BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF053M17

Length=907
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACB37380.1|  5-enolpyruvylshikimate 3-phosphate synthase             303   7e-116   Calystegia hederacea
gb|ACD80082.1|  5-enolpyruvylshikimate-3-phosphate synthase             300   3e-114   Convolvulus arvensis
ref|NP_001268176.1|  5-enolpyruvylshikimate-3-phosphate synthase        296   6e-113   Vitis vinifera
ref|XP_011090562.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    293   8e-113   Sesamum indicum [beniseed]
ref|XP_010264165.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    298   6e-112   Nelumbo nucifera [Indian lotus]
sp|P11043.1|AROA_PETHY  RecName: Full=3-phosphoshikimate 1-carbox...    297   8e-112   Petunia x hybrida [garden petunia]
gb|AAT45243.1|  5-enol-pyruvylshikimate-phosphate synthase              296   9e-112   Erigeron canadensis [horseweed]
ref|XP_004306932.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    291   2e-111   Fragaria vesca subsp. vesca
ref|XP_009628683.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    295   2e-111   Nicotiana tomentosiformis
gb|AAV64030.1|  5-enolpyruvylshikimate 3-phosphate synthase             297   4e-111   Camptotheca acuminata
ref|XP_006347878.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    296   4e-111   Solanum tuberosum [potatoes]
emb|CCB84814.1|  5-enol-pyruvylshikimate-phosphate synthase             296   5e-111   Erigeron canadensis [horseweed]
ref|XP_009781083.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    294   6e-111   Nicotiana sylvestris
ref|XP_004240047.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    296   8e-111   Solanum lycopersicum
ref|XP_004229803.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    296   1e-110   
gb|AAY40473.1|  5-enol-pyruvylshikimate-phosphate synthase              295   1e-110   Conyza sumatrensis
gb|AAY40472.1|  5-enol-pyruvylshikimate-phosphate synthase              295   2e-110   Conyza sumatrensis
gb|ABQ00959.1|  5-enol-pyruvylshikimate-phosphate synthase 1B           295   2e-110   Conyza bonariensis
gb|ABQ00960.1|  5-enol-pyruvylshikimate-phosphate synthase 1C           295   2e-110   Conyza bonariensis
gb|AAL27697.1|  5-enolpyruvylshikimate-3-phosphate synthase             289   2e-110   Dicliptera chinensis
gb|AAT45244.1|  5-enol-pyruvylshikimate-phosphate synthase              293   2e-110   Erigeron canadensis [horseweed]
gb|AAL27698.1|AF371966_1  5-enolpyruvylshikimate-3-phosphate synt...    288   3e-110   Dicliptera chinensis
emb|CCB84815.1|  5-enol-pyruvylshikimate-phosphate synthase             292   3e-110   Erigeron canadensis [horseweed]
gb|ABV24481.1|  5-enolpyruvylshikimate-3-phosphate synthase             294   3e-110   Gossypium hirsutum [American cotton]
gb|ABA54869.1|  putative 5-enolpyruvylshikimate 3-phosphate synthase    288   4e-110   Fagus sylvatica
gb|ABQ00957.1|  5-enol-pyruvylshikimate-phosphate synthase 2A           292   4e-110   Conyza bonariensis
sp|P10748.1|AROA_SOLLC  RecName: Full=3-phosphoshikimate 1-carbox...    295   4e-110   Solanum lycopersicum
gb|KHG02688.1|  3-phosphoshikimate 1-carboxyvinyltransferase, chl...    295   4e-110   Gossypium arboreum [tree cotton]
gb|ABY61050.1|  5-enolpyruvylshikimate-3-phosphate synthase             293   5e-110   Gossypium hirsutum [American cotton]
sp|P23981.1|AROA1_TOBAC  RecName: Full=3-phosphoshikimate 1-carbo...    291   5e-110   Nicotiana tabacum [American tobacco]
ref|XP_010098925.1|  3-phosphoshikimate 1-carboxyvinyltransferase       289   7e-110   Morus notabilis
gb|KJB09910.1|  hypothetical protein B456_001G174400                    288   8e-110   Gossypium raimondii
ref|XP_009596625.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    290   1e-109   Nicotiana tomentosiformis
sp|P23281.1|AROA2_TOBAC  RecName: Full=3-phosphoshikimate 1-carbo...    292   1e-109   Nicotiana tabacum [American tobacco]
ref|XP_008364368.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    286   2e-109   
ref|XP_010941045.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    288   2e-109   Elaeis guineensis
gb|KJB49293.1|  hypothetical protein B456_008G113600                    293   3e-109   Gossypium raimondii
ref|XP_009802118.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    289   3e-109   Nicotiana sylvestris
gb|ABQ00961.1|  5-enol-pyruvylshikimate-phosphate synthase 3A           288   3e-109   Conyza bonariensis
gb|KHG27092.1|  3-phosphoshikimate 1-carboxyvinyltransferase, chl...    286   4e-109   Gossypium arboreum [tree cotton]
gb|AFA26647.1|  EPSPS-like protein                                      287   5e-109   Cirsium setosum
gb|ABQ00958.1|  5-enol-pyruvylshikimate-phosphate synthase 1A           295   5e-109   Conyza bonariensis
ref|XP_010053905.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    291   5e-109   Eucalyptus grandis [rose gum]
ref|XP_007219002.1|  hypothetical protein PRUPE_ppa004186mg             282   7e-109   Prunus persica
ref|XP_008813028.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    288   8e-109   Phoenix dactylifera
ref|XP_002511692.1|  3-phosphoshikimate 1-carboxyvinyltransferase...    290   8e-109   Ricinus communis
ref|XP_009603427.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    287   9e-109   Nicotiana tomentosiformis
gb|ABQ00962.1|  5-enol-pyruvylshikimate-phosphate synthase 3B           287   9e-109   Conyza bonariensis
gb|AAY40474.1|  5-enol-pyruvylshikimate-phosphate synthase              289   1e-108   Conyza sumatrensis
ref|XP_010934664.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    286   1e-108   Elaeis guineensis
gb|KDP28768.1|  hypothetical protein JCGZ_14539                         288   2e-108   Jatropha curcas
ref|XP_011017482.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    292   2e-108   Populus euphratica
ref|XP_008232641.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    282   2e-108   Prunus mume [ume]
ref|XP_002301279.1|  3-phosphoshikimate 1-carboxyvinyltransferase...    292   2e-108   Populus trichocarpa [western balsam poplar]
ref|XP_007052087.1|  RNA 3'-terminal phosphate cyclase/enolpyruva...    292   3e-108   
ref|XP_009382957.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    287   3e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010941044.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    288   6e-108   Elaeis guineensis
ref|XP_010692222.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    290   7e-108   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008803985.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    286   9e-108   Phoenix dactylifera
gb|AHF20161.1|  5-enolpyruvylshikimate-3-phosphate synthase             286   1e-107   Musa acuminata AAA Group [Cavendish banana]
gb|AIR74881.1|  5-enolpyruvylshikimate-3-phosphate synthase             284   2e-107   Cyperus rotundus
gb|AEK22121.1|  5-enolpyruvylshikimate-3-phosphate synthase precu...    290   2e-107   Capsicum annuum
gb|ACV53021.1|  5-enolpyruvylshikimate-3-phosphate synthase             285   2e-107   Amaranthus palmeri
gb|AGE94064.1|  5-enolpyruvylshikimate-3-phosphate synthase             285   3e-107   Amaranthus palmeri
ref|XP_004506537.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    281   3e-107   Cicer arietinum [garbanzo]
gb|AFY09699.1|  chloroplast 5-enolpyruvylshikimate 3-phosphate sy...    283   5e-107   Hevea brasiliensis [jebe]
ref|XP_008438175.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    281   5e-107   Cucumis melo [Oriental melon]
gb|ACV53022.1|  5-enolpyruvylshikimate-3-phosphate synthase             283   5e-107   Amaranthus palmeri
gb|AGE94065.1|  5-enolpyruvylshikimate-3-phosphate synthase             285   6e-107   Amaranthus palmeri
ref|XP_003605139.1|  3-phosphoshikimate 1-carboxyvinyltransferase       286   7e-107   Medicago truncatula
gb|KDO85802.1|  hypothetical protein CISIN_1g010070mg                   281   8e-107   Citrus sinensis [apfelsine]
gb|ACV67277.1|  5-enolpyruvylshikimate-3-phosphate synthase             284   9e-107   Amaranthus tuberculatus
ref|XP_003517039.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    285   9e-107   Glycine max [soybeans]
ref|XP_004133920.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    280   1e-106   Cucumis sativus [cucumbers]
gb|AAN77867.1|  5-enolpyruvylshikimate-3-phosphate synthase             288   1e-106   Vitis vinifera
emb|CDO97700.1|  unnamed protein product                                285   2e-106   Coffea canephora [robusta coffee]
ref|XP_006445276.1|  hypothetical protein CICLE_v10019734mg             281   3e-106   Citrus clementina [clementine]
ref|XP_009418331.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    287   3e-106   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006857822.1|  hypothetical protein AMTR_s00069p00028020          280   4e-106   Amborella trichopoda
gb|ACV67278.1|  5-enolpyruvylshikimate-3-phosphate synthase             281   4e-106   Amaranthus tuberculatus
gb|AAT45245.1|  5-enol-pyruvylshikimate-phosphate synthase              286   5e-106   Erigeron canadensis [horseweed]
gb|KDO85805.1|  hypothetical protein CISIN_1g010070mg                   279   5e-106   Citrus sinensis [apfelsine]
gb|ABE77393.4|  EPSP synthase                                           282   8e-106   Allium macrostemon
gb|AAY40475.1|  5-enol-pyruvylshikimate-phosphate synthase              285   1e-105   Conyza sumatrensis
gb|AHF20162.1|  5-enolpyruvylshikimate-3-phosphate synthase             286   2e-105   Musa acuminata AAA Group [Cavendish banana]
gb|AAZ79230.2|  plastid 5-enolpyruvylshikimate 3-phosphate synthase     281   3e-105   Lolium multiflorum
ref|NP_182055.1|  3-phosphoshikimate 1-carboxyvinyltransferase / ...    275   3e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010506470.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    276   5e-105   Camelina sativa [gold-of-pleasure]
gb|KHN35635.1|  3-phosphoshikimate 1-carboxyvinyltransferase, chl...    278   5e-105   Glycine soja [wild soybean]
ref|XP_003521857.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    278   9e-105   Glycine max [soybeans]
ref|XP_007134860.1|  hypothetical protein PHAVU_010G082200g             277   1e-104   Phaseolus vulgaris [French bean]
ref|XP_010544647.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    275   2e-104   Tarenaya hassleriana [spider flower]
ref|XP_010518145.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    275   3e-104   Camelina sativa [gold-of-pleasure]
ref|XP_002894141.1|  hypothetical protein ARALYDRAFT_474025             273   3e-104   Arabidopsis lyrata subsp. lyrata
ref|XP_002880170.1|  3-phosphoshikimate 1-carboxyvinyltransferase       272   5e-104   
gb|ACH72672.1|  5-enolpyruvylshikimate 3-phosphate synthase             274   5e-104   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010508182.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    273   6e-104   Camelina sativa [gold-of-pleasure]
emb|CDY68487.1|  BnaAnng27440D                                          272   7e-104   Brassica napus [oilseed rape]
gb|AEP26124.1|  5-enolpyruvylshikimate-3-phosphate synthase             279   7e-104   Sorghum halepense [Johnson grass]
gb|EMT02861.1|  3-phosphoshikimate 1-carboxyvinyltransferase, chl...    274   7e-104   
ref|XP_008659331.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    279   8e-104   
emb|CAA29828.1|  EPSP                                                   271   8e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004964446.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    277   9e-104   Setaria italica
emb|CAA44974.1|  3-phosphoshikimate 1-carboxyvinyltransferase           278   9e-104   Zea mays [maize]
ref|XP_009133723.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    271   9e-104   Brassica rapa
ref|XP_006397708.1|  hypothetical protein EUTSA_v10001404mg             271   1e-103   
ref|XP_010506469.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    276   2e-103   Camelina sativa [gold-of-pleasure]
emb|CDY57099.1|  BnaC04g56880D                                          270   2e-103   Brassica napus [oilseed rape]
emb|CDX95645.1|  BnaC03g25260D                                          272   2e-103   
ref|XP_003557242.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    272   2e-103   Brachypodium distachyon [annual false brome]
ref|XP_006294019.1|  hypothetical protein CARUB_v10023012mg             273   3e-103   Capsella rubella
gb|KFK37326.1|  hypothetical protein AALP_AA4G242200                    274   3e-103   Arabis alpina [alpine rockcress]
ref|XP_002436424.1|  hypothetical protein SORBIDRAFT_10g002230          276   3e-103   Sorghum bicolor [broomcorn]
sp|P17688.1|AROA_BRANA  RecName: Full=3-phosphoshikimate 1-carbox...    270   3e-103   Brassica napus [oilseed rape]
gb|AFW85981.1|  3-phosphoshikimate 1-carboxyvinyltransferase            277   3e-103   
gb|AAS80163.1|  5-enolpyruvylshikimate-3-phosphate synthase             270   4e-103   Brassica rapa subsp. oleifera [biennial turnip rape]
emb|CDY37031.1|  BnaA04g26090D                                          269   5e-103   Brassica napus [oilseed rape]
gb|AIR74883.1|  5-enolpyruvylshikimate-3-phosphate synthase             268   7e-103   Cyperus rotundus
gb|AIR74885.1|  5-enolpyruvylshikimate-3-phosphate synthase             268   8e-103   Cyperus esculentus
gb|ADB85251.1|  5-enolpyruvyl shikimate 3-phosphate synthase            276   8e-103   Zoysia japonica [Japanese lawn grass]
gb|AIR74882.1|  5-enolpyruvylshikimate-3-phosphate synthase             268   8e-103   Cyperus rotundus
gb|AAY40476.1|  5-enol-pyruvylshikimate-phosphate synthase              290   8e-103   Conyza sumatrensis
gb|AIR74884.1|  5-enolpyruvylshikimate-3-phosphate synthase             268   8e-103   Cyperus esculentus
gb|ADB85252.1|  5-enolpyruvyl shikimate 3-phosphate synthase            276   8e-103   Zoysia japonica [Japanese lawn grass]
gb|AAL65913.1|AF440389_1  5-enolpyruvylshikimate-3-phosphate synt...    270   9e-103   Orychophragmus violaceus
ref|XP_006656606.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    273   1e-102   
gb|AAM63771.1|  5-enolpyruvylshikimate-3-phosphate (EPSP) synthas...    270   1e-102   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175317.1|  putative 5-enolpyruvylshikimate-3-phosphate syn...    270   1e-102   Arabidopsis thaliana [mouse-ear cress]
gb|AAR87845.1|  5-enolpyruvylshikimate-3-phosphate synthase             275   1e-102   Eleusine indica [crabgrass]
gb|AEQ75411.1|  plastid 5-enolpyruvylshikimate-3-phosphate synthase     274   2e-102   Eleusine indica [crabgrass]
gb|AEQ75410.1|  plastid 5-enolpyruvylshikimate-3-phosphate synthase     274   2e-102   Eleusine indica [crabgrass]
emb|CAD01096.1|  5-enolpyruvylshikimate-3-phosphate synthase            274   2e-102   Eleusine indica [crabgrass]
gb|AEP26126.1|  5-enolpyruvylshikimate-3-phosphate synthase             276   3e-102   Sorghum halepense [Johnson grass]
gb|AAL07437.1|AF413082_1  EPSP synthase                                 271   5e-102   Oryza sativa [red rice]
gb|AEB80422.2|  5-enolpyruvylshikimate-3-phosphate synthase             273   5e-102   Eleusine indica [crabgrass]
gb|AIX87986.1|  plastid 5-enolpyruvylshikimate-3-phosphate synthase     273   5e-102   Eleusine indica [crabgrass]
gb|AAR87844.1|  5-enolpyruvylshikimate-3-phosphate synthase             272   5e-102   Eleusine indica [crabgrass]
ref|NP_001056712.1|  Os06g0133900                                       271   5e-102   
gb|EAZ35730.1|  hypothetical protein OsJ_20021                          271   5e-102   Oryza sativa Japonica Group [Japonica rice]
gb|AIX87988.1|  plastid 5-enolpyruvylshikimate-3-phosphate synthase     273   6e-102   Eleusine indica [crabgrass]
gb|AHA87270.1|  5-enolpyruvylshikimate-3-phosphate synthase             278   7e-102   Sorghum halepense [Johnson grass]
emb|CAD01095.1|  5-enolpyruvylshikimate-3-phosphate synthase            271   1e-101   Eleusine indica [crabgrass]
ref|XP_009142326.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    265   1e-101   Brassica rapa
dbj|BAA32276.1|  3-phosphoshikimate 1-carboxyvinyltransferase           270   1e-101   Oryza sativa Japonica Group [Japonica rice]
gb|AIR95658.1|  plastid 5-enolpyruvylshikimate-3-phosphate synthase     271   2e-101   Eleusine indica [crabgrass]
ref|XP_006375310.1|  hypothetical protein POPTR_0014s06390g             265   3e-101   
gb|AEB80423.2|  5-enolpyruvylshikimate-3-phosphate synthase             270   4e-101   Eleusine indica [crabgrass]
gb|AIX87987.1|  plastid 5-enolpyruvylshikimate-3-phosphate synthase     270   4e-101   Eleusine indica [crabgrass]
gb|ABG88197.1|  EPSP synthase                                           262   1e-99    Phaseolus vulgaris [French bean]
gb|EMS45885.1|  3-phosphoshikimate 1-carboxyvinyltransferase, chl...    274   1e-99    Triticum urartu
gb|ACY30625.1|  EPSP synthase                                           272   2e-99    Ginkgo biloba [ginkgo]
ref|XP_011034141.1|  PREDICTED: LOW QUALITY PROTEIN: 3-phosphoshi...    268   8e-99    Populus euphratica
ref|NP_973996.1|  putative 5-enolpyruvylshikimate-3-phosphate syn...    256   3e-98    Arabidopsis thaliana [mouse-ear cress]
gb|AHL44841.1|  5-enolpyruvylshikimate-3-phosphate synthase             242   1e-94    Amaranthus spinosus
gb|AHL44843.1|  5-enolpyruvylshikimate-3-phosphate synthase             242   2e-94    Amaranthus spinosus
gb|AHL44842.1|  5-enolpyruvylshikimate-3-phosphate synthase             241   6e-94    Amaranthus spinosus
dbj|BAK08246.1|  predicted protein                                      272   3e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBI38901.3|  unnamed protein product                                260   2e-87    Vitis vinifera
ref|XP_002972123.1|  hypothetical protein SELMODRAFT_270937             236   2e-86    Selaginella moellendorffii
ref|XP_002993040.1|  hypothetical protein SELMODRAFT_162776             236   2e-86    Selaginella moellendorffii
gb|AAT45236.1|  5-enol-pyruvylshikimate-phosphate synthase              211   3e-86    Erigeron annuus [eastern daisy fleabane]
dbj|BAE20403.1|  5-enolpyruvylshikimate-3-phosphate synthase            211   8e-86    Lactuca sativa [cultivated lettuce]
dbj|BAE20404.1|  5-enolpyruvylshikimate-3-phosphate synthase            213   8e-85    Lactuca sativa [cultivated lettuce]
gb|AAK20397.1|AF349754_1  5-enolpyruvylshikimate 3-phosphate synt...    216   1e-84    Lolium rigidum
ref|XP_001760785.1|  predicted protein                                  221   6e-84    
gb|AAT45237.1|  5-enol-pyruvylshikimate-phosphate synthase              202   9e-83    Erigeron annuus [eastern daisy fleabane]
ref|XP_001771376.1|  predicted protein                                  214   1e-81    
gb|AAT45234.1|  5-enol-pyruvylshikimate-phosphate synthase              197   1e-80    Amaranthus tuberculatus
gb|EMT11485.1|  3-phosphoshikimate 1-carboxyvinyltransferase, chl...    250   1e-79    
emb|CDX74729.1|  BnaA05g04750D                                          224   5e-79    
gb|ABK26355.1|  unknown                                                 241   3e-76    Picea sitchensis
ref|XP_009376251.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    235   4e-74    Pyrus x bretschneideri [bai li]
ref|XP_009375142.1|  PREDICTED: 3-phosphoshikimate 1-carboxyvinyl...    234   1e-73    Pyrus x bretschneideri [bai li]
ref|XP_003059707.1|  predicted protein                                  203   5e-72    Micromonas pusilla CCMP1545
ref|XP_002505432.1|  predicted protein                                  201   1e-71    Micromonas commoda
ref|XP_001422572.1|  predicted protein                                  204   3e-71    Ostreococcus lucimarinus CCE9901
gb|AHF20163.1|  5-enolpyruvylshikimate-3-phosphate synthase             227   2e-70    Musa acuminata AAA Group [Cavendish banana]
ref|XP_005645595.1|  3-phosphoshikimate 1-carboxyvinyltransferase       202   4e-70    Coccomyxa subellipsoidea C-169
emb|CEG02121.1|  RNA 3'-terminal phosphate cyclase/enolpyruvate t...    202   4e-70    Ostreococcus tauri
gb|EYU31981.1|  hypothetical protein MIMGU_mgv1a006251mg                149   2e-69    Erythranthe guttata [common monkey flower]
ref|XP_003083034.1|  5-enolpyruvylshikimate-3-phosphate (ISS)           200   2e-69    
ref|XP_007509973.1|  3-phosphoshikimate 1-carboxyvinyltransferase       196   2e-69    Bathycoccus prasinos
gb|ABM68632.1|  plastid EPSP synthase                                   204   4e-69    Dunaliella salina
gb|ADI18434.1|  5-enolpyruvylshikimate-3-phosphate synthase             197   6e-68    uncultured delta proteobacterium HF4000_08N17
ref|XP_002946713.1|  hypothetical protein VOLCADRAFT_79287              192   7e-68    Volvox carteri f. nagariensis
ref|WP_029734606.1|  3-phosphoshikimate 1-carboxyvinyltransferase       197   2e-67    
ref|XP_005647657.1|  3-phosphoshikimate 1-carboxyvinyltransferase       192   3e-67    Coccomyxa subellipsoidea C-169
ref|XP_001702942.1|  5-enolpyruvylshikimate-3-phosphate synthase        190   8e-67    Chlamydomonas reinhardtii
gb|KJB49296.1|  hypothetical protein B456_008G113600                    149   1e-66    Gossypium raimondii
ref|WP_019307719.1|  hypothetical protein                               191   2e-65    
ref|XP_011397128.1|  3-phosphoshikimate 1-carboxyvinyltransferase...    185   5e-65    Auxenochlorella protothecoides
ref|WP_018051446.1|  hypothetical protein                               191   1e-64    
ref|WP_010151544.1|  3-phosphoshikimate 1-carboxyvinyltransferase       187   2e-64    
ref|WP_043954047.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   2e-61    Kosakonia radicincitans
ref|WP_031520206.1|  3-phosphoshikimate 1-carboxyvinyltransferase       171   4e-61    Siccibacter colletis
dbj|GAM56373.1|  5-enolpyruvylshikimate-3-phosphate synthase            175   7e-61    Vibrio ishigakensis
ref|WP_004725419.1|  3-phosphoshikimate 1-carboxyvinyltransferase       177   8e-61    Vibrio furnissii
ref|WP_007374139.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   8e-61    Kosakonia
gb|EPF18700.1|  3-phosphoshikimate 1-carboxyvinyltransferase            172   8e-61    Cedecea davisae DSM 4568
ref|WP_039899165.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   8e-61    Cedecea davisae
gb|EJF29387.1|  3-phosphoshikimate 1-carboxyvinyltransferase            174   9e-61    Enterobacter sp. Ag1
ref|WP_042481982.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   9e-61    Vibrio diazotrophicus
ref|WP_034810093.1|  3-phosphoshikimate 1-carboxyvinyltransferase       174   9e-61    Enterobacter sp. Ag1
ref|WP_035885858.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   2e-60    Kosakonia radicincitans
ref|WP_032183857.1|  3-phosphoshikimate 1-carboxyvinyltransferase       175   2e-60    Escherichia coli [E. coli]
ref|WP_014204899.1|  3-phosphoshikimate 1-carboxyvinyltransferase       176   2e-60    Vibrio furnissii
ref|WP_001558910.1|  3-phosphoshikimate 1-carboxyvinyltransferase       175   2e-60    Escherichia coli [E. coli]
ref|WP_001471310.1|  3-phosphoshikimate 1-carboxyvinyltransferase       174   2e-60    Escherichia coli [E. coli]
ref|WP_032080257.1|  3-phosphoshikimate 1-carboxyvinyltransferase       176   2e-60    Vibrio fluvialis
ref|WP_044362276.1|  3-phosphoshikimate 1-carboxyvinyltransferase       176   2e-60    Vibrio fluvialis
ref|WP_017445862.1|  hypothetical protein                               174   2e-60    Gayadomonas joobiniege
ref|WP_013366857.1|  3-phosphoshikimate 1-carboxyvinyltransferase       170   2e-60    [Enterobacter] lignolyticus
gb|KGQ11427.1|  3-phosphoshikimate 1-carboxyvinyltransferase            172   3e-60    Beauveria bassiana D1-5
ref|WP_038888220.1|  3-phosphoshikimate 1-carboxyvinyltransferase       170   3e-60    Cronobacter dublinensis
ref|WP_039296633.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   3e-60    Cedecea neteri
ref|WP_000445234.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   3e-60    Escherichia coli [E. coli]
ref|WP_002463073.1|  3-phosphoshikimate 1-carboxyvinyltransferase       167   3e-60    Atlantibacter hermannii
ref|WP_014069581.1|  3-phosphoshikimate 1-carboxyvinyltransferase       168   3e-60    Enterobacter
ref|WP_039306126.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   3e-60    Cedecea neteri
ref|WP_001602104.1|  3-phosphoshikimate 1-carboxyvinyltransferase       174   3e-60    Escherichia coli [E. coli]
ref|WP_032639263.1|  3-phosphoshikimate 1-carboxyvinyltransferase       167   4e-60    Enterobacter cloacae complex
dbj|GAM62314.1|  5-enolpyruvylshikimate-3-phosphate synthase            175   4e-60    Vibrio ishigakensis
