+KWV+KNVDP RT VFFMS SP HIKS +W+NPNGIKCA ET 
Sbjct  360  YDEVDRPKAYRRVLKTWAKWVEKNVDPQRTMVFFMSTSPNHIKSDEWDNPNGIKCALETQ  419

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P+++    L+VGTD+RLF +ASN+TR+M++  V F++IT LSE RKDAHTSVHT+RQGK+
Sbjct  420  PVIDLPHALDVGTDWRLFDLASNVTRSMRRVAVWFVSITALSELRKDAHTSVHTLRQGKL  479

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            LTPEQQADP  +ADCIHWCLPGLPDTWNEFLY+ I S
Sbjct  480  LTPEQQADPAKFADCIHWCLPGLPDTWNEFLYARIAS  516



>ref|XP_009399893.1| PREDICTED: protein ESKIMO 1-like [Musa acuminata subsp. malaccensis]
Length=496

 Score =   358 bits (920),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 163/218 (75%), Positives = 192/218 (88%), Gaps = 2/218 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDPT+HSILNRIIMPKSI +HG+NWKNVDYL+FNTYIWW+NT +MKVLRGSF KG+TE
Sbjct  273  NSDDPTVHSILNRIIMPKSIGRHGRNWKNVDYLVFNTYIWWLNTPTMKVLRGSFGKGSTE  332

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+DRP+AYR+VLSTW+ WV KNVDPNRT VFFMSMSP HIKS DW++P+GIKCA ET 
Sbjct  333  YDEIDRPVAYRQVLSTWANWVQKNVDPNRTTVFFMSMSPNHIKSTDWDDPDGIKCALETQ  392

Query  500  PILNTSMPLNVGTDYRLFSIASN-ITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGK  327
            P+ N S PL+VGTD+RLF++A   I+ +M++ P  F+ IT +SEYRKDAHTSVHT+RQGK
Sbjct  393  PVANLSHPLHVGTDWRLFAVAEEVISSSMRRVPASFVKITAMSEYRKDAHTSVHTLRQGK  452

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            +LT EQQADP TYADCIHWCLPGLPDTWNEFL++ I S
Sbjct  453  LLTAEQQADPATYADCIHWCLPGLPDTWNEFLFARIAS  490



>ref|XP_010264604.1| PREDICTED: protein ESKIMO 1-like [Nelumbo nucifera]
Length=567

 Score =   361 bits (926),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 164/218 (75%), Positives = 188/218 (86%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSIL+RIIMP+SI KHGK+WK VDYLIFNTYIWWMNT  MKVLRGSFD+G TE
Sbjct  350  NSDDPRMHSILDRIIMPESIAKHGKHWKGVDYLIFNTYIWWMNTPKMKVLRGSFDEGDTE  409

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DEV+RP+AY +VL TW+ WV++NVDP RT VFF SMSPLHIKS DW NP+GIKCAKET 
Sbjct  410  FDEVERPIAYARVLRTWANWVEENVDPQRTSVFFNSMSPLHIKSTDWNNPDGIKCAKETM  469

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P++N +  L VGTD RLF +A+N+T++MK PV FLNIT LSEYRKDAHTSV+TIRQG +L
Sbjct  470  PVVNMTTRLEVGTDRRLFVVAANVTQSMKVPVRFLNITTLSEYRKDAHTSVYTIRQGNLL  529

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQ+ADP  YADCIHWCLPGLPDTWNE LY+ I SRS
Sbjct  530  TPEQKADPAIYADCIHWCLPGLPDTWNELLYTRIFSRS  567



>ref|XP_008789130.1| PREDICTED: protein ESKIMO 1 [Phoenix dactylifera]
Length=520

 Score =   358 bits (919),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 164/217 (76%), Positives = 188/217 (87%), Gaps = 1/217 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP  HSI NRIIMP+SI KHGKNWK VDYLIFNTYIWWMNT +MKVLRGSFD+GATE
Sbjct  299  NSDDPNFHSIQNRIIMPESINKHGKNWKKVDYLIFNTYIWWMNTRNMKVLRGSFDEGATE  358

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEVDRP AYR+VL TW+KWV+KNVDP RT VFFMS SP H KS  W+NP+GIKCA ET 
Sbjct  359  YDEVDRPEAYRRVLKTWAKWVEKNVDPQRTMVFFMSTSPNHFKSEAWDNPSGIKCAMETK  418

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P++N    L++GTD+RLF +ASN+TR+M+K PV F++IT LSE RKDAHTSVHT+RQGK+
Sbjct  419  PVINPRHALDLGTDWRLFEVASNVTRSMRKVPVWFVSITALSELRKDAHTSVHTLRQGKL  478

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            LTPEQQADP  +ADCIHWCLPGLPDTWNEFLY+ I+S
Sbjct  479  LTPEQQADPAKFADCIHWCLPGLPDTWNEFLYARIVS  515



>ref|XP_009414283.1| PREDICTED: protein ESKIMO 1-like [Musa acuminata subsp. malaccensis]
Length=503

 Score =   357 bits (917),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 163/218 (75%), Positives = 186/218 (85%), Gaps = 2/218 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSI NRIIMPKSI KHG+NWKNVDYL+FNTYIWWMNT  MKVLRGSF++G+TE
Sbjct  274  NSDDPNMHSIQNRIIMPKSIAKHGRNWKNVDYLVFNTYIWWMNTLRMKVLRGSFEEGSTE  333

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YD+VDRP+AYR+VL TW+KWV +NVDP+RT VFFMSMSP HIKS DW+NP GIKCA ET 
Sbjct  334  YDDVDRPVAYRRVLDTWAKWVQRNVDPSRTMVFFMSMSPNHIKSTDWDNPEGIKCALETQ  393

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK--PVHFLNITKLSEYRKDAHTSVHTIRQGK  327
            P+ N S PL+VGTD+RL ++A  +   MK+  PV F+ IT LSE RKDAHTSVHT+RQGK
Sbjct  394  PVTNLSHPLDVGTDWRLLTVAEEVMEGMKERVPVSFVKITALSESRKDAHTSVHTLRQGK  453

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            +LT EQQADP TYADCIHWCLPGLPDTWNEFLY+ I S
Sbjct  454  LLTAEQQADPDTYADCIHWCLPGLPDTWNEFLYARIAS  491



>ref|XP_006411268.1| hypothetical protein EUTSA_v10016723mg [Eutrema salsugineum]
 gb|ESQ52721.1| hypothetical protein EUTSA_v10016723mg [Eutrema salsugineum]
Length=417

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 163/228 (71%), Positives = 189/228 (83%), Gaps = 10/228 (4%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP  HSI++RIIMP+SI+KHG NWK VD+LIFN+YIWWMNT S+KVLRGSFD+G TE
Sbjct  189  NSDDPKKHSIIDRIIMPESIEKHGVNWKGVDFLIFNSYIWWMNTVSIKVLRGSFDEGDTE  248

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+ RP+AY ++L T   WVD N+DP RT VFFMSMSPLHIKSLDW NP GI CA ET+
Sbjct  249  YDEIKRPIAYERMLRTLGDWVDHNIDPLRTTVFFMSMSPLHIKSLDWGNPEGIMCALETT  308

Query  500  PILNTSMPLN----------VGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTS  351
            PILNTSM  N          VGTDYRLFS+  N+T+++K P+HFLNIT LSEYRKDAHTS
Sbjct  309  PILNTSMTFNVGTDYRLYSEVGTDYRLFSVVENVTQSLKVPIHFLNITALSEYRKDAHTS  368

Query  350  VHTIRQGKMLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            V+TIRQG++LT EQQ DP  +ADCIHWCLPGLPDTWNEFLY+HIIS+S
Sbjct  369  VYTIRQGELLTREQQNDPANFADCIHWCLPGLPDTWNEFLYTHIISKS  416



>gb|EPS63212.1| hypothetical protein M569_11574, partial [Genlisea aurea]
Length=416

 Score =   353 bits (905),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 163/217 (75%), Positives = 186/217 (86%), Gaps = 1/217 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP SI KHG NW+NVD+LIFNTYIWWMNTF++K L+G FD+G  E
Sbjct  200  NSDDPNMHSILNRIIMPTSISKHGNNWRNVDFLIFNTYIWWMNTFTIKTLKGWFDRGDAE  259

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEVDRP+AY +V+ TWS WV++NVDP RT+VFFMSMSPLHI+S DWENP+GIKCA E +
Sbjct  260  YDEVDRPVAYERVMKTWSNWVEENVDPKRTKVFFMSMSPLHIRSSDWENPDGIKCAMEKT  319

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQ-GKM  324
            PI+  S  L+VGTD RL  IA+N+T +MK PVHFLNIT LSEYRKDAHTSV+TIRQ GKM
Sbjct  320  PIVKMSTALDVGTDRRLLRIAANVTSSMKTPVHFLNITTLSEYRKDAHTSVYTIRQGGKM  379

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            LT EQQ DP  +ADCIHWCLPGLPDTWNEFLY+ IIS
Sbjct  380  LTREQQEDPDNFADCIHWCLPGLPDTWNEFLYTLIIS  416



>ref|XP_006843597.1| hypothetical protein AMTR_s00007p00131340 [Amborella trichopoda]
 gb|ERN05272.1| hypothetical protein AMTR_s00007p00131340 [Amborella trichopoda]
Length=595

 Score =   355 bits (911),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 166/219 (76%), Positives = 192/219 (88%), Gaps = 4/219 (2%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP  HS+L+RIIMP+SI KH  NWKNVD LIFNTYIWWMNTF MKVLRGSFDKG  E
Sbjct  379  NSDDPRTHSVLDRIIMPESISKHAVNWKNVDVLIFNTYIWWMNTFKMKVLRGSFDKGDKE  438

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E++RP+AY +VL T SKWV+KN+DP+RT+VFFMSMSPLHIKS+DW NP+GIKCAKET 
Sbjct  439  YEEIERPIAYGRVLRTLSKWVNKNIDPHRTRVFFMSMSPLHIKSMDWNNPDGIKCAKETM  498

Query  500  PILNTSMP-LNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGK  327
            PIL+  MP + VGTDYR+F++ASNIT +MKK PV F+N+T LSE RKDAHTSV+TIRQGK
Sbjct  499  PILD--MPTVQVGTDYRVFAVASNITSSMKKVPVSFINVTALSELRKDAHTSVYTIRQGK  556

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            MLT EQ+ADP TYADCIHWCLPGLPDTWNEFLY+ +I R
Sbjct  557  MLTREQKADPATYADCIHWCLPGLPDTWNEFLYTQLIFR  595



>ref|XP_010517431.1| PREDICTED: protein trichome birefringence-like 28 [Camelina sativa]
Length=433

 Score =   349 bits (895),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 188/223 (84%), Gaps = 8/223 (4%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHS+++R+IMP+SI+KHG NWK VD+L+FN+YIWWMNT S+KVLRGSFD G TE
Sbjct  208  NSDDPKMHSVIDRVIMPESIEKHGVNWKGVDFLVFNSYIWWMNTVSIKVLRGSFDDGDTE  267

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+ RP+AY+++L T+  WVD N+DP  T VFFMSMSPLHIKSLDW+NP+GIKCA ET+
Sbjct  268  YDEIKRPIAYKRMLRTFGDWVDHNIDPLSTTVFFMSMSPLHIKSLDWDNPDGIKCALETT  327

Query  500  PILNTSMPLN--------VGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVH  345
            PI N S  +N        VGTDYRLFS   N+TR++K P+HFLNIT LSEYRKDAHTSV+
Sbjct  328  PISNMSFIVNTDHLQYSEVGTDYRLFSAVENVTRSLKVPIHFLNITALSEYRKDAHTSVY  387

Query  344  TIRQGKMLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHII  216
            TI+QGK+LT EQQADP  +ADCIHWCLPGLPDTWNEFLY+HI+
Sbjct  388  TIKQGKLLTREQQADPDNFADCIHWCLPGLPDTWNEFLYTHIV  430



>emb|CDY24925.1| BnaC03g22470D [Brassica napus]
Length=417

 Score =   348 bits (893),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/228 (71%), Positives = 188/228 (82%), Gaps = 10/228 (4%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP  HSI++RIIMP+SI+KHG NWK+VD+L+FN+YIWWMNT S+KVLRGSFD+G TE
Sbjct  189  NSDDPRKHSIIDRIIMPESIEKHGVNWKDVDFLVFNSYIWWMNTVSIKVLRGSFDEGDTE  248

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+ RP+AY +VL TW  WVD ++DP RT VFFMSMSPLHIKS DW NP+GI CA ET+
Sbjct  249  YDEIRRPIAYERVLRTWGDWVDHHIDPLRTTVFFMSMSPLHIKSSDWGNPDGILCALETT  308

Query  500  PILNTSMPLNV----------GTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTS  351
            PILN SM  NV          GTDYRLFS   N+T++MK P+ FLNIT LSEYRKDAHTS
Sbjct  309  PILNKSMVFNVGTNYRLFSEIGTDYRLFSSVENVTQSMKVPIRFLNITALSEYRKDAHTS  368

Query  350  VHTIRQGKMLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            V+TI+QGK+LT EQQ DP TYADCIHWCLPGLPDTWNE LY+HIIS+S
Sbjct  369  VYTIKQGKLLTREQQNDPATYADCIHWCLPGLPDTWNEVLYTHIISKS  416



>ref|XP_009133414.1| PREDICTED: protein trichome birefringence-like 28 [Brassica rapa]
Length=417

 Score =   347 bits (889),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 161/228 (71%), Positives = 187/228 (82%), Gaps = 10/228 (4%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP  HSI++RIIMP+SI+KH  NWK+VD+L+FN+YIWWMNT S+KVLRGSFD+G TE
Sbjct  189  NSDDPRKHSIIDRIIMPESIEKHAVNWKDVDFLVFNSYIWWMNTVSIKVLRGSFDEGDTE  248

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+ RP+AY +VL TW  WVD ++DP RT VFFMSMSPLHIKS DW NP+GI CA ET+
Sbjct  249  YDEIRRPIAYERVLRTWGDWVDHHIDPLRTTVFFMSMSPLHIKSSDWGNPDGILCALETT  308

Query  500  PILNTSMPLNV----------GTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTS  351
            PILN SM  NV          GTDYRLFS   N+T++MK P+ FLNIT LSEYRKDAHTS
Sbjct  309  PILNKSMVFNVGTNYRLFSEIGTDYRLFSSVENVTQSMKVPIRFLNITALSEYRKDAHTS  368

Query  350  VHTIRQGKMLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            V+TI+QGK+LT EQQ DP TYADCIHWCLPGLPDTWNE LY+HIIS+S
Sbjct  369  VYTIKQGKLLTQEQQNDPATYADCIHWCLPGLPDTWNEILYTHIISKS  416



>ref|XP_010505740.1| PREDICTED: protein trichome birefringence-like 28 [Camelina sativa]
Length=434

 Score =   346 bits (887),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 188/225 (84%), Gaps = 8/225 (4%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHS+++R+IMP+SI+KHG NWK VD+L+FN+YIWWMNT S+KVLRGSFD G TE
Sbjct  209  NSDDPKMHSVIDRVIMPESIEKHGVNWKGVDFLVFNSYIWWMNTVSIKVLRGSFDDGDTE  268

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+ RP+AY+++L T+  WVD N+DP  T VFFMSMSPLHIKS DW+NP GIKCA ET+
Sbjct  269  YDEIKRPVAYKRMLRTFGDWVDHNIDPLSTTVFFMSMSPLHIKSSDWDNPVGIKCALETT  328

Query  500  PILNTSMPLN--------VGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVH  345
            PI N S  +N        VGTDYRLFS   N+T+++K P+HFLNIT LSEYRKDAHTSV+
Sbjct  329  PISNMSFIVNTDYIQFSEVGTDYRLFSAVENVTQSLKVPIHFLNITALSEYRKDAHTSVY  388

Query  344  TIRQGKMLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            TI+QGK+LT EQQADP  +ADCIHWCLPGLPDTWNEFLY+HI+S+
Sbjct  389  TIKQGKLLTREQQADPANFADCIHWCLPGLPDTWNEFLYTHIVSQ  433



>ref|XP_010508898.1| PREDICTED: protein trichome birefringence-like 28 [Camelina sativa]
Length=433

 Score =   345 bits (886),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 156/223 (70%), Positives = 186/223 (83%), Gaps = 8/223 (4%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHS+++R+IMP+SI+KHG NWK+VD+L+FN+YIWWMNT S+KVLRGSFD G TE
Sbjct  208  NSDDPKMHSVIDRVIMPESIEKHGVNWKDVDFLVFNSYIWWMNTVSIKVLRGSFDDGDTE  267

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+ RP+AY+++L T+  WVD N+DP  T VFFMSMSPLHIKSLDW N  GIKCA ET+
Sbjct  268  YDEIKRPIAYKRMLRTFGNWVDHNIDPLSTTVFFMSMSPLHIKSLDWNNSEGIKCALETT  327

Query  500  PILNTSMPLN--------VGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVH  345
            PI N S  +N        VGTDYRLFS   N+TR++K P+HFLNIT LSEYRKDAHTSV+
Sbjct  328  PISNMSFIVNTDYLQFSEVGTDYRLFSAVENVTRSLKVPIHFLNITALSEYRKDAHTSVY  387

Query  344  TIRQGKMLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHII  216
            TI+QGK+LT EQQADP  +ADCIHWCLPGLPDTWNEFLY+HI+
Sbjct  388  TIKQGKLLTREQQADPENFADCIHWCLPGLPDTWNEFLYTHIV  430



>gb|KFK36902.1| hypothetical protein AALP_AA4G187700 [Arabis alpina]
Length=398

 Score =   343 bits (879),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/228 (70%), Positives = 187/228 (82%), Gaps = 10/228 (4%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP  HSI++RIIMP+SI+KHG NWKNVD+L+FN+YIWWMNT S+KVLRGSFD+G TE
Sbjct  166  NSDDPRKHSIIDRIIMPESIEKHGVNWKNVDFLVFNSYIWWMNTVSIKVLRGSFDEGDTE  225

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+ RP+AY +VL T   WVD N+DP  T VFFMSMSPLHIKSLDW NP+GI CA E++
Sbjct  226  YDEIRRPIAYERVLRTLGDWVDHNIDPLSTTVFFMSMSPLHIKSLDWGNPDGIMCALEST  285

Query  500  PILNTSMPLN----------VGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTS  351
            PI N SM  N          +GTDYRLFS+  N+TR++K P+HFLNIT LSEYRKDAHTS
Sbjct  286  PIQNKSMVFNAGTNYRLFSEIGTDYRLFSVVENVTRSLKVPIHFLNITGLSEYRKDAHTS  345

Query  350  VHTIRQGKMLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            V+TIRQG++LT EQQ DP  YADCIHWCLPGLPDTWNE LY++IIS+S
Sbjct  346  VYTIRQGELLTREQQNDPAHYADCIHWCLPGLPDTWNELLYTYIISKS  393



>ref|XP_002316204.1| hypothetical protein POPTR_0010s19480g [Populus trichocarpa]
 gb|EEF02375.1| hypothetical protein POPTR_0010s19480g [Populus trichocarpa]
Length=386

 Score =   342 bits (876),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 188/219 (86%), Gaps = 1/219 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLR-GSFDKGAT  684
            NSD P+ HSIL+RIIMP+SI KHG NWK  DYLIFNTYIWWMN+ +MKVL+ G+FD+G T
Sbjct  168  NSDHPSKHSILDRIIMPESINKHGDNWKGADYLIFNTYIWWMNSANMKVLKQGTFDEGVT  227

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            EYDE++R  A+ +VL TW+KW+++NVDPN T V+F+SMSP+H +SLDW NP+GIKC+KET
Sbjct  228  EYDEIERTAAFGRVLRTWAKWIEENVDPNLTSVYFISMSPMHFRSLDWNNPDGIKCSKET  287

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            +P+LN + PLNVGTD RL  + +N+T++MK PV+ LNIT LSEYRKDAHTS++T RQG++
Sbjct  288  APVLNMTTPLNVGTDSRLLVVEANVTQSMKVPVYLLNITTLSEYRKDAHTSIYTTRQGQL  347

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            LT EQQADP  YADCIHWCLPGLPDTWNEFLY+HIIS +
Sbjct  348  LTEEQQADPKIYADCIHWCLPGLPDTWNEFLYTHIISHT  386



>ref|XP_011035916.1| PREDICTED: protein ESKIMO 1-like isoform X1 [Populus euphratica]
Length=418

 Score =   342 bits (878),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 189/219 (86%), Gaps = 1/219 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLR-GSFDKGAT  684
            NSD P+ HSIL+RIIMP+SI KHG NWK  DYLIFNTYIWWMN+ +MKVL+ G+FD+G T
Sbjct  200  NSDHPSKHSILDRIIMPESINKHGDNWKGADYLIFNTYIWWMNSANMKVLKQGTFDEGVT  259

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            EYDE++R  A+ +VL TW+KW+++NVDPN T V+F+SMSP+H +SLDW NP+G+KC+KET
Sbjct  260  EYDEIERTAAFGRVLRTWAKWIEENVDPNLTSVYFISMSPMHFRSLDWNNPDGVKCSKET  319

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            +P+LNT+ PLNVGTD RL  + +N+T++MK PV+ LNIT LSEYRKDAHTS++T RQG++
Sbjct  320  APVLNTTTPLNVGTDSRLLVVEANVTQSMKVPVYLLNITTLSEYRKDAHTSIYTTRQGQL  379

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            LT EQQADP  YADCIHWCLPGLPDTWNEFLY+HIIS +
Sbjct  380  LTEEQQADPKIYADCIHWCLPGLPDTWNEFLYTHIISHT  418



>ref|XP_006295728.1| hypothetical protein CARUB_v10024847mg [Capsella rubella]
 gb|EOA28626.1| hypothetical protein CARUB_v10024847mg [Capsella rubella]
Length=434

 Score =   342 bits (878),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 185/225 (82%), Gaps = 8/225 (4%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHS+++R+IMP+SI KHG NWK VD+L+FN+YIWWMNTFS+KVLRGSFD G TE
Sbjct  209  NSDDPKMHSVIDRVIMPESIDKHGVNWKGVDFLVFNSYIWWMNTFSIKVLRGSFDDGDTE  268

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+ RP+AY ++L T   WVD N+DP  T VFFMSMSPLHIKSLDW NP+GI CA ET+
Sbjct  269  YDEIKRPIAYERMLRTLGNWVDHNIDPLSTTVFFMSMSPLHIKSLDWGNPDGIMCALETT  328

Query  500  PILNTSMPLN--------VGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVH  345
            PI N S  +         VGTDYRLFS   N+T+++K P+HFLNIT LSEYRKDAHT+V+
Sbjct  329  PISNMSFNVKPDYMQFSAVGTDYRLFSAVENVTQSLKVPIHFLNITALSEYRKDAHTTVY  388

Query  344  TIRQGKMLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            TI+QGK+LT +QQADP  +ADCIHWCLPGLPDTWNEFLY+HI+S+
Sbjct  389  TIKQGKLLTRDQQADPAKFADCIHWCLPGLPDTWNEFLYTHIVSQ  433



>ref|NP_030560.1| trichome birefringence-like 28 protein [Arabidopsis thaliana]
 sp|Q94K00.1|TBL28_ARATH RecName: Full=Protein trichome birefringence-like 28 [Arabidopsis 
thaliana]
 gb|AAK43877.1|AF370500_1 Unknown protein [Arabidopsis thaliana]
 gb|AAO30085.1| Unknown protein [Arabidopsis thaliana]
 gb|AEC09789.1| trichome birefringence-like 28 protein [Arabidopsis thaliana]
Length=424

 Score =   342 bits (876),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 183/223 (82%), Gaps = 6/223 (3%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP  HSI++RIIMP+SI+KHG NW  VD+L+FN+YIWWMNT S+KVLRGSFD G TE
Sbjct  201  NSDDPEKHSIIDRIIMPESIEKHGVNWIGVDFLVFNSYIWWMNTVSIKVLRGSFDDGDTE  260

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+ RP+AY +VL T   WVD N+DP  T VFFMSMSPLHIKS DW NP GI+CA ET+
Sbjct  261  YDEIKRPIAYERVLRTLGDWVDHNIDPLSTTVFFMSMSPLHIKSSDWANPEGIRCALETT  320

Query  500  PILNTSMPL------NVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTI  339
            PILN S  +       VGTDYRLF +A N+T+++K P+HFLNIT LSEYRKDAHTSV+TI
Sbjct  321  PILNMSFNVAYGQFSAVGTDYRLFPVAENVTQSLKVPIHFLNITALSEYRKDAHTSVYTI  380

Query  338  RQGKMLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            +QGK+LT EQQ DP  +ADCIHWCLPGLPDTWNEFLY+HIISR
Sbjct  381  KQGKLLTREQQNDPANFADCIHWCLPGLPDTWNEFLYTHIISR  423



>ref|XP_007008937.1| Uncharacterized protein TCM_046947 [Theobroma cacao]
 gb|EOY17747.1| Uncharacterized protein TCM_046947 [Theobroma cacao]
Length=417

 Score =   340 bits (871),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 156/218 (72%), Positives = 181/218 (83%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P  HS+ +RIIMP+SIK  G +WK VDYL+FNTYIWWMNT  MKVLRGSFD    E
Sbjct  200  NSDNPWRHSVKDRIIMPESIKNRGDDWKGVDYLVFNTYIWWMNTGYMKVLRGSFDADPIE  259

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+ RP+AY +VL TW+ WV+ NVD   T V+FMSMSPLHIKSLDW NP+GI+CAKE  
Sbjct  260  YDEIKRPIAYGRVLKTWANWVEANVDSKFTSVYFMSMSPLHIKSLDWNNPDGIRCAKEAL  319

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LN S P NVGTD+RLF   +N+TR+MK PV+FLNIT LSEYRKDAHTSV+T RQG+++
Sbjct  320  PVLNMSTPPNVGTDHRLFLAVANVTRSMKVPVYFLNITTLSEYRKDAHTSVYTTRQGQLI  379

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNE LY+HIIS S
Sbjct  380  TPEQQADPDTYADCIHWCLPGLPDTWNELLYTHIISHS  417



>ref|XP_009380702.1| PREDICTED: protein trichome birefringence-like 28 [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   342 bits (877),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 181/217 (83%), Gaps = 6/217 (3%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRII PKSI KHGK+WKNVDYL+FNTYIWWMNT +MKVLRGS     TE
Sbjct  273  NSDDPRMHSILNRIIDPKSIAKHGKHWKNVDYLVFNTYIWWMNTPTMKVLRGS-----TE  327

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+EV+R  AYR+VL+ W+KWV KNVDPNR+ VFFMSMSP HI+S DW NP+GIKCA ET 
Sbjct  328  YEEVERASAYRRVLNAWAKWVQKNVDPNRSMVFFMSMSPNHIRSTDWGNPDGIKCALETQ  387

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P+ N S PL+VGTD+RLF++A N+   MKK PV F+ IT LSEYRKDAHTSVHT+RQGK+
Sbjct  388  PVANLSRPLDVGTDWRLFAVAENVIGRMKKVPVSFVKITALSEYRKDAHTSVHTLRQGKL  447