ref|WP_019083452.1|  3-phosphoshikimate 1-carboxyvinyltransferase       176   4e-60    Yersinia enterocolitica
gb|ESA60561.1|  3-phosphoshikimate 1-carboxyvinyltransferase            173   4e-60    Escherichia coli 113303
ref|WP_041910626.1|  3-phosphoshikimate 1-carboxyvinyltransferase       169   4e-60    Enterobacter
ref|WP_038415776.1|  3-phosphoshikimate 1-carboxyvinyltransferase       167   4e-60    Enterobacter cloacae complex
ref|WP_034457199.1|  3-phosphoshikimate 1-carboxyvinyltransferase       171   5e-60    Buttiauxella noackiae
ref|WP_033815685.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   5e-60    Escherichia coli [E. coli]
ref|WP_000445237.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   5e-60    Enterobacteriaceae
ref|WP_014883218.1|  MULTISPECIES: 3-phosphoshikimate 1-carboxyvi...    168   5e-60    Enterobacter
ref|WP_042108061.1|  3-phosphoshikimate 1-carboxyvinyltransferase       174   5e-60    Escherichia coli [E. coli]
ref|WP_024548375.1|  MULTISPECIES: 3-phosphoshikimate 1-carboxyvi...    169   5e-60    Enterobacteriaceae
dbj|GAM76538.1|  5-enolpyruvylshikimate-3-phosphate synthase            174   5e-60    Vibrio ishigakensis
ref|WP_000445175.1|  MULTISPECIES: 3-phosphoshikimate 1-carboxyvi...    173   5e-60    Escherichia
ref|WP_032637070.1|  3-phosphoshikimate 1-carboxyvinyltransferase       168   5e-60    Enterobacter kobei
ref|WP_021577203.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   5e-60    Escherichia coli [E. coli]
ref|WP_040076330.1|  3-phosphoshikimate 1-carboxyvinyltransferase       171   5e-60    Enterobacteriaceae bacterium ATCC 29904
gb|ABR25383.1|  5-enolpyruvylshikimate-3-phosphate synthase             130   5e-60    Oryza sativa Indica Group [Indian rice]
pdb|3FK0|A  Chain A, E. Coli Epsp Synthase (Tips Mutation) Ligand...    174   5e-60    Escherichia coli K-12
ref|WP_001382116.1|  3-phosphoshikimate 1-carboxyvinyltransferase       174   5e-60    Escherichia coli [E. coli]
ref|WP_043864967.1|  3-phosphoshikimate 1-carboxyvinyltransferase       167   5e-60    Atlantibacter hermannii
ref|WP_038482812.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   5e-60    Cedecea neteri
ref|WP_004873749.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   5e-60    Yersinia mollaretii
ref|WP_032223555.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Escherichia coli [E. coli]
ref|WP_029399027.1|  3-phosphoshikimate 1-carboxyvinyltransferase       174   6e-60    Escherichia coli [E. coli]
sp|O87006.1|AROA_SHIDY  RecName: Full=3-phosphoshikimate 1-carbox...    173   6e-60    Shigella dysenteriae
ref|WP_000445238.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Escherichia coli [E. coli]
ref|WP_001710157.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Escherichia coli [E. coli]
ref|WP_001550903.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Enterobacteriaceae
ref|WP_032294001.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Escherichia coli [E. coli]
ref|WP_024226770.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Escherichia coli [E. coli]
ref|WP_021526266.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Escherichia coli [E. coli]
ref|WP_040081618.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Escherichia coli [E. coli]
ref|WP_038339587.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Escherichia coli [E. coli]
ref|WP_000445249.1|  MULTISPECIES: 3-phosphoshikimate 1-carboxyvi...    173   6e-60    Enterobacteriaceae
ref|WP_001676431.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Escherichia coli [E. coli]
sp|Q9ZFF7.1|AROA_SHISO  RecName: Full=3-phosphoshikimate 1-carbox...    173   6e-60    Shigella sonnei
ref|WP_000445225.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    
ref|WP_000445233.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Shigella sp. SF-2015
pdb|2QFS|A  Chain A, E.coli Epsp Synthase Pro101ser Liganded With...    173   6e-60    Escherichia coli K-12
ref|WP_022645463.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Enterobacteriaceae
ref|WP_000445223.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Escherichia coli [E. coli]
pdb|2QFQ|A  Chain A, E. Coli Epsp Synthase Pro101leu Liganded Wit...    173   6e-60    Escherichia coli K-12
ref|WP_032278048.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Enterobacteriaceae
ref|WP_000445211.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Escherichia coli [E. coli]
ref|WP_000445231.1|  MULTISPECIES: 3-phosphoshikimate 1-carboxyvi...    173   6e-60    Proteobacteria [purple bacteria]
ref|WP_001508516.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Escherichia coli [E. coli]
ref|WP_001730672.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Escherichia coli [E. coli]
ref|WP_001729830.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Escherichia coli [E. coli]
ref|WP_001686277.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Escherichia coli [E. coli]
ref|WP_001612735.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Escherichia coli [E. coli]
ref|WP_025760805.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Shigella flexneri
pdb|1MI4|A  Chain A, Glyphosate Insensitive G96a Mutant Epsp Synt...    173   6e-60    Escherichia coli [E. coli]
ref|WP_000445213.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Escherichia coli [E. coli]
ref|WP_000445235.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Escherichia coli [E. coli]
ref|WP_032253854.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Escherichia coli [E. coli]
ref|WP_021564996.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Escherichia coli [E. coli]
ref|WP_021562122.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Enterobacteriaceae
ref|WP_004092274.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    Escherichia coli [E. coli]
emb|CCJ43451.1|  5-enolpyruvylshikimate-3-phosphate synthetase          173   6e-60    
ref|WP_000445247.1|  MULTISPECIES: 3-phosphoshikimate 1-carboxyvi...    173   6e-60    
ref|WP_000445252.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    
ref|WP_001637747.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    
ref|WP_001391343.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    
ref|WP_000445239.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    
ref|WP_027253369.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    
ref|WP_039064792.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    
ref|WP_000445253.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    
pdb|3FJX|A  Chain A, E. Coli Epsp Synthase (T97i) Liganded With S3p     173   6e-60    
ref|WP_024244535.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    
ref|WP_000445224.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    
ref|WP_039029486.1|  3-phosphoshikimate 1-carboxyvinyltransferase       170   6e-60    
ref|WP_001489420.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   6e-60    
ref|WP_001589964.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   7e-60    
ref|WP_025748801.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   7e-60    
ref|WP_000445222.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   7e-60    
ref|WP_021566218.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   7e-60    
ref|WP_001483448.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   7e-60    
ref|WP_034838827.1|  3-phosphoshikimate 1-carboxyvinyltransferase       177   7e-60    
ref|WP_032237499.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   7e-60    
ref|WP_000445221.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   7e-60    
ref|WP_000445209.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   7e-60    
ref|WP_001706990.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   7e-60    
ref|WP_001693863.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   7e-60    
ref|WP_032280641.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   7e-60    
ref|WP_032279467.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   7e-60    
ref|WP_017030337.1|  3-phosphoshikimate 1-carboxyvinyltransferase       176   7e-60    
ref|WP_044866881.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   7e-60    
ref|WP_001404944.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   7e-60    
ref|WP_040975152.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   7e-60    
ref|WP_020330223.1|  5-Enolpyruvylshikimate-3-phosphate synthase        175   7e-60    
ref|WP_000445210.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   8e-60    
ref|WP_000445274.1|  3-phosphoshikimate 1-carboxyvinyltransferase       175   8e-60    
ref|WP_032247735.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   8e-60    
ref|WP_015671757.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   8e-60    
ref|WP_041382091.1|  3-phosphoshikimate 1-carboxyvinyltransferase       170   9e-60    
ref|WP_044862647.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   9e-60    
emb|CAQ84918.1|  3-phosphoshikimate 1-carboxyvinyltransferase           170   9e-60    
ref|WP_007730259.1|  5-Enolpyruvylshikimate-3-phosphate synthase        168   1e-59    
ref|WP_042714141.1|  3-phosphoshikimate 1-carboxyvinyltransferase       170   1e-59    
ref|WP_038186127.1|  3-phosphoshikimate 1-carboxyvinyltransferase       175   1e-59    
ref|WP_032617355.1|  3-phosphoshikimate 1-carboxyvinyltransferase       168   1e-59    
ref|WP_024108720.1|  3-phosphoshikimate 1-carboxyvinyltransferase       170   1e-59    
ref|WP_013097306.1|  3-phosphoshikimate 1-carboxyvinyltransferase       168   1e-59    
ref|WP_035892438.1|  3-phosphoshikimate 1-carboxyvinyltransferase       170   1e-59    
ref|WP_032638957.1|  3-phosphoshikimate 1-carboxyvinyltransferase       166   1e-59    
ref|WP_012016825.1|  3-phosphoshikimate 1-carboxyvinyltransferase       168   1e-59    
ref|WP_023335126.1|  3-phosphoshikimate 1-carboxyvinyltransferase       166   1e-59    
ref|WP_023481737.1|  3-phosphoshikimate 1-carboxyvinyltransferase       169   1e-59    
ref|WP_040084012.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   1e-59    
pdb|1EPS|A  Chain A, Structure And Topological Symmetry Of The Gl...    172   1e-59    
ref|WP_000445217.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   1e-59    
ref|WP_000445277.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   1e-59    
ref|WP_038981310.1|  3-phosphoshikimate 1-carboxyvinyltransferase       168   1e-59    
ref|WP_018151642.1|  3-phosphoshikimate 1-carboxyvinyltransferase       179   1e-59    
ref|WP_029882988.1|  MULTISPECIES: 3-phosphoshikimate 1-carboxyvi...    168   1e-59    
ref|WP_000445232.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   1e-59    
ref|WP_000445269.1|  3-phosphoshikimate 1-carboxyvinyltransferase       174   1e-59    
ref|WP_000445271.1|  3-phosphoshikimate 1-carboxyvinyltransferase       175   1e-59    
ref|WP_022578140.1|  3-phosphoshikimate 1-carboxyvinyltransferase       175   1e-59    
gb|EEW05249.1|  3-phosphoshikimate 1-carboxyvinyltransferase            175   1e-59    
ref|WP_042033622.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   1e-59    
ref|WP_000445272.1|  3-phosphoshikimate 1-carboxyvinyltransferase       175   2e-59    
ref|WP_024105709.1|  MULTISPECIES: 3-phosphoshikimate 1-carboxyvi...    170   2e-59    
ref|WP_000445275.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   2e-59    
ref|WP_005275111.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   2e-59    
ref|WP_038873081.1|  3-phosphoshikimate 1-carboxyvinyltransferase       167   2e-59    
ref|WP_000445214.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   2e-59    
ref|WP_032624533.1|  MULTISPECIES: 3-phosphoshikimate 1-carboxyvi...    167   2e-59    
ref|WP_000445276.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   2e-59    
ref|WP_039025199.1|  3-phosphoshikimate 1-carboxyvinyltransferase       169   2e-59    
ref|WP_023621032.1|  3-phosphoshikimate 1-carboxyvinyltransferase       167   2e-59    
emb|CEP31180.1|  5-enolpyruvylshikimate-3-phosphate synthetase          171   2e-59    
ref|XP_005711541.1|  3-phosphoshikimate 1-carboxyvinyltransferase       177   2e-59    
ref|WP_023299723.1|  3-phosphoshikimate 1-carboxyvinyltransferase       166   2e-59    
ref|WP_017456186.1|  3-phosphoshikimate 1-carboxyvinyltransferase       169   2e-59    
ref|WP_036108716.1|  3-phosphoshikimate 1-carboxyvinyltransferase       168   2e-59    
ref|WP_044708965.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   2e-59    
ref|WP_023332546.1|  MULTISPECIES: 3-phosphoshikimate 1-carboxyvi...    169   2e-59    
ref|WP_001599632.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   2e-59    
ref|WP_023327023.1|  3-phosphoshikimate 1-carboxyvinyltransferase       169   2e-59    
ref|WP_008499969.1|  MULTISPECIES: 3-phosphoshikimate 1-carboxyvi...    169   2e-59    
ref|WP_038863816.1|  3-phosphoshikimate 1-carboxyvinyltransferase       168   2e-59    
ref|WP_021240876.1|  3-phosphoshikimate 1-carboxyvinyltransferase       169   2e-59    
ref|WP_039266074.1|  3-phosphoshikimate 1-carboxyvinyltransferase       169   2e-59    
ref|WP_001541394.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   2e-59    
ref|WP_023305806.1|  3-phosphoshikimate 1-carboxyvinyltransferase       166   2e-59    
ref|WP_028127223.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   2e-59    
ref|WP_007768796.1|  5-Enolpyruvylshikimate-3-phosphate synthase        166   2e-59    
gb|KFC82920.1|  5-enolpyruvylshikimate-3-phosphate synthase             173   2e-59    
ref|WP_007707474.1|  5-Enolpyruvylshikimate-3-phosphate synthase        166   2e-59    
ref|WP_034494601.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   2e-59    
ref|WP_032674462.1|  3-phosphoshikimate 1-carboxyvinyltransferase       169   2e-59    
ref|WP_016955462.1|  hypothetical protein                               174   2e-59    
ref|WP_033145092.1|  3-phosphoshikimate 1-carboxyvinyltransferase       166   2e-59    
ref|WP_014831286.1|  3-phosphoshikimate 1-carboxyvinyltransferase       166   2e-59    
ref|WP_024967617.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   2e-59    
ref|WP_010429243.1|  3-phosphoshikimate 1-carboxyvinyltransferase       166   2e-59    
gb|KGI64102.1|  3-phosphoshikimate 1-carboxyvinyltransferase            166   3e-59    
ref|WP_028012568.1|  3-phosphoshikimate 1-carboxyvinyltransferase       166   3e-59    
ref|WP_039261572.1|  3-phosphoshikimate 1-carboxyvinyltransferase       166   3e-59    
ref|WP_042583417.1|  3-phosphoshikimate 1-carboxyvinyltransferase       169   3e-59    
ref|WP_044723137.1|  3-phosphoshikimate 1-carboxyvinyltransferase       171   3e-59    
ref|WP_019079877.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   3e-59    
ref|WP_024907795.1|  MULTISPECIES: 3-phosphoshikimate 1-carboxyvi...    166   3e-59    
ref|WP_006174452.1|  3-phosphoshikimate 1-carboxyvinyltransferase       169   3e-59    
ref|WP_017693699.1|  MULTISPECIES: 3-phosphoshikimate 1-carboxyvi...    166   3e-59    
ref|WP_032658201.1|  3-phosphoshikimate 1-carboxyvinyltransferase       166   3e-59    
ref|WP_029739498.1|  3-phosphoshikimate 1-carboxyvinyltransferase       166   3e-59    
ref|WP_032103946.1|  MULTISPECIES: 3-phosphoshikimate 1-carboxyvi...    166   3e-59    
ref|WP_000445273.1|  MULTISPECIES: 3-phosphoshikimate 1-carboxyvi...    174   3e-59    
ref|WP_008080429.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   3e-59    
ref|WP_006819306.1|  3-phosphoshikimate 1-carboxyvinyltransferase       167   3e-59    
emb|CCQ40082.1|  3-phosphoshikimate 1-carboxyvinyltransferase           173   3e-59    
ref|WP_033789272.1|  3-phosphoshikimate 1-carboxyvinyltransferase       171   3e-59    
ref|WP_038258595.1|  3-phosphoshikimate 1-carboxyvinyltransferase       166   3e-59    
ref|WP_000445236.1|  3-phosphoshikimate 1-carboxyvinyltransferase       174   3e-59    
ref|WP_001625003.1|  3-phosphoshikimate 1-carboxyvinyltransferase       171   3e-59    
ref|WP_044549529.1|  3-phosphoshikimate 1-carboxyvinyltransferase       171   3e-59    
ref|WP_001616741.1|  3-phosphoshikimate 1-carboxyvinyltransferase       171   3e-59    
ref|WP_023303391.1|  3-phosphoshikimate 1-carboxyvinyltransferase       166   3e-59    
ref|WP_032670211.1|  3-phosphoshikimate 1-carboxyvinyltransferase       166   3e-59    
ref|WP_036838061.1|  3-phosphoshikimate 1-carboxyvinyltransferase       170   4e-59    
ref|WP_010091742.1|  3-phosphoshikimate 1-carboxyvinyltransferase       169   4e-59    
ref|WP_023310996.1|  3-phosphoshikimate 1-carboxyvinyltransferase       166   4e-59    
ref|WP_023292882.1|  3-phosphoshikimate 1-carboxyvinyltransferase       168   4e-59    
ref|WP_015965098.1|  3-phosphoshikimate 1-carboxyvinyltransferase       168   4e-59    
ref|WP_015740715.1|  3-phosphoshikimate 1-carboxyvinyltransferase       166   4e-59    
ref|WP_023320650.1|  3-phosphoshikimate 1-carboxyvinyltransferase       167   4e-59    
ref|WP_020239940.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   4e-59    
ref|WP_008805857.1|  MULTISPECIES: 3-phosphoshikimate 1-carboxyvi...    169   4e-59    
ref|WP_013650091.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   4e-59    
gb|AHM74729.1|  5-enolpyruvylshikimate-3-phosphate synthase             171   4e-59    
ref|WP_033751289.1|  3-phosphoshikimate 1-carboxyvinyltransferase       171   4e-59    
ref|WP_005171024.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   4e-59    
gb|AAA27666.1|  5-enolpyruvylshikimate 3-phosphate synthase (aroA)      173   4e-59    
ref|WP_001692603.1|  3-phosphoshikimate 1-carboxyvinyltransferase       170   4e-59    
ref|WP_012905301.1|  3-phosphoshikimate 1-carboxyvinyltransferase       169   4e-59    
ref|WP_004710026.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   4e-59    
ref|WP_033737641.1|  3-phosphoshikimate 1-carboxyvinyltransferase       174   4e-59    
ref|WP_000445248.1|  3-phosphoshikimate 1-carboxyvinyltransferase       171   4e-59    
ref|WP_004849473.1|  MULTISPECIES: 3-phosphoshikimate 1-carboxyvi...    167   4e-59    
ref|WP_000445176.1|  3-phosphoshikimate 1-carboxyvinyltransferase       170   4e-59    
ref|WP_038206322.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   4e-59    
ref|WP_004130942.1|  3-phosphoshikimate 1-carboxyvinyltransferase       167   4e-59    
ref|WP_007664657.1|  5-Enolpyruvylshikimate-3-phosphate synthase        167   4e-59    
emb|CDL32944.1|  5-Enolpyruvylshikimate-3-phosphate synthase            166   4e-59    
ref|WP_039341315.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   4e-59    
ref|WP_006880468.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   4e-59    
ref|WP_006118622.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   4e-59    
ref|WP_000445215.1|  3-phosphoshikimate 1-carboxyvinyltransferase       171   4e-59    
ref|WP_005159903.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   5e-59    
ref|WP_001480353.1|  3-phosphoshikimate 1-carboxyvinyltransferase       171   5e-59    
ref|WP_000445212.1|  MULTISPECIES: 3-phosphoshikimate 1-carboxyvi...    171   5e-59    
ref|WP_001361681.1|  3-phosphoshikimate 1-carboxyvinyltransferase       170   5e-59    
ref|WP_001723317.1|  3-phosphoshikimate 1-carboxyvinyltransferase       170   5e-59    
ref|WP_025119383.1|  MULTISPECIES: 3-phosphoshikimate 1-carboxyvi...    171   5e-59    
emb|CCV62157.1|  3-phosphoshikimate 1-carboxyvinyltransferase           173   5e-59    
ref|WP_038424269.1|  3-phosphoshikimate 1-carboxyvinyltransferase       166   5e-59    
ref|WP_043615442.1|  3-phosphoshikimate 1-carboxyvinyltransferase       160   5e-59    
gb|EJU28278.1|  3-phosphoshikimate 1-carboxyvinyltransferase            166   5e-59    
ref|WP_035012976.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   5e-59    
gb|EUC91111.1|  3-phosphoshikimate 1-carboxyvinyltransferase            167   5e-59    
ref|WP_043596417.1|  3-phosphoshikimate 1-carboxyvinyltransferase       160   5e-59    
ref|WP_000445226.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   5e-59    
ref|WP_024529854.1|  3-phosphoshikimate 1-carboxyvinyltransferase       171   5e-59    
ref|WP_044177919.1|  3-phosphoshikimate 1-carboxyvinyltransferase       166   5e-59    
gb|EEW11581.1|  3-phosphoshikimate 1-carboxyvinyltransferase            174   6e-59    
ref|WP_032225493.1|  3-phosphoshikimate 1-carboxyvinyltransferase       170   6e-59    
ref|WP_024484604.1|  3-phosphoshikimate 1-carboxyvinyltransferase       171   6e-59    
gb|AAP94212.1|  3-phosphoshikimate 1-carboxyvinyltransferase            173   6e-59    
ref|WP_014228640.1|  3-phosphoshikimate 1-carboxyvinyltransferase       167   6e-59    
ref|WP_009603465.1|  3-phosphoshikimate 1-carboxyvinyltransferase       174   6e-59    
ref|WP_022647628.1|  MULTISPECIES: 3-phosphoshikimate 1-carboxyvi...    166   6e-59    
gb|ACA49855.1|  enoylpyrovyl-shikimate 3 phosphate synthase             170   6e-59    
ref|WP_023616193.1|  3-phosphoshikimate 1-carboxyvinyltransferase       169   6e-59    
ref|WP_021804921.1|  5-Enolpyruvylshikimate-3-phosphate synthase        171   6e-59    
ref|WP_032735138.1|  3-phosphoshikimate 1-carboxyvinyltransferase       169   6e-59    
ref|WP_022551017.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   7e-59    
ref|WP_038249702.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   7e-59    
ref|WP_032694245.1|  3-phosphoshikimate 1-carboxyvinyltransferase       166   7e-59    
ref|WP_000445229.1|  3-phosphoshikimate 1-carboxyvinyltransferase       170   7e-59    
gb|EUB37737.1|  3-phosphoshikimate 1-carboxyvinyltransferase            166   7e-59    
ref|WP_027314275.1|  3-phosphoshikimate 1-carboxyvinyltransferase       174   7e-59    
ref|WP_009206179.1|  3-phosphoshikimate 1-carboxyvinyltransferase       171   7e-59    
gb|AAQ60717.1|  3-phosphoshikimate 1-carboxyvinyltransferase            160   7e-59    
ref|WP_004100699.1|  MULTISPECIES: 3-phosphoshikimate 1-carboxyvi...    167   7e-59    
gb|AEB98924.1|  5-enolpyruvylshikimate 3-phosphate synthase             169   7e-59    
ref|WP_032993765.1|  3-phosphoshikimate 1-carboxyvinyltransferase       165   8e-59    
ref|WP_007792293.1|  5-Enolpyruvylshikimate-3-phosphate synthase        165   8e-59    
ref|WP_021019035.1|  3-phosphoshikimate 1-carboxyvinyltransferase       173   8e-59    
ref|WP_023899055.1|  MULTISPECIES: 3-phosphoshikimate 1-carboxyvi...    165   8e-59    
emb|CBX73029.1|  3-phosphoshikimate 1-carboxyvinyltransferase           172   8e-59    
ref|WP_032720976.1|  3-phosphoshikimate 1-carboxyvinyltransferase       166   8e-59    
ref|WP_032974239.1|  3-phosphoshikimate 1-carboxyvinyltransferase       165   8e-59    
ref|WP_015704884.1|  3-phosphoshikimate 1-carboxyvinyltransferase       168   8e-59    
ref|WP_032656432.1|  3-phosphoshikimate 1-carboxyvinyltransferase       169   8e-59    
ref|WP_040904239.1|  3-phosphoshikimate 1-carboxyvinyltransferase       176   8e-59    
ref|WP_043622428.1|  3-phosphoshikimate 1-carboxyvinyltransferase       161   9e-59    
ref|WP_000445270.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   9e-59    
ref|WP_022595654.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   9e-59    
ref|WP_038218493.1|  3-phosphoshikimate 1-carboxyvinyltransferase       171   9e-59    
ref|WP_020079258.1|  3-phosphoshikimate 1-carboxyvinyltransferase       167   9e-59    
ref|WP_000445218.1|  3-phosphoshikimate 1-carboxyvinyltransferase       170   9e-59    
gb|EUC84984.1|  3-phosphoshikimate 1-carboxyvinyltransferase            167   9e-59    
emb|CDM90682.1|  3-enolpyruvylshikimate-5-phosphate synthetase          171   9e-59    
ref|WP_039056355.1|  3-phosphoshikimate 1-carboxyvinyltransferase       167   9e-59    
ref|WP_021325192.1|  3-phosphoshikimate 1-carboxyvinyltransferase       169   9e-59    
ref|WP_017899443.1|  3-phosphoshikimate 1-carboxyvinyltransferase       168   9e-59    
ref|WP_004406551.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   9e-59    
ref|WP_032455786.1|  3-phosphoshikimate 1-carboxyvinyltransferase       168   9e-59    
ref|WP_020457236.1|  3-phosphoshikimate 1-carboxyvinyltransferase       168   9e-59    
ref|WP_038225163.1|  3-phosphoshikimate 1-carboxyvinyltransferase       171   1e-58    
ref|WP_042546287.1|  3-phosphoshikimate 1-carboxyvinyltransferase       170   1e-58    
ref|WP_022592884.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   1e-58    
ref|WP_004201384.1|  3-phosphoshikimate 1-carboxyvinyltransferase       168   1e-58    
ref|WP_023320069.1|  3-phosphoshikimate 1-carboxyvinyltransferase       168   1e-58    
ref|WP_022603767.1|  3-phosphoshikimate 1-carboxyvinyltransferase       172   1e-58    
ref|WP_004713328.1|  3-phosphoshikimate 1-carboxyvinyltransferase       171   1e-58    
ref|WP_000445228.1|  3-phosphoshikimate 1-carboxyvinyltransferase       169   1e-58    



>gb|ACB37380.1| 5-enolpyruvylshikimate 3-phosphate synthase [Calystegia hederacea]
Length=520

 Score =   303 bits (777),  Expect(2) = 7e-116, Method: Compositional matrix adjust.
 Identities = 139/151 (92%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  SWTENSVTVKGPPR PSGRKHLR IDVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  370  GAEVSWTENSVTVKGPPRGPSGRKHLRGIDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  429

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYCIITPPE+LN+TEIDTYDDHRMAMAFSLAA
Sbjct  430  SWRVKETERMIAICTELRKLGATVEEGPDYCIITPPEKLNMTEIDTYDDHRMAMAFSLAA  489

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYF+VL KFSKH
Sbjct  490  CADVPVTIKDPGCTRKTFPDYFDVLSKFSKH  520


 Score =   142 bits (358),  Expect(2) = 7e-116, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLMER GVSVEHSDSWDRFLIRGGQKYKSPGNA+VEGDASSASYFLAGAAVTGGT+TVE
Sbjct  290  IKLMERFGVSVEHSDSWDRFLIRGGQKYKSPGNAYVEGDASSASYFLAGAAVTGGTITVE  349

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGAEV
Sbjct  350  GCGTSSLQGDVKFAEVLEKMGAEV  373



>gb|ACD80082.1| 5-enolpyruvylshikimate-3-phosphate synthase [Convolvulus arvensis]
Length=520

 Score =   300 bits (769),  Expect(2) = 3e-114, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  SWTENSVTVKGPPR P GRKHLR IDVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  370  GAEVSWTENSVTVKGPPRGPFGRKHLRGIDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  429

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGA VEEGPDYCIITPPE+LNVTEIDTYDDHRMAMAFSLAA
Sbjct  430  SWRVKETERMIAICTELRKLGAIVEEGPDYCIITPPEKLNVTEIDTYDDHRMAMAFSLAA  489

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYF+VL KFSKH
Sbjct  490  CADVPVTIKDPGCTRKTFPDYFDVLSKFSKH  520


 Score =   140 bits (352),  Expect(2) = 3e-114, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLMER GVSVEHSDSWDRF IRGGQKYKSPGNA+VEGDASSASYFLAGAAVTGGT+TVE
Sbjct  290  IKLMERFGVSVEHSDSWDRFYIRGGQKYKSPGNAYVEGDASSASYFLAGAAVTGGTITVE  349

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGAEV
Sbjct  350  GCGTSSLQGDVKFAEVLEKMGAEV  373



>ref|NP_001268176.1| 5-enolpyruvylshikimate-3-phosphate synthase [Vitis vinifera]
 emb|CBI38903.3| unnamed protein product [Vitis vinifera]
 gb|ACY29662.2| 5-enolpyruvylshikimate-3-phosphate synthase [Vitis vinifera]
Length=521

 Score =   296 bits (759),  Expect(2) = 6e-113, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ SW ENSVTV GPPR  SGRKHLRAIDVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  371  GAKVSWMENSVTVTGPPRDSSGRKHLRAIDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  430

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  431  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTSIDTYDDHRMAMAFSLAA  490

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYFEVLQ+F+KH
Sbjct  491  CADVPVTIKDPGCTRKTFPDYFEVLQRFTKH  521


 Score =   139 bits (350),  Expect(2) = 6e-113, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEHS++WDRFLIRGGQKYKSPGNAFVEGDASSASYFLAGAAVTGGTVTVE
Sbjct  291  LKLMERFGVSVEHSNTWDRFLIRGGQKYKSPGNAFVEGDASSASYFLAGAAVTGGTVTVE  350

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLE+MGA+V
Sbjct  351  GCGTSSLQGDVKFAEVLEQMGAKV  374



>ref|XP_011090562.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2 [Sesamum 
indicum]
Length=519

 Score =   293 bits (751),  Expect(2) = 8e-113, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SGRKHLRAID+NMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  369  GAEVTWTENSVTVKGPPRGTSGRKHLRAIDINMNKMPDVAMTLAVVALFADGPTAIRDVA  428

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  429  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  488

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFP+YF+VL  FSKH
Sbjct  489  CADVPVTIRDPGCTRKTFPNYFDVLATFSKH  519


 Score =   142 bits (357),  Expect(2) = 8e-113, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEHSDSWDRFL+RGGQKYKSPGNA+VEGDASSASYFLAGAAVTGGT+TVE
Sbjct  289  LKLMERFGVSVEHSDSWDRFLVRGGQKYKSPGNAYVEGDASSASYFLAGAAVTGGTITVE  348

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGAEV
Sbjct  349  GCGTSSLQGDVKFAEVLEKMGAEV  372



>ref|XP_010264165.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2 [Nelumbo 
nucifera]
Length=525

 Score =   298 bits (763),  Expect(2) = 6e-112, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVTV GPPR  S RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  375  GAKVTWTENSVTVTGPPRDSSSRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  434

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPERLNVT IDTYDDHRMAMAFSLAA
Sbjct  435  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPERLNVTAIDTYDDHRMAMAFSLAA  494

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYFEVLQKF+KH
Sbjct  495  CADVPVTIKDPGCTRKTFPDYFEVLQKFTKH  525


 Score =   134 bits (338),  Expect(2) = 6e-112, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV+VEHS SWDRF I+GGQKYKSPGNA+VEGDASSASYFLAGAAVTGGT+TVE
Sbjct  295  LKLMERFGVTVEHSSSWDRFFIKGGQKYKSPGNAYVEGDASSASYFLAGAAVTGGTITVE  354

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  355  GCGTSSLQGDVKFAEVLEKMGAKV  378



>sp|P11043.1|AROA_PETHY RecName: Full=3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic; 
AltName: Full=5-enolpyruvylshikimate-3-phosphate 
synthase; Short=EPSP synthase; Flags: Precursor [Petunia 
x hybrida]
 gb|AAA33699.1| 5-enolpyruvylshikimate-3-phosphate synthase precursor [Petunia 
x hybrida]
Length=516

 Score =   297 bits (761),  Expect(2) = 8e-112, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR+ SGRKHLRAIDVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  366  GAEVTWTENSVTVKGPPRSSSGRKHLRAIDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  425

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYCIITPPE+LNVT+IDTYDDHRMAMAFSLAA
Sbjct  426  SWRVKETERMIAICTELRKLGATVEEGPDYCIITPPEKLNVTDIDTYDDHRMAMAFSLAA  485

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI DPGCTRKTFP+YF+VLQ++SKH
Sbjct  486  CADVPVTINDPGCTRKTFPNYFDVLQQYSKH  516


 Score =   135 bits (339),  Expect(2) = 8e-112, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER G+SVEHS SWDRF +RGGQKYKSPG AFVEGDASSASYFLAGAAVTGGT+TVE
Sbjct  286  LKLMERFGISVEHSSSWDRFFVRGGQKYKSPGKAFVEGDASSASYFLAGAAVTGGTITVE  345

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMGAEV
Sbjct  346  GCGTNSLQGDVKFAEVLEKMGAEV  369



>gb|AAT45243.1| 5-enol-pyruvylshikimate-phosphate synthase [Conyza canadensis]
Length=519

 Score =   296 bits (759),  Expect(2) = 9e-112, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SGRKHLRA+DVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  369  GAEVTWTENSVTVKGPPRDSSGRKHLRAVDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  428

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  429  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  488

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDP CTRKTFPDYFEVLQ+F+KH
Sbjct  489  CADVPVTIKDPSCTRKTFPDYFEVLQRFAKH  519


 Score =   135 bits (340),  Expect(2) = 9e-112, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEHSDSWD+F IRGGQKYKSPGNA+VEGDASSASYFLAGAA+TGGT+TVE
Sbjct  289  LKLMERFGVSVEHSDSWDQFFIRGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTITVE  348

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVL +MGAEV
Sbjct  349  GCGTSSLQGDVKFAEVLGQMGAEV  372



>ref|XP_004306932.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2 [Fragaria 
vesca subsp. vesca]
Length=520

 Score =   291 bits (744),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTV GP R  SGRKHL+A+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  370  GAEVTWTENSVTVTGPQRHSSGRKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  429

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  430  SWRVKETERMIAICTELRKLGATVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  489

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C +VPVTIKDPGCTRKTFP+YFEVL KF+KH
Sbjct  490  CGDVPVTIKDPGCTRKTFPNYFEVLGKFTKH  520


 Score =   140 bits (352),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV+VEHSDSWDRFL+RGGQKYKSPG AFVEGDASSASYFLAGAAVTGGTVTVE
Sbjct  290  LKLMERFGVTVEHSDSWDRFLVRGGQKYKSPGKAFVEGDASSASYFLAGAAVTGGTVTVE  349

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGAEV
Sbjct  350  GCGTSSLQGDVKFAEVLEKMGAEV  373



>ref|XP_009628683.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 1, chloroplastic 
[Nicotiana tomentosiformis]
Length=518

 Score =   295 bits (755),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SG KHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  368  GAEVTWTENSVTVKGPPRNSSGMKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  427

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATV EGPDYCIITPPE+LNVTEIDTYDDHRMAMAFSLAA
Sbjct  428  SWRVKETERMIAICTELRKLGATVVEGPDYCIITPPEKLNVTEIDTYDDHRMAMAFSLAA  487

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFP+YF+VLQ++SKH
Sbjct  488  CADVPVTIKDPGCTRKTFPNYFDVLQQYSKH  518


 Score =   135 bits (341),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEH+ SWDRFL+RGGQKYKSPG A+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  288  LKLMERFGVSVEHTSSWDRFLVRGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTVTVE  347

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGAEV
Sbjct  348  GCGTSSLQGDVKFAEVLEKMGAEV  371



>gb|AAV64030.1| 5-enolpyruvylshikimate 3-phosphate synthase [Camptotheca acuminata]
Length=519

 Score =   297 bits (760),  Expect(2) = 4e-111, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVTV GPPR  SGRKHLRA+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  369  GAKVTWTENSVTVTGPPRNSSGRKHLRAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  428

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT +DTYDDHRMAMAFSLAA
Sbjct  429  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTAVDTYDDHRMAMAFSLAA  488

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA VPVTIKDPGCTRKTFPDYFEVLQ+F+KH
Sbjct  489  CANVPVTIKDPGCTRKTFPDYFEVLQRFAKH  519


 Score =   133 bits (334),  Expect(2) = 4e-111, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLM+R GV+VEHSD+WDRFLI+GGQKYKSPGN++VEGDASSASYFLAGAAVTGGT+TVE
Sbjct  289  LKLMKRFGVTVEHSDNWDRFLIQGGQKYKSPGNSYVEGDASSASYFLAGAAVTGGTITVE  348

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCG+SSLQGDVKFAEVLEKMGA+V
Sbjct  349  GCGSSSLQGDVKFAEVLEKMGAKV  372



>ref|XP_006347878.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic-like 
[Solanum tuberosum]
Length=519

 Score =   296 bits (757),  Expect(2) = 4e-111, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SG KHLRAIDVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  369  GAEVTWTENSVTVKGPPRNSSGMKHLRAIDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  428

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATV EG DYCIITPPE+LNVTEIDTYDDHRMAMAFSLAA
Sbjct  429  SWRVKETERMIAICTELRKLGATVVEGSDYCIITPPEKLNVTEIDTYDDHRMAMAFSLAA  488

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYFEVLQK+SKH
Sbjct  489  CADVPVTIKDPGCTRKTFPDYFEVLQKYSKH  519


 Score =   134 bits (337),  Expect(2) = 4e-111, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV VEHS SWDRFL++GGQKYKSPG AFVEGDASSASYFLAGAAVTGGTVTVE
Sbjct  289  LKLMERFGVFVEHSSSWDRFLVKGGQKYKSPGKAFVEGDASSASYFLAGAAVTGGTVTVE  348

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGAEV
Sbjct  349  GCGTSSLQGDVKFAEVLEKMGAEV  372



>emb|CCB84814.1| 5-enol-pyruvylshikimate-phosphate synthase [Conyza canadensis]
Length=519

 Score =   296 bits (758),  Expect(2) = 5e-111, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SGRKHLRA+DVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  369  GAEVTWTENSVTVKGPPRDSSGRKHLRAVDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  428

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  429  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  488

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDP CTRKTFPDYFEVLQ+F+KH
Sbjct  489  CADVPVTIKDPSCTRKTFPDYFEVLQRFAKH  519


 Score =   133 bits (335),  Expect(2) = 5e-111, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLME  GVSVEHSDSWDRF IRGGQKYKSPGNA+VEGDASSASYFLAGAA+TGGT+TVE
Sbjct  289  LKLMEWFGVSVEHSDSWDRFFIRGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTITVE  348

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVL +MGAEV
Sbjct  349  GCGTSSLQGDVKFAEVLGQMGAEV  372



>ref|XP_009781083.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2 [Nicotiana 
sylvestris]
Length=512

 Score =   294 bits (752),  Expect(2) = 6e-111, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  S  KHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  362  GAEVTWTENSVTVKGPPRNSSAMKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  421

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYCIITPPE+LNVTEIDTYDDHRMAMAFSLAA
Sbjct  422  SWRVKETERMIAICTELRKLGATVEEGPDYCIITPPEKLNVTEIDTYDDHRMAMAFSLAA  481

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI DPGCTRKTFP+YF+VLQ++SKH
Sbjct  482  CADVPVTINDPGCTRKTFPNYFDVLQQYSKH  512


 Score =   135 bits (340),  Expect(2) = 6e-111, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER G+SVEHS SWDRF++RGGQKYKSPG A+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  282  LKLMERFGISVEHSSSWDRFVVRGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTVTVE  341

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGAEV
Sbjct  342  GCGTSSLQGDVKFAEVLEKMGAEV  365



>ref|XP_004240047.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2 [Solanum 
lycopersicum]
Length=518

 Score =   296 bits (759),  Expect(2) = 8e-111, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SGRKHL AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  368  GAEVTWTENSVTVKGPPRNSSGRKHLHAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  427

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYCIITPPE+LNVTEIDTYDDHRMAMAFSLAA
Sbjct  428  SWRVKETERMIAICTELRKLGATVEEGPDYCIITPPEKLNVTEIDTYDDHRMAMAFSLAA  487

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI DPGCTRKTFP+YF+VLQ++SKH
Sbjct  488  CADVPVTINDPGCTRKTFPNYFDVLQQYSKH  518


 Score =   132 bits (332),  Expect(2) = 8e-111, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER G+SVEH+ SWDRF +RGGQKYKSPG A+VEGDASSASYFLAGAAVTGGT+TVE
Sbjct  288  LKLMERFGISVEHNSSWDRFFVRGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTITVE  347

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMGAEV
Sbjct  348  GCGTNSLQGDVKFAEVLEKMGAEV  371



>ref|XP_004229803.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic 
[Solanum lycopersicum]
Length=520

 Score =   296 bits (758),  Expect(2) = 1e-110, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SG KHLRAIDVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  370  GAEVTWTENSVTVKGPPRNSSGMKHLRAIDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  429

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATV EG DYCIITPPE+LNVTEIDTYDDHRMAMAFSLAA
Sbjct  430  SWRVKETERMIAICTELRKLGATVVEGSDYCIITPPEKLNVTEIDTYDDHRMAMAFSLAA  489

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYFEVLQK+SKH
Sbjct  490  CADVPVTIKDPGCTRKTFPDYFEVLQKYSKH  520


 Score =   132 bits (331),  Expect(2) = 1e-110, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV VEHS  WDRFL++GGQKYKSPG AFVEGDASSASYFLAGAAVTGGTVTVE
Sbjct  290  LKLMERFGVFVEHSSGWDRFLVKGGQKYKSPGKAFVEGDASSASYFLAGAAVTGGTVTVE  349

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGAEV
Sbjct  350  GCGTSSLQGDVKFAEVLEKMGAEV  373



>gb|AAY40473.1| 5-enol-pyruvylshikimate-phosphate synthase, partial [Conyza sumatrensis]
Length=447

 Score =   295 bits (755),  Expect(2) = 1e-110, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SGRKHLRA+DVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  297  GAEVTWTENSVTVKGPPRDSSGRKHLRAVDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  356

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  357  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  416

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDP CTRKTFPDYFEVLQ+F+KH
Sbjct  417  CADVPVTIKDPSCTRKTFPDYFEVLQRFAKH  447


 Score =   133 bits (334),  Expect(2) = 1e-110, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLME  GVSVEHSDSWDRF IRGGQKYKSPGNA+VEGDASSASYFLAGAA+TGGT+TVE
Sbjct  217  LKLMEWFGVSVEHSDSWDRFFIRGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTITVE  276

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVL +MGAEV
Sbjct  277  GCGTSSLQGDVKFAEVLGQMGAEV  300



>gb|AAY40472.1| 5-enol-pyruvylshikimate-phosphate synthase [Conyza sumatrensis]
Length=447

 Score =   295 bits (755),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SGRKHLRA+DVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  297  GAEVTWTENSVTVKGPPRDSSGRKHLRAVDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  356

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  357  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  416

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDP CTRKTFPDYFEVLQ+F+KH
Sbjct  417  CADVPVTIKDPSCTRKTFPDYFEVLQRFAKH  447


 Score =   132 bits (333),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLME  GVSVEHSDSWDRF IRGGQKYKSPGNA+VEGDASSASYFLAGAA+TGGT+TVE
Sbjct  217  LKLMEWFGVSVEHSDSWDRFFIRGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTITVE  276

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVL +MGAEV
Sbjct  277  GCGTSSLQGDVKFAEVLGQMGAEV  300



>gb|ABQ00959.1| 5-enol-pyruvylshikimate-phosphate synthase 1B [Conyza bonariensis]
Length=446

 Score =   295 bits (756),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SGRKHLRA+DVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  296  GAEVTWTENSVTVKGPPRDSSGRKHLRAVDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  355

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  356  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  415

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDP CTRKTFPDYFEVLQ+F+KH
Sbjct  416  CADVPVTIKDPSCTRKTFPDYFEVLQRFAKH  446


 Score =   132 bits (332),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEHSDSWD+F IRG QKYKSPGNA+VEGDASSASYFLAGAA+TGGT+TVE
Sbjct  216  LKLMERFGVSVEHSDSWDQFFIRGDQKYKSPGNAYVEGDASSASYFLAGAAITGGTITVE  275

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVL +MGAEV
Sbjct  276  GCGTSSLQGDVKFAEVLGQMGAEV  299



>gb|ABQ00960.1| 5-enol-pyruvylshikimate-phosphate synthase 1C [Conyza bonariensis]
Length=446

 Score =   295 bits (755),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SGRKHLRA+DVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  296  GAEVTWTENSVTVKGPPRDSSGRKHLRAVDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  355

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  356  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  415

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDP CTRKTFPDYFEVLQ+F+KH
Sbjct  416  CADVPVTIKDPSCTRKTFPDYFEVLQRFAKH  446


 Score =   132 bits (332),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEHSDSWD+F IRG QKYKSPGNA+VEGDASSASYFLAGAA+TGGT+TVE
Sbjct  216  LKLMERFGVSVEHSDSWDQFFIRGDQKYKSPGNAYVEGDASSASYFLAGAAITGGTITVE  275

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVL +MGAEV
Sbjct  276  GCGTSSLQGDVKFAEVLGQMGAEV  299



>gb|AAL27697.1| 5-enolpyruvylshikimate-3-phosphate synthase [Dicliptera chinensis]
Length=516

 Score =   289 bits (739),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 143/151 (95%), Gaps = 1/151 (1%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ SWTENSVTV GPPR P G+KHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  367  GAKVSWTENSVTVTGPPRVP-GKKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  425

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  426  SWRVKETERMIAICTELRKLGATVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  485

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFP+YF+VL  +S H
Sbjct  486  CADVPVTIKDPGCTRKTFPNYFDVLSTYSNH  516


 Score =   138 bits (348),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV VEH+D+WDRFLIRGGQKYKSPGNAFVEGDASSASYFLAGAAVTGGTVTVE
Sbjct  287  LKLMERFGVYVEHTDNWDRFLIRGGQKYKSPGNAFVEGDASSASYFLAGAAVTGGTVTVE  346

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  347  GCGTSSLQGDVKFAEVLEKMGAKV  370



>gb|AAT45244.1| 5-enol-pyruvylshikimate-phosphate synthase [Conyza canadensis]
Length=523

 Score =   293 bits (749),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SGR HLR +DVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  373  GAEVTWTENSVTVKGPPRNSSGRGHLRPVDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  432

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  433  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  492

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTIKDPGCTRKTFPDYFEVL++++KH
Sbjct  493  CAEVPVTIKDPGCTRKTFPDYFEVLERYTKH  523


 Score =   134 bits (338),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEHSD+WDRF +RGGQKYKSPGNA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  293  LKLMERFGVSVEHSDTWDRFHVRGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVE  352

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVL +MGAEV
Sbjct  353  GCGTSSLQGDVKFAEVLGQMGAEV  376



>gb|AAL27698.1|AF371966_1 5-enolpyruvylshikimate-3-phosphate synthase B [Dicliptera chinensis]
Length=516

 Score =   288 bits (738),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 143/151 (95%), Gaps = 1/151 (1%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ SWTENSVTV GPPR P G+KHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  367  GAKVSWTENSVTVTGPPRVP-GKKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  425

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  426  SWRVKETERMIAICTELRKLGATVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  485

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFP+YF+VL  +S H
Sbjct  486  CADVPVTIKDPGCTRKTFPNYFDVLSTYSNH  516


 Score =   138 bits (348),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV VEH+D+WDRFLIRGGQKYKSPGNAFVEGDASSASYFLAGAAVTGGTVTVE
Sbjct  287  LKLMERFGVYVEHTDNWDRFLIRGGQKYKSPGNAFVEGDASSASYFLAGAAVTGGTVTVE  346

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  347  GCGTSSLQGDVKFAEVLEKMGAKV  370



>emb|CCB84815.1| 5-enol-pyruvylshikimate-phosphate synthase [Conyza canadensis]
Length=523

 Score =   292 bits (748),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SGR HLR +DVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  373  GAEVTWTENSVTVKGPPRNSSGRGHLRPVDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  432

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  433  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  492

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTIKDPGCTRKTFPDYFEVL++++KH
Sbjct  493  CAEVPVTIKDPGCTRKTFPDYFEVLERYTKH  523


 Score =   134 bits (338),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEHSD+WDRF +RGGQKYKSPGNA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  293  LKLMERFGVSVEHSDTWDRFHVRGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVE  352