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            LT EQQAD  TYADCIHWCLPGLPDTWNE LY+ I S
Sbjct  448  LTAEQQADAATYADCIHWCLPGLPDTWNELLYARITS  484



>ref|XP_002879849.1| hypothetical protein ARALYDRAFT_483061 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56108.1| hypothetical protein ARALYDRAFT_483061 [Arabidopsis lyrata subsp. 
lyrata]
Length=410

 Score =   337 bits (865),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 183/225 (81%), Gaps = 8/225 (4%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP  HSI++RIIMP+SI+KHG NW  VD+L+FN+YIWWMNT S+KVLRGSFD G TE
Sbjct  185  NSDDPRKHSIIDRIIMPESIEKHGVNWIGVDFLVFNSYIWWMNTVSIKVLRGSFDDGDTE  244

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+ RP+AY ++L T   WV+ N+DP  T VFFM MSPLHIKSLDW+NP GI CA ET+
Sbjct  245  YDEIKRPMAYERMLRTLGDWVNHNIDPISTTVFFMGMSPLHIKSLDWDNPEGIMCALETT  304

Query  500  PILNTSMPLN--------VGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVH  345
            PILN S  +         VGTDYRLFS+  N+T+++K P+HFLNIT LSEYRKDAHTSV+
Sbjct  305  PILNMSFNVKTNYRLFSAVGTDYRLFSVVENVTQSLKVPIHFLNITALSEYRKDAHTSVY  364

Query  344  TIRQGKMLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            TI+QGK+LT EQQ DP  +ADCIHWCLPGLPDTWNEFLY+HIIS+
Sbjct  365  TIKQGKLLTREQQTDPANFADCIHWCLPGLPDTWNEFLYTHIISQ  409



>ref|XP_007008939.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY17749.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=488

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/218 (74%), Positives = 178/218 (82%), Gaps = 27/218 (12%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SIKKHGKNWK+VDYL+FNTYIWWMNTF+MKVLRGSFDKG TE
Sbjct  298  NSDDPNMHSILNRIIMPESIKKHGKNWKDVDYLVFNTYIWWMNTFTMKVLRGSFDKGDTE  357

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AY +VL+TWSKWVDKNV+PNRT VFF SMSPLHIKSLDW NP+GIKCA ET+
Sbjct  358  YDEIERPVAYNRVLTTWSKWVDKNVNPNRTTVFFSSMSPLHIKSLDWNNPDGIKCALETT  417

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SM LNVGTD RL                           KDAHTSV+TIRQGKML
Sbjct  418  PILNQSMYLNVGTDRRL---------------------------KDAHTSVYTIRQGKML  450

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            +PEQ+ADP TYADCIHWCLPGLPDTWNEF+Y+ IIS S
Sbjct  451  SPEQKADPATYADCIHWCLPGLPDTWNEFIYTRIISHS  488



>ref|XP_002528303.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34061.1| conserved hypothetical protein [Ricinus communis]
Length=417

 Score =   334 bits (856),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 186/219 (85%), Gaps = 1/219 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P  HSIL+R+IMP+SIKKHG  WK+VD+LIFNTYIWWMN+ +MKVLRG+FD GA E
Sbjct  199  NSDNPWKHSILDRVIMPESIKKHGDKWKDVDFLIFNTYIWWMNSPNMKVLRGTFDAGAVE  258

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++R LAY +VL TW+KWV++NVD   T VFF SMSPLHI+S DW NP GIKCAKET+
Sbjct  259  YDEIERTLAYGRVLRTWAKWVEENVDTKVTSVFFTSMSPLHIRSSDWNNPEGIKCAKETT  318

Query  500  PILN-TSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P++  T+  L+VGTD RLF IA+N+T++MK PV+ +NIT LSEYRKDAHTS++T RQG++
Sbjct  319  PVVTMTNNRLDVGTDRRLFVIAANVTQSMKVPVYLINITTLSEYRKDAHTSIYTTRQGQL  378

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            LT EQQ +P  YADCIHWCLPGLPDTWNE LY+HIISRS
Sbjct  379  LTAEQQGNPAMYADCIHWCLPGLPDTWNELLYTHIISRS  417



>ref|XP_009406878.1| PREDICTED: protein trichome birefringence-like 28 [Musa acuminata 
subsp. malaccensis]
Length=532

 Score =   333 bits (854),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 147/217 (68%), Positives = 178/217 (82%), Gaps = 0/217 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +HSI NRIIM  SI KHGK+W+ VDYLIFNTYIWWMNT  MK+LRGSFD+G+T+
Sbjct  312  NSDDPNIHSIQNRIIMADSIAKHGKHWQGVDYLIFNTYIWWMNTAKMKLLRGSFDRGSTK  371

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEV RP AYR+VL+TW+KWV +NV+P +T VFFMS+SP H++S DW NP GIKCA ET+
Sbjct  372  YDEVSRPAAYRRVLTTWAKWVRRNVNPKKTMVFFMSLSPNHMRSTDWGNPKGIKCAMETT  431

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PI N S P  +GTD+RLF     + R M+ PV F+ IT ++E+RKDAHTSVHT+RQGK+L
Sbjct  432  PITNISRPFKLGTDWRLFREEEEVIRGMRFPVSFIKITAMTEFRKDAHTSVHTLRQGKLL  491

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            T EQQADP ++ADCIHWCLPGLPDTWNEF++  I SR
Sbjct  492  TREQQADPASFADCIHWCLPGLPDTWNEFVFVRIASR  528



>gb|KJB77003.1| hypothetical protein B456_012G116200 [Gossypium raimondii]
Length=419

 Score =   328 bits (840),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 180/218 (83%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P  H+I +RIIMP+SIK  G +WK VDYLIFNTYIWWM+T  +KVLRGSF+    E
Sbjct  202  NSDNPWRHTIKDRIIMPESIKNGGNDWKGVDYLIFNTYIWWMDTGYIKVLRGSFNADPIE  261

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+A+RKVL TW+KW+++NVDP  T V+FMSMSPLHIKS DW N +GI+CAKET 
Sbjct  262  YDEIERPVAFRKVLKTWAKWIEENVDPKFTSVYFMSMSPLHIKSSDWNNSDGIRCAKETL  321

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+ N   P NVGTD+RLF + +N+T +MK PV FL+IT LSEYRKDAH SV+T RQGK++
Sbjct  322  PVTNVFKPPNVGTDHRLFRMVANVTESMKVPVFFLDITTLSEYRKDAHASVYTTRQGKLM  381

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNE L++HII  S
Sbjct  382  TPEQQADPATYADCIHWCLPGLPDTWNELLFAHIILHS  419



>gb|KDP44747.1| hypothetical protein JCGZ_01247 [Jatropha curcas]
Length=404

 Score =   327 bits (837),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 182/219 (83%), Gaps = 4/219 (2%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLR-GSFDKGAT  684
            NSD P  HSIL+RIIMP+SIK HG  WK VDYLIFN+YIWWMNT +MKVLR G+F +G  
Sbjct  189  NSDSPRKHSILDRIIMPESIKTHGDKWKGVDYLIFNSYIWWMNTPNMKVLRQGTFSEGNV  248

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            EY+E++RP+AY +VL T + W+++NVDP  T V+FMSMSPLHIKSLDW NP GIKCAKET
Sbjct  249  EYEEIERPIAYERVLRTLANWIEQNVDPKLTSVYFMSMSPLHIKSLDWNNPEGIKCAKET  308

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
             P+   + P +VGTD RLF IA N+T+++K PV+ +NIT LSEYRKDAHTSV+T RQG++
Sbjct  309  IPM---TQPFDVGTDRRLFVIAMNVTQSIKVPVYLINITALSEYRKDAHTSVYTTRQGQL  365

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            LTPEQQA+P  YADCIHWCLPGLPDTWNE LY+HI+S+S
Sbjct  366  LTPEQQANPAMYADCIHWCLPGLPDTWNELLYTHIVSQS  404



>ref|XP_003558153.1| PREDICTED: protein trichome birefringence-like 28 [Brachypodium 
distachyon]
Length=553

 Score =   328 bits (840),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 178/217 (82%), Gaps = 1/217 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P +HS+ +RII   SI KH KNW  VDYL+FNTYIWW+NT  MKVL+GSFD+GATE
Sbjct  329  NSDNPKVHSVPDRIIQWHSIAKHAKNWLGVDYLVFNTYIWWLNTLDMKVLKGSFDEGATE  388

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y EVDRP+AY +VL TW+KWVD+N+DPNRT VFFM MSP HI    W N  GIKCA ET 
Sbjct  389  YVEVDRPVAYNEVLKTWAKWVDRNIDPNRTTVFFMGMSPNHITPEAWGNDGGIKCAMETM  448

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            PI N +  L+VGTD+RL++ A ++ +T ++ PVHF++IT LSE RKDAHTSVHT+RQGK+
Sbjct  449  PIKNRTASLDVGTDWRLYAGAQDVLQTFRRVPVHFVDITALSELRKDAHTSVHTLRQGKL  508

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            LTPEQQADP TYADCIHWCLPGLPDTWNEFLY+ I+S
Sbjct  509  LTPEQQADPKTYADCIHWCLPGLPDTWNEFLYARIVS  545



>ref|XP_002528304.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34062.1| conserved hypothetical protein [Ricinus communis]
Length=436

 Score =   323 bits (827),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 175/207 (85%), Gaps = 0/207 (0%)
 Frame = -1

Query  827  NRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATEYDEVDRPLAYR  648
            +RIIMP+SI KHG NWK+VDYLIF+TYIWWM +   KVLRGSFD+GATEYDE++ P+AY 
Sbjct  230  DRIIMPESISKHGSNWKDVDYLIFDTYIWWMTSIYTKVLRGSFDEGATEYDEIELPIAYE  289

Query  647  KVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETSPILNTSMPLNV  468
            + L TW+ WV++NVDP  T VFF SMSP H+KS DW+NP GIKCAKET+PILN + PL V
Sbjct  290  RTLRTWANWVEQNVDPKHTSVFFSSMSPTHVKSEDWDNPEGIKCAKETTPILNKTKPLEV  349

Query  467  GTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPTTY  288
            GT+++LF IA N+TR+MK PV+FLN+T LSEYRKDAHTS++T   GK+L+ EQ++DP  Y
Sbjct  350  GTNHQLFRIAVNVTRSMKVPVYFLNVTTLSEYRKDAHTSIYTAVDGKLLSTEQKSDPAKY  409

Query  287  ADCIHWCLPGLPDTWNEFLYSHIISRS  207
            ADC+HWCLPGLPDTWNE LY++IISRS
Sbjct  410  ADCLHWCLPGLPDTWNELLYTYIISRS  436



>ref|XP_002468038.1| hypothetical protein SORBIDRAFT_01g038450 [Sorghum bicolor]
 gb|EER95036.1| hypothetical protein SORBIDRAFT_01g038450 [Sorghum bicolor]
Length=564

 Score =   323 bits (829),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 145/217 (67%), Positives = 177/217 (82%), Gaps = 1/217 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P +HS+ +R+I   +I KH +NW  VDYL+FNTYIWW+NT  MKVL+GSFD+G+TE
Sbjct  339  NSDNPKVHSVPDRVIQWHAIAKHARNWVGVDYLVFNTYIWWLNTLDMKVLKGSFDQGSTE  398

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y EVDRP+AY++VL TW+KWVD+N+DPNRT VFFM MSP HI    W N  GIKCA ET 
Sbjct  399  YVEVDRPVAYKEVLKTWAKWVDRNIDPNRTTVFFMGMSPNHITPEAWGNQGGIKCAMETL  458

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            PI N S  L+VGTD+RL++ A  +  T+++ PVHF++IT LSE RKDAHTSVHT+RQGK+
Sbjct  459  PITNRSASLDVGTDWRLYAGAREVLPTLRRVPVHFVDITALSELRKDAHTSVHTLRQGKL  518

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            LTPEQQADP TYADCIHWCLPGLPDTWN+FLY+ I S
Sbjct  519  LTPEQQADPKTYADCIHWCLPGLPDTWNQFLYARIAS  555



>gb|EMT15412.1| hypothetical protein F775_14841 [Aegilops tauschii]
Length=406

 Score =   318 bits (815),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 179/220 (81%), Gaps = 2/220 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLR-GSFDKGAT  684
            NSD+P +HS+ +R+I   SI KH KNW +VDYL+FNTYIWW++   MKVL+ GSFD+GAT
Sbjct  181  NSDNPKVHSVPDRVIQWHSIAKHAKNWVSVDYLVFNTYIWWLSALDMKVLKKGSFDEGAT  240

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            EY+EVDRP+AY +VL TW+KWVD+N+DPN T VFFM MSP HI    W N  GIKCA ET
Sbjct  241  EYEEVDRPVAYSEVLKTWAKWVDRNIDPNSTTVFFMGMSPNHITPEAWGNEGGIKCAMET  300

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGK  327
             PI N S  L+VGTD+RL++ A ++ +T ++ PVHF++IT LSE RKDAHTSVHT+RQGK
Sbjct  301  QPIANRSATLDVGTDWRLYAGAQDVLKTFRRVPVHFVDITALSELRKDAHTSVHTLRQGK  360

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            +LTPEQQA+P TYADCIHWCLPGLPDTWN+FLY+ I+S +
Sbjct  361  LLTPEQQANPKTYADCIHWCLPGLPDTWNQFLYARIVSSA  400



>ref|XP_004984857.1| PREDICTED: uncharacterized protein LOC101774323 [Setaria italica]
Length=558

 Score =   322 bits (826),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 177/217 (82%), Gaps = 1/217 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P +HS+ +R+I   +I KH +NW  VDYL+FNTYIWW+NT  MKVL+GSFD+G+TE
Sbjct  335  NSDNPKVHSVPDRVIQWHAIAKHARNWVGVDYLVFNTYIWWLNTLDMKVLKGSFDQGSTE  394

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y EVDRP+AY++VL TW+KWVD+N+DPN+T VFFM MSP HI    W N  GIKCA ET 
Sbjct  395  YVEVDRPVAYKEVLKTWAKWVDRNIDPNKTTVFFMGMSPNHITPEAWGNQGGIKCAMETL  454

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            PI N S  L+VGTD+RL++ A  +  T+++ PVHF++IT LSE RKDAHTSVHT+RQGK+
Sbjct  455  PITNRSTSLDVGTDWRLYAGAQEVLPTLRRVPVHFVDITALSELRKDAHTSVHTLRQGKL  514

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            LTPEQQADP TYADCIHWCLPGLPDTWN+FLY+ I S
Sbjct  515  LTPEQQADPKTYADCIHWCLPGLPDTWNQFLYARIAS  551



>gb|EEE58859.1| hypothetical protein OsJ_10454 [Oryza sativa Japonica Group]
Length=507

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 176/217 (81%), Gaps = 1/217 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P +HS+ +R+I   SI KH  NW  VDYLIFNTYIWW+NT  MKVL+GSFD+GATE
Sbjct  284  NSDNPQVHSVPDRVIQWHSIAKHAHNWLGVDYLIFNTYIWWLNTLDMKVLKGSFDQGATE  343

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y EVDRP+AY++VL TW+KWVD+N+DPNRT VFFMSMSP HI    W N  GIKCA ET 
Sbjct  344  YVEVDRPVAYKEVLKTWAKWVDRNIDPNRTTVFFMSMSPNHITPEAWGNYGGIKCAMETL  403

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            PI N +  L+VGTD+RL++ A  + +T ++ PVH ++IT LSE RKDAHTSVHT+RQGK+
Sbjct  404  PITNRTTSLDVGTDWRLYAGAQEVLQTFRRVPVHLVDITALSELRKDAHTSVHTLRQGKL  463

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            LTPEQQ+DP TYADCIHWCLPGLPDTWN+FLY+ I S
Sbjct  464  LTPEQQSDPKTYADCIHWCLPGLPDTWNQFLYARIAS  500



>ref|XP_006649910.1| PREDICTED: protein YLS7-like [Oryza brachyantha]
Length=553

 Score =   322 bits (824),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 145/217 (67%), Positives = 176/217 (81%), Gaps = 1/217 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P +HS+ +R+I   SI KH  NW  VDYLIFNTYIWW+NT  MKVL+GSFD+GATE
Sbjct  331  NSDNPQVHSVPDRVIQWHSIAKHAHNWLGVDYLIFNTYIWWLNTLDMKVLKGSFDQGATE  390

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y EVDRP+AY++VL TW+KW+D+N+DPNRT VFFMSMSP HI    W N  GIKCA ET 
Sbjct  391  YVEVDRPVAYKEVLKTWAKWIDRNIDPNRTTVFFMSMSPNHITPEAWGNYGGIKCAMETL  450

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            PI N +  L+VGTD+RL++ A  + +T+++ PVH ++IT LSE RKDAHTSVHT+RQGK+
Sbjct  451  PITNRTTSLDVGTDWRLYAGAQEVLQTLRRVPVHLVDITALSELRKDAHTSVHTLRQGKL  510

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            LTPEQQADP  YADCIHWCLPGLPDTWN+FLY+ I S
Sbjct  511  LTPEQQADPKKYADCIHWCLPGLPDTWNQFLYARIAS  547



>gb|ABF95402.1| expressed protein [Oryza sativa Japonica Group]
 gb|EAY89585.1| hypothetical protein OsI_11114 [Oryza sativa Indica Group]
Length=558

 Score =   322 bits (824),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 176/217 (81%), Gaps = 1/217 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P +HS+ +R+I   SI KH  NW  VDYLIFNTYIWW+NT  MKVL+GSFD+GATE
Sbjct  335  NSDNPQVHSVPDRVIQWHSIAKHAHNWLGVDYLIFNTYIWWLNTLDMKVLKGSFDQGATE  394

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y EVDRP+AY++VL TW+KWVD+N+DPNRT VFFMSMSP HI    W N  GIKCA ET 
Sbjct  395  YVEVDRPVAYKEVLKTWAKWVDRNIDPNRTTVFFMSMSPNHITPEAWGNYGGIKCAMETL  454

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            PI N +  L+VGTD+RL++ A  + +T ++ PVH ++IT LSE RKDAHTSVHT+RQGK+
Sbjct  455  PITNRTTSLDVGTDWRLYAGAQEVLQTFRRVPVHLVDITALSELRKDAHTSVHTLRQGKL  514

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            LTPEQQ+DP TYADCIHWCLPGLPDTWN+FLY+ I S
Sbjct  515  LTPEQQSDPKTYADCIHWCLPGLPDTWNQFLYARIAS  551



>ref|NP_001049800.1| Os03g0291800 [Oryza sativa Japonica Group]
 dbj|BAF11714.1| Os03g0291800, partial [Oryza sativa Japonica Group]
Length=574

 Score =   322 bits (825),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 176/217 (81%), Gaps = 1/217 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P +HS+ +R+I   SI KH  NW  VDYLIFNTYIWW+NT  MKVL+GSFD+GATE
Sbjct  351  NSDNPQVHSVPDRVIQWHSIAKHAHNWLGVDYLIFNTYIWWLNTLDMKVLKGSFDQGATE  410

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y EVDRP+AY++VL TW+KWVD+N+DPNRT VFFMSMSP HI    W N  GIKCA ET 
Sbjct  411  YVEVDRPVAYKEVLKTWAKWVDRNIDPNRTTVFFMSMSPNHITPEAWGNYGGIKCAMETL  470

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            PI N +  L+VGTD+RL++ A  + +T ++ PVH ++IT LSE RKDAHTSVHT+RQGK+
Sbjct  471  PITNRTTSLDVGTDWRLYAGAQEVLQTFRRVPVHLVDITALSELRKDAHTSVHTLRQGKL  530

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            LTPEQQ+DP TYADCIHWCLPGLPDTWN+FLY+ I S
Sbjct  531  LTPEQQSDPKTYADCIHWCLPGLPDTWNQFLYARIAS  567



>ref|XP_009384920.1| PREDICTED: protein trichome birefringence-like 28 [Musa acuminata 
subsp. malaccensis]
Length=477

 Score =   317 bits (811),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/217 (67%), Positives = 174/217 (80%), Gaps = 7/217 (3%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +HSI NR+I   SI KHGK+WK VDYLIFNTYIWWMNT  M+VLRG      TE
Sbjct  264  NSDDPKVHSIRNRVIT-NSIAKHGKHWKGVDYLIFNTYIWWMNTPEMRVLRG------TE  316

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y +VDRP+AYR+VL TW+KWV +NVDP +T VFFMS SP H++S DW NP+G+KCA ET 
Sbjct  317  YSKVDRPVAYRRVLRTWAKWVRRNVDPEKTMVFFMSASPNHMRSQDWGNPDGVKCAMETM  376

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+ NTS  L +GTD+RLF+   ++ R+M+ PV F+ IT +SE RKDAHT+VHT+RQGK+L
Sbjct  377  PVTNTSRRLAIGTDWRLFAEEESVVRSMRLPVSFVRITAMSELRKDAHTAVHTLRQGKLL  436

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            T EQQADP TYADCIHWCLPGLPDTWNEFL++ I SR
Sbjct  437  TAEQQADPATYADCIHWCLPGLPDTWNEFLFARIASR  473



>gb|KDO36034.1| hypothetical protein CISIN_1g038968mg, partial [Citrus sinensis]
Length=206

 Score =   307 bits (786),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP MHSILNRIIMP+SI KHG+NWKNVDYLIFNTYIWWMNTFSMKVLRGSFD+GATE
Sbjct  33   NSDDPNMHSILNRIIMPESINKHGQNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDEGATE  92

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AY +VL TWSKWV++NVDPNRT VFF S SPLHIKSLDWENP+GIKCA ET+
Sbjct  93   YDEIERPVAYARVLKTWSKWVEQNVDPNRTTVFFGSTSPLHIKSLDWENPDGIKCALETT  152

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTI  339
            PI N SMPLNVGTD RLF +ASN+TR+MK PVHF+NIT LSEYRKD HT+V+TI
Sbjct  153  PITNLSMPLNVGTDRRLFVVASNVTRSMKVPVHFINITTLSEYRKDGHTAVYTI  206



>ref|XP_011095058.1| PREDICTED: protein ESKIMO 1-like [Sesamum indicum]
Length=437

 Score =   315 bits (807),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 177/218 (81%), Gaps = 0/218 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP  HSI  RIIMP+SI KHG +WK+ D+L+FNTYIWWMN+ ++KVLRGSF++G+ E
Sbjct  220  NSDDPRNHSISQRIIMPESISKHGIHWKSADFLVFNTYIWWMNSHTIKVLRGSFEQGSAE  279

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++R  AY +VL+TW+ W+  N D NRT  FF+SMSP+H +S +W + +G+ CA+ET+
Sbjct  280  YDEIERTTAYERVLTTWANWLISNADHNRTSAFFISMSPVHQQSSNWNDLDGVACARETT  339

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILNTSM L++GTD RL  I  N+ +    PV  ++IT LSEYRKD HTSV+TIRQGK+L
Sbjct  340  PILNTSMALDMGTDRRLLHITRNVIKATNTPVTLVDITTLSEYRKDGHTSVYTIRQGKLL  399

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPE++ADP T+ADC+HWCLPG+PDTWNE LY+HIISRS
Sbjct  400  TPEEKADPATFADCLHWCLPGVPDTWNELLYAHIISRS  437



>dbj|BAK06255.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=571

 Score =   318 bits (816),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 144/218 (66%), Positives = 177/218 (81%), Gaps = 2/218 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLR-GSFDKGAT  684
            NSD+P +HS+ +R+I   SI KH  NW  VDYL+FNTYIWW++   MKVL+ GSFD+GAT
Sbjct  344  NSDNPKVHSVPDRVIQWHSIAKHANNWLGVDYLVFNTYIWWLSALDMKVLKKGSFDEGAT  403

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            EY+EVDRP+AY +VL TW+KWVD+N+DPNRT VFFM MSP HI    W N  GIKCA ET
Sbjct  404  EYEEVDRPVAYSEVLKTWAKWVDRNIDPNRTTVFFMGMSPNHITPEAWGNQGGIKCAMET  463

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGK  327
             PI N S  L+VGTD+RL++ A ++ +T ++ PVHF++IT LSE RKDAHTSVHT+RQGK
Sbjct  464  LPITNRSATLDVGTDWRLYAGAQDVIKTFRRVPVHFVDITALSELRKDAHTSVHTLRQGK  523

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            +LTPE+QA+P TYADCIHWCLPGLPDTWNEFLY+ I+S
Sbjct  524  LLTPEEQANPKTYADCIHWCLPGLPDTWNEFLYARIVS  561



>gb|KDP44746.1| hypothetical protein JCGZ_01246 [Jatropha curcas]
Length=304

 Score =   310 bits (793),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 172/207 (83%), Gaps = 0/207 (0%)
 Frame = -1

Query  827  NRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATEYDEVDRPLAYR  648
            +R+IM +SI KHG NWK+VDYLIFN+YIWWM +   KVLRG     A EYDEV+ P+AY 
Sbjct  98   DRMIMAESISKHGNNWKDVDYLIFNSYIWWMTSIYTKVLRGPLADAAMEYDEVELPIAYE  157

Query  647  KVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETSPILNTSMPLNV  468
            +VL TW+KWV++NV+P +T VFF SMSP HIKSLDW+NP+GIKCAKET+PILN + PL V
Sbjct  158  RVLRTWAKWVEENVNPKQTSVFFSSMSPTHIKSLDWDNPDGIKCAKETTPILNRTKPLEV  217

Query  467  GTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPTTY  288
            GT+++LF+IA N+T++MK PV+FLNIT LSEYRKDAHTS++T   GK+L PEQ++DP  Y
Sbjct  218  GTNHQLFNIAVNVTQSMKIPVYFLNITSLSEYRKDAHTSIYTAVDGKLLLPEQKSDPAKY  277

Query  287  ADCIHWCLPGLPDTWNEFLYSHIISRS  207
            ADC+HWCLPGLPDTWNE LY+ I+S S
Sbjct  278  ADCLHWCLPGLPDTWNELLYTRIVSFS  304



>gb|KJB76209.1| hypothetical protein B456_012G077500 [Gossypium raimondii]
Length=430

 Score =   312 bits (800),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/219 (66%), Positives = 176/219 (80%), Gaps = 1/219 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P  HSI +RII P+SIK +G +WK VDYLIFNTYIWWMN+  MKVLRGSFD    E
Sbjct  212  NSDNPWRHSIKDRIIKPESIKNNGDDWKGVDYLIFNTYIWWMNSGYMKVLRGSFDAEPVE  271

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AY +V+  W+KWVD+NVD   T V+FMSMSP HIKS DW NP+GI CA ET 
Sbjct  272  YDEIERPIAYGRVVKRWAKWVDENVDSKFTSVYFMSMSPTHIKSSDWNNPDGILCANETL  331

Query  500  PILNTSM-PLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P+ N S+ P  +GTDYR   I +++ ++M+ PV+F+NIT +SEYRKDAHTSV+T RQG++
Sbjct  332  PMTNLSIPPPYIGTDYRALQIVADVIQSMEVPVNFINITAMSEYRKDAHTSVYTTRQGQL  391

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            +T EQQADP TYADCIHWCLPGLPDTWNE LY+HIIS S
Sbjct  392  ITKEQQADPATYADCIHWCLPGLPDTWNELLYTHIISHS  430



>gb|KFK36903.1| hypothetical protein AALP_AA4G187800 [Arabis alpina]
Length=414

 Score =   311 bits (798),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 176/228 (77%), Gaps = 10/228 (4%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD P MHS+ +RI+ P+SI+KHG NWKNVD+L+FN+YIWWM   S+KV R SFD+G TE
Sbjct  187  NSDGPGMHSVNDRIVAPESIEKHGVNWKNVDFLVFNSYIWWMKRASIKVRRRSFDEGDTE  246

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+   +AY ++L T   WVD N+DP  T +FFMSMSP H +SLDW N +GI CA ET 
Sbjct  247  YDEIPNLIAYERMLRTLGDWVDHNIDPLNTTIFFMSMSPHHRRSLDWGNHDGIMCALETM  306

Query  500  PILNTSMPLNVGTD----------YRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTS  351
            PILN S+ +NVGTD          Y LFS+  N+TR++K P+HFLNIT+LSEYRKDAHTS
Sbjct  307  PILNKSIKVNVGTDNKLYSEIGTAYSLFSVVENVTRSLKVPIHFLNITELSEYRKDAHTS  366

Query  350  VHTIRQGKMLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            V+T RQ K+LT EQQ DP +YADCIHWCLPGLPDTWNE LY+HIIS+S
Sbjct  367  VYTTRQSKLLTREQQNDPASYADCIHWCLPGLPDTWNELLYAHIISKS  414



>ref|XP_006655224.1| PREDICTED: protein YLS7-like, partial [Oryza brachyantha]
Length=327

 Score =   305 bits (782),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 175/218 (80%), Gaps = 2/218 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRG-SFDKGAT  684
            NSDDP +HSI++RII P SI KH  NW+ VDYLIFNTYIWWMNT  MK+LRG SF K   
Sbjct  94   NSDDPNIHSIVDRIIKPTSIAKHAANWEGVDYLIFNTYIWWMNTPEMKILRGGSFSKKPV  153

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            +YDE++R  AYRKVL TWS+WV+K+VDP +T VFFMS+SP+H+++  W  P+ IKC  ET
Sbjct  154  KYDEMERVAAYRKVLKTWSRWVEKHVDPKKTTVFFMSVSPVHMQNEGWGRPDVIKCFSET  213

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGK  327
             P +N +  L +GTD+ LFS+A  +T+ MK+ PVHF+NIT LSE RKDAHTSVHT+RQGK
Sbjct  214  QPAINYNKTLELGTDWDLFSMAQRVTKAMKRVPVHFINITALSEIRKDAHTSVHTLRQGK  273

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            +LT EQ+A+P  +ADCIHWCLPGLPDTWNEF+Y HI+S
Sbjct  274  LLTAEQKANPRKFADCIHWCLPGLPDTWNEFVYGHIVS  311



>ref|XP_002311232.2| hypothetical protein POPTR_0008s07000g [Populus trichocarpa]
 gb|EEE88599.2| hypothetical protein POPTR_0008s07000g [Populus trichocarpa]
Length=446

 Score =   309 bits (792),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 175/208 (84%), Gaps = 1/208 (0%)
 Frame = -1

Query  827  NRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRG-SFDKGATEYDEVDRPLAY  651
            +R+IMP+SI KHG +WKNVDYLIFNTYIWWM +   KVLRG SF +G  EYDEV+ P+AY
Sbjct  239  DRVIMPESISKHGDDWKNVDYLIFNTYIWWMTSIYSKVLRGGSFVEGPIEYDEVELPIAY  298

Query  650  RKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETSPILNTSMPLN  471
             +VL TW+KWV++NVDP  + VFF SMSP H ++LDW+NP+GIKC+ ET PILN S P +
Sbjct  299  ERVLRTWAKWVEENVDPKHSSVFFSSMSPTHARNLDWDNPDGIKCSNETKPILNKSKPFD  358

Query  470  VGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPTT  291
            VGT+ +LF+IA N+TR+MK PV+FLN+T LSEYRKDAHTS++T  +GK+L+PE+++DP  
Sbjct  359  VGTNRQLFAIAVNVTRSMKVPVNFLNVTTLSEYRKDAHTSIYTAIEGKLLSPEEKSDPLK  418

Query  290  YADCIHWCLPGLPDTWNEFLYSHIISRS  207
            YADC+HWCLPGLPDTWNE LY++IISR+
Sbjct  419  YADCLHWCLPGLPDTWNELLYTYIISRT  446



>ref|XP_002316203.2| hypothetical protein POPTR_0010s19460g [Populus trichocarpa]
 gb|EEF02374.2| hypothetical protein POPTR_0010s19460g [Populus trichocarpa]
Length=470

 Score =   310 bits (793),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 178/219 (81%), Gaps = 1/219 (0%)
 Frame = -1

Query  860  NSDDPTMH-SILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGAT  684
            NSD PTM     + IIMP+SI KHG+NWK+VDYLIFNTY WW+   +MKVLRGSFD+G  
Sbjct  252  NSDPPTMRDGKSDAIIMPESISKHGRNWKDVDYLIFNTYNWWLKYPTMKVLRGSFDEGTA  311

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            EYDE++R +AY +VL TW+KWV++NVDP RT +F+ S+ P H +S DW +P+GI CAKET
Sbjct  312  EYDEIERHIAYERVLRTWAKWVEENVDPTRTSIFYSSLFPQHFRSSDWNSPDGINCAKET  371

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
             PILN + P++V TD ++F+IA+N+ R+MK PVHFLN+T LSEYRKDAHTSV+T R GK+
Sbjct  372  MPILNRTTPVDVSTDRQVFAIAANVARSMKVPVHFLNVTTLSEYRKDAHTSVYTARDGKL  431

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            L+PEQ+++P  YADC+HWCLPG+PDTWNE LY+ II+ S
Sbjct  432  LSPEQRSNPGVYADCLHWCLPGVPDTWNELLYARIIALS  470



>ref|XP_004958797.1| PREDICTED: uncharacterized protein LOC101786797 [Setaria italica]
Length=492

 Score =   310 bits (794),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/227 (63%), Positives = 178/227 (78%), Gaps = 11/227 (5%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGS-----FD  696
            NSDDP +HS+++R+I  ++I KH  NWK VDYLIFNTYIWW+NTF MKVL+GS      +
Sbjct  257  NSDDPQVHSVMDRVIAWRAIAKHANNWKGVDYLIFNTYIWWLNTFEMKVLKGSGALRNHN  316

Query  695  KGA----TEYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPN  528
            KGA    ++Y  VDRP+AYR+VL TW+KWVD+++DPNRT VFFM MSP HI    W N  
Sbjct  317  KGAAGGWSKYALVDRPVAYREVLKTWAKWVDRHIDPNRTTVFFMGMSPNHITPWAWGNGG  376

Query  527  GIKCAKETSPILNTSMPLNVGTDYRLFSIASNI-TRTMKK-PVHFLNITKLSEYRKDAHT  354
            GIKCA ET PI+N + PLN+GTD+RL  +A  +  R +++ PVH ++IT LSE RKDAHT
Sbjct  377  GIKCAMETQPIVNRTEPLNIGTDWRLHGVARGVLARHLRRVPVHLVDITALSELRKDAHT  436

Query  353  SVHTIRQGKMLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            SVHT+RQGK+LTPEQQADP TYADCIHWCLPGLPDTWN F+Y+ I+S
Sbjct  437  SVHTLRQGKLLTPEQQADPKTYADCIHWCLPGLPDTWNHFIYARIVS  483



>dbj|BAJ91172.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=487

 Score =   309 bits (792),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 173/218 (79%), Gaps = 2/218 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVL-RGSFDKGAT  684
            NSDDP +HSI +R+I P SI KH  NW  VDYLIFNTYIWWMNT  MK++  GSF K   
Sbjct  257  NSDDPDIHSITDRMITPTSIAKHAANWIGVDYLIFNTYIWWMNTPKMKIVPDGSFTKKPV  316

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            +YDE+DR +AYR++L TWS WV++NVDP RT V FMS+SP+H++S  W +PN IKC  ET
Sbjct  317  KYDELDRVVAYRQILETWSGWVEENVDPKRTMVLFMSVSPVHMQSEGWGSPNNIKCFSET  376

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGK  327
             P LN S PL+VGTD+ LF+ +  +T+ MKK PVHF+NIT LSE RKDAHTSVHT+RQGK
Sbjct  377  QPALNYSKPLDVGTDWDLFTESHEVTKAMKKVPVHFINITALSEIRKDAHTSVHTLRQGK  436

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            +LT EQQA+P  +ADCIHWCLPGLPDTWNEF+Y HI+S
Sbjct  437  LLTKEQQANPRKFADCIHWCLPGLPDTWNEFIYGHIVS  474



>ref|XP_011035915.1| PREDICTED: protein trichome birefringence-like 28 [Populus euphratica]
Length=470

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 179/219 (82%), Gaps = 1/219 (0%)
 Frame = -1

Query  860  NSDDPTMH-SILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGAT  684
            NSD PTM     + IIMP+SI KHG+NWK+VDYLIFNTY WW+   +MKVLRGSFD+G T
Sbjct  252  NSDPPTMRDGKSDAIIMPESISKHGRNWKDVDYLIFNTYNWWLKYPTMKVLRGSFDEGTT  311

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            EYDE++R +AY +VL TW+KWV++NVDP RT +F+ S+ P H +S DW +P+G+ CAKET
Sbjct  312  EYDEIERHIAYERVLRTWAKWVEENVDPTRTSIFYSSLFPQHFRSSDWNDPDGVNCAKET  371

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
             PIL+ + P+NV  D ++F+IA+N+TR+MK PVHFLN+T LSEYRKDAHTSV+T R GK+
Sbjct  372  MPILSRTAPVNVSADRQVFAIAANVTRSMKVPVHFLNVTTLSEYRKDAHTSVYTARDGKL  431

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            L+PEQ+++P  +ADC+HWCLPG+PDTWNE LY+ II+ S
Sbjct  432  LSPEQRSNPGIHADCLHWCLPGVPDTWNELLYARIIALS  470



>dbj|BAJ96952.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=486

 Score =   309 bits (791),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 173/218 (79%), Gaps = 2/218 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVL-RGSFDKGAT  684
            NSDDP +HSI +R+I P SI KH  NW  VDYLIFNTYIWWMNT  MK++  GSF K   
Sbjct  256  NSDDPDIHSITDRMITPTSIAKHAANWIGVDYLIFNTYIWWMNTPKMKIVPDGSFTKKPV  315

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            +YDE+DR +AYR++L TWS WV++NVDP RT V FMS+SP+H++S  W +PN IKC  ET
Sbjct  316  KYDELDRVVAYRQILETWSGWVEENVDPKRTMVLFMSVSPVHMQSEGWGSPNNIKCFSET  375

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGK  327
             P LN S PL+VGTD+ LF+ +  +T+ MKK PVHF+NIT LSE RKDAHTSVHT+RQGK
Sbjct  376  QPALNYSKPLDVGTDWDLFTESHEVTKAMKKVPVHFINITALSEIRKDAHTSVHTLRQGK  435

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            +LT EQQA+P  +ADCIHWCLPGLPDTWNEF+Y HI+S
Sbjct  436  LLTKEQQANPRKFADCIHWCLPGLPDTWNEFIYGHIVS  473



>ref|XP_011048808.1| PREDICTED: protein ESKIMO 1-like isoform X2 [Populus euphratica]
Length=444

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 174/208 (84%), Gaps = 1/208 (0%)
 Frame = -1

Query  827  NRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRG-SFDKGATEYDEVDRPLAY  651
            +R+IMP+SI KHG +WKNVDYLIFNTYIWWM +   KVLRG SF +G  EYDEV+ P+AY
Sbjct  237  DRVIMPESISKHGDDWKNVDYLIFNTYIWWMTSIYTKVLRGGSFVEGPMEYDEVELPIAY  296

Query  650  RKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETSPILNTSMPLN  471
             +VL TW++WV++NVDP  + VFF SMSP H ++LDW+NP GIKC+ ET PILN S P +
Sbjct  297  ERVLRTWARWVEENVDPKNSSVFFSSMSPTHARNLDWDNPAGIKCSNETKPILNKSKPFD  356

Query  470  VGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPTT  291
            VGT+ +LF+IA N+TR+MK PV+FLN+T LSEYRKDAHTS++T  +GK+L+PE+++DP  
Sbjct  357  VGTNRQLFAIAVNVTRSMKVPVNFLNVTTLSEYRKDAHTSIYTAIEGKLLSPEKKSDPLK  416

Query  290  YADCIHWCLPGLPDTWNEFLYSHIISRS  207
            YADC+HWCLPGLPDTWNE LY++IISR+
Sbjct  417  YADCLHWCLPGLPDTWNELLYTYIISRT  444



>gb|EEE63378.1| hypothetical protein OsJ_18190 [Oryza sativa Japonica Group]
Length=491

 Score =   308 bits (790),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 174/218 (80%), Gaps = 2/218 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRG-SFDKGAT  684
            NSDDP MHSI++RII P SI KH  NW+ VDYLIFNTYIWWMNT  MK+L G SF K   
Sbjct  258  NSDDPNMHSIVDRIIKPTSIAKHAANWEGVDYLIFNTYIWWMNTPEMKILHGGSFSKKPV  317

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            +YDE++R  AYRKVL TWS+WV+K+VDP R+ VFFMS+SP+H++S  W  P+ IKC  ET
Sbjct  318  KYDEMERVAAYRKVLKTWSRWVEKHVDPKRSTVFFMSVSPVHMQSEGWGKPDAIKCFSET  377

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGK  327
             P +N +  L VGTD+ LFS A ++T+ MK+ PVHF+NIT LSE RKDAHTSV+T+RQGK
Sbjct  378  QPAINYTKKLEVGTDWDLFSTAHHVTKAMKRVPVHFINITALSEIRKDAHTSVNTLRQGK  437

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            +LT EQ+A+P  +ADCIHWCLPGLPDTWNEF+Y HI+S
Sbjct  438  LLTKEQKANPRKFADCIHWCLPGLPDTWNEFIYGHIVS  475



>gb|EMS47917.1| hypothetical protein TRIUR3_14971 [Triticum urartu]
Length=351

 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 173/218 (79%), Gaps = 2/218 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVL-RGSFDKGAT  684
            NSDDP +HSI +R+I P SI KH  NW  VDYLIFNTYIWWMNT  MK++  GSF +   
Sbjct  121  NSDDPDIHSITDRMITPTSIAKHAANWIGVDYLIFNTYIWWMNTPKMKIVPDGSFTRKPV  180

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            +YDE+DR +AYR++L TWS WV++NVDP RT V FMS+SP+H++S  W +P+ IKC  ET
Sbjct  181  KYDELDRVVAYRQILETWSGWVEENVDPKRTMVLFMSVSPVHMQSEGWGSPDNIKCFSET  240

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGK  327
             P+LN +  L+VGTD+ LF+ +  +T+ MKK PVHF+NIT LSE RKDAHTSVHT+RQGK
Sbjct  241  QPVLNYTKTLDVGTDWDLFTESHEVTKAMKKVPVHFINITALSEIRKDAHTSVHTLRQGK  300

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            +LT EQQA+P  +ADCIHWCLPGLPDTWNEF+Y HI+S
Sbjct  301  LLTKEQQANPRKFADCIHWCLPGLPDTWNEFIYGHIVS  338



>ref|XP_009402384.1| PREDICTED: protein ESKIMO 1-like [Musa acuminata subsp. malaccensis]
Length=550

 Score =   308 bits (788),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 173/217 (80%), Gaps = 6/217 (3%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            N+DDP +HS+ NR+I   SI KHGK+WK VDYLIFNTYIWWMNT  M VLRGS     T+
Sbjct  317  NADDPRIHSVPNRVIT-NSIAKHGKHWKGVDYLIFNTYIWWMNTPKMTVLRGS-----TK  370

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y  ++R  AYR+VL  W++WV +NV+P +T VFFMS+SP H++S DW+NP GIKCA ET 
Sbjct  371  YSRIERAAAYRRVLRIWARWVHRNVNPKKTMVFFMSLSPNHMRSEDWDNPEGIKCALETM  430

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+ + S PL VGTD+RLF++  ++ ++M+ PV F+ IT LSE+RKDAHTSVHT+RQGK+L
Sbjct  431  PVTDMSRPLEVGTDWRLFAVEESVIQSMRLPVSFIKITALSEFRKDAHTSVHTLRQGKLL  490

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            T EQQADP T+ADCIHWCLPGLPDTWNEFLY+ I SR
Sbjct  491  TAEQQADPATFADCIHWCLPGLPDTWNEFLYARIASR  527



>emb|CDY07619.1| BnaA03g18920D [Brassica napus]
Length=815

 Score =   314 bits (805),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP  HSI++RIIMP+SI+KH  NWK+VD+L+FN+YIWWMNT S+KVLRGSFD+G TE
Sbjct  189  NSDDPRKHSIIDRIIMPESIEKHAVNWKDVDFLVFNSYIWWMNTVSIKVLRGSFDEGDTE  248

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+ RP+AY +VL TW  WVD ++DP RT VFFMSMSPLHIKS DW NP+GI CA ET+
Sbjct  249  YDEIRRPIAYERVLRTWGDWVDHHIDPLRTTVFFMSMSPLHIKSSDWGNPDGILCALETT  308

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN SM  N+GTDYRLFS   N+T++MK P+ FLNIT LSEYRKDAHTSV+TI+QGK+L
Sbjct  309  PILNKSMVFNIGTDYRLFSSVENVTQSMKVPIRFLNITALSEYRKDAHTSVYTIKQGKLL  368

Query  320  TPEQQADPTTYADCIHWCLPGLP  252
            T EQQ DP TYADCIHW L   P
Sbjct  369  TQEQQNDPATYADCIHWDLTSEP  391


 Score =   251 bits (640),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 153/209 (73%), Gaps = 4/209 (2%)
 Frame = -1

Query  821  IIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVL-RGSFDKGATEYDEVDRPLAYRK  645
            IIMP SI KHG+NWK+ D+L+FNTYIWW     +KVL +GSF   + E +EV   + Y +
Sbjct  607  IIMPGSISKHGENWKDADFLVFNTYIWWTRHSKIKVLTQGSFSNESKESNEVGIYITYEE  666

Query  644  VLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGI--KCAKETSPILNTSMPLN  471
            VL TW  W+++N+DPNRT VFF SMSP H++S DW+   G+  KC KET PIL+ S P+ 
Sbjct  667  VLRTWKNWLEQNIDPNRTSVFFSSMSPTHVRSSDWDVSGGVTRKCEKETEPILDMSKPVA  726

Query  470  VGTDYRLFSIASNITR-TMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPT  294
            VGT+ RL  IA N+T+ T K  V FLN+T +SEYRKDAHTS +  R G++LTP Q++DP 
Sbjct  727  VGTNRRLQEIAVNVTKSTTKVHVTFLNLTTMSEYRKDAHTSFYGSRSGRLLTPVQKSDPR  786

Query  293  TYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            T+ADC HWCLPGLPDTWNEFL  +II RS
Sbjct  787  TFADCYHWCLPGLPDTWNEFLSLYIIHRS  815



>ref|XP_008654511.1| PREDICTED: protein trichome birefringence-like 28 [Zea mays]
 tpg|DAA44851.1| TPA: putative DUF231 domain containing family protein [Zea mays]
Length=555

 Score =   306 bits (784),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 177/221 (80%), Gaps = 5/221 (2%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLR--GSFD-KG  690
            NSD+P +HS+ +R+I   +I KH +NW  VDYL+FNTYIWW+NT  +KVL+   SFD +G
Sbjct  324  NSDNPKVHSVPDRVIQWHAIAKHARNWIGVDYLVFNTYIWWLNTLDIKVLKQGSSFDDQG  383

Query  689  ATEYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAK  510
            +TEY EVDRP+AY++VL+TW+KWVD+N+DPNRT VFFM MSP HI    W N  GIKCA 
Sbjct  384  STEYVEVDRPVAYKEVLTTWAKWVDRNIDPNRTTVFFMGMSPNHITPEAWGNKGGIKCAM  443

Query  509  ETSPIL-NTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIR  336
            ET PI  N S  L+VGTD+RL++ A  +  T+++ PVHF++IT LSE RKDAHTSVHT+R
Sbjct  444  ETLPIASNRSAALDVGTDWRLYAGAREVLPTLRRVPVHFVDITALSELRKDAHTSVHTLR  503

Query  335  QGKMLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            QGK+LTPEQQADP TYADCIHWCLPGLPDTWN+FLY+ I S
Sbjct  504  QGKLLTPEQQADPKTYADCIHWCLPGLPDTWNQFLYARIAS  544



>ref|XP_006435758.1| hypothetical protein CICLE_v10033614mg [Citrus clementina]
 gb|ESR48998.1| hypothetical protein CICLE_v10033614mg [Citrus clementina]
Length=379

 Score =   300 bits (767),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 172/219 (79%), Gaps = 1/219 (0%)
 Frame = -1

Query  860  NSDDPTMH-SILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGAT  684
            N+D PTM    ++ I+MP+SI KHG+NWK VDYLIFNTYIWW    +MKVLRGSFD+GAT
Sbjct  161  NADPPTMRDGKVDPIVMPESITKHGQNWKGVDYLIFNTYIWWTKYPTMKVLRGSFDEGAT  220

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            EYD++D    Y K L TW KWV++NV+PN T VFF S +P H++S D  N NG+KC +ET
Sbjct  221  EYDKIDMYTVYEKTLRTWGKWVEENVNPNLTFVFFSSAAPKHVRSSDRNNVNGVKCVQET  280

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            +PILN +  L VGT+ +LF+IA+N+T++M+ PVHFLNIT LSEYRKDAHTSV+    GKM
Sbjct  281  TPILNRTTRLEVGTNQQLFAIAANVTQSMEVPVHFLNITSLSEYRKDAHTSVYGTAAGKM  340

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            L PEQ +DP TYADC+HWCLPGLPDTWNE LY+ I+S S
Sbjct  341  LLPEQISDPATYADCLHWCLPGLPDTWNELLYARIVSGS  379



>gb|ACG46935.1| hypothetical protein [Zea mays]
Length=523

 Score =   304 bits (778),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 172/218 (79%), Gaps = 2/218 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRG-SFDKGAT  684
            NSDDP +HSI +R+I P SI KH  NW+ VDYLIFNTYIWWMNT  MK L G SF +   
Sbjct  288  NSDDPDIHSISDRMIKPTSIAKHAANWEGVDYLIFNTYIWWMNTPQMKTLHGGSFSRKHV  347

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            +YDE++R  AYRKVL TWS+WV+ +VDP RT V FMS+SP+H++S  W +PN +KC  ET
Sbjct  348  KYDEIERVEAYRKVLKTWSRWVEAHVDPKRTTVLFMSVSPVHMQSEGWGSPNAVKCFSET  407

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGK  327
             P ++ +  L VGTD+ LF+ A  +TR+MKK PVHF+NIT LSE RKDAHTSVHT+RQGK
Sbjct  408  QPAISYNKKLEVGTDWDLFATAQRVTRSMKKVPVHFVNITALSEIRKDAHTSVHTLRQGK  467

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            +LTPEQ+A+P  +ADCIHWCLPG+PDTWNEF+Y HI+S
Sbjct  468  LLTPEQKANPRKFADCIHWCLPGVPDTWNEFVYGHIVS  505



>ref|NP_001130739.1| putative DUF231 domain containing family protein [Zea mays]
 gb|ACF79079.1| unknown [Zea mays]
 gb|ACR36566.1| unknown [Zea mays]
 gb|AFW77729.1| putative DUF231 domain containing family protein [Zea mays]
Length=529

 Score =   304 bits (779),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 172/218 (79%), Gaps = 2/218 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRG-SFDKGAT  684
            NSDDP +HSI +R+I P SI KH  NW+ VDYLIFNTYIWWMNT  MK L G SF +   
Sbjct  292  NSDDPDIHSISDRMIKPTSIAKHAANWEGVDYLIFNTYIWWMNTPQMKTLHGGSFSRKHV  351

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            +YDE++R  AYRKVL TWS+WV+ +VDP RT V FMS+SP+H++S  W +PN +KC  ET
Sbjct  352  KYDEIERVEAYRKVLKTWSRWVEAHVDPKRTTVLFMSVSPVHMQSEGWGSPNAVKCFSET  411

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGK  327
             P ++ +  L VGTD+ LF+ A  +TR+MKK PVHF+NIT LSE RKDAHTSVHT+RQGK
Sbjct  412  QPAISYNKKLEVGTDWDLFATAQRVTRSMKKVPVHFVNITALSEIRKDAHTSVHTLRQGK  471

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            +LTPEQ+A+P  +ADCIHWCLPG+PDTWNEF+Y HI+S
Sbjct  472  LLTPEQKANPRKFADCIHWCLPGVPDTWNEFVYGHIVS  509



>gb|KDO68937.1| hypothetical protein CISIN_1g047865mg, partial [Citrus sinensis]
Length=389

 Score =   299 bits (766),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 171/219 (78%), Gaps = 1/219 (0%)
 Frame = -1

Query  860  NSDDPTMH-SILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGAT  684
            N+D PTM    L+ ++MP+SI KHG+NWK VDYLIFNTYIWW    +MKVLRGSFD+GAT
Sbjct  171  NADPPTMRDGKLDPVVMPESITKHGQNWKGVDYLIFNTYIWWTKYPTMKVLRGSFDEGAT  230

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            EYDE+D    Y K L  W KWV++NV+PN T VFF S +P H++S D  N NG+KC +ET
Sbjct  231  EYDEIDMYTVYEKTLRAWGKWVEENVNPNLTSVFFSSAAPKHVRSSDRNNVNGVKCVEET  290

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            +PI N +  L VGT+ +LF+IA+N+T++M+ PVHFLNIT LSEYRKDAHTSV+    GKM
Sbjct  291  TPIFNRTTRLEVGTNQQLFAIAANVTQSMEVPVHFLNITSLSEYRKDAHTSVYGTAAGKM  350

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            L PEQ ++PTTYADC+HWCLPGLPDTWNE +Y+ I+S S
Sbjct  351  LLPEQISEPTTYADCLHWCLPGLPDTWNELVYARIVSGS  389



>ref|XP_008805163.1| PREDICTED: protein ESKIMO 1-like [Phoenix dactylifera]
Length=405

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 173/218 (79%), Gaps = 3/218 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +HSI  RI+   SI +HG++WK VDYL+FNTYIWWMNT   KVLR    K  T+
Sbjct  182  NSDDPLIHSIPERIVKADSIARHGEHWKGVDYLVFNTYIWWMNTAKFKVLRKKA-KDWTD  240

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E+ R  AYR+VL TWSKWVD+NVDPNRT V+FMSMSP H +S DW NP G+KCAKET 
Sbjct  241  YEEIVRADAYRQVLKTWSKWVDENVDPNRTSVYFMSMSPNHFRSEDWGNPEGVKCAKETL  300

Query  500  PILN-TSMPLNVGTDYRLFSIASNITR-TMKKPVHFLNITKLSEYRKDAHTSVHTIRQGK  327
            P+LN T  PL +GTD  +  +A+N+TR T +  V F++IT LS+YRKDAHTSV+T+RQG+
Sbjct  301  PLLNWTGRPLELGTDREMHGVAANVTRSTGRVAVTFIDITALSQYRKDAHTSVYTVRQGE  360