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVL +MGAEV
Sbjct  353  GCGTSSLQGDVKFAEVLGQMGAEV  376



>gb|ABV24481.1| 5-enolpyruvylshikimate-3-phosphate synthase [Gossypium hirsutum]
Length=521

 Score =   294 bits (753),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVTV GPPR  SGRKHLRAIDVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  371  GAKVTWTENSVTVTGPPRNSSGRKHLRAIDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  430

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  431  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  490

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTIKDPGCTRKTFPDYFEVL + +KH
Sbjct  491  CAEVPVTIKDPGCTRKTFPDYFEVLDRVTKH  521


 Score =   132 bits (333),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLMER GV+VEH+DSWDRF IRGGQKY SPGNA+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  291  MKLMERFGVTVEHTDSWDRFFIRGGQKYMSPGNAYVEGDASSASYFLAGAAVTGGTVTVE  350

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLE MGA+V
Sbjct  351  GCGTSSLQGDVKFAEVLEMMGAKV  374



>gb|ABA54869.1| putative 5-enolpyruvylshikimate 3-phosphate synthase [Fagus sylvatica]
Length=520

 Score =   288 bits (736),  Expect(2) = 4e-110, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +W+E SVTV GPP+  S +KHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  370  GAKVTWSETSVTVTGPPQDSSKKKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  429

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIAVCTELRKLGATVEEGPDYC+ITPPE+LNVT+IDTYDDHRMAMAFSLAA
Sbjct  430  SWRVKETERMIAVCTELRKLGATVEEGPDYCVITPPEKLNVTDIDTYDDHRMAMAFSLAA  489

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C +VPVTI DPGCTRKTFPDYFEVLQ+F+KH
Sbjct  490  CGDVPVTINDPGCTRKTFPDYFEVLQRFTKH  520


 Score =   139 bits (350),  Expect(2) = 4e-110, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER G+SVEH+DSWDRFLIRGGQKYKSPGNA+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  290  LKLMERFGISVEHNDSWDRFLIRGGQKYKSPGNAYVEGDASSASYFLAGAAVTGGTVTVE  349

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  350  GCGTSSLQGDVKFAEVLEKMGAKV  373



>gb|ABQ00957.1| 5-enol-pyruvylshikimate-phosphate synthase 2A [Conyza bonariensis]
Length=446

 Score =   292 bits (748),  Expect(2) = 4e-110, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SGR HLR +DVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  296  GAEVTWTENSVTVKGPPRNSSGRGHLRPVDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  355

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  356  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  415

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTIKDPGCTRKTFPDYFEVL++++KH
Sbjct  416  CAEVPVTIKDPGCTRKTFPDYFEVLERYTKH  446


 Score =   134 bits (337),  Expect(2) = 4e-110, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEHSD+WDRF +RGGQKYKSPGNA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  216  LKLMERFGVSVEHSDTWDRFHVRGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVE  275

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVL +MGAEV
Sbjct  276  GCGTSSLQGDVKFAEVLGQMGAEV  299



>sp|P10748.1|AROA_SOLLC RecName: Full=3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic; 
AltName: Full=5-enolpyruvylshikimate-3-phosphate 
synthase; Short=EPSP synthase; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAA34136.1| 5-enolpyruvylshikimate-3-phosphate synthase precursor (EC 2.5.1.19) 
[Solanum lycopersicum]
Length=520

 Score =   295 bits (754),  Expect(2) = 4e-110, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SG KHLRAIDVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  370  GAEVTWTENSVTVKGPPRNSSGMKHLRAIDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  429

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATV EG DYCIITPPE+LNVTEIDTYDDHRMAMAFSLAA
Sbjct  430  SWRVKETERMIAICTELRKLGATVVEGSDYCIITPPEKLNVTEIDTYDDHRMAMAFSLAA  489

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIK+PGCTRKTFPDYFEVLQK+SKH
Sbjct  490  CADVPVTIKNPGCTRKTFPDYFEVLQKYSKH  520


 Score =   132 bits (331),  Expect(2) = 4e-110, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV VEHS  WDRFL++GGQKYKSPG AFVEGDASSASYFLAGAAVTGGTVTVE
Sbjct  290  LKLMERFGVFVEHSSGWDRFLVKGGQKYKSPGKAFVEGDASSASYFLAGAAVTGGTVTVE  349

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGAEV
Sbjct  350  GCGTSSLQGDVKFAEVLEKMGAEV  373



>gb|KHG02688.1| 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic [Gossypium 
arboreum]
 gb|KHG17604.1| 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic [Gossypium 
arboreum]
 gb|KHG30019.1| 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic [Gossypium 
arboreum]
Length=521

 Score =   295 bits (754),  Expect(2) = 4e-110, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVTV GPPR  SGRKHLRAIDVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  371  GAKVTWTENSVTVTGPPRNSSGRKHLRAIDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  430

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  431  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  490

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTIKDPGCTRKTFPDYFEVL + +KH
Sbjct  491  CAEVPVTIKDPGCTRKTFPDYFEVLDRVTKH  521


 Score =   132 bits (332),  Expect(2) = 4e-110, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLMER GV+VEH+DSWDRF IRGGQKY SPGNA+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  291  MKLMERFGVTVEHTDSWDRFFIRGGQKYMSPGNAYVEGDASSASYFLAGAAVTGGTVTVE  350

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGD+KFAEVLE MGA+V
Sbjct  351  GCGTSSLQGDIKFAEVLEMMGAKV  374



>gb|ABY61050.1| 5-enolpyruvylshikimate-3-phosphate synthase [Gossypium hirsutum]
 gb|ACF16410.1| 5-enolpyruvylshikimate-3-phosphate synthase [Gossypium hirsutum]
Length=521

 Score =   293 bits (751),  Expect(2) = 5e-110, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WT+NSVTV GPPR PSGRKHLRAIDVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  371  GAKVTWTKNSVTVTGPPRNPSGRKHLRAIDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  430

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPD+C+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  431  SWRVKETERMIAICTELRKLGATVEEGPDFCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  490

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTIKDPGCTRKTFPDYFEVL + +KH
Sbjct  491  CAEVPVTIKDPGCTRKTFPDYFEVLARVTKH  521


 Score =   132 bits (333),  Expect(2) = 5e-110, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLMER GV+VEH+DSWDRF IRGGQKY SPGNA+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  291  IKLMERFGVTVEHTDSWDRFFIRGGQKYMSPGNAYVEGDASSASYFLAGAAVTGGTVTVE  350

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLE MGA+V
Sbjct  351  GCGTSSLQGDVKFAEVLEMMGAKV  374



>sp|P23981.1|AROA1_TOBAC RecName: Full=3-phosphoshikimate 1-carboxyvinyltransferase 1, 
chloroplastic; AltName: Full=5-enolpyruvylshikimate-3-phosphate 
synthase 1; Short=EPSP synthase 1; Flags: Precursor [Nicotiana 
tabacum]
 gb|AAA34071.1| 5-enolpyruvylshikimate-3-phosphate synthase [Nicotiana tabacum]
Length=518

 Score =   291 bits (746),  Expect(2) = 5e-110, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SG KHLRA+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  368  GAEVTWTENSVTVKGPPRNSSGMKHLRAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  427

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATV EG DYCIITPPE+LNVTEIDTYDDHRMAMAFSLAA
Sbjct  428  SWRVKETERMIAICTELRKLGATVVEGSDYCIITPPEKLNVTEIDTYDDHRMAMAFSLAA  487

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFP+YF+VLQ++SKH
Sbjct  488  CADVPVTIKDPGCTRKTFPNYFDVLQQYSKH  518


 Score =   134 bits (338),  Expect(2) = 5e-110, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEH+ SWD+FL+RGGQKYKSPG A+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  288  LKLMERFGVSVEHTSSWDKFLVRGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTVTVE  347

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGAEV
Sbjct  348  GCGTSSLQGDVKFAEVLEKMGAEV  371



>ref|XP_010098925.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Morus notabilis]
 gb|EXB76227.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Morus notabilis]
Length=525

 Score =   289 bits (739),  Expect(2) = 7e-110, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ SWTENSVTV GPPR  SGRKHL+AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  375  GAKVSWTENSVTVTGPPRDSSGRKHLKAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  434

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LN   IDTYDDHRMAMAFSLAA
Sbjct  435  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNTAAIDTYDDHRMAMAFSLAA  494

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C +VPVTIKDPGCTRKTFPDYF+VL+ F+KH
Sbjct  495  CGDVPVTIKDPGCTRKTFPDYFDVLKIFTKH  525


 Score =   137 bits (344),  Expect(2) = 7e-110, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEH+DSWDRFL+RGGQKYKSPGNA+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  295  LKLMERFGVSVEHTDSWDRFLVRGGQKYKSPGNAYVEGDASSASYFLAGAAVTGGTVTVE  354

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVL KMGA+V
Sbjct  355  GCGTSSLQGDVKFAEVLGKMGAKV  378



>gb|KJB09910.1| hypothetical protein B456_001G174400 [Gossypium raimondii]
Length=521

 Score =   288 bits (737),  Expect(2) = 8e-110, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVTV GPPR PSGRKHL AIDVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  371  GAKVTWTENSVTVTGPPRNPSGRKHLCAIDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  430

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPPE+LNVT +DTYDDHRMAMAFSLAA
Sbjct  431  SWRVKETERMIAICTELRKLGATVEEGLDYCVITPPEKLNVTAVDTYDDHRMAMAFSLAA  490

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C EVPVTIKDPGCTRKTFPDYFEVL++ +KH
Sbjct  491  CGEVPVTIKDPGCTRKTFPDYFEVLERVTKH  521


 Score =   137 bits (345),  Expect(2) = 8e-110, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLMER GV+VEH+DSWDRFLI+GGQKYKSPGNA+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  291  IKLMERFGVTVEHTDSWDRFLIKGGQKYKSPGNAYVEGDASSASYFLAGAAVTGGTVTVE  350

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  351  GCGTSSLQGDVKFAEVLEKMGAKV  374



>ref|XP_009596625.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2-like 
[Nicotiana tomentosiformis]
Length=512

 Score =   290 bits (742),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGP +  SG KHL AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  362  GAEVTWTENSVTVKGPQKNSSGMKHLHAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  421

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYCIITPPE LNVTEIDTYDDHRMAMAFSLAA
Sbjct  422  SWRVKETERMIAICTELRKLGATVEEGPDYCIITPPENLNVTEIDTYDDHRMAMAFSLAA  481

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI DPGCTRKTFP+YF+VLQ++SKH
Sbjct  482  CADVPVTINDPGCTRKTFPNYFDVLQQYSKH  512


 Score =   135 bits (340),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER G+SVEHS SWDRF++RGGQKYKSPG A+VEGDASSASYFLAGAAVTGGT+TVE
Sbjct  282  LKLMERFGISVEHSSSWDRFVVRGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTITVE  341

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGAEV
Sbjct  342  GCGTSSLQGDVKFAEVLEKMGAEV  365



>sp|P23281.1|AROA2_TOBAC RecName: Full=3-phosphoshikimate 1-carboxyvinyltransferase 2; 
AltName: Full=5-enolpyruvylshikimate-3-phosphate synthase 2; 
Short=EPSP synthase 2, partial [Nicotiana tabacum]
 gb|AAA34072.1| 5-enolpyruvylshikimate-3-phosphate synthase, partial [Nicotiana 
tabacum]
Length=338

 Score =   292 bits (747),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  S  KHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  188  GAEVTWTENSVTVKGPPRNSSAMKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  247

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYCIITPPE+LNVTEIDTYDDHRMAMAFSLAA
Sbjct  248  SWRVKETERMIAICTELRKLGATVEEGPDYCIITPPEKLNVTEIDTYDDHRMAMAFSLAA  307

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI DPGCTRKTFP+YF+VLQ++SKH
Sbjct  308  CADVPVTINDPGCTRKTFPNYFDVLQQYSKH  338


 Score =   133 bits (334),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER G+SVEHS SWDRF++RGGQKYKSPG A+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  108  LKLMERFGISVEHSSSWDRFVVRGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTVTVE  167

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLE+MGAEV
Sbjct  168  GCGTSSLQGDVKFAEVLEQMGAEV  191



>ref|XP_008364368.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2 [Malus 
domestica]
Length=525

 Score =   286 bits (731),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVTV GP R  +G KHL+A+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  375  GAKVTWTENSVTVTGPRRLSAGGKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  434

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  435  SWRVKETERMIAICTELRKLGATVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  494

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C +VPVTIKDPGCTRKTFPDYFEVL +F+KH
Sbjct  495  CGDVPVTIKDPGCTRKTFPDYFEVLGRFTKH  525


 Score =   138 bits (348),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLME  GVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLAGAAVTGGTVTVE
Sbjct  295  LKLMECFGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLAGAAVTGGTVTVE  354

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  355  GCGTSSLQGDVKFAEVLEKMGAKV  378



>ref|XP_010941045.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2 isoform 
X2 [Elaeis guineensis]
Length=522

 Score =   288 bits (738),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSV V GPPR PS RK+L A+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  372  GAKVTWTENSVIVTGPPRDPSKRKNLHAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  431

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFS+AA
Sbjct  432  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTSIDTYDDHRMAMAFSIAA  491

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYF+VLQ+F++H
Sbjct  492  CADVPVTIKDPGCTRKTFPDYFDVLQRFTRH  522


 Score =   135 bits (341),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV+VEHSDSWDRFLI+GGQKYKS GNA+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  292  LKLMERFGVTVEHSDSWDRFLIKGGQKYKSSGNAYVEGDASSASYFLAGAAVTGGTVTVE  351

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  352  GCGTSSLQGDVKFAEVLEKMGAKV  375



>gb|KJB49293.1| hypothetical protein B456_008G113600 [Gossypium raimondii]
 gb|KJB49297.1| hypothetical protein B456_008G113600 [Gossypium raimondii]
Length=521

 Score =   293 bits (749),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WT+NSVTV GPPR  SGRKHLRAIDVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  371  GAKVTWTKNSVTVTGPPRNSSGRKHLRAIDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  430

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  431  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  490

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTIKDPGCTRKTFPDYFEVL + +KH
Sbjct  491  CAEVPVTIKDPGCTRKTFPDYFEVLARVTKH  521


 Score =   131 bits (329),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLM+R GV+VEH+DSWDRF IRGGQKY SPGNA+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  291  IKLMKRFGVTVEHTDSWDRFFIRGGQKYMSPGNAYVEGDASSASYFLAGAAVTGGTVTVE  350

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLE MGA+V
Sbjct  351  GCGTSSLQGDVKFAEVLEMMGAKV  374



>ref|XP_009802118.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 1, chloroplastic 
[Nicotiana sylvestris]
Length=518

 Score =   289 bits (740),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSV VKGPPR  SG KHLRA+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  368  GAEVTWTENSVMVKGPPRNSSGMKHLRAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  427

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATV EG DYCIITPPE+LNVTEIDTYDDHRMAMAFSLAA
Sbjct  428  SWRVKETERMIAICTELRKLGATVVEGSDYCIITPPEKLNVTEIDTYDDHRMAMAFSLAA  487

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFP+YF+VLQ++SKH
Sbjct  488  CADVPVTIKDPGCTRKTFPNYFDVLQQYSKH  518


 Score =   134 bits (338),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEH+ SWD+FL+RGGQKYKSPG A+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  288  LKLMERFGVSVEHTSSWDKFLVRGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTVTVE  347

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGAEV
Sbjct  348  GCGTSSLQGDVKFAEVLEKMGAEV  371



>gb|ABQ00961.1| 5-enol-pyruvylshikimate-phosphate synthase 3A [Conyza bonariensis]
Length=446

 Score =   288 bits (738),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SGR HL  +DVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  296  GAEVTWTENSVTVKGPPRNSSGRGHLCPVDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  355

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  356  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  415

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTIKDPGCTRKTFPDYFEVL++++KH
Sbjct  416  CAEVPVTIKDPGCTRKTFPDYFEVLERYTKH  446


 Score =   134 bits (338),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEHSD+WDRF +RGGQKYKSPGNA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  216  LKLMERFGVSVEHSDTWDRFYVRGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVE  275

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVL +MGAEV
Sbjct  276  GCGTSSLQGDVKFAEVLGQMGAEV  299



>gb|KHG27092.1| 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic [Gossypium 
arboreum]
Length=521

 Score =   286 bits (731),  Expect(2) = 4e-109, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVTV GPPR PSGRKHL AIDVNMNKMPDVAMTLAVVA++ADGPTAIRDVA
Sbjct  371  GAKVTWTENSVTVTGPPRNPSGRKHLCAIDVNMNKMPDVAMTLAVVAIYADGPTAIRDVA  430

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  431  SWRVKETERMIAICTELRKLGATVEEGLDYCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  490

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C +VPVTIKDPGCTRKTFPDYFEVL++ +KH
Sbjct  491  CGKVPVTIKDPGCTRKTFPDYFEVLERVTKH  521


 Score =   137 bits (346),  Expect(2) = 4e-109, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLMER GV+VEH+DSWDRFLI+GGQKYKSPGNA+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  291  IKLMERFGVTVEHTDSWDRFLIKGGQKYKSPGNAYVEGDASSASYFLAGAAVTGGTVTVE  350

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  351  GCGTSSLQGDVKFAEVLEKMGAKV  374



>gb|AFA26647.1| EPSPS-like protein [Cirsium setosum]
Length=520

 Score =   287 bits (735),  Expect(2) = 5e-109, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SGRKHLR +DVNMNKMPDVAMTLAVVAL+ADGPT IRDVA
Sbjct  370  GAEVTWTENSVTVKGPPRNSSGRKHLRPVDVNMNKMPDVAMTLAVVALYADGPTTIRDVA  429

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPPE+LNV  IDTYDDHRMAMAFSLAA
Sbjct  430  SWRVKETERMIAICTELRKLGATVEEGADYCVITPPEKLNVVAIDTYDDHRMAMAFSLAA  489

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI DPGCTRKTFPDYFEVLQKF+K+
Sbjct  490  CADVPVTINDPGCTRKTFPDYFEVLQKFAKN  520


 Score =   135 bits (341),  Expect(2) = 5e-109, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSV+H+DSWD+FLIRGGQKYKSPGNA+VEGDASSASYFLAGAA+TGGT+TVE
Sbjct  290  LKLMERFGVSVQHTDSWDKFLIRGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTITVE  349

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVL +MGAEV
Sbjct  350  GCGTSSLQGDVKFAEVLGQMGAEV  373



>gb|ABQ00958.1| 5-enol-pyruvylshikimate-phosphate synthase 1A [Conyza bonariensis]
Length=446

 Score =   295 bits (754),  Expect(2) = 5e-109, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SGRKHLRA+DVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  296  GAEVTWTENSVTVKGPPRDSSGRKHLRAVDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  355

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  356  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  415

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDP CTRKTFPDYFEVLQ+F+KH
Sbjct  416  CADVPVTIKDPSCTRKTFPDYFEVLQRFAKH  446


 Score =   128 bits (321),  Expect(2) = 5e-109, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEHSDSWD+F IRG QKYKSPGNA+VEGDASSASYFLAGAA+TGGT+TVE
Sbjct  216  LKLMERFGVSVEHSDSWDQFFIRGDQKYKSPGNAYVEGDASSASYFLAGAAITGGTITVE  275

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFA+V  +MGAEV
Sbjct  276  GCGTSSLQGDVKFAKVPGQMGAEV  299



>ref|XP_010053905.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2 [Eucalyptus 
grandis]
 gb|KCW78282.1| hypothetical protein EUGRSUZ_D02465 [Eucalyptus grandis]
Length=513

 Score =   291 bits (744),  Expect(2) = 5e-109, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTV GPPR  SGRKHLRAIDV+MNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  363  GAIVTWTENSVTVTGPPRNSSGRKHLRAIDVDMNKMPDVAMTLAVVALFADGPTAIRDVA  422

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPERLNVT IDTYDDHRMAMAFSLAA
Sbjct  423  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPERLNVTAIDTYDDHRMAMAFSLAA  482

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYFEVLQ  + H
Sbjct  483  CADVPVTIKDPGCTRKTFPDYFEVLQSVTSH  513


 Score =   132 bits (332),  Expect(2) = 5e-109, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEHS SWDRFL+RGGQKY++PG A+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  283  LKLMERFGVSVEHSGSWDRFLVRGGQKYRTPGKAYVEGDASSASYFLAGAAVTGGTVTVE  342

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA V
Sbjct  343  GCGTSSLQGDVKFAEVLEKMGAIV  366



>ref|XP_007219002.1| hypothetical protein PRUPE_ppa004186mg [Prunus persica]
 gb|EMJ20201.1| hypothetical protein PRUPE_ppa004186mg [Prunus persica]
Length=524

 Score =   282 bits (722),  Expect(2) = 7e-109, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 140/151 (93%), Gaps = 1/151 (1%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +W ENSVTV GP R  S RKHL+A+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  375  GAKVTWRENSVTVTGPQRNSS-RKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  433

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPERLNVT IDTYDDHRMAMAFSLAA
Sbjct  434  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPERLNVTAIDTYDDHRMAMAFSLAA  493

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C +VPVTI DPGCTRKTFPDYFEVL KF+KH
Sbjct  494  CGDVPVTINDPGCTRKTFPDYFEVLGKFTKH  524


 Score =   140 bits (353),  Expect(2) = 7e-109, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV+VEHSDSWDRF IRGGQKYKSPGNAFVEGDASSASYFLAGAAVTGGTVTVE
Sbjct  295  LKLMERFGVTVEHSDSWDRFFIRGGQKYKSPGNAFVEGDASSASYFLAGAAVTGGTVTVE  354

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  355  GCGTSSLQGDVKFAEVLEKMGAKV  378



>ref|XP_008813028.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2 [Phoenix 
dactylifera]
Length=521

 Score =   288 bits (738),  Expect(2) = 8e-109, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVTV GPPR PS RK+LRA+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  371  GAKVTWTENSVTVTGPPRDPSKRKNLRAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  430

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGA VEEGPDYC+ITPPERLNVT IDTYDDHRMAMAFS+AA
Sbjct  431  SWRVKETERMIAICTELRKLGAIVEEGPDYCVITPPERLNVTAIDTYDDHRMAMAFSIAA  490

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYF+VL++F+K+
Sbjct  491  CADVPVTIKDPGCTRKTFPDYFDVLRRFTKY  521


 Score =   134 bits (336),  Expect(2) = 8e-109, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV+VEHSDSWD+FLI+GGQKY+SPG A+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  291  LKLMERFGVTVEHSDSWDKFLIKGGQKYQSPGTAYVEGDASSASYFLAGAAVTGGTVTVE  350

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMGA+V
Sbjct  351  GCGTTSLQGDVKFAEVLEKMGAKV  374



>ref|XP_002511692.1| 3-phosphoshikimate 1-carboxyvinyltransferase, putative [Ricinus 
communis]
 gb|EEF50361.1| 3-phosphoshikimate 1-carboxyvinyltransferase, putative [Ricinus 
communis]
Length=518

 Score =   290 bits (742),  Expect(2) = 8e-109, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVTV GPPR    +KHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  368  GAKVTWTENSVTVTGPPRNSPTQKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  427

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVTEIDTYDDHRMAMAFSLAA
Sbjct  428  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTEIDTYDDHRMAMAFSLAA  487

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C +VPVTIKDPGCTRKTFPDYFEVLQ+F+K 
Sbjct  488  CGDVPVTIKDPGCTRKTFPDYFEVLQRFTKQ  518


 Score =   132 bits (331),  Expect(2) = 8e-109, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV VEHS SWDRF IRGGQKYKSPGN++VEGDASSASYFLAGAAVTGGT+TVE
Sbjct  288  LKLMERYGVFVEHSSSWDRFFIRGGQKYKSPGNSYVEGDASSASYFLAGAAVTGGTITVE  347

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLE+MGA+V
Sbjct  348  GCGTSSLQGDVKFAEVLEQMGAKV  371



>ref|XP_009603427.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2 [Nicotiana 
tomentosiformis]
Length=258

 Score =   287 bits (735),  Expect(2) = 9e-109, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGP +  SG KHL AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  108  GAEVTWTENSVTVKGPQKNSSGMKHLHAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  167

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYCIITPPE LNVTEIDTYDDHRMAMAFSLAA
Sbjct  168  SWRVKETERMIAICTELRKLGATVEEGPDYCIITPPENLNVTEIDTYDDHRMAMAFSLAA  227

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI DPGCTRKTFP+YF+VLQ++SKH
Sbjct  228  CADVPVTINDPGCTRKTFPNYFDVLQQYSKH  258


 Score =   135 bits (339),  Expect(2) = 9e-109, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER G+SVEHS SWDRF++RGGQKYKSPG A+VEGDASSASYFLAGAAVTGGT+TVE
Sbjct  28   LKLMERFGISVEHSSSWDRFVVRGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTITVE  87