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            +LTPEQ+ADP TYADCIHWCLPGLPDTWNE LY+ +++
Sbjct  361  LLTPEQKADPRTYADCIHWCLPGLPDTWNELLYARLLA  398



>ref|XP_006486529.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=426

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 172/219 (79%), Gaps = 1/219 (0%)
 Frame = -1

Query  860  NSDDPTMH-SILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGAT  684
            N+D PTM    ++ I+MP+SI KHG+NWK VDYLIFNTYIWW    +MKVLRGSFD+GAT
Sbjct  208  NADPPTMRDGKVDPIVMPESITKHGQNWKGVDYLIFNTYIWWTKYPTMKVLRGSFDEGAT  267

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            EYD++D    Y K L TW KWV++NV+PN T VFF S +P H++S D  N NG+KC +ET
Sbjct  268  EYDKIDMYTVYEKTLRTWGKWVEENVNPNLTFVFFSSAAPKHVRSSDRNNVNGVKCVQET  327

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            +PILN +  L VGT+ +LF+IA+N+T++M+ PVHFLNIT LSEYRKDAHTSV+    GKM
Sbjct  328  TPILNRTTRLEVGTNQQLFAIAANVTQSMEVPVHFLNITSLSEYRKDAHTSVYGTAAGKM  387

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            L PEQ +DP TYADC+HWCLPGLPDTWNE LY+ I+S S
Sbjct  388  LLPEQISDPATYADCLHWCLPGLPDTWNELLYARIVSGS  426



>ref|XP_004962376.1| PREDICTED: uncharacterized protein LOC101758227 [Setaria italica]
Length=527

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 172/218 (79%), Gaps = 2/218 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRG-SFDKGAT  684
            NSDDP +HSI +R+I P SI KH  NW+ VDYLIFNTYIWWMNT  MK + G SF +   
Sbjct  296  NSDDPDIHSISDRMIKPTSIAKHAANWEGVDYLIFNTYIWWMNTPQMKTVHGGSFSRKHV  355

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            +YDEV+R +AYRKVL TWS+WV+ ++DP RT V FMS+SP+H++S  W +PN +KC  ET
Sbjct  356  KYDEVERVVAYRKVLKTWSRWVETHIDPKRTTVLFMSVSPVHMQSEGWGSPNAVKCFSET  415

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGK  327
             P +N +  L VGTD+ LF+ A  +TR+MKK PVHF+NIT LSE RKDAHTSVHT+RQGK
Sbjct  416  QPAINYTKKLEVGTDWDLFATAQRVTRSMKKVPVHFINITALSEIRKDAHTSVHTLRQGK  475

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            +LT EQ+A+P  +ADCIHWCLPG+PDTWNEF+Y HI+S
Sbjct  476  LLTAEQKANPRKFADCIHWCLPGVPDTWNEFVYGHIMS  513



>gb|KDP44745.1| hypothetical protein JCGZ_01245 [Jatropha curcas]
Length=376

 Score =   297 bits (760),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 171/219 (78%), Gaps = 1/219 (0%)
 Frame = -1

Query  860  NSDDPTMH-SILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGAT  684
            NSD PTM     + +I  +SI KHG NWKNV YLIFNTY WW+   ++K LRGSFD+GA 
Sbjct  158  NSDPPTMRDGKSDSVIKVESITKHGNNWKNVHYLIFNTYTWWLKYPTIKALRGSFDEGAI  217

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            EYDE+ R +AY KVL TW+KWV++NVDPN T VFF SM P H++S DW+NP+GI C +ET
Sbjct  218  EYDEIQRHIAYEKVLRTWAKWVEENVDPNHTSVFFSSMFPQHLRSSDWKNPDGINCFEET  277

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
             PILN S P++V TD ++F+IA N+  +MK P+HFLNIT LSEYRKDAHTS++T   GK+
Sbjct  278  MPILNISTPVDVSTDKQVFAIARNVIESMKIPIHFLNITTLSEYRKDAHTSIYTSHGGKL  337

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            L+PEQ+++P  YADC+HWCLPGLPDTWNE LY+ II +S
Sbjct  338  LSPEQKSNPAIYADCLHWCLPGLPDTWNELLYADIIKQS  376



>ref|XP_002440930.1| hypothetical protein SORBIDRAFT_09g017080 [Sorghum bicolor]
 gb|EES19360.1| hypothetical protein SORBIDRAFT_09g017080 [Sorghum bicolor]
Length=522

 Score =   301 bits (770),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 169/217 (78%), Gaps = 2/217 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRG-SFDKGAT  684
            NSDDP +HSI +R+I P SI KH  NW+ VDYLIFNTYIWWMNT  MK L G SF +   
Sbjct  289  NSDDPDIHSISDRMIKPTSIAKHAANWEGVDYLIFNTYIWWMNTPQMKTLHGGSFSRKHV  348

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            +YDE++R  AYRKVL TWS+WV+ ++DP RT V FMS+SP+H++S  W +PN IKC  ET
Sbjct  349  KYDEIERVEAYRKVLKTWSRWVEAHIDPKRTTVLFMSVSPVHMQSEGWGSPNAIKCFSET  408

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGK  327
             P +N +  L VGTD+ LF  A  +TR+MKK PVHF+NIT LSE RKDAHTSVHT+RQGK
Sbjct  409  QPAINYTKKLEVGTDWDLFVTAQRVTRSMKKVPVHFINITALSEIRKDAHTSVHTLRQGK  468

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHII  216
            +LT EQ+A+P  +ADCIHWCLPG+PDTWNEF+Y HI+
Sbjct  469  LLTAEQKANPRKFADCIHWCLPGVPDTWNEFVYGHIV  505



>ref|NP_001142969.1| uncharacterized protein LOC100275422 [Zea mays]
 gb|ACG27974.1| hypothetical protein [Zea mays]
 tpg|DAA64250.1| TPA: putative DUF231 domain containing family protein [Zea mays]
Length=529

 Score =   299 bits (766),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 177/229 (77%), Gaps = 11/229 (5%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLR------GSF  699
            NSDDP  HS++NR+I  ++I KH KNWK VDYL+FN+YIWW+NTF MKV+R         
Sbjct  295  NSDDPQAHSVMNRVIAWRAIAKHAKNWKGVDYLVFNSYIWWLNTFEMKVIRRHQHQLEKE  354

Query  698  DKGA--TEYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNG  525
            ++G   ++Y  VDRP+AYR+VL TW++WVD+++DPNRT+VFFM MSP H+    W N  G
Sbjct  355  EEGVRWSKYALVDRPVAYREVLKTWARWVDRHIDPNRTRVFFMGMSPNHVTPWAWGNDGG  414

Query  524  IKCAKETSPILNT-SMPLNVGTDYRLFSIASNI-TRTMKK-PVHFLNITKLSEYRKDAHT  354
            IKCA ET PI N  +  L++GTD+RL  +A  +  R +++ PVHF++IT LSE RKDAHT
Sbjct  415  IKCAMETQPISNNRTGRLDIGTDWRLHGVARGVLARYLRRVPVHFVDITGLSELRKDAHT  474

Query  353  SVHTIRQGKMLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            SVHT+RQGK+LTPEQQADP TYADCIHWCLPGLPDTWN FLY+HI+S S
Sbjct  475  SVHTLRQGKLLTPEQQADPKTYADCIHWCLPGLPDTWNHFLYAHILSLS  523



>ref|XP_008655378.1| PREDICTED: uncharacterized protein LOC100501717 isoform X1 [Zea 
mays]
 gb|AFW81660.1| putative DUF231 domain containing family protein [Zea mays]
Length=514

 Score =   296 bits (757),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 170/217 (78%), Gaps = 2/217 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRG-SFDKGAT  684
            NSDDP +HSI +R+I P SI KH  NW+ VDYLIFNTYIWWMNT  MK + G SF +   
Sbjct  286  NSDDPDIHSISDRMIKPTSIAKHAANWEGVDYLIFNTYIWWMNTPQMKTVHGGSFSRKHV  345

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            +YDE++R  AYRKVL TWS+WV+ ++DP R+ V FMS+SP+H++S  W +PN +KC  ET
Sbjct  346  KYDEIERVEAYRKVLKTWSRWVEAHIDPKRSTVLFMSVSPVHMQSEGWGSPNAVKCFSET  405

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGK  327
             P +N +  L VGTD+ LF+ A  +TR+M+K PV F+++T LSE RKDAHTSVHT+RQGK
Sbjct  406  QPAINYTKKLEVGTDWDLFAAAQRVTRSMEKVPVRFVDVTALSEIRKDAHTSVHTLRQGK  465

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHII  216
            +LTPEQ+A+P  +ADCIHWCLPG+PDTWN+F+Y HI+
Sbjct  466  LLTPEQKANPRKFADCIHWCLPGVPDTWNQFVYGHIV  502



>ref|XP_002463443.1| hypothetical protein SORBIDRAFT_02g043950 [Sorghum bicolor]
 gb|EER99964.1| hypothetical protein SORBIDRAFT_02g043950 [Sorghum bicolor]
Length=528

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/231 (60%), Positives = 175/231 (76%), Gaps = 16/231 (7%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGA--  687
            NSDDP +HS+++R+I  ++I KH KNWK VDYL+FN+YIWW+NTF MKV++G+   G   
Sbjct  286  NSDDPQVHSVMDRVIAWRAIAKHAKNWKGVDYLVFNSYIWWLNTFEMKVMKGTNRHGHQQ  345

Query  686  -----------TEYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDW  540
                       ++Y  VDRP+AYR+VL TW+KWVD+++DPNRT+VFFM MSP HI    W
Sbjct  346  QQQQQQGKERWSKYALVDRPVAYREVLKTWAKWVDRHIDPNRTRVFFMGMSPNHITPWAW  405

Query  539  ENPNGIKCAKETSPILNT-SMPLNVGTDYRLFSIASNI-TRTMKK-PVHFLNITKLSEYR  369
             N  GIKCA ET PI N  +  L++GTD+RL  +A  +  R +++ PV F++IT LSE R
Sbjct  406  GNNGGIKCAMETQPISNNRTGRLDIGTDWRLHGVALGVLARYLRRVPVQFVDITGLSELR  465

Query  368  KDAHTSVHTIRQGKMLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHII  216
            KDAHTSVHT+RQGK+LTPEQQADP TYADCIHWCLPGLPDTWN FLY+HII
Sbjct  466  KDAHTSVHTLRQGKLLTPEQQADPKTYADCIHWCLPGLPDTWNHFLYAHII  516



>ref|XP_006659001.1| PREDICTED: protein YLS7-like [Oryza brachyantha]
Length=492

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/230 (59%), Positives = 174/230 (76%), Gaps = 12/230 (5%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVL--RGSFDKG-  690
            NSDDP +HS+ +R+I  +SI KH  NWK V YL+FNTYIWW+NTF +KVL  RG+  KG 
Sbjct  262  NSDDPQVHSVRDRVIAWRSIAKHAANWKGVHYLVFNTYIWWLNTFDIKVLKNRGADPKGK  321

Query  689  -------ATEYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENP  531
                   ++ Y  VDRP+AYR+VL TW+KWVD+ +DP +T VFFM+MSP HI    W   
Sbjct  322  GKEGWWSSSRYALVDRPIAYREVLKTWAKWVDRRIDPTKTTVFFMAMSPNHITPEAWGGS  381

Query  530  NG-IKCAKETSPILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAH  357
             G +KCA ET PI+N +  L++GTD+RL  +A  + R+M++ PV F++IT LSE RKDAH
Sbjct  382  AGAVKCAMETQPIMNRTWGLDIGTDWRLHGVARGVLRSMRRVPVRFVDITALSELRKDAH  441

Query  356  TSVHTIRQGKMLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TSVHT+RQGK+LTPEQQ+DP TYADCIHWCLPGLPDTWN FLY+HI++ +
Sbjct  442  TSVHTLRQGKLLTPEQQSDPRTYADCIHWCLPGLPDTWNHFLYAHIVAHA  491



>gb|EAZ14031.1| hypothetical protein OsJ_03957 [Oryza sativa Japonica Group]
Length=424

 Score =   289 bits (739),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 168/219 (77%), Gaps = 3/219 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +HSI +RII   +I  H +NW+ VDYL+FNTYIWWMNT +MK++R    +   E
Sbjct  201  NSDDPKIHSIQHRIIKADAIAAHAQNWRGVDYLVFNTYIWWMNTLNMKIMRPG-GQSWEE  259

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DEV R  AYRKVL+TW+ WV+ N+DP RT VFFMS+SPLHI    W NP GI+CAKET 
Sbjct  260  HDEVVRIEAYRKVLTTWASWVNDNIDPARTSVFFMSISPLHISPEVWGNPGGIRCAKETM  319

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTM--KKPVHFLNITKLSEYRKDAHTSVHTIRQGK  327
            P+LN   P+ +GTD+ +F  A+N++RT   + P+ F+++T +SE RKD HTSVHTIRQGK
Sbjct  320  PLLNWHGPIWLGTDWDMFHAAANVSRTAATRVPITFVDVTTMSERRKDGHTSVHTIRQGK  379

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            +LTPEQQADP TYADCIHWCLPG+PD WN  LY+ I+SR
Sbjct  380  VLTPEQQADPGTYADCIHWCLPGVPDIWNLILYTRIMSR  418



>gb|EYU41940.1| hypothetical protein MIMGU_mgv1a019959mg, partial [Erythranthe 
guttata]
Length=379

 Score =   287 bits (734),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 164/215 (76%), Gaps = 4/215 (2%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP  HSI  RII P SI KHG +WK+ D+L+FN+YIWWMN  ++KVLR     G+ E
Sbjct  163  NSDDPRNHSISQRIINPHSISKHGIHWKDADFLVFNSYIWWMNGRNIKVLRS----GSPE  218

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE++RP+AY +VL+TW+ W+  N++ +RT  FF++MSP+H +S +W  P G  CA ET 
Sbjct  219  YDEIERPIAYERVLTTWANWLKHNINHSRTSAFFITMSPVHQQSSNWNKPEGAACASETD  278

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PI NTS PL++GTD RL  I  N+ +T    V  ++IT LSEYRKD HTSV+TIRQGK+L
Sbjct  279  PISNTSTPLDMGTDRRLLKITKNVIKTTGVAVGLVDITTLSEYRKDGHTSVYTIRQGKLL  338

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHII  216
            TPEQ+ADP TYADC+HWCLPG+PDTWNE LY+HII
Sbjct  339  TPEQKADPATYADCLHWCLPGVPDTWNELLYAHII  373



>ref|XP_006654530.1| PREDICTED: protein YLS7-like [Oryza brachyantha]
Length=499

 Score =   290 bits (742),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 165/218 (76%), Gaps = 2/218 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP  HSI +R+I P++I  H  +W  VDYL+FNTYIWWMNT +MKV+R +  K   E
Sbjct  269  NSDDPKAHSIRDRVIKPEAIAAHAGDWLGVDYLVFNTYIWWMNTLNMKVMRPT-GKTWDE  327

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEV R  AYR+VL TW+ WV+ NVDP RT VFFMS+SPLHI    W NP G++CAKET+
Sbjct  328  YDEVGRIEAYRRVLDTWATWVNDNVDPARTSVFFMSLSPLHISPEAWGNPGGVRCAKETA  387

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P+ N   PL +GTD+ +F  A+N +R + + PV F+++T +SE RKD HTSVHTIRQG +
Sbjct  388  PVRNWRGPLWLGTDWDMFRAAANASRAVGRVPVTFVDVTAMSELRKDGHTSVHTIRQGSV  447

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            LTPEQQADP TYADCIHWCLPG+PD WN  LY+ I+SR
Sbjct  448  LTPEQQADPATYADCIHWCLPGVPDVWNLMLYARILSR  485



>ref|XP_010922575.1| PREDICTED: protein trichome birefringence-like 28 [Elaeis guineensis]
Length=449

 Score =   286 bits (733),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 169/217 (78%), Gaps = 3/217 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +HSI  RII   SI+KH  +WK VDYL+FNTYIWWMN+   KVLR       T+
Sbjct  227  NSDDPDIHSIPERIIKADSIEKHAVHWKGVDYLVFNTYIWWMNSAKFKVLRKK-ATNWTD  285

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDE+ R  AY+KVL T SKWVD+NVDPNRT V+FMSMSP H +S DW NP G+KCAKET 
Sbjct  286  YDEILRAEAYQKVLKTLSKWVDRNVDPNRTSVYFMSMSPNHFRSTDWGNPEGVKCAKETL  345

Query  500  PILNTS-MPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGK  327
            P+LN+    L +G+D ++  +  N+T+ M++ P+ F++IT+LSEYRKDAHTSV+TIRQGK
Sbjct  346  PVLNSMYQSLELGSDRQMHRLVVNMTKLMRRVPITFIDITRLSEYRKDAHTSVYTIRQGK  405

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHII  216
            +LT EQ+ADP TYADCIHWCLPGLPDTWNE LY+ I+
Sbjct  406  LLTSEQKADPRTYADCIHWCLPGLPDTWNELLYARIL  442



>gb|EAY76370.1| hypothetical protein OsI_04301 [Oryza sativa Indica Group]
Length=524

 Score =   288 bits (738),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 168/219 (77%), Gaps = 3/219 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +HSI +RII   +I  H +NW+ VDYL+FNTYIWWMNT +MK++R    +   E
Sbjct  301  NSDDPKIHSIQHRIIKADAIAAHAQNWRGVDYLVFNTYIWWMNTLNMKIMRPG-GQSWEE  359

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DEV R  AYRKVL+TW+ WV+ N+DP RT VFFMS+SPLHI    W NP GI+CAKET 
Sbjct  360  HDEVVRIEAYRKVLTTWASWVNDNIDPARTSVFFMSISPLHISPEVWGNPGGIRCAKETM  419

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTM--KKPVHFLNITKLSEYRKDAHTSVHTIRQGK  327
            P+LN   P+ +GTD+ +F  A+N++RT   + P+ F+++T +SE RKD HTSVHTIRQGK
Sbjct  420  PLLNWHGPIWLGTDWDMFHAAANVSRTAAPRVPITFVDVTTMSERRKDGHTSVHTIRQGK  479

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            +LTPEQQADP TYADCIHWCLPG+PD WN  LY+ I+SR
Sbjct  480  VLTPEQQADPGTYADCIHWCLPGVPDIWNLILYTRIMSR  518



>ref|NP_001044698.1| Os01g0830700 [Oryza sativa Japonica Group]
 dbj|BAB89591.1| lustrin A-like [Oryza sativa Japonica Group]
 dbj|BAF06612.1| Os01g0830700 [Oryza sativa Japonica Group]
 dbj|BAG95179.1| unnamed protein product [Oryza sativa Japonica Group]
Length=522

 Score =   288 bits (738),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 168/219 (77%), Gaps = 3/219 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +HSI +RII   +I  H +NW+ VDYL+FNTYIWWMNT +MK++R    +   E
Sbjct  301  NSDDPKIHSIQHRIIKADAIAAHAQNWRGVDYLVFNTYIWWMNTLNMKIMRPG-GQSWEE  359

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DEV R  AYRKVL+TW+ WV+ N+DP RT VFFMS+SPLHI    W NP GI+CAKET 
Sbjct  360  HDEVVRIEAYRKVLTTWASWVNDNIDPARTSVFFMSISPLHISPEVWGNPGGIRCAKETM  419

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTM--KKPVHFLNITKLSEYRKDAHTSVHTIRQGK  327
            P+LN   P+ +GTD+ +F  A+N++RT   + P+ F+++T +SE RKD HTSVHTIRQGK
Sbjct  420  PLLNWHGPIWLGTDWDMFHAAANVSRTAATRVPITFVDVTTMSERRKDGHTSVHTIRQGK  479

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            +LTPEQQADP TYADCIHWCLPG+PD WN  LY+ I+SR
Sbjct  480  VLTPEQQADPGTYADCIHWCLPGVPDIWNLILYTRIMSR  518



>ref|XP_009399999.1| PREDICTED: protein trichome birefringence-like 28 [Musa acuminata 
subsp. malaccensis]
Length=544

 Score =   288 bits (738),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 167/217 (77%), Gaps = 3/217 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +HSIL+RII   SI+KH  +WK VDYL+FNTYIWWMNT  MKVLR S  +  TE
Sbjct  323  NSDDPHVHSILDRIIKADSIEKHAVHWKGVDYLVFNTYIWWMNTLEMKVLRPSA-RNWTE  381

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YD + RP AY +V+ TWS+W+D+NVDP RT VFFMSMSPLH +S DW NPNGIKC+KET 
Sbjct  382  YDGIGRPQAYERVMRTWSRWLDENVDPRRTSVFFMSMSPLHSRSSDWGNPNGIKCSKETL  441

Query  500  PILNTSMPLNVGTDYRLFSIASNITR-TMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P+ N +  +++GTD R+F  A    + T + P+ F++IT +SE RKDAHTSVHT RQG +
Sbjct  442  PLTNVTG-VHLGTDMRMFERAKKAAQSTSRVPIAFVDITTMSELRKDAHTSVHTTRQGAV  500

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            +T EQQA+P  YADCIHWC+PGLPD WN+ LY+ I+S
Sbjct  501  MTAEQQANPAVYADCIHWCVPGLPDVWNQLLYAKILS  537



>emb|CDM82949.1| unnamed protein product [Triticum aestivum]
 emb|CDM84805.1| unnamed protein product [Triticum aestivum]
Length=544

 Score =   287 bits (735),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 167/219 (76%), Gaps = 3/219 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P +HSI  RII   +I  H +NW+N DYL+FNTYIWWMNT +MK+ R    +   +
Sbjct  316  NSDNPKIHSIPTRIIDASAIAAHAENWRNADYLVFNTYIWWMNTLNMKLKRPG-GQDWED  374

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DEV R  AYRKVL+TW+ WV+ N+DP RT VFFMSMSPLH+    W NPNGI+CAKET 
Sbjct  375  HDEVVRIEAYRKVLNTWAGWVNDNIDPARTSVFFMSMSPLHLSPQVWGNPNGIRCAKETM  434

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTM--KKPVHFLNITKLSEYRKDAHTSVHTIRQGK  327
            P+LN   P+ +GTD+ +F +ASNITR    + P+ F++IT +SE RKD HTSVHTIRQG+
Sbjct  435  PLLNWRGPIWLGTDWDMFKVASNITRAAAPRVPITFVDITTMSERRKDGHTSVHTIRQGQ  494

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            +LTPEQQADP TYADCIHWCLPG+PD WN  LY+ I+SR
Sbjct  495  ILTPEQQADPGTYADCIHWCLPGVPDIWNSILYTRIMSR  533



>ref|XP_003564532.1| PREDICTED: protein trichome birefringence-like 28 [Brachypodium 
distachyon]
Length=539

 Score =   287 bits (734),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 169/219 (77%), Gaps = 3/219 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +HSI +RII  +SI  H +NW++ DYL+FNTYIWWMNT +MK+ R    +   +
Sbjct  313  NSDDPKIHSIQHRIIDAESIAAHAENWRSADYLVFNTYIWWMNTLNMKLKRPG-GENWED  371

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DE+ R  AYRKVL+TW+ WVD+N+DP RT VFFMSMSPLHI    W NP+GI+CAKET 
Sbjct  372  HDELVRIEAYRKVLNTWASWVDENIDPARTSVFFMSMSPLHISPQVWGNPDGIRCAKETM  431

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTM--KKPVHFLNITKLSEYRKDAHTSVHTIRQGK  327
            P+LN   P+ +GTD+ +F +ASN+T     + P+ F++IT +SE RKD HTSVHTIRQG+
Sbjct  432  PLLNWRGPIWLGTDWDMFKVASNVTGAAAPRVPITFVDITTMSERRKDGHTSVHTIRQGQ  491

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            +LTPEQQADP TYADCIHWCLPG+PD WN  LY+ I+SR
Sbjct  492  VLTPEQQADPGTYADCIHWCLPGVPDIWNSLLYTRIMSR  530



>dbj|BAC75569.1| leaf senescence related protein-like [Oryza sativa Japonica Group]
Length=508

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/227 (59%), Positives = 171/227 (75%), Gaps = 9/227 (4%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVL--RGSFDKGA  687
            NSDDP +HS+ +R+I  +SI KH  NWK V YL+FNTYIWW+N F +KVL  RG+   G+
Sbjct  281  NSDDPQVHSVRDRVIAWRSIAKHAANWKGVHYLVFNTYIWWLNNFQIKVLKSRGAPFAGS  340

Query  686  ----TEYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNG-I  522
                + Y  VDR +AYR+VL TW+KWVD+ +DPN+T VFFM+MSP H     W    G +
Sbjct  341  GGWSSRYALVDRAIAYREVLKTWAKWVDRRIDPNKTHVFFMAMSPNHFMPEAWGGSAGAV  400

Query  521  KCAKETSPILN-TSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSV  348
            KCA ET PI+N TS  L++GTD+RL  +A  + R+M++  V F++IT LSE RKDAHTSV
Sbjct  401  KCAMETQPIVNRTSGGLDIGTDWRLHGVARGVLRSMRRVGVRFVDITALSELRKDAHTSV  460

Query  347  HTIRQGKMLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            HT+RQGK+LTPEQQADP TYADCIHWCLPGLPDTWN FLY+HI++ +
Sbjct  461  HTLRQGKLLTPEQQADPRTYADCIHWCLPGLPDTWNHFLYAHIVAHA  507



>ref|XP_006378655.1| hypothetical protein POPTR_0010s19470g, partial [Populus trichocarpa]
 gb|ERP56452.1| hypothetical protein POPTR_0010s19470g, partial [Populus trichocarpa]
Length=404

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 169/211 (80%), Gaps = 1/211 (0%)
 Frame = -1

Query  839  HSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATEYDEVDRP  660
            + + +RIIMP+SI KHG NWK+ DYLIFNTY W+ +    K   GSF +   +YDEV+ P
Sbjct  195  NGLSDRIIMPESISKHGDNWKSADYLIFNTYNWYKSIL-WKRRGGSFGEDPIQYDEVELP  253

Query  659  LAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETSPILNTSM  480
            +AY +VL TW+KWV++NVDP  + V+F SMSP H++SLDW+NP+ IK A ET PILN S 
Sbjct  254  IAYERVLRTWAKWVEENVDPKHSSVYFSSMSPTHVRSLDWDNPDRIKRANETKPILNKSK  313

Query  479  PLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQAD  300
            PL+VGT+++LF+IA N+TR+MK PV+FLN+T  SEYRKDAHTSV+T  +GK+L PE+++D
Sbjct  314  PLDVGTNWQLFAIAVNVTRSMKVPVNFLNVTTPSEYRKDAHTSVYTAVEGKLLWPEKKSD  373

Query  299  PTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            P  YADC+HWCLPGLPDTWNE LY++IISR+
Sbjct  374  PLKYADCLHWCLPGLPDTWNELLYTYIISRT  404



>dbj|BAK02998.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=392

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 165/223 (74%), Gaps = 9/223 (4%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVL---RGSFDKG  690
            NSDDP  HS+ +R++  +SI KH ++W+   +L+FNTYIWW+N F MKVL   R   DK 
Sbjct  164  NSDDPQAHSVADRVVAWRSIAKHARHWRAAHFLVFNTYIWWLNNFQMKVLKNPRALPDK-  222

Query  689  ATEYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWEN-PNGIKCA  513
               Y  VDRP+AY++VL TW+KWVD++VDP+ T+VFFM MSP H     W   P  +KCA
Sbjct  223  ---YTLVDRPVAYKEVLKTWAKWVDRHVDPDHTRVFFMGMSPNHGVPEAWGGGPGAVKCA  279

Query  512  KETSPILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIR  336
             ET PILN + PL +GTD+RL   A  + R+M++ PVH ++IT LSE+RKDAHTSVHT+R
Sbjct  280  METQPILNHTGPLYIGTDWRLHGAAEAVLRSMRRVPVHLVDITALSEFRKDAHTSVHTLR  339

Query  335  QGKMLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            QGK+LT EQQADP TYADCIHWCLPGLPDTWN FLY+ I + S
Sbjct  340  QGKLLTAEQQADPRTYADCIHWCLPGLPDTWNHFLYAQIAAPS  382



>gb|EEC82737.1| hypothetical protein OsI_27441 [Oryza sativa Indica Group]
Length=601

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/227 (59%), Positives = 171/227 (75%), Gaps = 9/227 (4%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVL--RGSFDKGA  687
            NSDDP +HS+ +R+I  +SI KH  NWK V YL+FNTYIWW+N F +KVL  RG+   G+
Sbjct  374  NSDDPQVHSVRDRVIAWRSIAKHAANWKGVHYLVFNTYIWWLNNFQIKVLKSRGAPFAGS  433

Query  686  ----TEYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNG-I  522
                + Y  VDR +AYR+VL TW+KWVD+ +DPN+T VFFM+MSP H     W    G +
Sbjct  434  GGWSSRYALVDRAIAYREVLKTWAKWVDRRIDPNKTHVFFMAMSPNHFMPEAWGGSAGAV  493

Query  521  KCAKETSPILN-TSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSV  348
            KCA ET PI+N TS  L++GTD+RL  +A  + R+M++  V F++IT LSE RKDAHTSV
Sbjct  494  KCAMETQPIVNRTSGGLDIGTDWRLHGVARGVLRSMRRVGVRFVDITALSELRKDAHTSV  553

Query  347  HTIRQGKMLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            HT+RQGK+LTPEQQADP TYADCIHWCLPGLPDTWN FLY+HI++ +
Sbjct  554  HTLRQGKLLTPEQQADPRTYADCIHWCLPGLPDTWNHFLYAHIVAHA  600



>ref|NP_001060731.1| Os07g0693600 [Oryza sativa Japonica Group]
 dbj|BAF22645.1| Os07g0693600 [Oryza sativa Japonica Group]
 gb|EAZ41191.1| hypothetical protein OsJ_25693 [Oryza sativa Japonica Group]
Length=605

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/227 (59%), Positives = 171/227 (75%), Gaps = 9/227 (4%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVL--RGSFDKGA  687
            NSDDP +HS+ +R+I  +SI KH  NWK V YL+FNTYIWW+N F +KVL  RG+   G+
Sbjct  378  NSDDPQVHSVRDRVIAWRSIAKHAANWKGVHYLVFNTYIWWLNNFQIKVLKSRGAPFAGS  437

Query  686  ----TEYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNG-I  522
                + Y  VDR +AYR+VL TW+KWVD+ +DPN+T VFFM+MSP H     W    G +
Sbjct  438  GGWSSRYALVDRAIAYREVLKTWAKWVDRRIDPNKTHVFFMAMSPNHFMPEAWGGSAGAV  497

Query  521  KCAKETSPILN-TSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSV  348
            KCA ET PI+N TS  L++GTD+RL  +A  + R+M++  V F++IT LSE RKDAHTSV
Sbjct  498  KCAMETQPIVNRTSGGLDIGTDWRLHGVARGVLRSMRRVGVRFVDITALSELRKDAHTSV  557

Query  347  HTIRQGKMLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            HT+RQGK+LTPEQQADP TYADCIHWCLPGLPDTWN FLY+HI++ +
Sbjct  558  HTLRQGKLLTPEQQADPRTYADCIHWCLPGLPDTWNHFLYAHIVAHA  604



>ref|NP_001168900.1| uncharacterized protein LOC100382706 [Zea mays]
 gb|ACN30974.1| unknown [Zea mays]
 tpg|DAA57002.2| TPA: hypothetical protein ZEAMMB73_914259 [Zea mays]
Length=541

 Score =   282 bits (722),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 165/221 (75%), Gaps = 5/221 (2%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +HSI +RII   +I  H +NW+ VDYL+FNTY+WWMNT  MKV+R    K   E
Sbjct  316  NSDDPKIHSIQHRIIKADTIGAHAENWRGVDYLVFNTYMWWMNTLDMKVMRPG-AKSWEE  374

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DEV R  AYRKVL+TW+ WV+ NVDP RT VFFMSMSPLHI    W NP+GI+CAKET 
Sbjct  375  HDEVVRIEAYRKVLTTWASWVNDNVDPARTSVFFMSMSPLHISPQVWGNPDGIRCAKETM  434

Query  500  PILNTSMPLNVGTDYRLFSIASNITR----TMKKPVHFLNITKLSEYRKDAHTSVHTIRQ  333
            P+L+   PL +G D+ +F  A N++R    + + P+ FL+IT +SE RKD HTSVHTIRQ
Sbjct  435  PLLDWHGPLWLGMDWDMFHQARNVSRGGGASPRVPITFLDITTMSERRKDGHTSVHTIRQ  494

Query  332  GKMLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            GK+L PE+QADP TYADCIHWCLPG+PD WN  LY+ I+SR
Sbjct  495  GKVLGPEEQADPATYADCIHWCLPGVPDIWNLMLYTRILSR  535



>ref|XP_004970448.1| PREDICTED: uncharacterized protein LOC101759220 isoform X2 [Setaria 
italica]
Length=539

 Score =   282 bits (721),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 165/219 (75%), Gaps = 4/219 (2%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +HSI +RII   +I  H +NW+ VDYL+FNTYIWWMNT +MKV  G+  +   E
Sbjct  317  NSDDPKIHSIQHRIIKADTIAAHAENWRGVDYLVFNTYIWWMNTLNMKVTPGA--QSWEE  374

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DEV R  AYRKVL+TW+ WV++NVDP RT VFFMSMSPLHI    W NP+GI+CAKET 
Sbjct  375  HDEVVRMEAYRKVLTTWANWVNENVDPARTSVFFMSMSPLHISPQVWGNPDGIRCAKETM  434

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTM--KKPVHFLNITKLSEYRKDAHTSVHTIRQGK  327
            P+L    PL +G D+ +F  A N++R    + P+ F++IT +SE RKD HTSVHTIRQGK
Sbjct  435  PLLEWHGPLWLGMDWDMFHEAKNVSRAASPRVPITFVDITTMSERRKDGHTSVHTIRQGK  494

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            +L PE+QADP TYADCIHWCLPG+PD WN  LY+ I+SR
Sbjct  495  VLGPEEQADPGTYADCIHWCLPGVPDIWNLVLYTRILSR  533



>ref|XP_010233574.1| PREDICTED: protein trichome birefringence-like 28 [Brachypodium 
distachyon]
Length=535

 Score =   281 bits (719),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 167/218 (77%), Gaps = 4/218 (2%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +HS+++R+I  +SI KH ++W+   +L+FNTYIWW+NTF MKVL+       ++
Sbjct  299  NSDDPQVHSVVDRVIAWRSIAKHARHWRGAHFLVFNTYIWWLNTFEMKVLKNP-RVSPSK  357

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWEN-PNGIKCAKET  504
            Y  VDRP+AYR+VL TW+KWVD+++DP +T VFFM MSP HI    W   P  +KCA ET
Sbjct  358  YSLVDRPVAYREVLKTWAKWVDRHIDPKKTMVFFMGMSPNHIAPDTWGGQPGAVKCAMET  417

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGK  327
             PI+N +  +N+GTD+RL  +A  +  +M++ PVH ++IT LSE+RKDAHTSVHT+RQGK
Sbjct  418  EPIMNRTW-VNIGTDWRLHGVAQGVLGSMRRVPVHLVDITALSEFRKDAHTSVHTLRQGK  476

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            +LT EQQADP  YADCIHWCLPGLPDTWN FLY+ II+
Sbjct  477  LLTREQQADPRAYADCIHWCLPGLPDTWNHFLYARIIA  514



>ref|XP_004970447.1| PREDICTED: uncharacterized protein LOC101759220 isoform X1 [Setaria 
italica]
Length=540

 Score =   281 bits (719),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 164/219 (75%), Gaps = 3/219 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +HSI +RII   +I  H +NW+ VDYL+FNTYIWWMNT +MKV R    +   E
Sbjct  317  NSDDPKIHSIQHRIIKADTIAAHAENWRGVDYLVFNTYIWWMNTLNMKVTRPG-AQSWEE  375

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DEV R  AYRKVL+TW+ WV++NVDP RT VFFMSMSPLHI    W NP+GI+CAKET 
Sbjct  376  HDEVVRMEAYRKVLTTWANWVNENVDPARTSVFFMSMSPLHISPQVWGNPDGIRCAKETM  435

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTM--KKPVHFLNITKLSEYRKDAHTSVHTIRQGK  327
            P+L    PL +G D+ +F  A N++R    + P+ F++IT +SE RKD HTSVHTIRQGK
Sbjct  436  PLLEWHGPLWLGMDWDMFHEAKNVSRAASPRVPITFVDITTMSERRKDGHTSVHTIRQGK  495

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            +L PE+QADP TYADCIHWCLPG+PD WN  LY+ I+SR
Sbjct  496  VLGPEEQADPGTYADCIHWCLPGVPDIWNLVLYTRILSR  534



>ref|XP_007008936.1| Uncharacterized protein TCM_042483 [Theobroma cacao]
 gb|EOY17746.1| Uncharacterized protein TCM_042483 [Theobroma cacao]
Length=461

 Score =   278 bits (710),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 168/219 (77%), Gaps = 2/219 (1%)
 Frame = -1

Query  860  NSDDPTMH-SILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGAT  684
            N D PT     ++ +I  +SI KHG NWKNVDYLIFNTYIWW    +MKVLRGSFD G T
Sbjct  244  NVDPPTRRDGTVDPVIKLESISKHGDNWKNVDYLIFNTYIWWRYP-TMKVLRGSFDDGVT  302

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            +Y E+++ +AY  VL +W KW+++NVD N T VFF S +P HIKS  W N +GIKC+ ET
Sbjct  303  DYVEINQNIAYESVLRSWGKWLEENVDSNHTSVFFSSPAPSHIKSSAWNNTSGIKCSNET  362

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            +PILN S  L+VGT+  LF+IA N++R+++ PVHFL+IT LSEYRKDAHTS++    GK+
Sbjct  363  TPILNISTSLDVGTNRWLFAIAVNVSRSLEIPVHFLDITTLSEYRKDAHTSIYAAPGGKL  422

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            LT EQ++DP TYADC+HWCLPGLPDTWNE LY+ IIS++
Sbjct  423  LTQEQKSDPATYADCVHWCLPGLPDTWNELLYTLIISQT  461



>ref|XP_002456582.1| hypothetical protein SORBIDRAFT_03g038800 [Sorghum bicolor]
 gb|EES01702.1| hypothetical protein SORBIDRAFT_03g038800 [Sorghum bicolor]
Length=540

 Score =   280 bits (715),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 163/219 (74%), Gaps = 3/219 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +HSI +RII   +I  H  NW+ VDYL+FNTYIWWMNT  MKV+R    K   E
Sbjct  316  NSDDPKIHSIQHRIIKADTIGAHADNWRGVDYLVFNTYIWWMNTLDMKVMRPG-AKSWEE  374

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DEV R  AYRKVL+TW+ WV+ N+DP RT VFFMSMSPLHI    W NP+GI+CAKET 
Sbjct  375  HDEVVRIEAYRKVLTTWANWVNDNIDPARTSVFFMSMSPLHISPQVWGNPDGIRCAKETM  434

Query  500  PILNTSMPLNVGTDYRLFSIASNITR--TMKKPVHFLNITKLSEYRKDAHTSVHTIRQGK  327
            P+L    PL +G D+ +F  A N++R  + + P+ F++IT +SE RKD HTSVHTIRQGK
Sbjct  435  PLLEWHGPLWLGMDWDMFHQAKNVSRRASPRVPITFVDITTMSERRKDGHTSVHTIRQGK  494

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            +L PE+QADP TYADCIHWCLPG+PD WN  LY+ I+SR
Sbjct  495  VLGPEEQADPGTYADCIHWCLPGVPDIWNLVLYTRILSR  533



>ref|XP_009397099.1| PREDICTED: protein trichome birefringence-like 28 [Musa acuminata 
subsp. malaccensis]
Length=476

 Score =   278 bits (710),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 166/217 (76%), Gaps = 3/217 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +H+I  RII  +SI+KH   WK  D L+FNTYIWWMNT  +KVLR    K  T 
Sbjct  257  NSDDPNIHTIDVRIIKAESIEKHAVQWKGADVLVFNTYIWWMNTRKIKVLRPGA-KNWTH  315

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
             D+V+R  AY  VL T SKW+D+N+DPNR+ VFFMSMSPLHIKS DW NPNGIKCAKET 
Sbjct  316  TDDVERWDAYETVLRTLSKWLDRNMDPNRSSVFFMSMSPLHIKSSDWGNPNGIKCAKETL  375

Query  500  PILNTSMPLNVGTDYRLFSIASNIT-RTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            PI N +  ++VGTD  LF++A  +T  T + PV F++IT +SEYRKDAHTSV+T+RQG +
Sbjct  376  PIKNMTG-VSVGTDMNLFALAKKVTGSTARVPVTFIDITAMSEYRKDAHTSVYTVRQGAL  434

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            LTPEQQA P  +ADCIHWCLPGLPDTWN+ L++ ++S
Sbjct  435  LTPEQQAKPAEFADCIHWCLPGLPDTWNQVLFTRLLS  471



>gb|EEC79381.1| hypothetical protein OsI_20293 [Oryza sativa Indica Group]
Length=504

 Score =   277 bits (709),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 164/218 (75%), Gaps = 2/218 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP  HSI +R+I P++I  H  +W  VDYL+FNTYIWWMNT +MKV+R +  K   E
Sbjct  275  NSDDPKAHSIRDRVIKPEAIAAHAGDWVGVDYLVFNTYIWWMNTVNMKVVRPT-GKTWEE  333

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEV R  AYR+VL TW+ WV+ NVDP RT VFFMS+SPLHI S  W NP G++CAKE +
Sbjct  334  YDEVGRIEAYRRVLDTWATWVNDNVDPARTSVFFMSVSPLHISSEAWGNPGGVRCAKEDA  393

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P+ N   PL +GTD+ +F  A N +R   + PV F+++T +SE RKD HTSVHTIRQG++
Sbjct  394  PVQNWHGPLWLGTDWDMFRAARNASRAAGRVPVTFVDVTAMSELRKDGHTSVHTIRQGRV  453

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            LTPEQQADP TYADCIHWCLPG+PD WN  LY+ I+SR
Sbjct  454  LTPEQQADPATYADCIHWCLPGVPDVWNLMLYARILSR  491



>gb|AAV43889.1| unknown protein [Oryza sativa Japonica Group]
Length=517

 Score =   277 bits (709),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 161/218 (74%), Gaps = 16/218 (7%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRG-SFDKGAT  684
            NSDDP MHSI++RII P SI KH  NW+ VDYLIFNTYIWWMNT  MK+L G SF K   
Sbjct  298  NSDDPNMHSIVDRIIKPTSIAKHAANWEGVDYLIFNTYIWWMNTPEMKILHGGSFSKKPV  357

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            +YDE++R  AYRKVL TWS+WV+K+VDP R+ VFFMS+SP+H++S  W  P+ IKC  ET
Sbjct  358  KYDEMERVAAYRKVLKTWSRWVEKHVDPKRSTVFFMSVSPVHMQSEGWGKPDAIKCFSET  417

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGK  327
             P +N +  L VGTD+ LFS A ++T+ MK+ PVHF+NIT LSE RKDAHTS        
Sbjct  418  QPAINYTKKLEVGTDWDLFSTAHHVTKAMKRVPVHFINITALSEIRKDAHTS--------  469

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
                  +A+P  +ADCIHWCLPGLPDTWNEF+Y HI+S
Sbjct  470  ------KANPRKFADCIHWCLPGLPDTWNEFIYGHIVS  501



>gb|EEE64048.1| hypothetical protein OsJ_18877 [Oryza sativa Japonica Group]
Length=500

 Score =   276 bits (705),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 163/218 (75%), Gaps = 2/218 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP  HSI +R+I P++I  H  +W  VDYL+FNTYIWWMNT +MKV+R +  K   E
Sbjct  275  NSDDPKAHSIRDRVIKPEAIAAHAGDWVGVDYLVFNTYIWWMNTVNMKVVRPT-GKTWEE  333

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEV R  AYR+VL TW+ WV+ NVDP RT VFFMS+SPLHI    W NP G++CAKE +
Sbjct  334  YDEVGRIEAYRRVLDTWATWVNDNVDPARTSVFFMSVSPLHISPEAWGNPGGVRCAKEDA  393

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P+ N   PL +GTD+ +F  A N +R   + PV F+++T +SE RKD HTSVHTIRQG++
Sbjct  394  PVQNWHGPLWLGTDWDMFRAARNASRAAGRVPVTFVDVTAMSELRKDGHTSVHTIRQGRV  453

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            LTPEQQADP TYADCIHWCLPG+PD WN  LY+ I+SR
Sbjct  454  LTPEQQADPATYADCIHWCLPGVPDVWNLMLYARILSR  491



>ref|NP_001055807.1| Os05g0470000 [Oryza sativa Japonica Group]
 dbj|BAF17721.1| Os05g0470000, partial [Oryza sativa Japonica Group]
Length=514

 Score =   276 bits (705),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 163/218 (75%), Gaps = 2/218 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP  HSI +R+I P++I  H  +W  VDYL+FNTYIWWMNT +MKV+R +  K   E
Sbjct  289  NSDDPKAHSIRDRVIKPEAIAAHAGDWVGVDYLVFNTYIWWMNTVNMKVVRPT-GKTWEE  347

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            YDEV R  AYR+VL TW+ WV+ NVDP RT VFFMS+SPLHI    W NP G++CAKE +
Sbjct  348  YDEVGRIEAYRRVLDTWATWVNDNVDPARTSVFFMSVSPLHISPEAWGNPGGVRCAKEDA  407

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P+ N   PL +GTD+ +F  A N +R   + PV F+++T +SE RKD HTSVHTIRQG++
Sbjct  408  PVQNWHGPLWLGTDWDMFRAARNASRAAGRVPVTFVDVTAMSELRKDGHTSVHTIRQGRV  467

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            LTPEQQADP TYADCIHWCLPG+PD WN  LY+ I+SR
Sbjct  468  LTPEQQADPATYADCIHWCLPGVPDVWNLMLYARILSR  505



>ref|XP_006644950.1| PREDICTED: protein YLS7-like [Oryza brachyantha]
Length=517

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 168/219 (77%), Gaps = 3/219 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +HSI +RII   +I  H  NW+ VDYL+FNTYIWWMNT +MK++R    +   E
Sbjct  296  NSDDPKIHSIQHRIIKADAIAAHADNWRGVDYLVFNTYIWWMNTLNMKIMRPG-GQSWEE  354

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DEV R  AYR+VL+TW+ WV++NVDP RT VFFMS+SPLHI    W NP GI+CAKET 
Sbjct  355  HDEVVRIDAYRRVLTTWASWVNENVDPARTSVFFMSISPLHISPEVWGNPGGIRCAKETM  414

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTM--KKPVHFLNITKLSEYRKDAHTSVHTIRQGK  327
            P+LN + P+ +GTD+ +F  A+N++R    + P+ F+++T +SE RKD HTSVHTIRQG+
Sbjct  415  PLLNWNGPIWLGTDWDMFHAAANVSRAAAPRVPITFVDVTTMSERRKDGHTSVHTIRQGQ  474

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            +LTPEQQADP TYADCIHWCLPG+PD WN  LY+ I+SR
Sbjct  475  VLTPEQQADPGTYADCIHWCLPGVPDIWNLILYTRIMSR  513



>ref|XP_009400772.1| PREDICTED: protein trichome birefringence-like 28 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009400773.1| PREDICTED: protein trichome birefringence-like 28 [Musa acuminata 
subsp. malaccensis]
Length=525

 Score =   273 bits (698),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 165/217 (76%), Gaps = 3/217 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +HSI  RII   SI+KH  +WK  D L+F+TYIWWMNT  +KVLR    K  TE
Sbjct  306  NSDDPEIHSIAVRIIKADSIEKHAVHWKGADVLVFDTYIWWMNTPKIKVLRPGA-KNWTE  364

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DE+ R  AY +VL T S WVD+N+DPNR+ VFFMSMSPLH +S  W NP+GIKCAKET 
Sbjct  365  HDEIVRREAYERVLRTLSNWVDQNLDPNRSSVFFMSMSPLHSRSTYWGNPDGIKCAKETM  424

Query  500  PILNTSMPLNVGTDYRLFSIASNIT-RTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            PI N +  + +G D  LF++A N+T  T + P+ F++IT +SEYRKDAHTSV+T+RQG++
Sbjct  425  PIQNMTG-VRLGMDKNLFAVAKNVTGSTARVPITFIDITTMSEYRKDAHTSVYTVRQGEL  483

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            LTPEQQA P  +ADCIHWC+PGLPDTWN+ LY+ ++S
Sbjct  484  LTPEQQAKPAEFADCIHWCVPGLPDTWNQILYARLLS  520



>ref|XP_009396865.1| PREDICTED: protein trichome birefringence-like 28 [Musa acuminata 
subsp. malaccensis]
Length=518

 Score =   273 bits (698),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 163/217 (75%), Gaps = 3/217 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +HSI++RII   SI+KH   WK VDYL+FNTYIWWMNT  +KV R S  +  TE
Sbjct  298  NSDDPRIHSIVDRIIKADSIEKHAVQWKEVDYLVFNTYIWWMNTEKIKVSRPSA-RDWTE  356

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E+ RP AY +VL TWSKW+D+NVDP RT VF+MSMSPLH +S DW N +GIKCAKET 
Sbjct  357  YEEISRPQAYERVLRTWSKWLDENVDPKRTLVFYMSMSPLHSRSSDWGNADGIKCAKETL  416

Query  500  PILNTSMPLNVGTDYRLFSIASNITR-TMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P+ N +  +++GTD  +F  A      T + PV F++IT +SE RKDAHTSVHT RQG +
Sbjct  417  PLTNMTG-VSLGTDMSMFRQAKKAAESTSRVPVTFVDITAMSELRKDAHTSVHTTRQGAV  475

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIIS  213
            +T EQ+A+P  YADCIHWCLPGLPD WN+ L ++I+S
Sbjct  476  MTAEQKANPAAYADCIHWCLPGLPDVWNQILLANILS  512



>ref|NP_001168546.1| putative DUF231 domain containing family protein [Zea mays]
 gb|ACN28621.1| unknown [Zea mays]
 tpg|DAA39353.1| TPA: putative DUF231 domain containing family protein [Zea mays]
Length=472

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/225 (56%), Positives = 166/225 (74%), Gaps = 2/225 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P  HSI  RII P+ I+ H +NWK+VDYLIFNTYIWWMNT  +KV R +  +  +E
Sbjct  236  NSDNPNFHSIKERIISPERIEAHARNWKDVDYLIFNTYIWWMNTADIKVRRPN-SRYWSE  294

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
             DEV R  AY +V  TWS W++ N+DP RT VFFM++SP+HI   +W NP GI+C KET 
Sbjct  295  NDEVPRIEAYGRVFKTWSDWLNNNIDPARTSVFFMTISPIHISPQNWGNPGGIRCVKETL  354

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P  N S PL++  D RL+ +   +  +M+K PV  +NITK+S+YRKDAH SV+TIRQGK+
Sbjct  355  PYQNYSQPLDLYHDMRLYDLVIKVASSMEKVPVSVINITKMSDYRKDAHASVYTIRQGKL  414

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS*YVTQF  189
            LTP+Q+ADP  +ADCIHWCLPG+PD WN+ LY+ I+S+S + + F
Sbjct  415  LTPKQKADPEKFADCIHWCLPGVPDVWNQILYTRILSKSPWRSNF  459



>gb|KHG17263.1| Alanine--tRNA ligase [Gossypium arboreum]
Length=425

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 162/216 (75%), Gaps = 3/216 (1%)
 Frame = -1

Query  860  NSDDPTMH-SILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGAT  684
            N D PTM    +  I+  +SI KHG NWKNVDYLIFNTYIWW    ++KVLRGSF+ G T
Sbjct  211  NVDPPTMRDGTVEPIVKLESISKHGDNWKNVDYLIFNTYIWWRYP-TVKVLRGSFEDGVT  269

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            +Y ++D+ +AY   L +W+KWV++NVDPN+T VFF+SM+P H  S  W N NGI C  ET
Sbjct  270  DYVDIDQNVAYESALKSWAKWVEENVDPNQTSVFFISMAPSHKMSSAWNNTNGIMCLNET  329

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            +PI+NTS   +VGT+ +L +I  N+ R+MK P+ FLNIT+LSEYRKDAHTS++    GK+
Sbjct  330  TPIVNTST-FDVGTNRQLSAIVENVVRSMKIPLQFLNITRLSEYRKDAHTSIYAAPGGKL  388

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHII  216
            LT EQ+ADP  YADC+HWCLPGLPDTWNE LY+ II
Sbjct  389  LTQEQKADPAKYADCVHWCLPGLPDTWNELLYTLII  424



>gb|KJB76206.1| hypothetical protein B456_012G077300 [Gossypium raimondii]
Length=428

 Score =   268 bits (684),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 166/219 (76%), Gaps = 3/219 (1%)
 Frame = -1

Query  860  NSDDPTM-HSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGAT  684
            N D PTM +  +  ++  +SI KHG NWKNVDYLIFNTYIWW    +MK L+GSF  GAT
Sbjct  212  NVDPPTMRYGTVVPVVKLESISKHGDNWKNVDYLIFNTYIWWRYP-TMKALQGSFSNGAT  270

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            +  ++D+ +AY + L +W+KWV++NVD NRT VFF SMSP H+KS DW N N IKC  ET
Sbjct  271  DSVDIDQNVAYERALKSWAKWVEENVDSNRTSVFFSSMSPTHMKSSDWNNTNRIKCWNET  330

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            SP  N S  ++VGT+++LF+ A N+ R+MK P+HFLNIT+LSEYRKDAHTS++    GK+
Sbjct  331  SPFPNISR-IDVGTNWQLFTTAVNVIRSMKIPLHFLNITRLSEYRKDAHTSIYAAPGGKL  389

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            LT EQ++DP  YADC+HWCLPGLPDTWNE L++ I+ R+
Sbjct  390  LTQEQKSDPARYADCLHWCLPGLPDTWNELLFALIMYRT  428