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGAEV
Sbjct  88   GCGTSSLQGDVKFAEVLEKMGAEV  111



>gb|ABQ00962.1| 5-enol-pyruvylshikimate-phosphate synthase 3B [Conyza bonariensis]
Length=446

 Score =   287 bits (735),  Expect(2) = 9e-109, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SGR HL  +DVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  296  GAEVTWTENSVTVKGPPRNSSGRGHLCPVDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  355

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  356  SWRVKETERMIAICTELRKLGATVEEGPDYCAITPPEKLNVTAIDTYDDHRMAMAFSLAA  415

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTIKDPGCTRKTFPDYFEVL++++KH
Sbjct  416  CAEVPVTIKDPGCTRKTFPDYFEVLERYTKH  446


 Score =   135 bits (339),  Expect(2) = 9e-109, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEHSD+WDRF +RGGQKYKSPGNA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  216  LKLMERFGVSVEHSDTWDRFYVRGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVE  275

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVL +MGAEV
Sbjct  276  GCGTSSLQGDVKFAEVLGQMGAEV  299



>gb|AAY40474.1| 5-enol-pyruvylshikimate-phosphate synthase [Conyza sumatrensis]
Length=446

 Score =   289 bits (740),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SGR  LR +DVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  296  GAEVTWTENSVTVKGPPRNSSGRGELRPVDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  355

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  356  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  415

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTIKDPGCTRKTFPDYFEVL++++KH
Sbjct  416  CAEVPVTIKDPGCTRKTFPDYFEVLERYTKH  446


 Score =   132 bits (333),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEHSD+WDRF +RGGQKYKSPG+A+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  216  LKLMERFGVSVEHSDTWDRFYVRGGQKYKSPGSAYVEGDASSASYFLAGAAITGGTVTVE  275

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVL +MGAEV
Sbjct  276  GCGTSSLQGDVKFAEVLGQMGAEV  299



>ref|XP_010934664.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2-like 
[Elaeis guineensis]
Length=522

 Score =   286 bits (731),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVTV GPP  PS RK+LRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  372  GAKVTWTENSVTVTGPPGDPSKRKNLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  431

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGA VEEGPDYC+ITPPERLNVT IDTYDDHRMAMAFS+AA
Sbjct  432  SWRVKETERMIAICTELRKLGAIVEEGPDYCVITPPERLNVTAIDTYDDHRMAMAFSIAA  491

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYF+VL++F+K+
Sbjct  492  CADVPVTIKDPGCTRKTFPDYFDVLRRFTKN  522


 Score =   135 bits (340),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV+VEHSDSWD+FLI+GGQKYKSPG A+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  292  LKLMERFGVTVEHSDSWDKFLIKGGQKYKSPGTAYVEGDASSASYFLAGAAVTGGTVTVE  351

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMGA+V
Sbjct  352  GCGTTSLQGDVKFAEVLEKMGAKV  375



>gb|KDP28768.1| hypothetical protein JCGZ_14539 [Jatropha curcas]
Length=519

 Score =   288 bits (737),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVTV GPPR    +KHLRA+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  369  GAKVTWTENSVTVTGPPRNSPSQKHLRAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  428

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNV EIDTYDDHRMAMAFSLAA
Sbjct  429  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVAEIDTYDDHRMAMAFSLAA  488

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C +VPVTIKDPGCTRKTFPDYFEVL++F+KH
Sbjct  489  CGDVPVTIKDPGCTRKTFPDYFEVLERFTKH  519


 Score =   133 bits (334),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV+VEHS SWDRF IRGGQKY+SPGN++VEGDASSASYFLAGAA+TGGT+ VE
Sbjct  289  LKLMERYGVNVEHSGSWDRFFIRGGQKYRSPGNSYVEGDASSASYFLAGAAITGGTIAVE  348

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  349  GCGTSSLQGDVKFAEVLEKMGAKV  372



>ref|XP_011017482.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2-like 
[Populus euphratica]
Length=518

 Score =   292 bits (748),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WT+NSVTV GPPR  SG+KHLRA+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  368  GAKVTWTKNSVTVTGPPRDSSGQKHLRAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  427

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVTEIDTYDDHRMAMAFSLAA
Sbjct  428  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTEIDTYDDHRMAMAFSLAA  487

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C EV VTIKDPGCTRKTFPDYFEVL++++KH
Sbjct  488  CGEVQVTIKDPGCTRKTFPDYFEVLERYTKH  518


 Score =   128 bits (322),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV VEHSD+WDRF +RGGQKYKSP N+FVEGDASSASYFLAGAA+TGGT+TVE
Sbjct  288  LKLMERYGVFVEHSDNWDRFFVRGGQKYKSPKNSFVEGDASSASYFLAGAAITGGTITVE  347

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCG  SLQGDVKFAEVLEKMGA+V
Sbjct  348  GCGMDSLQGDVKFAEVLEKMGAKV  371



>ref|XP_008232641.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2 [Prunus 
mume]
Length=524

 Score =   282 bits (722),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 140/151 (93%), Gaps = 1/151 (1%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +W ENSVTV GP R  S RKHL+A+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  375  GAKVTWRENSVTVTGPQRNSS-RKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  433

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPERLNVT IDTYDDHRMAMAFSLAA
Sbjct  434  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPERLNVTAIDTYDDHRMAMAFSLAA  493

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C +VPVTI DPGCTRKTFPDYFEVL KF+KH
Sbjct  494  CGDVPVTINDPGCTRKTFPDYFEVLGKFTKH  524


 Score =   138 bits (348),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLM+R GV+VEHSDSWDRF IRGGQKYKSPGNAFVEGDASSASYFLAGAAVTGGTVTVE
Sbjct  295  LKLMKRFGVTVEHSDSWDRFFIRGGQKYKSPGNAFVEGDASSASYFLAGAAVTGGTVTVE  354

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  355  GCGTSSLQGDVKFAEVLEKMGAKV  378



>ref|XP_002301279.1| 3-phosphoshikimate 1-carboxyvinyltransferase family protein [Populus 
trichocarpa]
 gb|EEE80552.1| 3-phosphoshikimate 1-carboxyvinyltransferase family protein [Populus 
trichocarpa]
Length=518

 Score =   292 bits (748),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WT+NSVTV GPPR  SG+KHLRA+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  368  GAKVTWTKNSVTVTGPPRDSSGQKHLRAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  427

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVTEIDTYDDHRMAMAFSLAA
Sbjct  428  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTEIDTYDDHRMAMAFSLAA  487

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C EV VTIKDPGCTRKTFPDYFEVL++++KH
Sbjct  488  CGEVQVTIKDPGCTRKTFPDYFEVLERYTKH  518


 Score =   128 bits (322),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV VEHSD+WDRF +RGGQKYKSP N+FVEGDASSASYFLAGAA+TGGT+TVE
Sbjct  288  LKLMERYGVFVEHSDNWDRFFVRGGQKYKSPKNSFVEGDASSASYFLAGAAITGGTITVE  347

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCG  SLQGDVKFAEVLEKMGA+V
Sbjct  348  GCGMDSLQGDVKFAEVLEKMGAKV  371



>ref|XP_007052087.1| RNA 3'-terminal phosphate cyclase/enolpyruvate transferase, alpha/beta 
isoform 1 [Theobroma cacao]
 gb|EOX96244.1| RNA 3'-terminal phosphate cyclase/enolpyruvate transferase, alpha/beta 
isoform 1 [Theobroma cacao]
Length=521

 Score =   292 bits (747),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVTV GPPR  SG+KHLRAIDVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  371  GAKVTWTENSVTVTGPPRNSSGKKHLRAIDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  430

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  431  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  490

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI DPGCTRKTFPDYFEVL+K +KH
Sbjct  491  CADVPVTINDPGCTRKTFPDYFEVLEKVTKH  521


 Score =   128 bits (322),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLMER GVSVEH+ SWDRF IRG QKYKSPG A+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  291  IKLMERFGVSVEHTGSWDRFYIRGRQKYKSPGKAYVEGDASSASYFLAGAAVTGGTVTVE  350

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  351  GCGTSSLQGDVKFAEVLEKMGAKV  374



>ref|XP_009382957.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2 [Musa 
acuminata subsp. malaccensis]
Length=518

 Score =   287 bits (735),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ SWTENSVTV GPPR PS + HL  IDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  368  GAKVSWTENSVTVTGPPRDPSKKGHLHGIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  427

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+CTELRKLGATVEEGPD+CIITPPE+LN+T IDTYDDHRMAMAFS+AA
Sbjct  428  SWRVKETERMVAICTELRKLGATVEEGPDFCIITPPEKLNITAIDTYDDHRMAMAFSIAA  487

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYF+VLQ+F+KH
Sbjct  488  CADVPVTIKDPGCTRKTFPDYFDVLQRFTKH  518


 Score =   133 bits (334),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV VEHSD+WDRF I+G QKYKSPGNA+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  288  LKLMERFGVKVEHSDNWDRFYIKGAQKYKSPGNAYVEGDASSASYFLAGAAVTGGTVTVE  347

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  348  GCGTSSLQGDVKFAEVLEKMGAKV  371



>ref|XP_010941044.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2 isoform 
X1 [Elaeis guineensis]
Length=524

 Score =   288 bits (738),  Expect(2) = 6e-108, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSV V GPPR PS RK+L A+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  374  GAKVTWTENSVIVTGPPRDPSKRKNLHAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  433

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFS+AA
Sbjct  434  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTSIDTYDDHRMAMAFSIAA  493

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYF+VLQ+F++H
Sbjct  494  CADVPVTIKDPGCTRKTFPDYFDVLQRFTRH  524


 Score =   130 bits (328),  Expect(2) = 6e-108, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 82/86 (95%), Gaps = 2/86 (2%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYK--SPGNAFVEGDASSASYFLagaavtggtvt  715
            LKLMER GV+VEHSDSWDRFLI+GGQKYK  S GNA+VEGDASSASYFLAGAAVTGGTVT
Sbjct  292  LKLMERFGVTVEHSDSWDRFLIKGGQKYKYESSGNAYVEGDASSASYFLAGAAVTGGTVT  351

Query  714  VEGCGTSSLQGDVKFAEVLEKMGAEV  637
            VEGCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  352  VEGCGTSSLQGDVKFAEVLEKMGAKV  377



>ref|XP_010692222.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2 [Beta 
vulgaris subsp. vulgaris]
Length=517

 Score =   290 bits (741),  Expect(2) = 7e-108, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GPPR  SGRKHLRA+DVNMNKMPDVAMTLAVVAL+ADGPT IRDVA
Sbjct  367  GCKVSWTENSVTVTGPPRDASGRKHLRAVDVNMNKMPDVAMTLAVVALYADGPTTIRDVA  426

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  427  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  486

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYF+VL++F+KH
Sbjct  487  CADVPVTIKDPGCTRKTFPDYFDVLERFAKH  517


 Score =   129 bits (325),  Expect(2) = 7e-108, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLMER GVSVEHS  W RFLIRGGQKYKSPGNA+VEGDASSASYF+ GAAVTGGTVTVE
Sbjct  287  IKLMERFGVSVEHSADWGRFLIRGGQKYKSPGNAYVEGDASSASYFIGGAAVTGGTVTVE  346

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMG +V
Sbjct  347  GCGTSSLQGDVKFAEVLEKMGCKV  370



>ref|XP_008803985.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2-like 
[Phoenix dactylifera]
Length=522

 Score =   286 bits (731),  Expect(2) = 9e-108, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVTV GPPR PS RK+L AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  372  GAKVTWTENSVTVTGPPRDPSNRKNLHAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  431

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPP +L+VT IDTYDDHRMAMAFS+AA
Sbjct  432  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPGKLSVTSIDTYDDHRMAMAFSVAA  491

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYF+VLQ+F++H
Sbjct  492  CADVPVTIKDPGCTRKTFPDYFDVLQRFTRH  522


 Score =   133 bits (334),  Expect(2) = 9e-108, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLME  GV+VEHSDSWDRFLI+GGQKYKSPG+A+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  292  LKLMECFGVTVEHSDSWDRFLIKGGQKYKSPGSAYVEGDASSASYFLAGAAVTGGTVTVE  351

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMGA+V
Sbjct  352  GCGTASLQGDVKFAEVLEKMGAKV  375



>gb|AHF20161.1| 5-enolpyruvylshikimate-3-phosphate synthase, partial [Musa acuminata 
AAA Group]
Length=332

 Score =   286 bits (732),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ SWTENSVTV GPPR PS + HLR IDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  182  GAKVSWTENSVTVTGPPRDPSKKGHLRGIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  241

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+CTELRKLGATVEEGPD+CIITPPE+LN+T IDTYDDHRMAMAFS+AA
Sbjct  242  SWRVKETERMVAICTELRKLGATVEEGPDFCIITPPEKLNITAIDTYDDHRMAMAFSIAA  301

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFPDYF+VLQ+F+KH
Sbjct  302  CADVPVTIRDPGCTRKTFPDYFDVLQRFTKH  332


 Score =   132 bits (331),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV VEHSD+WDRF I+G QKYKSPGNA+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  102  LKLMERFGVKVEHSDNWDRFYIKGAQKYKSPGNAYVEGDASSASYFLAGAAVTGGTVTVE  161

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  162  GCGTSSLQGDVKFAEVLEKMGAKV  185



>gb|AIR74881.1| 5-enolpyruvylshikimate-3-phosphate synthase [Cyperus rotundus]
Length=509

 Score =   284 bits (726),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 142/152 (93%), Gaps = 1/152 (1%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGR-KHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDV  473
            G++ +WTENSVTV GPPR  S R KHL+A+DVNMNKMPDVAMTLAVVALFADGPTAIRDV
Sbjct  358  GAKVTWTENSVTVTGPPRGSSFREKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAIRDV  417

Query  472  ASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLA  293
            ASWRVKETERM+A+CTELRKLGATVEEGPDYCIITPPE+LN+  IDTYDDHRMAM FSLA
Sbjct  418  ASWRVKETERMVAICTELRKLGATVEEGPDYCIITPPEKLNIAAIDTYDDHRMAMTFSLA  477

Query  292  ACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            ACAEVPVTI DPGCTRKTFPDYF+VLQKF+K+
Sbjct  478  ACAEVPVTINDPGCTRKTFPDYFDVLQKFAKY  509


 Score =   134 bits (337),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLMER GVSVEH+DSWDRF I+GGQKYKSPG AFVEGDASSASYFLAGAA++GGTVTVE
Sbjct  278  IKLMERFGVSVEHTDSWDRFFIKGGQKYKSPGKAFVEGDASSASYFLAGAAISGGTVTVE  337

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMGA+V
Sbjct  338  GCGTASLQGDVKFAEVLEKMGAKV  361



>gb|AEK22121.1| 5-enolpyruvylshikimate-3-phosphate synthase precursor [Capsicum 
annuum]
Length=516

 Score =   290 bits (742),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SG KHLRAIDVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  366  GADVTWTENSVTVKGPPRNSSGMKHLRAIDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  425

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATV EG DYCIITPPE+LN+TEIDTYDDHRMAMAFSLAA
Sbjct  426  SWRVKETERMIAICTELRKLGATVVEGSDYCIITPPEKLNITEIDTYDDHRMAMAFSLAA  485

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFP+YF+VLQ++SKH
Sbjct  486  CADVPVTIKDPGCTRKTFPNYFDVLQQYSKH  516


 Score =   127 bits (319),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV VEH+ SW+RF ++GGQKYKSPG A+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  286  LKLMERFGVFVEHTSSWNRFFVKGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTVTVE  345

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  346  GCGTSSLQGDVKFAEVLEKMGADV  369



>gb|ACV53021.1| 5-enolpyruvylshikimate-3-phosphate synthase [Amaranthus palmeri]
Length=518

 Score =   285 bits (728),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + +WTENSVTV GPPR  SGRKHLRAIDVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  368  GCKVTWTENSVTVTGPPRDSSGRKHLRAIDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  427

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPPE+LN T I+TYDDHRMAMAFSLAA
Sbjct  428  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPEKLNPTAIETYDDHRMAMAFSLAA  487

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI DPGCTRKTFPDYF+VL+KF+KH
Sbjct  488  CADVPVTILDPGCTRKTFPDYFDVLEKFAKH  518


 Score =   132 bits (333),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLMER GVSVEHSDSWDRF IRGGQKYKSPG A+VEGDASSASYFLAGAAVTGGTVTV+
Sbjct  288  IKLMERFGVSVEHSDSWDRFYIRGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTVTVK  347

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMG +V
Sbjct  348  GCGTSSLQGDVKFAEVLEKMGCKV  371



>gb|AGE94064.1| 5-enolpyruvylshikimate-3-phosphate synthase, partial [Amaranthus 
palmeri]
Length=510

 Score =   285 bits (728),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + +WTENSVTV GPPR  SGRKHLRAIDVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  360  GCKVTWTENSVTVTGPPRNSSGRKHLRAIDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  419

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPPE+LN T I+TYDDHRMAMAFSLAA
Sbjct  420  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPEKLNPTAIETYDDHRMAMAFSLAA  479

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI DPGCTRKTFPDYF+VL+KF+KH
Sbjct  480  CADVPVTILDPGCTRKTFPDYFDVLEKFAKH  510


 Score =   132 bits (332),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLMER GVSVEHSDSWDRF IRGGQKYKSPG A+VEGDASSASYFLAGAAVTGGTVTV+
Sbjct  280  IKLMERFGVSVEHSDSWDRFYIRGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTVTVK  339

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMG +V
Sbjct  340  GCGTSSLQGDVKFAEVLEKMGCKV  363



>ref|XP_004506537.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic-like 
[Cicer arietinum]
Length=525

 Score =   281 bits (719),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVT+ GPPR  SGRK L+ IDVNMNKMPDVAMTLAVVALFA+GPT IRDVA
Sbjct  375  GAKVTWTENSVTLTGPPRDSSGRKVLQGIDVNMNKMPDVAMTLAVVALFANGPTTIRDVA  434

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPPE+LN+T IDTYDDHRMAMAFSLAA
Sbjct  435  SWRVKETERMIAICTELRKLGATVEEGTDYCVITPPEKLNITSIDTYDDHRMAMAFSLAA  494

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C +VPVTIKDPGCTRKTFPDYFEVL++F+KH
Sbjct  495  CGDVPVTIKDPGCTRKTFPDYFEVLERFTKH  525


 Score =   135 bits (340),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEHSD+WDRFL+ GGQKYKSPGNAFVEGDASSASYFLAGAAVTGGT+TV 
Sbjct  295  LKLMERFGVSVEHSDNWDRFLVHGGQKYKSPGNAFVEGDASSASYFLAGAAVTGGTITVI  354

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  355  GCGTSSLQGDVKFAEVLEKMGAKV  378



>gb|AFY09699.1| chloroplast 5-enolpyruvylshikimate 3-phosphate synthase [Hevea 
brasiliensis]
Length=523

 Score =   283 bits (725),  Expect(2) = 5e-107, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVTV GPPR    +KHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  373  GAKVTWTENSVTVTGPPRNSPSKKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  432

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGA VEEG DYC+ITPPE+L V EIDTYDDHRMAMAFSLAA
Sbjct  433  SWRVKETERMIAICTELRKLGANVEEGQDYCVITPPEKLKVAEIDTYDDHRMAMAFSLAA  492

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C +VPVTIKDPGCTRKTFPDYFEVL++F+KH
Sbjct  493  CGDVPVTIKDPGCTRKTFPDYFEVLERFTKH  523


 Score =   133 bits (334),  Expect(2) = 5e-107, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV++EHS SWDRF +RGGQKYKSPGN+FVEGDASSASYFLAGAA+TGGT+TVE
Sbjct  293  LKLMERYGVTIEHSGSWDRFFVRGGQKYKSPGNSFVEGDASSASYFLAGAAITGGTITVE  352

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVL+KMGA+V
Sbjct  353  GCGTSSLQGDVKFAEVLDKMGAKV  376



>ref|XP_008438175.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2 [Cucumis 
melo]
Length=526

 Score =   281 bits (718),  Expect(2) = 5e-107, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVTV GPPR     KHL+AIDVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  376  GAKVTWTENSVTVTGPPRDSPTSKHLKAIDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  435

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYCII PPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  436  SWRVKETERMIAICTELRKLGATVEEGPDYCIIAPPEKLNVTAIDTYDDHRMAMAFSLAA  495

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C +VPVTIKDPGCTRKTFPDYFEVLQ+F K+
Sbjct  496  CQDVPVTIKDPGCTRKTFPDYFEVLQQFVKN  526


 Score =   135 bits (340),  Expect(2) = 5e-107, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV VEH+DSWDRFL+RGGQKYKSPG+A+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  296  LKLMERFGVHVEHNDSWDRFLVRGGQKYKSPGHAYVEGDASSASYFLAGAAVTGGTVTVE  355

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  356  GCGTSSLQGDVKFAEVLEKMGAKV  379



>gb|ACV53022.1| 5-enolpyruvylshikimate-3-phosphate synthase [Amaranthus palmeri]
 gb|AGH20187.1| 5-enolpyruvylshikimate-3-phosphate synthase [Amaranthus palmeri]
Length=518

 Score =   283 bits (725),  Expect(2) = 5e-107, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + +WTENSVTV GPPR  SG+KHLRAIDVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  368  GCKVTWTENSVTVTGPPRDSSGKKHLRAIDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  427

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPPE+LN T I+TYDDHRMAMAFSLAA
Sbjct  428  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPEKLNPTAIETYDDHRMAMAFSLAA  487

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI DPGCTRKTFPDYF+VL+KF+KH
Sbjct  488  CADVPVTILDPGCTRKTFPDYFDVLEKFAKH  518


 Score =   132 bits (333),  Expect(2) = 5e-107, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLMER GVSVEHSDSWDRF IRGGQKYKSPG A+VEGDASSASYFLAGAAVTGGTVTV+
Sbjct  288  IKLMERFGVSVEHSDSWDRFYIRGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTVTVK  347

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMG +V
Sbjct  348  GCGTSSLQGDVKFAEVLEKMGCKV  371



>gb|AGE94065.1| 5-enolpyruvylshikimate-3-phosphate synthase, partial [Amaranthus 
palmeri]
 gb|AGE94066.1| 5-enolpyruvylshikimate-3-phosphate synthase, partial [Amaranthus 
palmeri]
Length=510

 Score =   285 bits (728),  Expect(2) = 6e-107, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + +WTENSVTV GPPR  SGRKHLRAIDVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  360  GCKVTWTENSVTVTGPPRNSSGRKHLRAIDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  419

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPPE+LN T I+TYDDHRMAMAFSLAA
Sbjct  420  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPEKLNPTAIETYDDHRMAMAFSLAA  479

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI DPGCTRKTFPDYF+VL+KF+KH
Sbjct  480  CADVPVTILDPGCTRKTFPDYFDVLEKFAKH  510


 Score =   131 bits (330),  Expect(2) = 6e-107, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            ++LMER GVSVEHSDSWDRF IRGGQKYKSPG A+VEGDASSASYFLAGAAVTGGTVTV+
Sbjct  280  IRLMERFGVSVEHSDSWDRFYIRGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTVTVK  339

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMG +V
Sbjct  340  GCGTSSLQGDVKFAEVLEKMGCKV  363



>ref|XP_003605139.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Medicago truncatula]
 gb|AES87336.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Medicago truncatula]
Length=522

 Score =   286 bits (732),  Expect(2) = 7e-107, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVTV GPPR  SGRK L+ IDVNMNKMPDVAMTLAVVAL+A+GPTAIRDVA
Sbjct  372  GAKVTWTENSVTVTGPPRDSSGRKVLQGIDVNMNKMPDVAMTLAVVALYANGPTAIRDVA  431

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  432  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTSIDTYDDHRMAMAFSLAA  491

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C +VPVTIKDPGCTRKTFPDYF+VL++F+KH
Sbjct  492  CGDVPVTIKDPGCTRKTFPDYFQVLERFTKH  522


 Score =   129 bits (325),  Expect(2) = 7e-107, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV VEHS +WDRFL+ GGQKYKSPGNAFVEGDASSASYFLAGAAVTGGT+TV 
Sbjct  292  LKLMERFGVFVEHSANWDRFLVHGGQKYKSPGNAFVEGDASSASYFLAGAAVTGGTITVI  351

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  352  GCGTSSLQGDVKFAEVLEKMGAKV  375



>gb|KDO85802.1| hypothetical protein CISIN_1g010070mg [Citrus sinensis]
Length=519

 Score =   281 bits (718),  Expect(2) = 8e-107, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVTV GPPR P GRKHLRA+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  369  GAKVTWTENSVTVTGPPRDPYGRKHLRAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  428

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+L V  IDTYDDHRMAMAFSLAA
Sbjct  429  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLKVAAIDTYDDHRMAMAFSLAA  488

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDP CTRKTFPDYF+VL   +K 
Sbjct  489  CADVPVTIKDPSCTRKTFPDYFDVLDSVTKR  519