>ref|XP_004977644.1| PREDICTED: uncharacterized protein LOC101777232 [Setaria italica]
Length=471

 Score =   269 bits (687),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 164/219 (75%), Gaps = 2/219 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P +HSI +RII P  I+ H K WK+VDYLIFNTYIWWMNT  MKV R +  +  ++
Sbjct  234  NSDNPKIHSIEHRIIRPDRIEGHAKYWKDVDYLIFNTYIWWMNTADMKVRRPN-SRYWSQ  292

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DEV R  AY +V  TWS W++ N+DP RT VFFM++SPLHI   +W NP GI+C KET 
Sbjct  293  HDEVPRIEAYGRVFKTWSDWLNHNIDPARTSVFFMTISPLHISPQNWGNPEGIRCVKETL  352

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P  N S PL++  D R+F +   +  +M K PV  +NIT++S+YRKDAHTS+++IRQGK+
Sbjct  353  PFQNYSQPLDLYHDMRMFDMVVKVASSMDKVPVTVINITRMSDYRKDAHTSLYSIRQGKL  412

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            LTP+Q+ADP  +ADCIHWCLPG+PD WN+ LY+ I+SRS
Sbjct  413  LTPKQKADPEKFADCIHWCLPGVPDVWNQILYTRILSRS  451



>ref|XP_004978594.1| PREDICTED: uncharacterized protein LOC101782500 [Setaria italica]
Length=471

 Score =   269 bits (687),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 165/219 (75%), Gaps = 2/219 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P  HSI +RII P+ I+ H K WK+VDYLIFNTYIWWMNT  MKV R +  +  ++
Sbjct  235  NSDNPNFHSIEHRIISPERIEGHAKYWKDVDYLIFNTYIWWMNTADMKVRRPN-SRYWSQ  293

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DEV R  AY +V  TWS W++ N+DP RT VFFM++SPLHI   +W NP GI+C KET 
Sbjct  294  HDEVPRIEAYGRVFKTWSDWLNNNIDPARTSVFFMTISPLHISPKNWGNPEGIRCVKETL  353

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P  N S PL++  D R+F +   +  +M+K PV  +NIT++S+YRKDAHTS++TIRQGK+
Sbjct  354  PYQNYSQPLDLYHDMRIFDLVVKVASSMEKVPVTVINITRMSDYRKDAHTSLYTIRQGKL  413

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            LTP+Q+ADP  +ADCIHWCLPG+PD WN+ LY+ I+S+S
Sbjct  414  LTPKQKADPEKFADCIHWCLPGVPDVWNQILYTRILSKS  452



>ref|XP_002441664.1| hypothetical protein SORBIDRAFT_08g000470 [Sorghum bicolor]
 gb|EES15502.1| hypothetical protein SORBIDRAFT_08g000470 [Sorghum bicolor]
Length=472

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/225 (56%), Positives = 163/225 (72%), Gaps = 2/225 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P  HSI  RII P+ I+ H KNWK+ DYLIFNTYIWWMN   +KV R +  K  +E
Sbjct  236  NSDNPNFHSITERIISPERIESHAKNWKDADYLIFNTYIWWMNNADIKVRRPN-SKSWSE  294

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
             DEV R  AY +V  TWS W++ N+DP RT VFFM++S  H+   +W NP+ IKC KET 
Sbjct  295  NDEVPRIEAYGQVFKTWSDWINNNIDPARTSVFFMTISSPHLSPQNWGNPDAIKCVKETL  354

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P  N S PL++  D RL+ +  N+ R+M+K PV  +NITK+S+YRKDAHT ++T RQGK+
Sbjct  355  PYQNYSQPLDLYHDMRLYDLVVNVARSMEKVPVSVINITKMSDYRKDAHTGLYTFRQGKL  414

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS*YVTQF  189
            LTPEQ+ADP  +ADCIHWCLPG+PD WN+ LY+ I+S+S + + F
Sbjct  415  LTPEQKADPGKFADCIHWCLPGVPDVWNQILYTRILSKSSWRSNF  459



>gb|EAY81960.1| hypothetical protein OsI_37137 [Oryza sativa Indica Group]
Length=455

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 162/219 (74%), Gaps = 2/219 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P  H I  RII P+ I+ H  NWK+VDYLIFNTYIWWMN   +KV R +     ++
Sbjct  226  NSDNPNFHHIDQRIISPERIESHANNWKDVDYLIFNTYIWWMNNEDIKVRRPN-STSWSD  284

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DEV R   Y +V  TWS W+++NVDP RT VFFM++SPLH     W NPNGIKC KET 
Sbjct  285  HDEVPRIETYGRVFKTWSTWLEQNVDPARTSVFFMTISPLHNSPAQWGNPNGIKCVKETL  344

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P+LN + PL++  D R++ + + + + MK  PV  ++IT++S+YRKDAHTS+++IRQGK+
Sbjct  345  PVLNYTKPLDLNHDMRMYDLVAKVAKNMKNVPVSLIDITRMSDYRKDAHTSLYSIRQGKL  404

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            LTPEQ+ADP  YADCIHWCLPG+PD WN+ LY+ I+S+S
Sbjct  405  LTPEQKADPQKYADCIHWCLPGVPDVWNQILYTRILSKS  443



>ref|NP_001065927.1| Os12g0104700 [Oryza sativa Japonica Group]
 gb|ABA95597.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF28946.1| Os12g0104700 [Oryza sativa Japonica Group]
 dbj|BAG90376.1| unnamed protein product [Oryza sativa Japonica Group]
Length=455

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 162/219 (74%), Gaps = 2/219 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P  H I  RII P+ I+ H  NWK+VDYLIFNTYIWWMN   +KV R +     ++
Sbjct  226  NSDNPNFHHIDQRIISPERIESHANNWKDVDYLIFNTYIWWMNNEDIKVRRPN-STSWSD  284

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DEV R   Y +V  TWS W+++NVDP RT VFFM++SPLH     W NPNGIKC KET 
Sbjct  285  HDEVPRIETYGRVFKTWSTWLEQNVDPARTSVFFMTISPLHNSPAQWGNPNGIKCVKETL  344

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P+LN + PL++  D R++ + + + + MK  PV  ++IT++S+YRKDAHTS+++IRQGK+
Sbjct  345  PVLNYTKPLDLNHDMRMYDLVAKVAKNMKNVPVSLIDITRMSDYRKDAHTSLYSIRQGKL  404

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            LTPEQ+ADP  YADCIHWCLPG+PD WN+ LY+ I+S+S
Sbjct  405  LTPEQKADPQKYADCIHWCLPGVPDVWNQILYTRILSKS  443



>dbj|BAJ99630.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=458

 Score =   266 bits (680),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 167/219 (76%), Gaps = 2/219 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P +HSI +RII P+ I+ H + W++VDYLIFNTYIWWMNT  MKV R    +  +E
Sbjct  227  NSDNPKIHSIEHRIIRPERIEGHAQYWRDVDYLIFNTYIWWMNTADMKVRRPG-TRYWSE  285

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DEV R  AY +VL TWS W+++N+DP RT VFFM++SPLHI    W NP+GIKCAKET 
Sbjct  286  HDEVPRIEAYGRVLKTWSDWLNENIDPARTSVFFMTISPLHISPDKWGNPHGIKCAKETL  345

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P+LN + PL++  D R++ + ++  R+MKK PV  ++IT++S+YRKDAHTSV+++RQG +
Sbjct  346  PVLNYTEPLDLNHDMRMYDLVASTARSMKKVPVTLIDITRMSDYRKDAHTSVYSVRQGYL  405

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            LT +Q+ DP  +ADCIHWCLPG+PD WN  LY+ I S+S
Sbjct  406  LTAKQKNDPEKFADCIHWCLPGVPDVWNTVLYTRIFSKS  444



>dbj|BAJ93258.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=458

 Score =   266 bits (679),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 167/219 (76%), Gaps = 2/219 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P +HSI +RII P+ I+ H + W++VDYLIFNTYIWWMNT  MKV R    +  +E
Sbjct  227  NSDNPKIHSIEHRIIRPERIEGHAQYWRDVDYLIFNTYIWWMNTADMKVRRPD-TRYWSE  285

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DEV R  AY +VL TWS W+++N+DP RT VFFM++SPLHI    W NP+GIKCAKET 
Sbjct  286  HDEVPRIEAYGRVLKTWSDWLNENIDPARTSVFFMTISPLHISPDKWGNPHGIKCAKETL  345

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P+LN + PL++  D R++ + ++  R+MKK PV  ++IT++S+YRKDAHTSV+++RQG +
Sbjct  346  PVLNYTEPLDLNHDMRMYDLVASTARSMKKVPVTLIDITRMSDYRKDAHTSVYSVRQGYL  405

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            LT +Q+ DP  +ADCIHWCLPG+PD WN  LY+ I S+S
Sbjct  406  LTAKQKNDPEKFADCIHWCLPGVPDVWNTVLYTRIFSKS  444



>ref|XP_002879850.1| hypothetical protein ARALYDRAFT_483062 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56109.1| hypothetical protein ARALYDRAFT_483062 [Arabidopsis lyrata subsp. 
lyrata]
Length=427

 Score =   265 bits (676),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 160/207 (77%), Gaps = 2/207 (1%)
 Frame = -1

Query  821  IIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRG-SFDKG-ATEYDEVDRPLAYR  648
            +I+P+SI KHG+NWK+ DYL+FNTYIWW     +KVL+  SF+KG + +YDE+   + Y+
Sbjct  221  VIIPQSISKHGENWKDADYLVFNTYIWWTRHSKIKVLKQESFNKGDSKDYDEIGIYIVYK  280

Query  647  KVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETSPILNTSMPLNV  468
            +VLSTW+ W+++N++PN+T +FF SMSP HI+S DW    G KC KET PILN S P++V
Sbjct  281  QVLSTWTNWLEQNINPNQTSIFFSSMSPTHIRSSDWGFNEGNKCEKETEPILNMSRPIDV  340

Query  467  GTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPTTY  288
            GT+ RL+ IA N+T++ K P+HFLNIT +SEYRKD HTS +  R GK++TPEQ+ DP T+
Sbjct  341  GTNRRLYEIAVNVTKSTKVPIHFLNITTMSEYRKDGHTSFYGSRSGKLITPEQKLDPRTF  400

Query  287  ADCIHWCLPGLPDTWNEFLYSHIISRS  207
            ADC HWCLPGLPDTWNE L  +II +S
Sbjct  401  ADCYHWCLPGLPDTWNELLSLYIIYKS  427



>ref|XP_002442440.1| hypothetical protein SORBIDRAFT_08g020080 [Sorghum bicolor]
 gb|EES16278.1| hypothetical protein SORBIDRAFT_08g020080 [Sorghum bicolor]
Length=471

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 165/218 (76%), Gaps = 2/218 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P +HSI +RII P+ I+ H + W+ VDYLIFNTYIWWMNT  MKV R +  +  +E
Sbjct  235  NSDNPKIHSIEHRIIRPERIEGHARYWRGVDYLIFNTYIWWMNTADMKVRRPN-SRYWSE  293

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DEV R  AY +V  TWS W++ N+DP RT VFFM++SPLHI   +W NP+GI+C KET 
Sbjct  294  HDEVPRIEAYGRVFKTWSDWLNDNIDPARTSVFFMTISPLHISPHNWGNPDGIRCVKETL  353

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P  N S PL++  D R++ +   +  +M+K PV  +NITK+S+YRKDAHTS+++IRQGK+
Sbjct  354  PYQNYSQPLDLYHDMRMYDLVVKVASSMEKVPVTVINITKMSDYRKDAHTSLYSIRQGKL  413

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            LTP+Q+ADP  +ADCIHWCLPG+PD WN+ LY+ I+S+
Sbjct  414  LTPKQKADPEKFADCIHWCLPGVPDVWNQILYTKILSK  451



>gb|KJB76211.1| hypothetical protein B456_012G077600 [Gossypium raimondii]
Length=427

 Score =   264 bits (674),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 163/219 (74%), Gaps = 3/219 (1%)
 Frame = -1

Query  860  NSDDPTMH-SILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGAT  684
            N D PTM    +  I+  +SI KHG NWKNVDY IFNTYIWW    ++KVLRGSF+ G  
Sbjct  211  NVDPPTMRDGTVEPIVKLESISKHGDNWKNVDYFIFNTYIWWRYP-TVKVLRGSFEDGVA  269

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            +Y ++D+ +AY   L +W+KW+++NVDPN+T+VFF S++P H+ S  W N NGI C  ET
Sbjct  270  DYVDIDQNVAYESALKSWAKWMEENVDPNQTKVFFSSVAPSHMMSSAWNNTNGIMCLNET  329

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            +PI+NTS   +VGT+ +L +I  N+ R+MK P+ FLNIT+LSEYRKDAHTS++    GK+
Sbjct  330  TPIVNTST-FDVGTNQQLSAILENVVRSMKIPLQFLNITRLSEYRKDAHTSIYAAPGGKL  388

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            LT EQ+ADP  YADC+HWCLPGLPDTWNE LY+ II ++
Sbjct  389  LTQEQKADPARYADCVHWCLPGLPDTWNELLYTLIIFQT  427



>gb|EEE52598.1| hypothetical protein OsJ_34909 [Oryza sativa Japonica Group]
Length=455

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 159/216 (74%), Gaps = 2/216 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P  H I  RII P+ I+ H  NWK+VDYLIFNTYIWWMN   +KV R +     ++
Sbjct  226  NSDNPNFHHIDQRIISPERIESHANNWKDVDYLIFNTYIWWMNNEDIKVRRPN-STSWSD  284

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DEV R   Y +V  TWS W+++NVDP RT VFFM++SPLH     W NPNGIKC KET 
Sbjct  285  HDEVPRIETYGRVFKTWSTWLEQNVDPARTSVFFMTISPLHNSPAQWGNPNGIKCVKETL  344

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P+LN + PL++  D R++ + + + + MK  PV  ++IT++S+YRKDAHTS+++IRQGK+
Sbjct  345  PVLNYTKPLDLNHDMRMYDLVAKVAKNMKNVPVSLIDITRMSDYRKDAHTSLYSIRQGKL  404

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHII  216
            LTPEQ+ADP  YADCIHWCLPG+PD WN+ LY+ I+
Sbjct  405  LTPEQKADPQKYADCIHWCLPGVPDVWNQILYTRIL  440



>gb|EEC68689.1| hypothetical protein OsI_37151 [Oryza sativa Indica Group]
Length=478

 Score =   264 bits (674),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 159/216 (74%), Gaps = 2/216 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P  H I  RII P+ I+ H  NWK+VDYLIFNTYIWWMN   +KV R +     ++
Sbjct  249  NSDNPNFHHIDQRIISPERIESHANNWKDVDYLIFNTYIWWMNNEDIKVRRPN-STSWSD  307

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DEV R   Y +V  TWS W+++NVDP RT VFFM++SPLH     W NPNGIKC KET 
Sbjct  308  HDEVPRIETYGRVFKTWSTWLEQNVDPARTSVFFMTISPLHNSPAQWGNPNGIKCVKETL  367

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P+LN + PL++  D R++ + + + + MK  PV  ++IT++S+YRKDAHTS+++IRQGK+
Sbjct  368  PVLNYTKPLDLNHDMRMYDLVAKVAKNMKNVPVSLIDITRMSDYRKDAHTSLYSIRQGKL  427

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHII  216
            LTPEQ+ADP  YADCIHWCLPG+PD WN+ LY+ I+
Sbjct  428  LTPEQKADPQKYADCIHWCLPGVPDVWNQILYTRIL  463



>gb|KJB76212.1| hypothetical protein B456_012G077600 [Gossypium raimondii]
Length=428

 Score =   262 bits (669),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 164/220 (75%), Gaps = 4/220 (2%)
 Frame = -1

Query  860  NSDDPTMH-SILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGAT  684
            N D PTM    +  I+  +SI KHG NWKNVDY IFNTYIWW    ++KVLRGSF+ G  
Sbjct  211  NVDPPTMRDGTVEPIVKLESISKHGDNWKNVDYFIFNTYIWWRYP-TVKVLRGSFEDGVA  269

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLH-IKSLDWENPNGIKCAKE  507
            +Y ++D+ +AY   L +W+KW+++NVDPN+T+VFF S++P H I+S  W N NGI C  E
Sbjct  270  DYVDIDQNVAYESALKSWAKWMEENVDPNQTKVFFSSVAPSHMIRSSAWNNTNGIMCLNE  329

Query  506  TSPILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGK  327
            T+PI+NTS   +VGT+ +L +I  N+ R+MK P+ FLNIT+LSEYRKDAHTS++    GK
Sbjct  330  TTPIVNTST-FDVGTNQQLSAILENVVRSMKIPLQFLNITRLSEYRKDAHTSIYAAPGGK  388

Query  326  MLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            +LT EQ+ADP  YADC+HWCLPGLPDTWNE LY+ II ++
Sbjct  389  LLTQEQKADPARYADCVHWCLPGLPDTWNELLYTLIIFQT  428



>ref|XP_006294274.1| hypothetical protein CARUB_v10023271mg [Capsella rubella]
 gb|EOA27172.1| hypothetical protein CARUB_v10023271mg [Capsella rubella]
Length=427

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 159/207 (77%), Gaps = 2/207 (1%)
 Frame = -1

Query  821  IIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLR-GSF-DKGATEYDEVDRPLAYR  648
            +IMP+SI KHG+NWK+ DYL+FNTYIWW     +K L+ GSF ++ + +Y+E+   +AY+
Sbjct  221  VIMPQSISKHGENWKDADYLVFNTYIWWTRHSKIKTLKQGSFSNEDSKDYEEIGIYIAYK  280

Query  647  KVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETSPILNTSMPLNV  468
            +VLSTW+ WV++N++PN+T +FF SMSP HI+S DW    G KC +ET PILN S P++V
Sbjct  281  QVLSTWTNWVEQNINPNQTSIFFSSMSPTHIRSSDWGFNEGSKCERETEPILNMSRPIDV  340

Query  467  GTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPTTY  288
            GT+ RL+ IA N+T++   P+HFLNIT +SEYRKD HTS +  R GK++TPEQ+ DP T+
Sbjct  341  GTNRRLYEIAVNVTKSTTVPIHFLNITTMSEYRKDGHTSFYGSRAGKLITPEQRLDPRTF  400

Query  287  ADCIHWCLPGLPDTWNEFLYSHIISRS  207
            ADC HWCLPGLPDTWNE L  +II +S
Sbjct  401  ADCYHWCLPGLPDTWNELLSLYIIYKS  427



>ref|XP_010534606.1| PREDICTED: protein trichome birefringence-like 30 [Tarenaya hassleriana]
Length=451

 Score =   261 bits (666),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 156/205 (76%), Gaps = 2/205 (1%)
 Frame = -1

Query  818  IMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLR--GSFDKGATEYDEVDRPLAYRK  645
            IM +SI  HGKNWK+ DYL+FNTYIWW    ++KVLR  GSF +G+ EY+E+D  + Y K
Sbjct  246  IMMESISNHGKNWKDSDYLVFNTYIWWTKHSTIKVLRRRGSFGEGSEEYEEIDMYMTYEK  305

Query  644  VLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETSPILNTSMPLNVG  465
            VL TW+ W+++N+DP+RT +FF SMSP H+ S DW    G +C KET P+L+T+  L+VG
Sbjct  306  VLRTWAMWLEENIDPSRTSIFFSSMSPTHLSSSDWNINGGTRCEKETEPVLHTTRTLDVG  365

Query  464  TDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPTTYA  285
            T+ R+F IA N+T++ K P+ FLNIT+LSEYRKD HTS +   +GK+++PEQ +DP T+A
Sbjct  366  TNRRMFEIAENVTKSTKLPIKFLNITRLSEYRKDGHTSFYGSPRGKLVSPEQTSDPATFA  425

Query  284  DCIHWCLPGLPDTWNEFLYSHIISR  210
            DC+HWCLPGLPDTWNE L  +I+ +
Sbjct  426  DCLHWCLPGLPDTWNELLSVYILHK  450



>ref|NP_565924.1| protein TRICHOME BIREFRINGENCE-LIKE 30 [Arabidopsis thaliana]
 sp|Q9SEZ9.1|TBL30_ARATH RecName: Full=Protein trichome birefringence-like 30 [Arabidopsis 
thaliana]
 gb|AAL10482.1| At2g40160/T7M7.25 [Arabidopsis thaliana]
 gb|AAM47478.1| At2g40160/T7M7.25 [Arabidopsis thaliana]
 gb|AEC09790.1| uncharacterized protein AT2G40160 [Arabidopsis thaliana]
Length=427

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/206 (58%), Positives = 158/206 (77%), Gaps = 2/206 (1%)
 Frame = -1

Query  821  IIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRG-SFDKG-ATEYDEVDRPLAYR  648
            +I+P SI KHG+NWK+ DYLIFNTYIWW    ++KVL+  SF+KG + EY+E+   + Y+
Sbjct  221  VIIPNSISKHGENWKDADYLIFNTYIWWTRHSTIKVLKQESFNKGDSKEYNEIGIYIVYK  280

Query  647  KVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETSPILNTSMPLNV  468
            +VLSTW+KW+++N++P++T +FF SMSP HI+S DW    G KC KET PILN S P+NV
Sbjct  281  QVLSTWTKWLEQNINPSQTSIFFSSMSPTHIRSSDWGFNEGSKCEKETEPILNMSKPINV  340

Query  467  GTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPTTY  288
            GT+ RL+ IA N T++ K P+HFLNIT +SEYRKD HTS +    GK++TPEQ+ DP T+
Sbjct  341  GTNRRLYEIALNATKSTKVPIHFLNITTMSEYRKDGHTSFYGSINGKLMTPEQKLDPRTF  400

Query  287  ADCIHWCLPGLPDTWNEFLYSHIISR  210
            ADC HWCLPGLPD+WNE L  +II +
Sbjct  401  ADCYHWCLPGLPDSWNELLSLYIIYK  426



>ref|XP_003579057.1| PREDICTED: protein trichome birefringence-like 28 [Brachypodium 
distachyon]
Length=462

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 164/218 (75%), Gaps = 2/218 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P +HSI +RII P+ I+ H K W+ VDYLIFNTYIWWMNT  MKV R    +  +E
Sbjct  234  NSDNPRIHSIDHRIIRPERIEGHAKYWRGVDYLIFNTYIWWMNTADMKVRRPD-SRYWSE  292

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DEV R  AY +VL TWS W+++N+DP RT VFFM++SPLHI    W NP+ IKC  ET 
Sbjct  293  HDEVPRIDAYGRVLKTWSDWLEENIDPARTSVFFMTISPLHISPDKWGNPSAIKCFNETL  352

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P+LN + P ++  D R++ + ++ +R+MKK PV  ++IT++S+YRKDAHTSV+TIR+ ++
Sbjct  353  PVLNYTEPFDLNHDMRMYDLVASTSRSMKKVPVTLIDITRMSDYRKDAHTSVYTIRRDRL  412

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            LTP+Q+ADP  +ADCIHWCLPG+PD WN  L++ I S+
Sbjct  413  LTPKQRADPEKFADCIHWCLPGVPDVWNTVLFTRIFSK  450



>ref|XP_008661696.1| PREDICTED: protein trichome birefringence-like 28 [Zea mays]
Length=465

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 160/218 (73%), Gaps = 2/218 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P +HSI +RII P+ I+ H K W+ VDYLIFNTYIWWMNT  MKV R +  +  +E
Sbjct  228  NSDNPKIHSIEHRIIRPERIEGHAKYWRGVDYLIFNTYIWWMNTADMKVRRPN-SRYWSE  286

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            +DEV R  AY  V  TWS W++ N+DP+RT VFFM++SPLHI   +W NP+GI+C KET 
Sbjct  287  HDEVPRIEAYGLVFKTWSDWLNDNIDPDRTLVFFMTISPLHISPHNWGNPDGIRCVKETL  346

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P  N S PL++  D R+  +   +   M K PV  +NIT++S+YRKDAHT +++IRQGK+
Sbjct  347  PYQNYSQPLDLYHDMRMHDLVVKVASAMAKVPVTVINITRMSDYRKDAHTGLYSIRQGKL  406

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISR  210
            LTPEQ+ DP  +ADCIHWCLPG+PD WN+ LY+ I+S+
Sbjct  407  LTPEQKGDPEKFADCIHWCLPGVPDVWNQILYTRILSK  444



>gb|ACN29054.1| unknown [Zea mays]
Length=406

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/225 (53%), Positives = 165/225 (73%), Gaps = 2/225 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P  HSI  RII P+ I+ H K+WK+ DYL+FNTYIWWMN   +KV R +  +  ++
Sbjct  170  NSDNPNFHSIKERIISPERIEAHAKHWKDADYLVFNTYIWWMNNADIKVRRPN-SRYWSD  228

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
             DEV R  AY +V  TWS W++ N+DP RT +FFM++SP H+   +W NP+GIKC +ET 
Sbjct  229  NDEVPRIEAYGRVFKTWSDWLNDNIDPARTSIFFMTISPPHLSPQNWGNPDGIKCVRETL  288

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P  N S  L++  D RL+ +  N+  +M+K PV  +NIT++S+YRKDAHTS++TIRQGK+
Sbjct  289  PYQNYSQHLDLYHDMRLYDLVVNVASSMEKVPVTVINITRMSDYRKDAHTSLYTIRQGKL  348

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS*YVTQF  189
            LTP+Q+ADP  +ADCIHWCLPG+PD WN+ LY+ I+S+S + + F
Sbjct  349  LTPKQKADPEKFADCIHWCLPGVPDVWNQILYTRILSKSSWHSNF  393



>gb|AFW64533.1| putative DUF231 domain containing family protein [Zea mays]
Length=469

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/225 (55%), Positives = 165/225 (73%), Gaps = 2/225 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P  HSI   II P+ I+ H K+WK+VDYLIFNTYIWWMNT  +KV R S  +  +E
Sbjct  233  NSDNPNFHSIKEWIISPERIEAHTKHWKDVDYLIFNTYIWWMNTADIKV-RRSNSRYWSE  291

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
             DEV R  AY +V  TWS W++ N+DP RT VFFM++SP H+   +W NP+GIKC  ET 
Sbjct  292  NDEVPRIEAYGRVFKTWSDWLNDNIDPARTSVFFMTISPPHLSPQNWGNPDGIKCVGETL  351

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P  N S PL++  D RL+ +   +  +M+K PV  ++IT++S+YRKDAHTS++TIRQGK+
Sbjct  352  PYQNYSQPLDLYHDMRLYDLVVKVASSMEKVPVTVIDITRMSDYRKDAHTSLYTIRQGKL  411

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS*YVTQF  189
            LTP+Q+ADP  +ADCIHWCLPG+PD WN+ LY+ I+S+S + + F
Sbjct  412  LTPKQKADPEKFADCIHWCLPGVPDVWNQILYTRILSKSSWHSNF  456



>gb|ACG43011.1| hypothetical protein [Zea mays]
Length=478

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/225 (54%), Positives = 165/225 (73%), Gaps = 2/225 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P  HSI  RII P+ I+ H K+WK+ DYLIFNTYIWWMN   +KV R +  +  ++
Sbjct  242  NSDNPNFHSIKERIISPERIEAHAKHWKDADYLIFNTYIWWMNNADIKVRRPN-SRYWSD  300