 Score =   134 bits (338),  Expect(2) = 8e-107, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV VEHSDSWDRF I+GGQKYKSPGNAFVEGDASSASYF+AGAAVTGGTVTVE
Sbjct  289  LKLMERFGVFVEHSDSWDRFFIQGGQKYKSPGNAFVEGDASSASYFVAGAAVTGGTVTVE  348

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  349  GCGTSSLQGDVKFAEVLEKMGAKV  372



>gb|ACV67277.1| 5-enolpyruvylshikimate-3-phosphate synthase [Amaranthus tuberculatus]
Length=518

 Score =   284 bits (726),  Expect(2) = 9e-107, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G   +WTENSVTV GPPR  SGRKHLRAIDVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  368  GCTVTWTENSVTVTGPPRESSGRKHLRAIDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  427

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPPE+LN T I+TYDDHRMAMAFSLAA
Sbjct  428  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPEKLNPTAIETYDDHRMAMAFSLAA  487

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI DPGCTRKTFPDYF+VL+KF+KH
Sbjct  488  CADVPVTILDPGCTRKTFPDYFDVLEKFAKH  518


 Score =   131 bits (330),  Expect(2) = 9e-107, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            ++LMER GVSVEHSDSWDRF IRGGQKYKSPG A+VEGDASSASYFLAGAAVTGGTVTV+
Sbjct  288  IRLMERFGVSVEHSDSWDRFFIRGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTVTVK  347

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMG  V
Sbjct  348  GCGTSSLQGDVKFAEVLEKMGCTV  371



>ref|XP_003517039.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic-like 
[Glycine max]
 gb|KHN25559.1| 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic [Glycine 
soja]
Length=525

 Score =   285 bits (728),  Expect(2) = 9e-107, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +W+ENSVTV GPPR  SGRK LR IDVNMNKMPDVAMTLAVVALFA+GPTAIRDVA
Sbjct  375  GAKVTWSENSVTVSGPPRDFSGRKVLRGIDVNMNKMPDVAMTLAVVALFANGPTAIRDVA  434

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  435  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  494

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C +VPVTIKDPGCTRKTFPDYFEVL++ +KH
Sbjct  495  CGDVPVTIKDPGCTRKTFPDYFEVLERLTKH  525


 Score =   130 bits (328),  Expect(2) = 9e-107, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEHS +WDRFL+ GGQKYKSPGNAFVEGDASSASY LAGAA+TGGT+TV 
Sbjct  295  LKLMERFGVSVEHSGNWDRFLVHGGQKYKSPGNAFVEGDASSASYLLAGAAITGGTITVN  354

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  355  GCGTSSLQGDVKFAEVLEKMGAKV  378



>ref|XP_004133920.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 1, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004155786.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 1, chloroplastic-like 
[Cucumis sativus]
 gb|KGN56608.1| hypothetical protein Csa_3G126230 [Cucumis sativus]
Length=526

 Score =   280 bits (717),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WT+NSVTV GPPR     KHL+AIDVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  376  GAKVTWTDNSVTVTGPPRDSPRSKHLKAIDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  435

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  436  SWRVKETERMIAICTELRKLGATVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  495

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C +VPVTIKDPGCTRKTFPDYFEVLQ+F K+
Sbjct  496  CQDVPVTIKDPGCTRKTFPDYFEVLQQFVKN  526


 Score =   135 bits (339),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV VEH+DSWDRFL+RGGQKYKSPG+A+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  296  LKLMERFGVYVEHNDSWDRFLVRGGQKYKSPGHAYVEGDASSASYFLAGAAVTGGTVTVE  355

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  356  GCGTSSLQGDVKFAEVLEKMGAKV  379



>gb|AAN77867.1| 5-enolpyruvylshikimate-3-phosphate synthase [Vitis vinifera]
Length=330

 Score =   288 bits (736),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ SWTENSVTV GPP+  SGRKHLRAIDVNMNKMPDVAMTLAVVAL+A+GPTAIRDVA
Sbjct  180  GAKVSWTENSVTVTGPPQDSSGRKHLRAIDVNMNKMPDVAMTLAVVALYAEGPTAIRDVA  239

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  240  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTSIDTYDDHRMAMAFSLAA  299

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGC RKT PDYFEVLQ+F+KH
Sbjct  300  CADVPVTIKDPGCIRKTSPDYFEVLQRFTKH  330


 Score =   127 bits (318),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 79/84 (94%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEHS++WDRFLIRGGQKYKSPGNAFVEGDASSASYFLAGAAVTGGTVTVE
Sbjct  101  LKLMERFGVSVEHSNTWDRFLIRGGQKYKSPGNAFVEGDASSASYFLAGAAVTGGTVTVE  160

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKF E L  MGA+V
Sbjct  161  GCGTSSLQGDVKFVEFLS-MGAKV  183



>emb|CDO97700.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   285 bits (729),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSV VKGP R  S  KHLRAID+NMNKMPDVAMTLAVVALFADG TAIRDVA
Sbjct  316  GAEVTWTENSVIVKGPRRDSSRGKHLRAIDINMNKMPDVAMTLAVVALFADGSTAIRDVA  375

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  376  SWRVKETERMIAICTELRKLGATVEEGPDYCIITPPEKLNVTSIDTYDDHRMAMAFSLAA  435

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYF+VL+KFSKH
Sbjct  436  CADVPVTIKDPGCTRKTFPDYFDVLEKFSKH  466


 Score =   129 bits (325),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV+VEHS SWDRFL+ GGQKYKSPG A+VEGDASSASYFLAGAAVTGGT+TVE
Sbjct  236  LKLMERFGVTVEHSGSWDRFLVHGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTITVE  295

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT SLQGDVKFAEVLE+MGAEV
Sbjct  296  GCGTGSLQGDVKFAEVLEQMGAEV  319



>ref|XP_006445276.1| hypothetical protein CICLE_v10019734mg [Citrus clementina]
 ref|XP_006490910.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic-like 
[Citrus sinensis]
 gb|ESR58516.1| hypothetical protein CICLE_v10019734mg [Citrus clementina]
Length=519

 Score =   281 bits (718),  Expect(2) = 3e-106, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVTV GPPR P GRKHLRA+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  369  GAKVTWTENSVTVTGPPRDPYGRKHLRAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  428

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+L V  IDTYDDHRMAMAFSLAA
Sbjct  429  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLKVAAIDTYDDHRMAMAFSLAA  488

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDP CTRKTFPDYF+VL   +K 
Sbjct  489  CADVPVTIKDPSCTRKTFPDYFDVLDSVTKR  519


 Score =   133 bits (334),  Expect(2) = 3e-106, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV VEH DSWDRF I+GGQKYKSPGNAFVEGDASSASYF+AGAAVTGGTVTVE
Sbjct  289  LKLMERFGVFVEHGDSWDRFFIQGGQKYKSPGNAFVEGDASSASYFVAGAAVTGGTVTVE  348

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  349  GCGTSSLQGDVKFAEVLEKMGAKV  372



>ref|XP_009418331.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2-like 
[Musa acuminata subsp. malaccensis]
Length=518

 Score =   287 bits (735),  Expect(2) = 3e-106, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ SWTENSVTV GPP+ PS +KHL  IDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  368  GAKVSWTENSVTVTGPPQDPSKKKHLHGIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  427

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  428  SWRVKETERMIAICTELRKLGATVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  487

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFPDYF+VL++F+K+
Sbjct  488  CADVPVTIRDPGCTRKTFPDYFDVLERFTKN  518


 Score =   126 bits (317),  Expect(2) = 3e-106, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV VEH+D+WD+F I+G QKY SPG+A+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  288  LKLMERFGVKVEHTDNWDKFFIKGAQKYTSPGSAYVEGDASSASYFLAGAAVTGGTVTVE  347

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMGA+V
Sbjct  348  GCGTTSLQGDVKFAEVLEKMGAKV  371



>ref|XP_006857822.1| hypothetical protein AMTR_s00069p00028020 [Amborella trichopoda]
 gb|ERN19289.1| hypothetical protein AMTR_s00069p00028020 [Amborella trichopoda]
Length=518

 Score =   280 bits (715),  Expect(2) = 4e-106, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ SWTEN+VTV GPP  PS +K LR IDVNMNKMPDVAMTLAVVAL+ADGPTAIRDV 
Sbjct  368  GAKVSWTENTVTVTGPPMDPSKKKRLRGIDVNMNKMPDVAMTLAVVALYADGPTAIRDVG  427

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKETERMIA+CTELRKLGATVEEG DYCIITPPERLNVT IDTYDDHRMAMAFSLAA
Sbjct  428  TWRVKETERMIAICTELRKLGATVEEGSDYCIITPPERLNVTAIDTYDDHRMAMAFSLAA  487

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFPDYFEVLQ+F K 
Sbjct  488  CADVPVTIRDPGCTRKTFPDYFEVLQRFVKR  518


 Score =   134 bits (336),  Expect(2) = 4e-106, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV+VEHS SWDRFLIRGGQ YKSPGNA+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  288  LKLMERFGVTVEHSGSWDRFLIRGGQLYKSPGNAYVEGDASSASYFLAGAAVTGGTVTVE  347

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDV+FAEVLEKMGA+V
Sbjct  348  GCGTSSLQGDVRFAEVLEKMGAKV  371



>gb|ACV67278.1| 5-enolpyruvylshikimate-3-phosphate synthase [Amaranthus tuberculatus]
Length=518

 Score =   281 bits (720),  Expect(2) = 4e-106, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + +WTENSVTV GPPR  SGRKHLRAIDVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  368  GCKVTWTENSVTVTGPPRESSGRKHLRAIDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  427

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPPE+L  T I+TYDDHRMAMAFSLAA
Sbjct  428  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPEKLIPTAIETYDDHRMAMAFSLAA  487

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI DPGCTRKTFPDYF+VL+KF+KH
Sbjct  488  CADVPVTILDPGCTRKTFPDYFDVLEKFAKH  518


 Score =   132 bits (331),  Expect(2) = 4e-106, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            ++LMER GVSVEHSDSWDRF IRGGQKYKSPG A+VEGDASSASYFLAGAAVTGGTVTV+
Sbjct  288  IRLMERFGVSVEHSDSWDRFFIRGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTVTVK  347

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMG +V
Sbjct  348  GCGTSSLQGDVKFAEVLEKMGCKV  371



>gb|AAT45245.1| 5-enol-pyruvylshikimate-phosphate synthase [Conyza canadensis]
Length=454

 Score =   286 bits (733),  Expect(2) = 5e-106, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SGR HLR +DVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  304  GAEVTWTENSVTVKGPPRNSSGRGHLRPVDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  363

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ TPPE+LNVT IDTYDDHRMAM FSLAA
Sbjct  364  SWRVKETERMIAICTELRKLGATVEEGPDYCVTTPPEKLNVTAIDTYDDHRMAMTFSLAA  423

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRK+FPDYFEVL++++KH
Sbjct  424  CADVPVTIKDPGCTRKSFPDYFEVLERYTKH  454


 Score =   126 bits (317),  Expect(2) = 5e-106, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLM+R GVSVEHSD+ DRF +RGGQKYKSPGNA+VE DASSASYFLAGAA+TGGTVTVE
Sbjct  224  LKLMQRFGVSVEHSDTLDRFHVRGGQKYKSPGNAYVESDASSASYFLAGAAITGGTVTVE  283

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVL +MGAEV
Sbjct  284  GCGTSSLQGDVKFAEVLGQMGAEV  307



>gb|KDO85805.1| hypothetical protein CISIN_1g010070mg [Citrus sinensis]
Length=474

 Score =   279 bits (713),  Expect(2) = 5e-106, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVTV GPPR P GRKHLRA+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  324  GAKVTWTENSVTVTGPPRDPYGRKHLRAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  383

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+L V  IDTYDDHRMAMAFSLAA
Sbjct  384  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLKVAAIDTYDDHRMAMAFSLAA  443

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSK  200
            CA+VPVTIKDP CTRKTFPDYF+VL   +K
Sbjct  444  CADVPVTIKDPSCTRKTFPDYFDVLDSVTK  473


 Score =   134 bits (337),  Expect(2) = 5e-106, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV VEHSDSWDRF I+GGQKYKSPGNAFVEGDASSASYF+AGAAVTGGTVTVE
Sbjct  244  LKLMERFGVFVEHSDSWDRFFIQGGQKYKSPGNAFVEGDASSASYFVAGAAVTGGTVTVE  303

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  304  GCGTSSLQGDVKFAEVLEKMGAKV  327



>gb|ABE77393.4| EPSP synthase [Allium macrostemon]
Length=522

 Score =   282 bits (721),  Expect(2) = 8e-106, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVTV GPP+ P  +K L+A+DVNMNKMPDVAMTLAVVAL+ADGPT IRDVA
Sbjct  372  GAKVTWTENSVTVTGPPQDPQKKKRLKAVDVNMNKMPDVAMTLAVVALYADGPTTIRDVA  431

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATV EGPDYCIITPPE+LNVTEIDTYDDHRMAMAFSLAA
Sbjct  432  SWRVKETERMIAICTELRKLGATVVEGPDYCIITPPEKLNVTEIDTYDDHRMAMAFSLAA  491

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C++VPVTIKDPGCTRKTFPDYFEVL++++KH
Sbjct  492  CSDVPVTIKDPGCTRKTFPDYFEVLERYAKH  522


 Score =   130 bits (326),  Expect(2) = 8e-106, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV V+HS +WDRF I+GGQKYKSPGNA+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  292  LKLMERFGVHVDHSSTWDRFFIKGGQKYKSPGNAYVEGDASSASYFLAGAAVTGGTVTVE  351

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLE MGA+V
Sbjct  352  GCGTSSLQGDVKFAEVLENMGAKV  375



>gb|AAY40475.1| 5-enol-pyruvylshikimate-phosphate synthase, partial [Conyza sumatrensis]
Length=446

 Score =   285 bits (730),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SGR HLR +DVNMNKMPDVAMTLAVVAL+ADG TAIRDVA
Sbjct  296  GAEVTWTENSVTVKGPPRNSSGRGHLRPVDVNMNKMPDVAMTLAVVALYADGRTAIRDVA  355

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAM FSLAA
Sbjct  356  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTAIDTYDDHRMAMTFSLAA  415

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRK+FPDYFEVL++++KH
Sbjct  416  CADVPVTIKDPGCTRKSFPDYFEVLERYTKH  446


 Score =   126 bits (316),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLM++ GVSVEHSD+ DRF +RGGQKYKSPGNA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  216  LKLMKQFGVSVEHSDTLDRFHVRGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVE  275

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVL +MGAEV
Sbjct  276  GCGTSSLQGDVKFAEVLGQMGAEV  299



>gb|AHF20162.1| 5-enolpyruvylshikimate-3-phosphate synthase, partial [Musa acuminata 
AAA Group]
Length=514

 Score =   286 bits (733),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -1

Query  658  REDGSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIR  479
            ++ G++ SWTENSVTV GPP+ PS +KHL  IDVNMNKMPDVAMTLAVVALFADGPTAIR
Sbjct  361  KKMGAKVSWTENSVTVTGPPQDPSKKKHLHGIDVNMNKMPDVAMTLAVVALFADGPTAIR  420

Query  478  DVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFS  299
            DVASWRVKETERMIA+CTELRKLGATVEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFS
Sbjct  421  DVASWRVKETERMIAICTELRKLGATVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFS  480

Query  298  LAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            LAACA+VPVTI+DPGCTRKTFPDYF+VL+ F+K+
Sbjct  481  LAACADVPVTIRDPGCTRKTFPDYFDVLETFTKN  514


 Score =   125 bits (313),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV VEH+D+WD+F I+G QKY SPG+A+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  284  LKLMERFGVKVEHTDNWDKFFIKGAQKYTSPGSAYVEGDASSASYFLAGAAVTGGTVTVE  343

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVL+KMGA+V
Sbjct  344  GCGTTSLQGDVKFAEVLKKMGAKV  367



>gb|AAZ79230.2| plastid 5-enolpyruvylshikimate 3-phosphate synthase [Lolium multiflorum]
Length=437

 Score =   281 bits (718),  Expect(2) = 3e-105, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WT+ SVTV GPPR P GRKHL+A+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  287  GAKVTWTDTSVTVTGPPRQPFGRKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  346

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+CTEL KLGATVEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  347  SWRVKETERMVAICTELTKLGATVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  406

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTI+DPGCTRKTFP+YF+VL  F K+
Sbjct  407  CAEVPVTIRDPGCTRKTFPNYFDVLSTFVKN  437


 Score =   130 bits (326),  Expect(2) = 3e-105, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV+ EHSDSWDRF I+GGQKYKSPGNA+VEGDASSASYFLAGAA+TGGTVTV+
Sbjct  207  LRLMERFGVTAEHSDSWDRFYIKGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVQ  266

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  267  GCGTTSLQGDVKFAEVLEMMGAKV  290



>ref|NP_182055.1| 3-phosphoshikimate 1-carboxyvinyltransferase / 5-enolpyruvylshikimate-3-phosphate 
/ EPSP synthase  [Arabidopsis thaliana]
 sp|P05466.3|AROA_ARATH RecName: Full=3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic; 
AltName: Full=5-enolpyruvylshikimate-3-phosphate 
synthase; Short=EPSP synthase; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAB82633.1| 5-enolpyruvylshikimate-3-phosphate (EPSP) synthase [Arabidopsis 
thaliana]
 gb|AAY25438.1| At2g45300 [Arabidopsis thaliana]
 dbj|BAE99170.1| 5-enolpyruvylshikimate-3-phosphate (EPSP) synthase [Arabidopsis 
thaliana]
 gb|AEC10536.1| 3-phosphoshikimate 1-carboxyvinyltransferase / 5-enolpyruvylshikimate-3-phosphate 
/ EPSP synthase [Arabidopsis thaliana]
Length=520

 Score =   275 bits (702),  Expect(2) = 3e-105, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GPPR   G +HLRAIDVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  370  GCKVSWTENSVTVTGPPRDAFGMRHLRAIDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  429

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP+++   EIDTYDDHRMAMAFSLAA
Sbjct  430  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPKKVKTAEIDTYDDHRMAMAFSLAA  489

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VP+TI DPGCTRKTFPDYF+VL++ +KH
Sbjct  490  CADVPITINDPGCTRKTFPDYFQVLERITKH  520


 Score =   135 bits (341),  Expect(2) = 3e-105, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEHSDSWDRF ++GGQKYKSPGNA+VEGDASSASYFLAGAA+TG TVTVE
Sbjct  290  LKLMERFGVSVEHSDSWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE  349

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMG +V
Sbjct  350  GCGTTSLQGDVKFAEVLEKMGCKV  373



>ref|XP_010506470.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic 
isoform X2 [Camelina sativa]
Length=521

 Score =   276 bits (705),  Expect(2) = 5e-105, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GPPR   G +HLRAIDVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  371  GCKVSWTENSVTVTGPPRDAFGMRHLRAIDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  430

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP+++   EIDTYDDHRMAMAFSLAA
Sbjct  431  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPKKVKPAEIDTYDDHRMAMAFSLAA  490

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFPDYFEVL++ +KH
Sbjct  491  CADVPVTIRDPGCTRKTFPDYFEVLERITKH  521


 Score =   134 bits (336),  Expect(2) = 5e-105, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVS EHSDSWDRF ++GGQKYKSPGNA+VEGDASSASYFLAGAA+TG TVTVE
Sbjct  291  LKLMERFGVSAEHSDSWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE  350

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMG +V
Sbjct  351  GCGTTSLQGDVKFAEVLEKMGCKV  374



>gb|KHN35635.1| 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic [Glycine 
soja]
Length=526

 Score =   278 bits (711),  Expect(2) = 5e-105, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +W+ENSVTV GPP+  SG+K L+ IDVNMNKMPDVAMTLAVVALFA+G T IRDVA
Sbjct  376  GAKVTWSENSVTVTGPPQDSSGQKVLQGIDVNMNKMPDVAMTLAVVALFANGQTTIRDVA  435

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  436  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  495

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C +VPVTIKDPGCTRKTFPDYFEVL++F+KH
Sbjct  496  CGDVPVTIKDPGCTRKTFPDYFEVLERFTKH  526


 Score =   131 bits (330),  Expect(2) = 5e-105, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEHS +WD+FL+ GGQKYKSPGNAFVEGDASSASYFLAGAAVTGGT+TV 
Sbjct  296  LKLMERFGVSVEHSGNWDKFLVHGGQKYKSPGNAFVEGDASSASYFLAGAAVTGGTITVN  355

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  356  GCGTSSLQGDVKFAEVLEKMGAKV  379



>ref|XP_003521857.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic-like 
[Glycine max]
Length=526

 Score =   278 bits (712),  Expect(2) = 9e-105, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +W+ENSVTV GPP+  SG+K L+ IDVNMNKMPDVAMTLAVVALFA+G TAIRDVA
Sbjct  376  GAKVTWSENSVTVTGPPQDSSGQKVLQGIDVNMNKMPDVAMTLAVVALFANGQTAIRDVA  435

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  436  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  495

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C +VPVTIKDPGCTRKTFPDYFEVL++F++H
Sbjct  496  CGDVPVTIKDPGCTRKTFPDYFEVLERFTRH  526


 Score =   130 bits (327),  Expect(2) = 9e-105, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEHS +WD+FL+ GGQKYKSPGNAFVEGDASSASYFLAGAAVTGGT+TV 
Sbjct  296  LKLMERFGVSVEHSGNWDKFLVHGGQKYKSPGNAFVEGDASSASYFLAGAAVTGGTITVN  355

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMGA+V
Sbjct  356  GCGTNSLQGDVKFAEVLEKMGAKV  379



>ref|XP_007134860.1| hypothetical protein PHAVU_010G082200g [Phaseolus vulgaris]
 gb|ESW06854.1| hypothetical protein PHAVU_010G082200g [Phaseolus vulgaris]
Length=525

 Score =   277 bits (709),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVTV GPPR  S RK L+ IDVNMNKMPDVAMTLAVVALFA+G T IRDVA
Sbjct  375  GAKVTWTENSVTVTGPPRDSSDRKVLQGIDVNMNKMPDVAMTLAVVALFANGSTTIRDVA  434

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGA VEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  435  SWRVKETERMIAICTELRKLGAAVEEGPDYCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  494

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C +VPVTIKDPGCTRKTFPDYFEVL++F+KH
Sbjct  495  CGDVPVTIKDPGCTRKTFPDYFEVLERFTKH  525


 Score =   131 bits (329),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV VEHS +WD+FL+ GGQKYKSPGNAFVEGDASSASYFLAGAAVTGGT+TVE
Sbjct  295  LKLMERFGVYVEHSGNWDKFLVHGGQKYKSPGNAFVEGDASSASYFLAGAAVTGGTMTVE  354

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  355  GCGTSSLQGDVKFAEVLEKMGAKV  378



>ref|XP_010544647.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic 
[Tarenaya hassleriana]
Length=521

 Score =   275 bits (702),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVTV GPPR   G +HLR +DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  371  GAKVTWTENSVTVTGPPRDAFGMRHLRGVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  430

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+L   EIDTYDDHRMAMAFSLAA
Sbjct  431  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLKPAEIDTYDDHRMAMAFSLAA  490

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSK  200
            CA+VPVTI+DPGCTRKTFPDYF+VL++ +K
Sbjct  491  CADVPVTIRDPGCTRKTFPDYFQVLERVTK  520


 Score =   133 bits (334),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV  EHSDSWDRF ++GGQKYKSPGNA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  291  LKLMERFGVHAEHSDSWDRFYVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVE  350

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  351  GCGTSSLQGDVKFAEVLEKMGAKV  374



>ref|XP_010518145.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic-like 
[Camelina sativa]
Length=521

 Score =   275 bits (702),  Expect(2) = 3e-104, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GPPR   G +HL AIDVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  371  GCKVSWTENSVTVTGPPRDAFGMRHLSAIDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  430

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP++L   EIDTYDDHRMAMAFSLAA
Sbjct  431  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPKKLKPAEIDTYDDHRMAMAFSLAA  490

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYF+VL++ +KH
Sbjct  491  CADVPVTIKDPGCTRKTFPDYFQVLERITKH  521


 Score =   132 bits (332),  Expect(2) = 3e-104, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVS EHSDSWDRF ++GGQKYKSPGNA+VEGDASSASYFLAGAA+TG TVTV+
Sbjct  291  LKLMERFGVSAEHSDSWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVK  350

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMG +V
Sbjct  351  GCGTTSLQGDVKFAEVLEKMGCKV  374



>ref|XP_002894141.1| hypothetical protein ARALYDRAFT_474025 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70400.1| hypothetical protein ARALYDRAFT_474025 [Arabidopsis lyrata subsp. 
lyrata]
Length=523