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
             DEV R  AY +V  TWS W++ N+DP RT VFFM++SP H+   +W NP+GIKC +ET 
Sbjct  301  NDEVPRIEAYGRVFKTWSDWLNDNIDPARTSVFFMTISPPHLSPQNWGNPDGIKCVRETL  360

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P  N S  L++  D RL+ +  N+  +M+K PV  +NIT++S+YRKDAHTS++TIRQGK+
Sbjct  361  PYQNYSQHLDLYHDMRLYDLVVNVASSMEKVPVTVINITRMSDYRKDAHTSLYTIRQGKL  420

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS*YVTQF  189
            LTP+Q+ADP  +ADCIHWCLPG+PD WN+ LY+ I+S+S + + F
Sbjct  421  LTPKQKADPEKFADCIHWCLPGVPDVWNQILYTRILSKSSWHSNF  465



>ref|XP_008679315.1| PREDICTED: protein trichome birefringence-like 28 [Zea mays]
Length=470

 Score =   259 bits (661),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/225 (55%), Positives = 165/225 (73%), Gaps = 2/225 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P  HSI   II P+ I+ H K+WK+VDYLIFNTYIWWMNT  +KV R S  +  +E
Sbjct  234  NSDNPNFHSIKEWIISPERIEAHTKHWKDVDYLIFNTYIWWMNTADIKV-RRSNSRYWSE  292

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
             DEV R  AY +V  TWS W++ N+DP RT VFFM++SP H+   +W NP+GIKC  ET 
Sbjct  293  NDEVPRIEAYGRVFKTWSDWLNDNIDPARTSVFFMTISPPHLSPQNWGNPDGIKCVGETL  352

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P  N S PL++  D RL+ +   +  +M+K PV  ++IT++S+YRKDAHTS++TIRQGK+
Sbjct  353  PYQNYSQPLDLYHDMRLYDLVVKVASSMEKVPVTVIDITRMSDYRKDAHTSLYTIRQGKL  412

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS*YVTQF  189
            LTP+Q+ADP  +ADCIHWCLPG+PD WN+ LY+ I+S+S + + F
Sbjct  413  LTPKQKADPEKFADCIHWCLPGVPDVWNQILYTRILSKSSWHSNF  457



>ref|NP_001189720.1| protein TRICHOME BIREFRINGENCE-LIKE 30 [Arabidopsis thaliana]
 gb|AEC09791.1| uncharacterized protein AT2G40160 [Arabidopsis thaliana]
Length=441

 Score =   258 bits (659),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -1

Query  821  IIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRG-SFDKG-ATEYDEVDRPLAYR  648
            +I+P SI KHG+NWK+ DYLIFNTYIWW    ++KVL+  SF+KG + EY+E+   + Y+
Sbjct  221  VIIPNSISKHGENWKDADYLIFNTYIWWTRHSTIKVLKQESFNKGDSKEYNEIGIYIVYK  280

Query  647  KVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETSPILNTSMPLNV  468
            +VLSTW+KW+++N++P++T +FF SMSP HI+S DW    G KC KET PILN S P+NV
Sbjct  281  QVLSTWTKWLEQNINPSQTSIFFSSMSPTHIRSSDWGFNEGSKCEKETEPILNMSKPINV  340

Query  467  GTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPTTY  288
            GT+ RL+ IA N T++ K P+HFLNIT +SEYRKD HTS +    GK++TPEQ+ DP T+
Sbjct  341  GTNRRLYEIALNATKSTKVPIHFLNITTMSEYRKDGHTSFYGSINGKLMTPEQKLDPRTF  400

Query  287  ADCIHWCLPGLPDTWNEFLYSHIISRS  207
            ADC HWCLPGLPD+WNE L   ++ R 
Sbjct  401  ADCYHWCLPGLPDSWNELLSLFLLHRE  427



>ref|NP_001131868.1| putative DUF231 domain containing family protein [Zea mays]
 gb|ACF80472.1| unknown [Zea mays]
 gb|AFW55787.1| putative DUF231 domain containing family protein [Zea mays]
Length=478

 Score =   258 bits (660),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 119/225 (53%), Positives = 165/225 (73%), Gaps = 2/225 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P  HSI  RII P+ I+ H K+WK+ DYL+FNTYIWWMN   +KV R +  +  ++
Sbjct  242  NSDNPNFHSIKERIISPERIEAHAKHWKDADYLVFNTYIWWMNNADIKVRRPN-SRYWSD  300

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
             DEV R  AY +V  TWS W++ N+DP RT +FFM++SP H+   +W NP+GIKC +ET 
Sbjct  301  NDEVPRIEAYGRVFKTWSDWLNDNIDPARTSIFFMTISPPHLSPQNWGNPDGIKCVRETL  360

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            P  N S  L++  D RL+ +  N+  +M+K PV  +NIT++S+YRKDAHTS++TIRQGK+
Sbjct  361  PYQNYSQHLDLYHDMRLYDLVVNVASSMEKVPVTVINITRMSDYRKDAHTSLYTIRQGKL  420

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS*YVTQF  189
            LTP+Q+ADP  +ADCIHWCLPG+PD WN+ LY+ I+S+S + + F
Sbjct  421  LTPKQKADPEKFADCIHWCLPGVPDVWNQILYTRILSKSSWHSNF  465



>gb|KJB76207.1| hypothetical protein B456_012G077300 [Gossypium raimondii]
Length=423

 Score =   255 bits (651),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 162/219 (74%), Gaps = 8/219 (4%)
 Frame = -1

Query  860  NSDDPTM-HSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGAT  684
            N D PTM +  +  ++  +SI KHG NWKNVDYLIFNTYIWW    +MK L      GAT
Sbjct  212  NVDPPTMRYGTVVPVVKLESISKHGDNWKNVDYLIFNTYIWWRYP-TMKAL-----NGAT  265

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            +  ++D+ +AY + L +W+KWV++NVD NRT VFF SMSP H+KS DW N N IKC  ET
Sbjct  266  DSVDIDQNVAYERALKSWAKWVEENVDSNRTSVFFSSMSPTHMKSSDWNNTNRIKCWNET  325

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            SP  N S  ++VGT+++LF+ A N+ R+MK P+HFLNIT+LSEYRKDAHTS++    GK+
Sbjct  326  SPFPNISR-IDVGTNWQLFTTAVNVIRSMKIPLHFLNITRLSEYRKDAHTSIYAAPGGKL  384

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            LT EQ++DP  YADC+HWCLPGLPDTWNE L++ I+ R+
Sbjct  385  LTQEQKSDPARYADCLHWCLPGLPDTWNELLFALIMYRT  423



>gb|KDP44744.1| hypothetical protein JCGZ_01244 [Jatropha curcas]
Length=383

 Score =   251 bits (641),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 153/205 (75%), Gaps = 5/205 (2%)
 Frame = -1

Query  821  IIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATEYDEVDRPLAYRKV  642
            +IMP +I KH  +W+  D+LIF++Y WW    +++VL+GSF+KG T Y E++R + + +V
Sbjct  184  VIMPDAIAKHANHWREADHLIFDSYAWWTKHPTVRVLQGSFEKGDTRYIEIERHIIFERV  243

Query  641  LSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETSPILNTSMPLNVGT  462
            L  W+KW+++N+DP RT +FF + SP+H +S DW NPNG+ CA ET PILNTSM L++GT
Sbjct  244  LRIWAKWMEENIDPKRTSIFFNTASPIHSRSSDWNNPNGVNCAGETLPILNTSMALDLGT  303

Query  461  DYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPTTYAD  282
            D ++ +IA+N+  +MK PVHFLNIT LSEYRKDAH S +         P+Q+A+P  +AD
Sbjct  304  DRKISAIAANVIGSMKIPVHFLNITTLSEYRKDAHPSFYNTN-----GPKQKANPAEFAD  358

Query  281  CIHWCLPGLPDTWNEFLYSHIISRS  207
            C+HWC+PGLPDTWNE L++HII  S
Sbjct  359  CLHWCVPGLPDTWNELLHAHIIGHS  383



>ref|XP_002528307.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34065.1| conserved hypothetical protein [Ricinus communis]
Length=422

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 157/219 (72%), Gaps = 5/219 (2%)
 Frame = -1

Query  860  NSDDPTMHSILN-RIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGAT  684
            +SD P M       +IMP+SI KHG  WK+ DYLIF++Y WW+   +++VLRGSFDKG T
Sbjct  208  SSDPPPMRDGKTISVIMPESIAKHGDYWKHADYLIFDSYAWWVKHPTVRVLRGSFDKGDT  267

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            +YDE+++ +AY + L TW+ +V++NVDP+RT +FF +M P H +S +W +P    C KE 
Sbjct  268  KYDEIEQHIAYERALRTWANFVEQNVDPSRTTIFFSTMFPQHYRSAEWNDPKATNCWKEI  327

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
             PI++ S PLN+ TD R F IA  +T++MK  VHFLNIT LSEYRKDAH S++T  Q   
Sbjct  328  LPIMDNSRPLNISTDMRFFRIAEKVTKSMKVAVHFLNITTLSEYRKDAHMSIYTNNQD--  385

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
              P+Q+ +P   ADC+HWCLPG+PDTWNE LY+H+I+ S
Sbjct  386  --PKQKDNPADGADCVHWCLPGVPDTWNELLYAHLITHS  422



>emb|CDY24924.1| BnaC03g22480D [Brassica napus]
Length=419

 Score =   250 bits (638),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 152/209 (73%), Gaps = 4/209 (2%)
 Frame = -1

Query  821  IIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATEYD-EVDRPLAYRK  645
            IIMP SI KHG+NWK+ D+L+FNTYIWW     +KVLRGSF    +E   EV     Y +
Sbjct  211  IIMPGSISKHGENWKDADFLVFNTYIWWTRHSKIKVLRGSFITNESEESIEVGIYSMYEE  270

Query  644  VLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGI--KCAKETSPILNTSMPLN  471
            VL TW  W+++N++PNRT VFF SMSP H++S DW+   G+  KC KET PILN S P++
Sbjct  271  VLRTWKNWLEQNINPNRTSVFFSSMSPTHVRSSDWDVNGGVTRKCEKETEPILNMSKPVD  330

Query  470  VGTDYRLFSIASNITR-TMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPT  294
            VGT+ RL  IA N+T+ T K  V FLN+T +SEYRKDAHTS +  R G++LTP Q++DP 
Sbjct  331  VGTNRRLQEIAVNVTKSTAKVHVTFLNVTTMSEYRKDAHTSFYGSRSGRLLTPVQKSDPR  390

Query  293  TYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            T+ADC HWCLPGLPDTWNEFL  +II RS
Sbjct  391  TFADCYHWCLPGLPDTWNEFLSLYIIHRS  419



>gb|KHG12904.1| DNA ligase [Gossypium arboreum]
Length=428

 Score =   249 bits (636),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 158/219 (72%), Gaps = 3/219 (1%)
 Frame = -1

Query  860  NSDDPTM-HSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGAT  684
            N D PTM +  +   +  +SI KHG NWKNVDYLIFNTYIWW    +MK L+  F  GAT
Sbjct  212  NVDPPTMRYGTVVPEVKLESISKHGDNWKNVDYLIFNTYIWWRYP-TMKALQRIFSNGAT  270

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            +  +VD+ +AY + L +W+KWV++NVD NRT VFF SMSP H+K  DW N N IKC  ET
Sbjct  271  DSVDVDQNVAYERALKSWAKWVEENVDSNRTSVFFSSMSPTHMKRSDWNNTNRIKCWNET  330

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKM  324
            SP  N S  ++VGT+ +LF+   N+ ++MK P+HF NIT+LSEYRKDAHTS++    GK+
Sbjct  331  SPFPNISR-IDVGTNRQLFTTTVNVIQSMKIPLHFFNITRLSEYRKDAHTSIYAAPGGKL  389

Query  323  LTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            LT EQ++DP  YADC+ WC+PGLPDTWNE L++ I+ RS
Sbjct  390  LTQEQKSDPARYADCLDWCVPGLPDTWNELLFALIMYRS  428



>ref|XP_009133416.1| PREDICTED: protein trichome birefringence-like 30 isoform X1 
[Brassica rapa]
Length=433

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 152/209 (73%), Gaps = 4/209 (2%)
 Frame = -1

Query  821  IIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVL-RGSFDKGATEYDEVDRPLAYRK  645
            IIMP SI KHG+NWK+ D+L+FNTYIWW     +KVL +GSF   + E +EV   + Y +
Sbjct  225  IIMPGSISKHGENWKDADFLVFNTYIWWTRHSKIKVLTQGSFSNESKESNEVGIYIMYEE  284

Query  644  VLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGI--KCAKETSPILNTSMPLN  471
            VL TW  W+++N+DPNRT VFF SMSP H++S DW+   G+  KC KET PIL+ S P+ 
Sbjct  285  VLRTWKNWLEQNIDPNRTSVFFSSMSPTHVRSSDWDVSGGVTRKCEKETEPILDMSKPVA  344

Query  470  VGTDYRLFSIASNITR-TMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPT  294
            VGT+ RL  IA N+T+ T K  V FLN+T +SEYRKDAHTS +  R G++ TP Q++DP 
Sbjct  345  VGTNRRLQEIAVNVTKSTTKVHVTFLNVTTMSEYRKDAHTSFYGSRSGRLSTPVQKSDPR  404

Query  293  TYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            T+ADC HWCLPGLPDTWNEFL  +II RS
Sbjct  405  TFADCYHWCLPGLPDTWNEFLSLYIIHRS  433



>ref|XP_006411269.1| hypothetical protein EUTSA_v10016697mg [Eutrema salsugineum]
 gb|ESQ52722.1| hypothetical protein EUTSA_v10016697mg [Eutrema salsugineum]
Length=427

 Score =   247 bits (630),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 153/205 (75%), Gaps = 3/205 (1%)
 Frame = -1

Query  821  IIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLR-GSFDKGATEYDEVDRPLAYRK  645
            IIMP+SI KHG++WK+ D+L+FNTYIWW     +KVL+ GSF +G+ EY+E+   + Y +
Sbjct  220  IIMPRSISKHGESWKDADFLVFNTYIWWTRNSKIKVLKQGSFSQGSKEYNEIGIYVMYEQ  279

Query  644  VLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGI-KCAKETSPILNTSMPLNV  468
            VL TW+ W+++N+D NRT +FF SMSP H++S DW    G  KC KET PIL+ S P++V
Sbjct  280  VLRTWANWLEQNIDSNRTSIFFSSMSPAHVRSSDWSVDGGSSKCEKETEPILDMSKPIDV  339

Query  467  GTDYRLFSIASNITR-TMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPTT  291
            GT+ R + IA N+T+ T +  ++FL++T +SEYRKD HTS +  R GK++TPEQ+ DP T
Sbjct  340  GTNRRFYEIAVNVTKSTSRVKINFLDVTTMSEYRKDGHTSFYGSRSGKLITPEQKLDPRT  399

Query  290  YADCIHWCLPGLPDTWNEFLYSHII  216
            +ADC HWCLPGLPDTWNE L  +II
Sbjct  400  FADCYHWCLPGLPDTWNELLSLYII  424



>tpg|DAA47343.1| TPA: putative DUF231 domain containing family protein [Zea mays]
Length=492

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 161/245 (66%), Gaps = 29/245 (12%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P +HSI +RII P+ I+ H K W+ VDYLIFNTYIWWMNT  MKV R +  +  +E
Sbjct  228  NSDNPKIHSIEHRIIRPERIEGHAKYWRGVDYLIFNTYIWWMNTADMKVRRPN-SRYWSE  286

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSL---------------  546
            +DEV R  AY  V  TWS W++ N+DP+RT VFFM++SPLHI+                 
Sbjct  287  HDEVPRIEAYGLVFKTWSDWLNDNIDPDRTLVFFMTISPLHIRRCVINMVYENRVPVSLT  346

Query  545  ------------DWENPNGIKCAKETSPILNTSMPLNVGTDYRLFSIASNITRTMKK-PV  405
                        +W NP+GI+C KET P  N S PL++  D R+  +   +   M K PV
Sbjct  347  LVYVLFYENSPHNWGNPDGIRCVKETLPYQNYSQPLDLYHDMRMHDLVVKVASAMAKVPV  406

Query  404  HFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYS  225
              +NIT++S+YRKDAHT +++IRQGK+LTPEQ+ DP  +ADCIHWCLPG+PD WN+ LY+
Sbjct  407  TVINITRMSDYRKDAHTGLYSIRQGKLLTPEQKGDPEKFADCIHWCLPGVPDVWNQILYT  466

Query  224  HIISR  210
             I+S+
Sbjct  467  RILSK  471



>gb|KHG07986.1| Ferrochelatase [Gossypium arboreum]
Length=172

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 133/169 (79%), Gaps = 1/169 (1%)
 Frame = -1

Query  710  RGSFDKGATEYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENP  531
            RGSFD    EYDE++RP+AY +V+  W+KWVD+NVD   T V+FMSMSP HIKS DW NP
Sbjct  4    RGSFDAEPVEYDEIERPIAYWRVVKRWAKWVDENVDSKFTSVYFMSMSPTHIKSSDWNNP  63

Query  530  NGIKCAKETSPILNTSMPL-NVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHT  354
            +GI CA ET P+ N S+P   +GTDYR   + +++ ++MK PV+F+NIT +SEYRKDAHT
Sbjct  64   DGILCANETLPMTNLSIPPPYIGTDYRALQMVADVIQSMKVPVNFINITAMSEYRKDAHT  123

Query  353  SVHTIRQGKMLTPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            SV+T RQG+++T EQQADP  YADCIHWCLPGLPDTWNE LY+ IIS S
Sbjct  124  SVYTTRQGQLITKEQQADPAKYADCIHWCLPGLPDTWNELLYTQIISHS  172



>ref|XP_010517430.1| PREDICTED: protein trichome birefringence-like 30 [Camelina sativa]
Length=430

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 153/209 (73%), Gaps = 4/209 (2%)
 Frame = -1

Query  821  IIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLR-GSFDKGAT--EYDEVDRPLAY  651
            +IMP+SI KHG+NWK  DYL+FNTYIWW     +K L+ GSF K  +  +Y+E    + Y
Sbjct  222  VIMPQSISKHGENWKYADYLVFNTYIWWTRHSKIKTLKQGSFRKNDSKEDYEETGIYIGY  281

Query  650  RKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETSPILNTSM-PL  474
            ++VLSTW+ W+ +N++PN+T +FF SMSP HI+S DW +  G KC +ET PILN S  P+
Sbjct  282  KQVLSTWTNWLKQNINPNQTSIFFSSMSPTHIRSSDWGSNEGSKCERETEPILNMSRRPI  341

Query  473  NVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPT  294
            +VGT+ RL+ IA N T++   P+ FL+ITK+SEYRKD HTS +  R GK++T EQ+ DP 
Sbjct  342  DVGTNRRLYEIAVNATKSTTVPIRFLDITKMSEYRKDGHTSFYGSRTGKLITTEQRLDPR  401

Query  293  TYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            T+ADC HWCLPGLPDTWNE L  +II +S
Sbjct  402  TFADCYHWCLPGLPDTWNELLSLYIIYKS  430



>ref|XP_010321451.1| PREDICTED: protein ESKIMO 1-like isoform X2 [Solanum lycopersicum]
Length=407

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 147/218 (67%), Gaps = 53/218 (24%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSDDP +H+IL R+IMP+SI+KHG +WKNVDYLIFN                        
Sbjct  243  NSDDPAVHNILTRLIMPESIEKHGNSWKNVDYLIFN------------------------  278

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
                                         T V++M+   + + S+DW NPNGIKCAKET+
Sbjct  279  -----------------------------TYVWWMNGGTMKVLSMDWNNPNGIKCAKETT  309

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+LN SMPLNVGTD RLF IASN+T+++K PV+F+NIT++SEYRKDAHTS++TIRQGK+L
Sbjct  310  PVLNMSMPLNVGTDKRLFDIASNVTKSIKLPVYFMNITRISEYRKDAHTSLYTIRQGKIL  369

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            TPEQQADP TYADCIHWCLPGLPDTWNE LY+ I+S S
Sbjct  370  TPEQQADPATYADCIHWCLPGLPDTWNELLYTRIMSSS  407



>ref|XP_010505739.1| PREDICTED: protein trichome birefringence-like 30 isoform X2 
[Camelina sativa]
Length=430

 Score =   244 bits (623),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 155/209 (74%), Gaps = 4/209 (2%)
 Frame = -1

Query  821  IIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLR-GSFDKGAT--EYDEVDRPLAY  651
            +I+P+SI KHG+NWK+ DYL+FNTYIWW     +K L+ GSF K  +  +Y+E    + Y
Sbjct  222  VIIPQSISKHGENWKDADYLVFNTYIWWTRHSKIKTLKQGSFSKNDSKEDYEETGIYIGY  281

Query  650  RKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETSPILNTSM-PL  474
            ++VLSTW+ W+++N++PN+T +FF SMSP HI+S DW +  G KC +ET PILN S  P+
Sbjct  282  KQVLSTWTNWLEQNINPNQTSIFFSSMSPTHIRSSDWGSNEGSKCERETEPILNMSRRPI  341

Query  473  NVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPT  294
            +VGT+ RL+ IA + T++   P+ FLNITK+SEYRKD HTS +  + GK++T EQ+ DP 
Sbjct  342  DVGTNRRLYEIAVDATKSTNVPIRFLNITKMSEYRKDGHTSFYGSKTGKLITTEQRLDPR  401

Query  293  TYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            T+ADC HWCLPGLPDTWNE L  +II ++
Sbjct  402  TFADCYHWCLPGLPDTWNELLSLYIIYKN  430



>ref|NP_001055286.1| Os05g0354400 [Oryza sativa Japonica Group]
 dbj|BAF17200.1| Os05g0354400 [Oryza sativa Japonica Group]
Length=571

 Score =   248 bits (632),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 148/192 (77%), Gaps = 2/192 (1%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRG-SFDKGAT  684
            NSDDP MHSI++RII P SI KH  NW+ VDYLIFNTYIWWMNT  MK+L G SF K   
Sbjct  298  NSDDPNMHSIVDRIIKPTSIAKHAANWEGVDYLIFNTYIWWMNTPEMKILHGGSFSKKPV  357

Query  683  EYDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKET  504
            +YDE++R  AYRKVL TWS+WV+K+VDP R+ VFFMS+SP+H++S  W  P+ IKC  ET
Sbjct  358  KYDEMERVAAYRKVLKTWSRWVEKHVDPKRSTVFFMSVSPVHMQSEGWGKPDAIKCFSET  417

Query  503  SPILNTSMPLNVGTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGK  327
             P +N +  L VGTD+ LFS A ++T+ MK+ PVHF+NIT LSE RKDAHTSV+T+RQGK
Sbjct  418  QPAINYTKKLEVGTDWDLFSTAHHVTKAMKRVPVHFINITALSEIRKDAHTSVNTLRQGK  477

Query  326  MLTPEQQADPTT  291
            +LT +++  P +
Sbjct  478  LLTKDRRRTPAS  489



>ref|XP_010508900.1| PREDICTED: protein trichome birefringence-like 30 [Camelina sativa]
Length=430

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 154/209 (74%), Gaps = 4/209 (2%)
 Frame = -1

Query  821  IIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLR-GSFDKGAT--EYDEVDRPLAY  651
            +I+P+SI KHG+NWK+ DYL+FNTYIWW     +K L+ GSF K  +  +Y+E    + Y
Sbjct  222  VIIPQSISKHGENWKDADYLVFNTYIWWTRHSKIKTLKQGSFSKNDSKEDYEETGIYIGY  281

Query  650  RKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETSPILNTSMP-L  474
            ++VLSTW+KW+++N++ N+T +FF SMSP HI+S DW    G KC +ET PILN S+P +
Sbjct  282  KQVLSTWTKWLEQNINTNQTSIFFSSMSPTHIRSSDWGFNEGSKCERETEPILNMSIPPI  341

Query  473  NVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPT  294
            +VGT+ RL+ IA + T++   P+ FLNIT +SEYRKD HTS +  R GK++T EQ+ DP 
Sbjct  342  DVGTNRRLYEIAVDATKSTTVPIRFLNITTMSEYRKDGHTSFYGSRTGKLMTTEQRLDPR  401

Query  293  TYADCIHWCLPGLPDTWNEFLYSHIISRS  207
            T+ADC HWCLPGLPDTWNE L  +II +S
Sbjct  402  TFADCYHWCLPGLPDTWNELLSLYIIYKS  430



>ref|XP_009133417.1| PREDICTED: protein trichome birefringence-like 30 isoform X2 
[Brassica rapa]
Length=427

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 148/208 (71%), Gaps = 8/208 (4%)
 Frame = -1

Query  821  IIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATEYDEVDRPLAYRKV  642
            IIMP SI KHG+NWK+ D+L+FNTYIWW     +KVL  S      E +EV   + Y +V
Sbjct  225  IIMPGSISKHGENWKDADFLVFNTYIWWTRHSKIKVLNES-----KESNEVGIYIMYEEV  279

Query  641  LSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGI--KCAKETSPILNTSMPLNV  468
            L TW  W+++N+DPNRT VFF SMSP H++S DW+   G+  KC KET PIL+ S P+ V
Sbjct  280  LRTWKNWLEQNIDPNRTSVFFSSMSPTHVRSSDWDVSGGVTRKCEKETEPILDMSKPVAV  339

Query  467  GTDYRLFSIASNITR-TMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPTT  291
            GT+ RL  IA N+T+ T K  V FLN+T +SEYRKDAHTS +  R G++ TP Q++DP T
Sbjct  340  GTNRRLQEIAVNVTKSTTKVHVTFLNVTTMSEYRKDAHTSFYGSRSGRLSTPVQKSDPRT  399

Query  290  YADCIHWCLPGLPDTWNEFLYSHIISRS  207
            +ADC HWCLPGLPDTWNEFL  +II RS
Sbjct  400  FADCYHWCLPGLPDTWNEFLSLYIIHRS  427



>ref|XP_004148615.1| PREDICTED: uncharacterized protein LOC101212899 [Cucumis sativus]
 ref|XP_004172770.1| PREDICTED: uncharacterized protein LOC101226938 [Cucumis sativus]
Length=440

 Score =   240 bits (613),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 145/214 (68%), Gaps = 1/214 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P +     RI+   S+  H K+W NVD L+FNTY+WWM+   +K L GSF+ G   
Sbjct  228  NSDNPIIGDPRQRILRVDSVANHSKHWTNVDILVFNTYVWWMSGVRIKSLWGSFENGEEG  287

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E D P+AY   L TW+ WVD NV+PN T+VFF +MSP H +S+DW   NG KC  ET 
Sbjct  288  YEEFDTPIAYTMGLKTWANWVDSNVNPNITRVFFTTMSPTHTRSMDWGRVNGSKCFNETK  347

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PI N       G D  + S+ S I   MK PV F+NIT+LS+YR DAH+S+ T   GK+L
Sbjct  348  PIKNKKF-WGSGADKGIMSVVSKIVHKMKVPVTFINITQLSDYRIDAHSSIFTETGGKLL  406