 Score =   273 bits (698),  Expect(2) = 3e-104, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GP R   G +HLRAIDVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  373  GCKVSWTENSVTVTGPSRDAFGMRHLRAIDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  432

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP+++  TEIDTYDDHRMAMAFSLAA
Sbjct  433  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPKKVKPTEIDTYDDHRMAMAFSLAA  492

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VP+TI DPGCTRKTFPDYF+VL++ +KH
Sbjct  493  CADVPITINDPGCTRKTFPDYFQVLERITKH  523


 Score =   134 bits (336),  Expect(2) = 3e-104, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVS EHSDSWDRF ++GGQKYKSPGNA+VEGDASSASYFLAGAA+TG TVTVE
Sbjct  293  LKLMERFGVSAEHSDSWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE  352

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMG +V
Sbjct  353  GCGTTSLQGDVKFAEVLEKMGCKV  376



>ref|XP_002880170.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH56429.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Arabidopsis lyrata 
subsp. lyrata]
Length=516

 Score =   272 bits (696),  Expect(2) = 5e-104, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GPPR   G +HLRAIDVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  366  GCKVSWTENSVTVTGPPRDAFGMRHLRAIDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  425

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP+++   EIDTYDDHRMAMAFSLAA
Sbjct  426  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPKKVKPAEIDTYDDHRMAMAFSLAA  485

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VP+TI DPGCTRKTFPDYF+VL++ +KH
Sbjct  486  CADVPITINDPGCTRKTFPDYFQVLERITKH  516


 Score =   134 bits (336),  Expect(2) = 5e-104, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVS EHSDSWDRF ++GGQKYKSPGNA+VEGDASSASYFLAGAA+TG TVTVE
Sbjct  286  LKLMERFGVSTEHSDSWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE  345

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMG +V
Sbjct  346  GCGTTSLQGDVKFAEVLEKMGCKV  369



>gb|ACH72672.1| 5-enolpyruvylshikimate 3-phosphate synthase [Triticum aestivum]
Length=510

 Score =   274 bits (701),  Expect(2) = 5e-104, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WT+ SVTV GPPR P GRKHL+A+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  360  GAKVTWTDTSVTVTGPPRQPFGRKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  419

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGATVEEGPDYCIITPPE+LN+T IDTYDDHRMAMAFSLAA
Sbjct  420  SWRVKETERMVAIRTELTKLGATVEEGPDYCIITPPEKLNITAIDTYDDHRMAMAFSLAA  479

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTI+DPGCTRKTFP+YF+VL  F K+
Sbjct  480  CAEVPVTIRDPGCTRKTFPNYFDVLSTFVKN  510


 Score =   132 bits (331),  Expect(2) = 5e-104, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV+ EHSDSWDRF I+GGQKYKSPGNA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  280  LKLMERFGVTAEHSDSWDRFYIKGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVE  339

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  340  GCGTTSLQGDVKFAEVLEMMGAKV  363



>ref|XP_010508182.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic-like 
[Camelina sativa]
Length=523

 Score =   273 bits (699),  Expect(2) = 6e-104, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GPPR   G +HL AIDVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  373  GCKVSWTENSVTVTGPPRDAFGMRHLSAIDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  432

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP++L   EIDTYDDHRMAMAFSLAA
Sbjct  433  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPKKLKPAEIDTYDDHRMAMAFSLAA  492

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFPDYF+VL++ +KH
Sbjct  493  CADVPVTIRDPGCTRKTFPDYFQVLERITKH  523


 Score =   132 bits (333),  Expect(2) = 6e-104, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVS EHSDSWDRF ++GGQKYKSPGN++VEGDASSASYFLAGAA+TG TVTVE
Sbjct  293  LKLMERFGVSAEHSDSWDRFFVKGGQKYKSPGNSYVEGDASSASYFLAGAAITGETVTVE  352

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMG +V
Sbjct  353  GCGTTSLQGDVKFAEVLEKMGCKV  376



>emb|CDY68487.1| BnaAnng27440D [Brassica napus]
Length=521

 Score =   272 bits (695),  Expect(2) = 7e-104, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GP R   G +HLRA+DVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  371  GCKVSWTENSVTVTGPSRDAFGMRHLRAVDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  430

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP +L   EIDTYDDHRMAMAFSLAA
Sbjct  431  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPAKLKPAEIDTYDDHRMAMAFSLAA  490

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYF+VL+  +KH
Sbjct  491  CADVPVTIKDPGCTRKTFPDYFQVLESITKH  521


 Score =   134 bits (336),  Expect(2) = 7e-104, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVS EHSDSWDRF ++GGQKYKSPGNA+VEGDASSASYFLAGAA+TG TVTVE
Sbjct  291  LKLMERFGVSAEHSDSWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE  350

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMG +V
Sbjct  351  GCGTTSLQGDVKFAEVLEKMGCKV  374



>gb|AEP26124.1| 5-enolpyruvylshikimate-3-phosphate synthase, partial [Sorghum 
halepense]
 gb|AEP26125.1| 5-enolpyruvylshikimate-3-phosphate synthase, partial [Sorghum 
halepense]
 gb|AEP26127.1| 5-enolpyruvylshikimate-3-phosphate synthase, partial [Sorghum 
halepense]
Length=444

 Score =   279 bits (713),  Expect(2) = 7e-104, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTE SVTV GPPR P GRKHL+AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  294  GAKVTWTETSVTVTGPPRQPFGRKHLKAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  353

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  354  SWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  413

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct  414  CAEVPVTIRDPGCTRKTFPDYFDVLSTFVKN  444


 Score =   127 bits (318),  Expect(2) = 7e-104, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  214  LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE  273

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  274  GCGTTSLQGDVKFAEVLEMMGAKV  297



>gb|EMT02861.1| 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic [Aegilops 
tauschii]
Length=391

 Score =   274 bits (701),  Expect(2) = 7e-104, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WT+ SVTV GPPR P GRKHL+A+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  241  GAKVTWTDTSVTVTGPPRQPFGRKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  300

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGATVEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  301  SWRVKETERMVAIRTELTKLGATVEEGPDYCIITPPEKLNVTVIDTYDDHRMAMAFSLAA  360

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTI+DPGCTRKTFP+YF+VL  F K+
Sbjct  361  CAEVPVTIRDPGCTRKTFPNYFDVLSTFVKN  391


 Score =   131 bits (330),  Expect(2) = 7e-104, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV+ EHSDSWDRF I+GGQKYKSPGNA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  161  LKLMERFGVTAEHSDSWDRFYIKGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVE  220

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  221  GCGTTSLQGDVKFAEVLEMMGAKV  244



>ref|XP_008659331.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2 [Zea 
mays]
Length=474

 Score =   279 bits (713),  Expect(2) = 8e-104, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTE SVTV GPPR P GRKHL+AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  324  GAKVTWTETSVTVTGPPREPFGRKHLKAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  383

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  384  SWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  443

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct  444  CAEVPVTIRDPGCTRKTFPDYFDVLSTFVKN  474


 Score =   127 bits (318),  Expect(2) = 8e-104, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  244  LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE  303

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  304  GCGTTSLQGDVKFAEVLEMMGAKV  327



>emb|CAA29828.1| EPSP [Arabidopsis thaliana]
Length=520

 Score =   271 bits (694),  Expect(2) = 8e-104, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GPPR   G +HLRAIDVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  370  GCKVSWTENSVTVTGPPRDAFGMRHLRAIDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  429

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP+++   EIDTYDDHRMAMAFSLAA
Sbjct  430  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPKKVKTAEIDTYDDHRMAMAFSLAA  489

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VP+TI D GCTRKTFPDYF+VL++ +KH
Sbjct  490  CADVPITINDSGCTRKTFPDYFQVLERITKH  520


 Score =   134 bits (336),  Expect(2) = 8e-104, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEHSDSWDRF ++GGQKYKSPGNA+VEGDASSA YFLAGAA+TG TVTVE
Sbjct  290  LKLMERFGVSVEHSDSWDRFFVKGGQKYKSPGNAYVEGDASSACYFLAGAAITGETVTVE  349

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMG +V
Sbjct  350  GCGTTSLQGDVKFAEVLEKMGCKV  373



>ref|XP_004964446.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic-like 
[Setaria italica]
Length=511

 Score =   277 bits (709),  Expect(2) = 9e-104, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTE SVTV GPPR P GRKHL+AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  361  GAKVTWTETSVTVTGPPREPFGRKHLKAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  420

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  421  SWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  480

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct  481  CAEVPVTIRDPGCTRKTFPDYFDVLSTFVKN  511


 Score =   128 bits (321),  Expect(2) = 9e-104, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSD+WDRF I+GGQKYKSP NA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  281  LRLMERFGVKAEHSDNWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE  340

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMGA+V
Sbjct  341  GCGTTSLQGDVKFAEVLEKMGAKV  364



>emb|CAA44974.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Zea mays]
Length=444

 Score =   278 bits (712),  Expect(2) = 9e-104, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTE SVTV GPPR P GRKHL+AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  294  GAKVTWTETSVTVTGPPREPFGRKHLKAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  353

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  354  SWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  413

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct  414  CAEVPVTIRDPGCTRKTFPDYFDVLSTFVKN  444


 Score =   127 bits (318),  Expect(2) = 9e-104, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  214  LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE  273

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  274  GCGTTSLQGDVKFAEVLEMMGAKV  297



>ref|XP_009133723.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic-like 
[Brassica rapa]
Length=514

 Score =   271 bits (694),  Expect(2) = 9e-104, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GP R   G +HLRA+DVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  364  GCKVSWTENSVTVTGPSRDAFGMRHLRAVDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  423

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP +L   EIDTYDDHRMAMAFSLAA
Sbjct  424  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPAKLKPAEIDTYDDHRMAMAFSLAA  483

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYF+VL+  +KH
Sbjct  484  CADVPVTIKDPGCTRKTFPDYFQVLESITKH  514


 Score =   134 bits (336),  Expect(2) = 9e-104, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVS EHSDSWDRF ++GGQKYKSPGNA+VEGDASSASYFLAGAA+TG TVTVE
Sbjct  284  LKLMERFGVSAEHSDSWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE  343

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMG +V
Sbjct  344  GCGTTSLQGDVKFAEVLEKMGCKV  367



>ref|XP_006397708.1| hypothetical protein EUTSA_v10001404mg [Eutrema salsugineum]
 ref|XP_006397709.1| hypothetical protein EUTSA_v10001404mg [Eutrema salsugineum]
 gb|ESQ39161.1| hypothetical protein EUTSA_v10001404mg [Eutrema salsugineum]
 gb|ESQ39162.1| hypothetical protein EUTSA_v10001404mg [Eutrema salsugineum]
Length=518

 Score =   271 bits (693),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GP R   G +HLRA+DVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  368  GCKVSWTENSVTVTGPSRDAFGMRHLRAVDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  427

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP++L   EIDTYDDHRMAMAFSLAA
Sbjct  428  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPKKLIPAEIDTYDDHRMAMAFSLAA  487

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFPDYF+VL++ +KH
Sbjct  488  CADVPVTIRDPGCTRKTFPDYFQVLERITKH  518


 Score =   134 bits (336),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVS EHSDSWDRF ++GGQKYKSPGNA+VEGDASSASYFLAGAA+TG TVTVE
Sbjct  288  LKLMERFGVSAEHSDSWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE  347

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMG +V
Sbjct  348  GCGTTSLQGDVKFAEVLEKMGCKV  371



>ref|XP_010506469.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic 
isoform X1 [Camelina sativa]
Length=523

 Score =   276 bits (705),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GPPR   G +HLRAIDVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  373  GCKVSWTENSVTVTGPPRDAFGMRHLRAIDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  432

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP+++   EIDTYDDHRMAMAFSLAA
Sbjct  433  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPKKVKPAEIDTYDDHRMAMAFSLAA  492

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFPDYFEVL++ +KH
Sbjct  493  CADVPVTIRDPGCTRKTFPDYFEVLERITKH  523


 Score =   129 bits (323),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 79/86 (92%), Gaps = 2/86 (2%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYK--SPGNAFVEGDASSASYFLagaavtggtvt  715
            LKLMER GVS EHSDSWDRF ++GGQKYK  SPGNA+VEGDASSASYFLAGAA+TG TVT
Sbjct  291  LKLMERFGVSAEHSDSWDRFFVKGGQKYKQESPGNAYVEGDASSASYFLAGAAITGETVT  350

Query  714  VEGCGTSSLQGDVKFAEVLEKMGAEV  637
            VEGCGT+SLQGDVKFAEVLEKMG +V
Sbjct  351  VEGCGTTSLQGDVKFAEVLEKMGCKV  376



>emb|CDY57099.1| BnaC04g56880D [Brassica napus]
Length=515

 Score =   270 bits (691),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GP R   G +HLRA+DVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  365  GCKVSWTENSVTVTGPSRDAFGMRHLRAVDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  424

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP ++   EIDTYDDHRMAMAFSLAA
Sbjct  425  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPAKVKPAEIDTYDDHRMAMAFSLAA  484

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYF+VL+  +KH
Sbjct  485  CADVPVTIKDPGCTRKTFPDYFQVLESITKH  515


 Score =   134 bits (337),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVS EHSDSWDRF ++GGQKYKSPGNA+VEGDASSASYFLAGAA+TG TVTVE
Sbjct  285  LKLMERFGVSAEHSDSWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE  344

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMG +V
Sbjct  345  GCGTTSLQGDVKFAEVLEKMGCKV  368



>emb|CDX95645.1| BnaC03g25260D [Brassica napus]
Length=509

 Score =   272 bits (696),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GP R   G +HLRA+DVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  359  GCKVSWTENSVTVTGPSRDAFGMRHLRAVDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  418

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP +L  +EIDTYDDHRMAMAFSLAA
Sbjct  419  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPAKLKPSEIDTYDDHRMAMAFSLAA  478

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYF+VL+  +KH
Sbjct  479  CADVPVTIKDPGCTRKTFPDYFQVLESITKH  509


 Score =   132 bits (331),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVS EHSDSWDRF ++GGQKYKSPGNA+VEGDASSASYFLAGAA+TG TVTVE
Sbjct  279  LKLMERFGVSAEHSDSWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE  338

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEV EKMG +V
Sbjct  339  GCGTTSLQGDVKFAEVFEKMGCKV  362



>ref|XP_003557242.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2-like 
[Brachypodium distachyon]
Length=510

 Score =   272 bits (696),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WT+ SVTV GPPR P GRKHL+A+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  360  GAKVTWTDTSVTVTGPPRQPFGRKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  419

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA VEEG DYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  420  SWRVKETERMVAIRTELTKLGAHVEEGSDYCIITPPEKLNVTSIDTYDDHRMAMAFSLAA  479

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTI+DPGCTRKTFP+YF+VL  F K+
Sbjct  480  CAEVPVTIRDPGCTRKTFPNYFDVLSTFVKN  510


 Score =   132 bits (331),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV+ EHSDSWDRF I+GGQKYKSPGNA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  280  LRLMERFGVTAEHSDSWDRFYIKGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVE  339

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  340  GCGTTSLQGDVKFAEVLEMMGAKV  363



>ref|XP_006294019.1| hypothetical protein CARUB_v10023012mg [Capsella rubella]
 gb|EOA26917.1| hypothetical protein CARUB_v10023012mg [Capsella rubella]
Length=519

 Score =   273 bits (698),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GPPR   G +HL AIDVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  369  GCKVSWTENSVTVTGPPRDAFGMRHLHAIDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  428

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP++L   EIDTYDDHRMAMAFSLAA
Sbjct  429  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPKKLTPAEIDTYDDHRMAMAFSLAA  488

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFPDYF+VL++ +KH
Sbjct  489  CADVPVTIRDPGCTRKTFPDYFQVLERITKH  519


 Score =   130 bits (328),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVS EHSDSWDRF ++GGQKYKSP N++VEGDASSASYFLAGAA+TG TVTVE
Sbjct  289  LKLMERFGVSAEHSDSWDRFFVKGGQKYKSPANSYVEGDASSASYFLAGAAITGETVTVE  348

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMG +V
Sbjct  349  GCGTTSLQGDVKFAEVLEKMGCKV  372



>gb|KFK37326.1| hypothetical protein AALP_AA4G242200 [Arabis alpina]
Length=515

 Score =   274 bits (701),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GP R   G +HLRA+DVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  365  GCKVSWTENSVTVTGPSRDAFGMRHLRAVDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  424

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPPE+L   EIDTYDDHRMAMAFSLAA
Sbjct  425  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPEKLIPAEIDTYDDHRMAMAFSLAA  484

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYF+VL+K +KH
Sbjct  485  CADVPVTIKDPGCTRKTFPDYFQVLEKITKH  515


 Score =   129 bits (325),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV+ EHS++WDRF ++GGQKYKSPGNA+VEGDASSASYFLAGAA+TG TVTVE
Sbjct  285  LKLMERFGVTAEHSENWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE  344

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMG +V
Sbjct  345  GCGTTSLQGDVKFAEVLEKMGCKV  368



>ref|XP_002436424.1| hypothetical protein SORBIDRAFT_10g002230 [Sorghum bicolor]
 gb|EER87791.1| hypothetical protein SORBIDRAFT_10g002230 [Sorghum bicolor]
Length=506

 Score =   276 bits (707),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTE SVTV GPPR P GRKHL+AIDVNMNKMPDVAMTLAVVALFA+GPTAIRDVA
Sbjct  356  GAKVTWTETSVTVTGPPRQPFGRKHLKAIDVNMNKMPDVAMTLAVVALFANGPTAIRDVA  415

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  416  SWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  475

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct  476  CAEVPVTIRDPGCTRKTFPDYFDVLSTFVKN  506


 Score =   127 bits (319),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  276  LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE  335

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  336  GCGTTSLQGDVKFAEVLEMMGAKV  359



>sp|P17688.1|AROA_BRANA RecName: Full=3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic; 
AltName: Full=5-enolpyruvylshikimate-3-phosphate 
synthase; Short=EPSP synthase; Flags: Precursor [Brassica 
napus]
 emb|CAA35839.1| 5-enolpyruvylshikimate-3-phosphate synthase [Brassica napus]
Length=516

 Score =   270 bits (690),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GP R   G +HLRA+DVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  366  GCKVSWTENSVTVTGPSRDAFGMRHLRAVDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  425

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP ++   EIDTYDDHRMAMAFSLAA
Sbjct  426  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPAKVKPAEIDTYDDHRMAMAFSLAA  485

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYF+VL+  +KH
Sbjct  486  CADVPVTIKDPGCTRKTFPDYFQVLESITKH  516


 Score =   134 bits (336),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVS EHSDSWDRF ++GGQKYKSPGNA+VEGDASSASYFLAGAA+TG TVTVE
Sbjct  286  LKLMERFGVSAEHSDSWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE  345

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMG +V
Sbjct  346  GCGTTSLQGDVKFAEVLEKMGCKV  369



>gb|AFW85981.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Zea mays]
Length=390

 Score =   277 bits (708),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTE SVTV GPPR P GRKHL+AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  240  GAKVTWTETSVTVTGPPREPFGRKHLKAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  299

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  300  SWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  359

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct  360  CAEVPVTIRDPGCTRKTFPDYFDVLSTFVKN  390


 Score =   126 bits (317),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  160  LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE  219

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  220  GCGTTSLQGDVKFAEVLEMMGAKV  243



>gb|AAS80163.1| 5-enolpyruvylshikimate-3-phosphate synthase [Brassica rapa subsp. 
oleifera]
Length=514

 Score =   270 bits (690),  Expect(2) = 4e-103, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GP R   G +HLRA+DVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  364  GCKVSWTENSVTVTGPSRDAFGMRHLRAVDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  423

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP ++   EIDTYDDHRMAMAFSLAA
Sbjct  424  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPAKVKPAEIDTYDDHRMAMAFSLAA  483

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYF+VL+  +KH
Sbjct  484  CADVPVTIKDPGCTRKTFPDYFQVLESITKH  514


 Score =   133 bits (335),  Expect(2) = 4e-103, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVS EHSDSWDRF ++GGQKYKSPGNA+VEGDASSASYFLAGAA+TG TVTVE
Sbjct  284  LKLMERFGVSAEHSDSWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE  343

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMG +V
Sbjct  344  GCGTTSLQGDVKFAEVLEKMGCKV  367



>emb|CDY37031.1| BnaA04g26090D [Brassica napus]
Length=516

 Score =   269 bits (687),  Expect(2) = 5e-103, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GP R   G +HLRA+DVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  366  GCKVSWTENSVTVTGPSRDAFGMRHLRAVDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  425

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP ++   EIDTYDDHRMAMAFSLAA
Sbjct  426  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPAKVKPAEIDTYDDHRMAMAFSLAA  485

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFPDYF+VL+  +KH
Sbjct  486  CADVPVTIRDPGCTRKTFPDYFQVLESITKH  516


 Score =   134 bits (336),  Expect(2) = 5e-103, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVS EHSDSWDRF ++GGQKYKSPGNA+VEGDASSASYFLAGAA+TG TVTVE
Sbjct  286  LKLMERFGVSAEHSDSWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE  345

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMG +V
Sbjct  346  GCGTTSLQGDVKFAEVLEKMGCKV  369



>gb|AIR74883.1| 5-enolpyruvylshikimate-3-phosphate synthase, partial [Cyperus 
rotundus]
Length=491

 Score =   268 bits (686),  Expect(2) = 7e-103, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 133/143 (93%), Gaps = 1/143 (1%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGR-KHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDV  473
            G++ +WTENSVTV GPPR  S R KHL+A+DVNMNKMPDVAMTLAVVALFADGPTAIRDV
Sbjct  349  GAKVTWTENSVTVTGPPRGSSFREKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAIRDV  408

Query  472  ASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLA  293
            ASWRVKETERM+A+CTELRKLGATVEEGPDYCIITPPE+LN+  IDTYDDHRMAM FSLA
Sbjct  409  ASWRVKETERMVAICTELRKLGATVEEGPDYCIITPPEKLNIAAIDTYDDHRMAMTFSLA  468

Query  292  ACAEVPVTIKDPGCTRKTFPDYF  224
            ACAEVPVTI DPGCTRKTFPDYF
Sbjct  469  ACAEVPVTINDPGCTRKTFPDYF  491


 Score =   134 bits (337),  Expect(2) = 7e-103, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLMER GVSVEH+DSWDRF I+GGQKYKSPG AFVEGDASSASYFLAGAA+TGGTVTVE
Sbjct  269  IKLMERFGVSVEHTDSWDRFFIKGGQKYKSPGKAFVEGDASSASYFLAGAAITGGTVTVE  328

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMGA+V
Sbjct  329  GCGTASLQGDVKFAEVLEKMGAKV  352



>gb|AIR74885.1| 5-enolpyruvylshikimate-3-phosphate synthase, partial [Cyperus 
esculentus]
Length=492

 Score =   268 bits (686),  Expect(2) = 8e-103, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 134/145 (92%), Gaps = 1/145 (1%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGR-KHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDV  473
            G++ +WTENSVTV GPPR  S R KHL+A+DVNMNKMPDVAMTLAVVALFADGPTAIRDV
Sbjct  348  GAKVTWTENSVTVTGPPRGSSFREKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAIRDV  407

Query  472  ASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLA  293
            ASWRVKETERM+A+CTELRKLGA VEEGPDYCIITPPE+LN+  IDTYDDHRMAM FSLA
Sbjct  408  ASWRVKETERMVAICTELRKLGAKVEEGPDYCIITPPEKLNIAAIDTYDDHRMAMTFSLA  467

Query  292  ACAEVPVTIKDPGCTRKTFPDYFEV  218
            ACAEVPVTI DPGCTRKTFPDYF+V
Sbjct  468  ACAEVPVTINDPGCTRKTFPDYFDV  492


 Score =   134 bits (336),  Expect(2) = 8e-103, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLMER GVSVEH+DSWDRF I+GGQKYKSPG AFVEGDASSASYFLAGAA+TGGTVTVE
Sbjct  268  IKLMERFGVSVEHTDSWDRFFIKGGQKYKSPGKAFVEGDASSASYFLAGAAITGGTVTVE  327

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMGA+V
Sbjct  328  GCGTASLQGDVKFAEVLEKMGAKV  351



>gb|ADB85251.1| 5-enolpyruvyl shikimate 3-phosphate synthase [Zoysia japonica]
Length=391

 Score =   276 bits (705),  Expect(2) = 8e-103, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTE SVTV GPPR P GRKHL+AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  241  GAKVTWTETSVTVTGPPREPFGRKHLKAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  300

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  301  SWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  360

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct  361  CADVPVTIRDPGCTRKTFPDYFDVLSSFVKN  391


 Score =   126 bits (317),  Expect(2) = 8e-103, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  161  LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE  220

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  221  GCGTTSLQGDVKFAEVLEMMGAKV  244



>gb|AIR74882.1| 5-enolpyruvylshikimate-3-phosphate synthase, partial [Cyperus 
rotundus]
Length=490