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHI  219
            TPEQ+ADP  +ADCIHWCLPG+PDTWN+ L++H+
Sbjct  407  TPEQKADPLHHADCIHWCLPGVPDTWNQILFAHL  440



>gb|EPS65057.1| hypothetical protein M569_09721, partial [Genlisea aurea]
Length=297

 Score =   236 bits (601),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 144/215 (67%), Gaps = 1/215 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD P +    NRI+   S+ KH  NW  +D L+FNTY+WWM+ F++K   GSF   A  
Sbjct  84   NSDIPIIPDPRNRIVRVDSVAKHAGNWVGIDVLVFNTYVWWMSGFTVKSWWGSFGNAAES  143

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
              E++ P++Y   L TW+ W+D NV+PN T+VFF +MSP H +S DW    GI+C  ET+
Sbjct  144  NQELEAPVSYTLALKTWANWIDANVNPNVTRVFFTTMSPTHQRSADWGREKGIRCFNETT  203

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+         G+D R+  I SN+   MK PV  +N+T+LSEYR DAHTSV+T   GK+L
Sbjct  204  PVSREGH-WGTGSDKRIMRIVSNVLGRMKVPVTVINVTQLSEYRIDAHTSVYTELGGKLL  262

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHII  216
            TP+Q+ DP+ +ADCIHWCLPG+PDTWN  LY+H++
Sbjct  263  TPKQREDPSRFADCIHWCLPGVPDTWNRILYAHLL  297



>gb|ABA91060.1| expressed protein [Oryza sativa Japonica Group]
Length=525

 Score =   242 bits (618),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 121/265 (46%), Positives = 160/265 (60%), Gaps = 51/265 (19%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P  H I  RII P+ I+ H  NWK+VDYLIFNTYIWWMN   +KV R +     ++
Sbjct  247  NSDNPNFHHIDQRIISPERIESHANNWKDVDYLIFNTYIWWMNNEDIKVRRPN-STSWSD  305

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKS----------------  549
            +DEV R   Y +V  TWS W+++NVDP RT VFFM++SPLH  S                
Sbjct  306  HDEVPRIETYGRVFKTWSTWLEQNVDPARTSVFFMTISPLHNSSKIGIGGRWFNTDAVIT  365

Query  548  ---------------------------------LDWENPNGIKCAKETSPILNTSMPLNV  468
                                               W NPNGIKC KET P+LN + PL++
Sbjct  366  FCQFNIDEPCISATGSLELWNILKYRHRVRWFPAQWGNPNGIKCVKETLPVLNYTKPLDL  425

Query  467  GTDYRLFSIASNITRTMKK-PVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPTT  291
              D R++ + + + + MK  PV  ++IT++S+YRKDAHTS+++IRQGK+LTPEQ+ADP  
Sbjct  426  NHDMRMYDLVAKVAKNMKNVPVSLIDITRMSDYRKDAHTSLYSIRQGKLLTPEQKADPQK  485

Query  290  YADCIHWCLPGLPDTWNEFLYSHII  216
            YADCIHWCLPG+PD WN+ LY+ I+
Sbjct  486  YADCIHWCLPGVPDVWNQILYTRIL  510



>ref|XP_006429424.1| hypothetical protein CICLE_v10011779mg [Citrus clementina]
 gb|ESR42664.1| hypothetical protein CICLE_v10011779mg [Citrus clementina]
Length=431

 Score =   239 bits (609),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 148/214 (69%), Gaps = 1/214 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD   +     RI+   SI+KH K+W  VD ++FNTY+WWM+   +K L GSF  GA  
Sbjct  219  NSDLQIIGDPKKRILKVDSIEKHAKHWGAVDIIVFNTYVWWMSGIRLKTLWGSFANGADG  278

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            ++E+D P+AYR  L TW+ W+D  ++PNRT+VFF +MSP H KS+DW N +GIKC  ET 
Sbjct  279  FEELDTPIAYRIGLKTWANWIDSTINPNRTRVFFTTMSPTHTKSIDWGNKDGIKCFNETK  338

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+         G+D ++ S+ S++ + MK PV FLNIT++SEYR DAH SV+T   GK+L
Sbjct  339  PVTKKKH-WGSGSDKKMMSVVSDVVKKMKVPVTFLNITQISEYRIDAHASVYTEAGGKVL  397

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHI  219
            T E++ADP  +ADCIHWCLPG+PDTWN+   +H+
Sbjct  398  TEEERADPLRHADCIHWCLPGVPDTWNQIFLAHL  431



>ref|XP_006481061.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=431

 Score =   239 bits (609),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 148/214 (69%), Gaps = 1/214 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD   +     RI+   SI+KH K+W  VD ++FNTY+WWM+   +K L GSF  GA  
Sbjct  219  NSDLQIIGDPKKRILKVDSIEKHAKHWGAVDIIVFNTYVWWMSGIRLKTLWGSFANGADG  278

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            ++E+D P+AYR  L TW+ W+D  ++PNRT+VFF +MSP H KS+DW N +GIKC  ET 
Sbjct  279  FEELDTPIAYRIGLKTWANWIDSTINPNRTRVFFTTMSPTHTKSIDWGNKDGIKCFNETK  338

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+         G+D ++ S+ S++ + MK PV FLNIT++SEYR DAH SV+T   GK+L
Sbjct  339  PVTKKKH-WGSGSDKKMMSVVSDVVKKMKVPVTFLNITQISEYRIDAHASVYTEAGGKVL  397

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHI  219
            T E++ADP  +ADCIHWCLPG+PDTWN+   +H+
Sbjct  398  TEEERADPLRHADCIHWCLPGVPDTWNQIFLAHL  431



>gb|KDO56693.1| hypothetical protein CISIN_1g014084mg [Citrus sinensis]
Length=431

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 148/214 (69%), Gaps = 1/214 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD   +     RI+   SI+KH K+W  VD ++FNTY+WWM+   +K L GSF  GA  
Sbjct  219  NSDLQIIGDPKKRILKVDSIEKHAKHWGAVDIIVFNTYVWWMSGIRLKTLWGSFANGADG  278

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            ++E+D P+AYR  L TW+ W+D  ++PNRT+VFF +MSP H KS+DW N +GIKC  ET 
Sbjct  279  FEELDTPIAYRIGLKTWANWIDSTINPNRTRVFFTTMSPTHTKSIDWGNKDGIKCFNETK  338

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+         G+D ++ S+ S++ + MK PV FLNIT++SEYR DAH SV+T   GK+L
Sbjct  339  PVTKKKH-WGSGSDKKMMSVVSDVVKKMKVPVTFLNITQISEYRIDAHASVYTEAGGKVL  397

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHI  219
            T E++ADP  +ADCIHWCLPG+PDTWN+   +H+
Sbjct  398  TEEERADPLRHADCIHWCLPGVPDTWNQIFLAHL  431



>ref|XP_008464204.1| PREDICTED: protein trichome birefringence-like 3 [Cucumis melo]
Length=436

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 145/214 (68%), Gaps = 1/214 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+P +     RI+   S+  H K+W NVD L+FNTY+WWM+   +K L GSF+ G   
Sbjct  224  NSDNPIIGDPKQRILRVDSVANHSKHWANVDILVFNTYVWWMSGVKIKALWGSFENGEEG  283

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E D P+AY   L TW+ WVD NV+PN T+VFF +MSP H +S+DW   NG KC  ET 
Sbjct  284  YEEFDTPIAYTMGLKTWANWVDSNVNPNITRVFFTTMSPTHTRSMDWGRVNGSKCFNETK  343

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PI N       G D  + S+ S I   MK PV F+NIT+LS+YR DAH+S++T   GK+L
Sbjct  344  PIKNKKF-WGSGADKGIMSVVSKIVHKMKVPVTFINITQLSDYRIDAHSSIYTETGGKLL  402

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHI  219
            T EQ+ADP  +ADCIHWCLPG+PDTWN+ L++H+
Sbjct  403  TTEQKADPLHHADCIHWCLPGVPDTWNQILFNHL  436



>ref|XP_010999799.1| PREDICTED: protein trichome birefringence-like 30 [Populus euphratica]
Length=428

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 147/197 (75%), Gaps = 4/197 (2%)
 Frame = -1

Query  800  KKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATEYDEVDRPLAYRKVLSTWSKW  621
            KK  K WK  DYLIF+TY WW+   +++++RG FD+ A EYD V+  +AY + L TW+KW
Sbjct  235  KKGQKTWKKTDYLIFDTYAWWIKHPTVRLIRGPFDERAKEYDVVEAHVAYERSLRTWAKW  294

Query  620  VDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETSPILNTSMPLNVGTDYRLFSI  441
            VD++V P+RT+VFF SM+PLH+++LDW N + + C KET+PILN S+PL    D+R F+I
Sbjct  295  VDEHVHPSRTEVFFNSMAPLHVRALDWNNADAVMCEKETTPILNMSIPLEGSNDHRYFAI  354

Query  440  ASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPTTYADCIHWCLP  261
            A  +  +MK P+ FLNIT LSEYRKDAH S++     K+ + EQ+A+P  Y+DC+HWC+P
Sbjct  355  AEKVIHSMKFPIKFLNITTLSEYRKDAHPSIY----NKVPSREQKANPAKYSDCVHWCVP  410

Query  260  GLPDTWNEFLYSHIISR  210
            GLPDTWNE LY++I ++
Sbjct  411  GLPDTWNELLYAYITNQ  427



>ref|XP_002323595.1| hypothetical protein POPTR_0016s12660g [Populus trichocarpa]
 gb|EEF05356.1| hypothetical protein POPTR_0016s12660g [Populus trichocarpa]
Length=426

 Score =   236 bits (602),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 146/214 (68%), Gaps = 1/214 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            N+D   +     RI+   SI KH K+W  VD+L+FNTY+WWM+   +K L GSF  G   
Sbjct  214  NTDHHIIADPKKRILKVDSIDKHAKHWGGVDFLVFNTYVWWMSGIRLKTLWGSFANGEEG  273

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E+D P+AY+  L TW+ W+D N++PN+T+VFF +MSP H +S DW N  G+KC  ET 
Sbjct  274  YEELDTPVAYKIGLKTWANWIDSNINPNKTRVFFTTMSPTHTRSEDWNNTEGLKCFNETK  333

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+L        G+D R+ S+ ++I + MK PV F+NIT+LSEYR DAH SV+T   GK+L
Sbjct  334  PVLKKKY-WGSGSDKRMMSVVASIGKKMKVPVTFINITQLSEYRIDAHASVYTETGGKLL  392

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHI  219
            T EQ+ADP  +ADCIHWCLPG+PDTWN    +++
Sbjct  393  TEEQRADPLHHADCIHWCLPGVPDTWNRIFLAYL  426



>ref|XP_011004745.1| PREDICTED: protein trichome birefringence-like 3 [Populus euphratica]
Length=426

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 146/214 (68%), Gaps = 1/214 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            N+D   +     R++   SI KH K+W  VD+L+FNTY+WWM+   +K L GSF  G   
Sbjct  214  NTDHHIIADPKKRLLKVDSIDKHAKHWGGVDFLVFNTYVWWMSGQRLKTLWGSFANGEDG  273

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y E+D P+AY+  L TW+ W+D N++PN+T+VFF +MSP H +S DW NP G+KC  ET 
Sbjct  274  YVELDTPIAYKIGLKTWANWIDSNINPNKTRVFFTTMSPTHTRSEDWNNPEGLKCFNETK  333

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+L        G+D R+ S+ ++I + MK PV F+NIT+LSEYR DAH SV+T   GK+L
Sbjct  334  PVLKKKY-WGTGSDKRMMSVVASIGKKMKVPVTFINITQLSEYRIDAHASVYTETGGKLL  392

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHI  219
            T EQ+ADP  +ADCIHWCLPG+PDTWN    +++
Sbjct  393  TEEQRADPLHHADCIHWCLPGVPDTWNRIFLAYL  426



>ref|XP_010037693.1| PREDICTED: protein trichome birefringence-like 3 [Eucalyptus 
grandis]
 gb|KCW49442.1| hypothetical protein EUGRSUZ_K02974 [Eucalyptus grandis]
Length=432

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 146/214 (68%), Gaps = 1/214 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD   +     RI+   SI KH K+W  VD L+FN+Y+WWM    +K L GSF  G   
Sbjct  220  NSDLHIVGDPRKRILKVDSIMKHAKHWTGVDILVFNSYVWWMTGLRIKSLWGSFANGEEG  279

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E+D P+AYR  L TW+ WVD  ++PN T+V F +MSP H++S+DW N +GIKC  ET 
Sbjct  280  YEELDLPVAYRIALKTWANWVDSTINPNETRVLFTTMSPTHMRSVDWNNKDGIKCFNETK  339

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P++  +     G+D R+  + S++   MK PV F+N+T+LSEYR DAH+S++T   G +L
Sbjct  340  PVMKKNH-WGTGSDKRIMKVVSSVVEKMKVPVTFINVTQLSEYRIDAHSSIYTETGGSLL  398

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHI  219
            T EQ+ADP  +ADCIHWCLPG+PDTWN+ LY+H+
Sbjct  399  TDEQKADPLHHADCIHWCLPGVPDTWNQILYAHL  432



>ref|XP_011077543.1| PREDICTED: protein trichome birefringence-like 3 [Sesamum indicum]
Length=426

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 143/215 (67%), Gaps = 1/215 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD   +     RI+   S+ KH K+W  VD L+FNTY+WWM+   +K L GSF  G   
Sbjct  213  NSDLHIIADPKKRILKVDSVAKHAKHWIGVDILVFNTYVWWMSGLKIKSLWGSFANGDEG  272

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E+D P++Y   L TW+ WVD NV+PN+T+VFF +MSP H +S DW N  GIKC  ET 
Sbjct  273  YEELDAPVSYTIGLKTWANWVDSNVNPNKTRVFFTTMSPTHQRSADWGNEKGIKCFNETK  332

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PI         G+D R+  + + +   MK PV  +NIT+LSEYR DAH+S++T   GK+L
Sbjct  333  PITKKRH-WGSGSDKRMMGVVAGVVERMKVPVTLINITQLSEYRIDAHSSIYTELGGKLL  391

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHII  216
            T EQ+ADP  YADCIHWCLPG+PDTWN  LY+H++
Sbjct  392  TDEQKADPLHYADCIHWCLPGVPDTWNRILYAHLL  426



>emb|CDP06464.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   234 bits (597),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 147/212 (69%), Gaps = 1/212 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD+  +     RI+   SI KH K+W +VD L+FNTY+WWM+   +K L GSF  G   
Sbjct  212  NSDERIVGDPKKRILRVDSIAKHAKHWVDVDILVFNTYVWWMSGLKIKSLWGSFANGEEG  271

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
             +E++ P++YR  L TW+ WVD  +DPN T+VFF +MSP H +S DW N NGIKC  ET 
Sbjct  272  SEELEAPVSYRIGLKTWANWVDSTIDPNTTRVFFTTMSPTHQRSEDWGNKNGIKCFNETK  331

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PILN       G+D R+ ++ +++   MK PV F+NIT+LSEYR DAH+S++T  QG++L
Sbjct  332  PILN-KWHWGSGSDRRMMNVVASVVEKMKVPVTFINITQLSEYRIDAHSSIYTELQGQLL  390

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYS  225
            T EQ+ADP   ADCIHWCLPG+PDTWN+ L++
Sbjct  391  TDEQKADPLHNADCIHWCLPGVPDTWNQILFA  422



>ref|XP_002532108.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30270.1| conserved hypothetical protein [Ricinus communis]
Length=416

 Score =   233 bits (595),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 147/214 (69%), Gaps = 1/214 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            N+D   +     RI+   SI+ H K+WK VD+++FNTY+WWM+   +K L GSF  G   
Sbjct  204  NTDLKIIGDPKKRIMKVDSIENHAKHWKGVDFIVFNTYVWWMSGLRLKTLWGSFANGEEG  263

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E+D P+AY+  L TW+ WVD N++PN+T+VFF +MSP H +S DW N  GIKC  ET 
Sbjct  264  YEELDTPIAYKIGLKTWANWVDSNINPNKTRVFFTTMSPTHTRSEDWNNTKGIKCFNETK  323

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P++        G+D R+ S+ ++I   MK PV  LNIT+LSEYR DAHTSV+T   GK+L
Sbjct  324  PVMKKRH-WGSGSDKRIMSVVASIVGKMKVPVTVLNITQLSEYRIDAHTSVYTETGGKVL  382

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHI  219
            T E++ADP  +ADCIHWCLPG+PDTWN+   +++
Sbjct  383  TDEEKADPLHHADCIHWCLPGVPDTWNQIFLAYL  416



>ref|XP_007205758.1| hypothetical protein PRUPE_ppa010289mg [Prunus persica]
 gb|EMJ06957.1| hypothetical protein PRUPE_ppa010289mg [Prunus persica]
Length=255

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 144/214 (67%), Gaps = 1/214 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD   + +   RI+   SI KH K+W+ VD L+FNTY+WWM+ +++K   GSF  G   
Sbjct  43   NSDLHIIGNPKERILKVDSIAKHAKHWEGVDILVFNTYVWWMSGYTIKSYWGSFPNGEEG  102

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E++ P AYR  L TW+ WVD NV+PN+T+VFF +MSP H++S DW+NP G++C  ET 
Sbjct  103  YEELEAPAAYRIALKTWANWVDSNVNPNKTRVFFTTMSPTHMRSADWDNPEGMRCFNETK  162

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P L        G+D R+  + + + + MK PV  LN+T++S +R DAHT V+T   GK+L
Sbjct  163  PFLKKGF-WGTGSDKRVMRVVAEVLKRMKVPVSVLNVTQMSNHRVDAHTKVYTETGGKVL  221

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHI  219
            T EQ+AD    +DCIHWCLPG+PDTWN+   +H+
Sbjct  222  TDEQKADVLHNSDCIHWCLPGVPDTWNQIFLAHL  255



>ref|XP_010253783.1| PREDICTED: protein trichome birefringence-like 3 [Nelumbo nucifera]
Length=437

 Score =   233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 139/203 (68%), Gaps = 1/203 (0%)
 Frame = -1

Query  827  NRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATEYDEVDRPLAYR  648
            +RI+   S+ KH KNW   D L+FNTY+WWM+   +K L GSF  G   ++E++ P+AYR
Sbjct  236  DRILKVDSVDKHAKNWVGPDILVFNTYVWWMSGLKIKSLWGSFANGEEGFEELEAPIAYR  295

Query  647  KVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETSPILNTSMPLNV  468
              L TW+ WVD  +DPN+T+VFF + SP H++S DW N  GI+C  ET PIL        
Sbjct  296  IALKTWANWVDSYIDPNKTRVFFTTASPTHMRSSDWNNKKGIRCYNETRPILQKGY-WGS  354

Query  467  GTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPTTY  288
            G+D R+  +  +I   MK PV F+NIT++SE+R D HTSV+T  QGK+LT E++ DP  Y
Sbjct  355  GSDRRMMGVVRSIVERMKIPVSFINITQISEHRVDGHTSVYTEYQGKLLTDEEKTDPKKY  414

Query  287  ADCIHWCLPGLPDTWNEFLYSHI  219
            ADCIHWCLPG+PDTWN+  Y+++
Sbjct  415  ADCIHWCLPGVPDTWNQLFYAYL  437



>ref|XP_006843601.1| hypothetical protein AMTR_s00007p00135110 [Amborella trichopoda]
 gb|ERN05276.1| hypothetical protein AMTR_s00007p00135110 [Amborella trichopoda]
Length=427

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 143/214 (67%), Gaps = 1/214 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD   +     RI+   SI KH ++W  VD L+FNTY+WWM+   +K L GSF      
Sbjct  215  NSDIKVIGDPKKRILRLDSISKHAQHWIGVDILVFNTYVWWMSGLKIKSLWGSFANAEEG  274

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E+D P+AYR  L TW+ WVD  V+PN+T+VFF +MSP H++S DW N  GI+C  ET 
Sbjct  275  YEELDAPIAYRIGLRTWANWVDSTVNPNKTRVFFTTMSPTHMRSSDWGNDKGIRCYNETR  334

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+L        G+D RL S+  +I + MK PV  +NIT+LSE+R D HTSV+T   GK+L
Sbjct  335  PVLKRGY-WGSGSDGRLMSVVGSIVKRMKVPVSVINITQLSEHRIDGHTSVYTETHGKVL  393

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHI  219
              EQ+ADP   ADCIHWCLPG+PDTWN+ LYS++
Sbjct  394  NDEQKADPLHNADCIHWCLPGVPDTWNQILYSYL  427



>gb|KDP24428.1| hypothetical protein JCGZ_24992 [Jatropha curcas]
Length=354

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 140/202 (69%), Gaps = 1/202 (0%)
 Frame = -1

Query  824  RIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATEYDEVDRPLAYRK  645
            RI+   SI+KH K+W  VD L+FNTY+WWM+   +K L GSFD G   Y E+D P+AY+ 
Sbjct  154  RIMKVDSIEKHAKHWGGVDILVFNTYVWWMSGLRLKTLWGSFDNGEEGYVELDTPVAYKV  213

Query  644  VLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETSPILNTSMPLNVG  465
             L TW+ WVD N++PN+T+VFF +MSP H +S DW N  GIKC  ET P++        G
Sbjct  214  GLKTWANWVDSNINPNKTRVFFTTMSPTHTRSEDWNNTEGIKCFNETKPVMKKKH-WGSG  272

Query  464  TDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPTTYA  285
            +D ++ S+ ++    MK PV  LNIT+LSEYR DAHTSV+T   GK+LT E++ADP  +A
Sbjct  273  SDKKMMSVVASTVANMKVPVTVLNITQLSEYRIDAHTSVYTETGGKVLTDEEKADPLHHA  332

Query  284  DCIHWCLPGLPDTWNEFLYSHI  219
            DCIHWCLPG+PDTWN    +++
Sbjct  333  DCIHWCLPGVPDTWNRIFLAYL  354



>ref|XP_009409561.1| PREDICTED: protein trichome birefringence-like 3 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=428

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 144/214 (67%), Gaps = 1/214 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            N+D   +     RII   SI KH ++W  VD L+FNTY+WWM+   +K L GSF  G   
Sbjct  216  NTDGHIIADTSKRIIRVDSITKHARHWIGVDILVFNTYVWWMSGQRIKSLWGSFANGEEG  275

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            ++E+D  +AYR  L TW+ W+D  ++PN T+VFF +MSP H++S DW N NGIKC  ET 
Sbjct  276  FEELDAVVAYRIGLKTWANWIDSTLNPNATRVFFTTMSPTHMRSADWHNRNGIKCYNETE  335

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+         G+D R+  + + +   M+ PV FLN+T+LSE+R D HTSV+T  QGK+L
Sbjct  336  PVRERGY-WGSGSDRRIMQVVAGVVGRMRVPVTFLNVTQLSEHRIDGHTSVYTEFQGKIL  394

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHI  219
            + EQ+A+P  YADCIHWCLPG+PDTWN+ LY+++
Sbjct  395  SEEQKANPLRYADCIHWCLPGVPDTWNQLLYAYL  428



>gb|EYU41920.1| hypothetical protein MIMGU_mgv1a007164mg [Erythranthe guttata]
Length=417

 Score =   231 bits (589),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 143/215 (67%), Gaps = 1/215 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD   +     RI+   S+ +H K W  VD L+FNTY+WWM+    K L GSF  G   
Sbjct  204  NSDVHIVADPKKRILKVDSVAEHAKYWLGVDILVFNTYVWWMSGLRTKSLWGSFANGEEG  263

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y E++ P++Y   L TW+ WVD NV+PN+T+VFF + SP H+KS DW N NG KC  ET 
Sbjct  264  YQELETPVSYTIGLKTWANWVDSNVNPNKTRVFFTTASPTHLKSADWGNKNGTKCFNETK  323

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            PI         G+D R+ S+ +++ R+MK PV  +NIT+LSEYR D HTSV+T   GK+L
Sbjct  324  PISKKGH-WGSGSDKRMMSVVASVVRSMKVPVTLINITQLSEYRIDGHTSVYTELGGKLL  382

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHII  216
              E++ADP  +ADCIHWCLPG+PDTWN+ LY+H++
Sbjct  383  KDEEKADPLHFADCIHWCLPGVPDTWNQILYAHLL  417



>gb|EYU26676.1| hypothetical protein MIMGU_mgv1a006839mg [Erythranthe guttata]
Length=429

 Score =   231 bits (589),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 143/215 (67%), Gaps = 1/215 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            N+D   +     RI+   S+ KH K+W  VD L+FNTY+WWM+   +K L GSF  G   
Sbjct  214  NTDVHIIADPKKRILKVDSVDKHAKHWIGVDILVFNTYVWWMSGLKIKSLWGSFANGEEG  273

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E+D  ++Y+  L TW+ WVD NV+PN+T+VFF +MSP H +S DW N  GIKC  ET 
Sbjct  274  YEELDAAVSYKLGLKTWANWVDSNVNPNKTKVFFTTMSPTHQRSADWGNEKGIKCFNETR  333

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P+         G+D R+ S+ + +   MK PV  LNIT+LSEYR DAH+S++T   GK+L
Sbjct  334  PV-KKKRHWGTGSDKRIMSVVAGVVSRMKVPVTLLNITQLSEYRIDAHSSIYTELGGKLL  392

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHII  216
            T E++ DP  YADCIHWCLPG+PDTWN  LY+H++
Sbjct  393  TEEEKEDPLHYADCIHWCLPGVPDTWNRILYAHLL  427



>ref|XP_002263633.3| PREDICTED: protein trichome birefringence-like 3 [Vitis vinifera]
 emb|CBI22809.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 145/214 (68%), Gaps = 1/214 (0%)
 Frame = -1

Query  860  NSDDPTMHSILNRIIMPKSIKKHGKNWKNVDYLIFNTYIWWMNTFSMKVLRGSFDKGATE  681
            NSD   +     RI+   S+ KH K+W  VD L+FNTY+WWM+   +K L GSF  G   
Sbjct  267  NSDLHIIGDPRQRILRVDSVSKHAKHWLGVDILVFNTYVWWMSGLRIKSLWGSFANGEEG  326

Query  680  YDEVDRPLAYRKVLSTWSKWVDKNVDPNRTQVFFMSMSPLHIKSLDWENPNGIKCAKETS  501
            Y+E+D P+AYR  L TW+ WVD  V+PN+T+VFF +MSP H++S DW N +GIKC  ET 
Sbjct  327  YEELDAPVAYRFGLKTWANWVDSTVNPNKTRVFFTTMSPTHMRSADWNNKDGIKCYNETK  386

Query  500  PILNTSMPLNVGTDYRLFSIASNITRTMKKPVHFLNITKLSEYRKDAHTSVHTIRQGKML  321
            P++        G+D R+ ++  +I   MK PV  +NIT++SE+R DAH+SV+T  QG +L
Sbjct  387  PVMKRGH-WGTGSDKRIMNVVDSIVEKMKVPVTVINITQMSEHRVDAHSSVYTETQGNLL  445

Query  320  TPEQQADPTTYADCIHWCLPGLPDTWNEFLYSHI  219
            T EQ+ADP  YADCIHWCLPG+PDTWN+   +++
Sbjct  446  TEEQKADPLRYADCIHWCLPGVPDTWNQAFLAYL  479



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1823856796800