 Score =   268 bits (685),  Expect(2) = 8e-103, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 133/143 (93%), Gaps = 1/143 (1%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGR-KHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDV  473
            G++ +WTENSVTV GPPR  S R KHL+A+DVNMNKMPDVAMTLAVVALFADGPTAIRDV
Sbjct  348  GAKVTWTENSVTVTGPPRGSSFREKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAIRDV  407

Query  472  ASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLA  293
            ASWRVKETERM+A+CTELRKLGATVEEGPDYCIITPPE+LN+  IDTYDDHRMAM FSLA
Sbjct  408  ASWRVKETERMVAICTELRKLGATVEEGPDYCIITPPEKLNIAAIDTYDDHRMAMTFSLA  467

Query  292  ACAEVPVTIKDPGCTRKTFPDYF  224
            ACAEVPVTI DPGCTRKTFPDYF
Sbjct  468  ACAEVPVTINDPGCTRKTFPDYF  490


 Score =   134 bits (336),  Expect(2) = 8e-103, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLMER GVSVEH+DSWDRF I+GGQKYKSPG AFVEGDASSASYFLAGAA+TGGTVTVE
Sbjct  268  IKLMERFGVSVEHTDSWDRFFIKGGQKYKSPGKAFVEGDASSASYFLAGAAITGGTVTVE  327

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMGA+V
Sbjct  328  GCGTASLQGDVKFAEVLEKMGAKV  351



>gb|AAY40476.1| 5-enol-pyruvylshikimate-phosphate synthase [Conyza sumatrensis]
Length=444

 Score =   290 bits (741),  Expect(2) = 8e-103, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +W ENSVTVKGPPR  SGR HLR +DVNMNKMPDVAM LAVVAL+ADGPTAIRDVA
Sbjct  294  GAEVTWAENSVTVKGPPRNSSGRGHLRPVDVNMNKMPDVAMALAVVALYADGPTAIRDVA  353

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  354  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTAIDTYDDHRMAMAFSLAA  413

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTIKDPGCTRKTFPDYFEVL++++KH
Sbjct  414  CAEVPVTIKDPGCTRKTFPDYFEVLERYTKH  444


 Score =   112 bits (281),  Expect(2) = 8e-103, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 77/84 (92%), Gaps = 2/84 (2%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLM++ GVSVEHSD+ DRF +RGGQK  SPGNA+VEGDAS+ASYFLAGAA+TGGTVTVE
Sbjct  216  LKLMKQFGVSVEHSDTLDRFHVRGGQK--SPGNAYVEGDASNASYFLAGAAITGGTVTVE  273

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSL GDVKFAEVL +MGAEV
Sbjct  274  GCGTSSLLGDVKFAEVLGQMGAEV  297



>gb|AIR74884.1| 5-enolpyruvylshikimate-3-phosphate synthase, partial [Cyperus 
esculentus]
Length=493

 Score =   268 bits (685),  Expect(2) = 8e-103, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 134/145 (92%), Gaps = 1/145 (1%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGR-KHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDV  473
            G++ +WTENSVTV GPPR  S R KHL+A+DVNMNKMPDVAMTLAVVALFADGPTAIRDV
Sbjct  349  GAKVTWTENSVTVTGPPRGSSFREKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAIRDV  408

Query  472  ASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLA  293
            ASWRVKETERM+A+CTELRKLGA VEEGPDYCIITPPE+LN+  IDTYDDHRMAM FSLA
Sbjct  409  ASWRVKETERMVAICTELRKLGAKVEEGPDYCIITPPEKLNIAAIDTYDDHRMAMTFSLA  468

Query  292  ACAEVPVTIKDPGCTRKTFPDYFEV  218
            ACAEVPVTI DPGCTRKTFPDYF+V
Sbjct  469  ACAEVPVTINDPGCTRKTFPDYFDV  493


 Score =   134 bits (336),  Expect(2) = 8e-103, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLMER GVSVEH+DSWDRF I+GGQKYKSPG AFVEGDASSASYFLAGAA+TGGTVTVE
Sbjct  269  IKLMERFGVSVEHTDSWDRFFIKGGQKYKSPGKAFVEGDASSASYFLAGAAITGGTVTVE  328

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMGA+V
Sbjct  329  GCGTASLQGDVKFAEVLEKMGAKV  352



>gb|ADB85252.1| 5-enolpyruvyl shikimate 3-phosphate synthase [Zoysia japonica]
Length=391

 Score =   276 bits (705),  Expect(2) = 8e-103, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTE SVTV GPPR P GRKHL+AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  241  GAKVTWTETSVTVTGPPREPFGRKHLKAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  300

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  301  SWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  360

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct  361  CADVPVTIRDPGCTRKTFPDYFDVLSSFVKN  391


 Score =   126 bits (317),  Expect(2) = 8e-103, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  161  LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE  220

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  221  GCGTTSLQGDVKFAEVLEMMGAKV  244



>gb|AAL65913.1|AF440389_1 5-enolpyruvylshikimate-3-phosphate synthase [Orychophragmus violaceus]
Length=518

 Score =   270 bits (691),  Expect(2) = 9e-103, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GP R   G +HLRA+DVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  368  GCKVSWTENSVTVTGPSRDAFGMRHLRAVDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  427

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP ++   EIDTYDDHRMAMAFSLAA
Sbjct  428  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPAKVKPAEIDTYDDHRMAMAFSLAA  487

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYF+VL+  +KH
Sbjct  488  CADVPVTIKDPGCTRKTFPDYFQVLESITKH  518


 Score =   132 bits (331),  Expect(2) = 9e-103, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVS EHS+SWDRF ++GGQKYKSPGNA+VEGDASSASYFLAGAA+TG TVTVE
Sbjct  288  LKLMERFGVSAEHSESWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE  347

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMG +V
Sbjct  348  GCGTTSLQGDVKFAEVLEKMGCKV  371



>ref|XP_006656606.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic-like, 
partial [Oryza brachyantha]
Length=452

 Score =   273 bits (697),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WT+ SVTV GPPR P G+KHL+A+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  302  GAKVTWTDTSVTVTGPPREPYGKKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  361

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  362  SWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  421

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFP+YF+VL  F K+
Sbjct  422  CADVPVTIRDPGCTRKTFPNYFDVLSTFVKN  452


 Score =   129 bits (324),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV+ EHS+SWDRF I+GGQKYKSPGNA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  222  LRLMERFGVTAEHSESWDRFYIKGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVE  281

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  282  GCGTTSLQGDVKFAEVLEMMGAKV  305



>gb|AAM63771.1| 5-enolpyruvylshikimate-3-phosphate (EPSP) synthase, putative 
[Arabidopsis thaliana]
Length=521

 Score =   270 bits (690),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GP R   G +HLRAIDVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  371  GCKVSWTENSVTVTGPSRDAFGMRHLRAIDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  430

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP+++   EIDTYDDHRMAMAFSLAA
Sbjct  431  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPKKVKPAEIDTYDDHRMAMAFSLAA  490

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VP+TI DPGCTRKTFPDYF+VL++ +KH
Sbjct  491  CADVPITINDPGCTRKTFPDYFQVLERITKH  521


 Score =   131 bits (330),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVS EHS+SWDRF ++GGQKYKSPGNA+VEGDASSASYFLAGAA+TG TVTVE
Sbjct  291  LKLMERFGVSAEHSESWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE  350

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMG +V
Sbjct  351  GCGTTSLQGDVKFAEVLEKMGCKV  374



>ref|NP_175317.1| putative 5-enolpyruvylshikimate-3-phosphate synthase [Arabidopsis 
thaliana]
 gb|AAG29739.1|AC084414_7 5-enolpyruvylshikimate-3-phosphate (EPSP) synthase, putative 
[Arabidopsis thaliana]
 gb|AAG50661.1|AC084242_5 5-enolpyruvylshikimate-3-phosphate, putative [Arabidopsis thaliana]
 gb|AAK25934.1|AF360224_1 putative 5-enolpyruvylshikimate-3-phosphate (EPSP) synthase [Arabidopsis 
thaliana]
 gb|AAK64123.1| putative 5-enolpyruvylshikimate-3-phosphate synthase [Arabidopsis 
thaliana]
 gb|AEE32360.1| putative 5-enolpyruvylshikimate-3-phosphate synthase [Arabidopsis 
thaliana]
Length=521

 Score =   270 bits (690),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GP R   G +HLRAIDVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  371  GCKVSWTENSVTVTGPSRDAFGMRHLRAIDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  430

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP+++   EIDTYDDHRMAMAFSLAA
Sbjct  431  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPKKVKPAEIDTYDDHRMAMAFSLAA  490

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VP+TI DPGCTRKTFPDYF+VL++ +KH
Sbjct  491  CADVPITINDPGCTRKTFPDYFQVLERITKH  521


 Score =   131 bits (330),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVS EHS+SWDRF ++GGQKYKSPGNA+VEGDASSASYFLAGAA+TG TVTVE
Sbjct  291  LKLMERFGVSAEHSESWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE  350

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMG +V
Sbjct  351  GCGTTSLQGDVKFAEVLEKMGCKV  374



>gb|AAR87845.1| 5-enolpyruvylshikimate-3-phosphate synthase [Eleusine indica]
Length=445

 Score =   275 bits (702),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTE SVTV GP R P GRKHL+AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  295  GAKVTWTETSVTVTGPQREPFGRKHLKAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  354

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  355  SWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  414

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct  415  CADVPVTIRDPGCTRKTFPDYFDVLSTFVKN  445


 Score =   127 bits (318),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  215  LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE  274

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  275  GCGTTSLQGDVKFAEVLEMMGAKV  298



>gb|AEQ75411.1| plastid 5-enolpyruvylshikimate-3-phosphate synthase [Eleusine 
indica]
Length=443

 Score =   274 bits (701),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTE SVTV GP R P GRKHL+AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  293  GAKVTWTETSVTVTGPQREPFGRKHLKAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  352

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  353  SWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  412

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct  413  CADVPVTIRDPGCTRKTFPDYFDVLSTFVKN  443


 Score =   127 bits (318),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  213  LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE  272

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  273  GCGTTSLQGDVKFAEVLEMMGAKV  296



>gb|AEQ75410.1| plastid 5-enolpyruvylshikimate-3-phosphate synthase [Eleusine 
indica]
Length=443

 Score =   274 bits (701),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTE SVTV GP R P GRKHL+AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  293  GAKVTWTETSVTVTGPQREPFGRKHLKAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  352

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  353  SWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  412

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct  413  CADVPVTIRDPGCTRKTFPDYFDVLSTFVKN  443


 Score =   127 bits (318),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  213  LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE  272

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  273  GCGTTSLQGDVKFAEVLEMMGAKV  296



>emb|CAD01096.1| 5-enolpyruvylshikimate-3-phosphate synthase [Eleusine indica]
 gb|AAN63155.1| 5-enolpyruvylshikimate-3-phosphate synthase [Eleusine indica]
Length=445

 Score =   274 bits (701),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTE SVTV GP R P GRKHL+AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  295  GAKVTWTETSVTVTGPQREPFGRKHLKAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  354

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  355  SWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  414

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct  415  CADVPVTIRDPGCTRKTFPDYFDVLSTFVKN  445


 Score =   127 bits (318),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  215  LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE  274

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  275  GCGTTSLQGDVKFAEVLEMMGAKV  298



>gb|AEP26126.1| 5-enolpyruvylshikimate-3-phosphate synthase, partial [Sorghum 
halepense]
Length=444

 Score =   276 bits (705),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WT+ SVTV GPPR P GRKHL+A+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  294  GAKVTWTDTSVTVTGPPRQPFGRKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  353

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGATVEEGPDYCIITPPE+LN+T IDTYDDHRMAMAFSLAA
Sbjct  354  SWRVKETERMVAIRTELTKLGATVEEGPDYCIITPPEKLNITAIDTYDDHRMAMAFSLAA  413

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTI+DPGCTRKTFP+YF+VL  F K+
Sbjct  414  CAEVPVTIRDPGCTRKTFPNYFDVLSTFVKN  444


 Score =   124 bits (312),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+G QKYKSP NA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  214  LRLMERFGVKAEHSDSWDRFYIKGDQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE  273

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  274  GCGTTSLQGDVKFAEVLEMMGAKV  297



>gb|AAL07437.1|AF413082_1 EPSP synthase [Oryza sativa]
 dbj|BAB61062.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Oryza sativa (japonica 
cultivar-group)]
 gb|AAL06593.1| 5-enolpyruvylshikimate 3-phosphate synthase [Oryza sativa]
Length=511

 Score =   271 bits (692),  Expect(2) = 5e-102, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WT+ SVTV GPPR P G+KHL+A+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  361  GAKVTWTDTSVTVTGPPREPYGKKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  420

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LN+T IDTYDDHRMAMAFSLAA
Sbjct  421  SWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLNITAIDTYDDHRMAMAFSLAA  480

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFP+YF+VL  F ++
Sbjct  481  CADVPVTIRDPGCTRKTFPNYFDVLSTFVRN  511


 Score =   129 bits (323),  Expect(2) = 5e-102, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+GGQKYKSPGNA+VEGDASSASYFLAGAA+TGGTVTV+
Sbjct  281  LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVQ  340

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  341  GCGTTSLQGDVKFAEVLEMMGAKV  364



>gb|AEB80422.2| 5-enolpyruvylshikimate-3-phosphate synthase [Eleusine indica]
Length=391

 Score =   273 bits (698),  Expect(2) = 5e-102, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTE SVTV GP R P GRKHL+AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  241  GAKVTWTETSVTVTGPQREPFGRKHLKAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  300

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  301  SWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  360

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct  361  CADVPVTIRDPGCTRKTFPDYFDVLSTFVKN  391


 Score =   126 bits (317),  Expect(2) = 5e-102, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  161  LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE  220

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  221  GCGTTSLQGDVKFAEVLEMMGAKV  244



>gb|AIX87986.1| plastid 5-enolpyruvylshikimate-3-phosphate synthase, partial 
[Eleusine indica]
Length=403

 Score =   273 bits (698),  Expect(2) = 5e-102, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTE SVTV GP R P GRKHL+AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  253  GAKVTWTETSVTVTGPQREPFGRKHLKAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  312

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  313  SWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  372

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct  373  CADVPVTIRDPGCTRKTFPDYFDVLSTFVKN  403


 Score =   126 bits (317),  Expect(2) = 5e-102, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  173  LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE  232

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  233  GCGTTSLQGDVKFAEVLEMMGAKV  256



>gb|AAR87844.1| 5-enolpyruvylshikimate-3-phosphate synthase [Eleusine indica]
Length=445

 Score =   272 bits (696),  Expect(2) = 5e-102, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTE SVTV GP R P GRKHL+AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  295  GAKVTWTETSVTVTGPQREPFGRKHLKAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  354

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEGPDYCI TPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  355  SWRVKETERMVAIRTELTKLGASVEEGPDYCITTPPEKLNVTAIDTYDDHRMAMAFSLAA  414

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct  415  CADVPVTIRDPGCTRKTFPDYFDVLSTFVKN  445


 Score =   127 bits (319),  Expect(2) = 5e-102, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  215  LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE  274

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  275  GCGTTSLQGDVKFAEVLETMGAKV  298



>ref|NP_001056712.1| Os06g0133900 [Oryza sativa Japonica Group]
 dbj|BAD67887.1| putative 5-enolpyruvylshikimate-3-phosphate synthase [Oryza sativa 
Japonica Group]
 dbj|BAD68865.1| putative 5-enolpyruvylshikimate-3-phosphate synthase [Oryza sativa 
Japonica Group]
 dbj|BAF18626.1| Os06g0133900 [Oryza sativa Japonica Group]
 gb|EAY99539.1| hypothetical protein OsI_21508 [Oryza sativa Indica Group]
Length=515

 Score =   271 bits (692),  Expect(2) = 5e-102, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WT+ SVTV GPPR P G+KHL+A+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  365  GAKVTWTDTSVTVTGPPREPYGKKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  424

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LN+T IDTYDDHRMAMAFSLAA
Sbjct  425  SWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLNITAIDTYDDHRMAMAFSLAA  484

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFP+YF+VL  F ++
Sbjct  485  CADVPVTIRDPGCTRKTFPNYFDVLSTFVRN  515


 Score =   129 bits (323),  Expect(2) = 5e-102, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+GGQKYKSPGNA+VEGDASSASYFLAGAA+TGGTVTV+
Sbjct  285  LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVQ  344

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  345  GCGTTSLQGDVKFAEVLEMMGAKV  368



>gb|EAZ35730.1| hypothetical protein OsJ_20021 [Oryza sativa Japonica Group]
Length=506

 Score =   271 bits (693),  Expect(2) = 5e-102, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WT+ SVTV GPPR P G+KHL+A+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  356  GAKVTWTDTSVTVTGPPREPYGKKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  415

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LN+T IDTYDDHRMAMAFSLAA
Sbjct  416  SWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLNITAIDTYDDHRMAMAFSLAA  475

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFP+YF+VL  F ++
Sbjct  476  CADVPVTIRDPGCTRKTFPNYFDVLSTFVRN  506


 Score =   128 bits (322),  Expect(2) = 5e-102, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+GGQKYKSPGNA+VEGDASSASYFLAGAA+TGGTVTV+
Sbjct  276  LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVQ  335

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  336  GCGTTSLQGDVKFAEVLEMMGAKV  359



>gb|AIX87988.1| plastid 5-enolpyruvylshikimate-3-phosphate synthase, partial 
[Eleusine indica]
 gb|AIX87989.1| plastid 5-enolpyruvylshikimate-3-phosphate synthase, partial 
[Eleusine indica]
Length=403

 Score =   273 bits (697),  Expect(2) = 6e-102, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTE SVTV GP R P GRKHL+AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  253  GAKVTWTETSVTVTGPQREPFGRKHLKAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  312

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  313  SWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  372

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct  373  CADVPVTIRDPGCTRKTFPDYFDVLSTFVKN  403


 Score =   126 bits (317),  Expect(2) = 6e-102, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  173  LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE  232

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  233  GCGTTSLQGDVKFAEVLEMMGAKV  256



>gb|AHA87270.1| 5-enolpyruvylshikimate-3-phosphate synthase, partial [Sorghum 
halepense]
Length=445

 Score =   278 bits (711),  Expect(2) = 7e-102, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTE SVTV GPPR P GRKHL+AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  295  GAKVTWTETSVTVTGPPRQPFGRKHLKAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  354

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  355  SWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  414

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct  415  CAEVPVTIRDPGCTRKTFPDYFDVLSTFVKN  445


 Score =   120 bits (302),  Expect(2) = 7e-102, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHS+SWDRF I+GGQKYKSPGNA+VEGDA SA YFLAGAA+TGGTVTV+
Sbjct  215  LRLMERFGVKAEHSESWDRFYIKGGQKYKSPGNAYVEGDAXSAXYFLAGAAITGGTVTVQ  274

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCG +SLQGDVKFAEVLE MGA+V
Sbjct  275  GCGXTSLQGDVKFAEVLEMMGAKV  298



>emb|CAD01095.1| 5-enolpyruvylshikimate-3-phosphate synthase [Eleusine indica]
 gb|AAN63156.1| 5-enolpyruvylshikimate-3-phosphate synthase [Eleusine indica]
Length=445

 Score =   271 bits (693),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTE SVTV GP R P GRKHL+AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  295  GAKVTWTETSVTVTGPQREPFGRKHLKAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  354

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEG DYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  355  SWRVKETERMVAIRTELTKLGASVEEGLDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  414

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct  415  CADVPVTIRDPGCTRKTFPDYFDVLSTFVKN  445


 Score =   127 bits (318),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  215  LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE  274

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  275  GCGTTSLQGDVKFAEVLEMMGAKV  298



>ref|XP_009142326.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic 
[Brassica rapa]
Length=516

 Score =   265 bits (676),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GP R   G +HL A+DVNM+KMPDVAMTLAVVALFADGPT +RDVA
Sbjct  366  GCKVSWTENSVTVTGPSRDAFGMRHLGAVDVNMDKMPDVAMTLAVVALFADGPTTLRDVA  425

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP ++   EIDTYDDHRMAMAFSLAA
Sbjct  426  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPAKVKPAEIDTYDDHRMAMAFSLAA  485

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTIKDPGCTRKTFPDYF+VL+  +KH
Sbjct  486  CADVPVTIKDPGCTRKTFPDYFQVLESITKH  516


 Score =   134 bits (336),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVS EHSDSWDRF ++GGQKYKSPGNA+VEGDASSASYFLAGAA+TG TVTVE
Sbjct  286  LKLMERFGVSAEHSDSWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE  345

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMG +V
Sbjct  346  GCGTTSLQGDVKFAEVLEKMGCKV  369



>dbj|BAA32276.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Oryza sativa Japonica 
Group]
Length=391

 Score =   270 bits (689),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WT+ SVTV GPPR P G+KHL+A+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  241  GAKVTWTDTSVTVTGPPREPYGKKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  300

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LN+T IDTYDDHRMAMAFSLAA
Sbjct  301  SWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLNITAIDTYDDHRMAMAFSLAA  360

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFP+YF+VL  F ++
Sbjct  361  CADVPVTIRDPGCTRKTFPNYFDVLSTFVRN  391


 Score =   128 bits (322),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+GGQKYKSPGNA+VEGDASSASYFLAGAA+TGGTVTV+
Sbjct  161  LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVQ  220

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  221  GCGTTSLQGDVKFAEVLEMMGAKV  244



>gb|AIR95658.1| plastid 5-enolpyruvylshikimate-3-phosphate synthase, partial 
[Eleusine indica]
Length=445

 Score =   271 bits (693),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTE SVTV GP R P GRKHL+AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  295  GAKVTWTETSVTVTGPQREPFGRKHLKAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  354

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEG DYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  355  SWRVKETERMVAIRTELTKLGASVEEGLDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  414

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct  415  CADVPVTIRDPGCTRKTFPDYFDVLSTFVKN  445


 Score =   127 bits (318),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  215  LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE  274

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  275  GCGTTSLQGDVKFAEVLEMMGAKV  298



>ref|XP_006375310.1| hypothetical protein POPTR_0014s06390g [Populus trichocarpa]
 gb|ERP53107.1| hypothetical protein POPTR_0014s06390g [Populus trichocarpa]
Length=503

 Score =   265 bits (678),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WT+NSVTV G PR  SG KHLRA+DVNMNKMPDVAMTLAVVALF +GPTAIRDVA
Sbjct  353  GAKVTWTKNSVTVTGLPRDSSGWKHLRAVDVNMNKMPDVAMTLAVVALFTNGPTAIRDVA  412

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKE ERMIA+  ELRKLGATVEEGPDYC+ITPPE+LNVTEIDTYDDHRMAMAFSLAA
Sbjct  413  SWRVKEMERMIAIWKELRKLGATVEEGPDYCVITPPEKLNVTEIDTYDDHRMAMAFSLAA  472

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
              EVPVTIKDPG T KTFPDYFEVL+ ++KH
Sbjct  473  WGEVPVTIKDPGGTGKTFPDYFEVLEGYTKH  503


 Score =   131 bits (330),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV ++HSDSWDRF IRGGQKYKSPGN+FVEGDASSA YFLAGAA+TGGT+TVE
Sbjct  273  LKLMERYGVFIQHSDSWDRFFIRGGQKYKSPGNSFVEGDASSAGYFLAGAAITGGTITVE  332

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT SLQGDVKFAEVLEKMGA+V
Sbjct  333  GCGTDSLQGDVKFAEVLEKMGAKV  356



>gb|AEB80423.2| 5-enolpyruvylshikimate-3-phosphate synthase [Eleusine indica]
Length=391

 Score =   270 bits (690),  Expect(2) = 4e-101, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTE SVTV GP R P GRKHL+AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  241  GAKVTWTETSVTVTGPQREPFGRKHLKAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  300

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEG DYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  301  SWRVKETERMVAIRTELTKLGASVEEGLDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  360

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct  361  CADVPVTIRDPGCTRKTFPDYFDVLSTFVKN  391


 Score =   126 bits (317),  Expect(2) = 4e-101, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  161  LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE  220

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  221  GCGTTSLQGDVKFAEVLEMMGAKV  244



>gb|AIX87987.1| plastid 5-enolpyruvylshikimate-3-phosphate synthase, partial 
[Eleusine indica]
Length=403

 Score =   270 bits (690),  Expect(2) = 4e-101, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTE SVTV GP R P GRKHL+AIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  253  GAKVTWTETSVTVTGPQREPFGRKHLKAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  312

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGA+VEEG DYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  313  SWRVKETERMVAIRTELTKLGASVEEGLDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  372

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct  373  CADVPVTIRDPGCTRKTFPDYFDVLSTFVKN  403


 Score =   126 bits (317),  Expect(2) = 4e-101, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  173  LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE  232

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  233  GCGTTSLQGDVKFAEVLEMMGAKV  256



>gb|ABG88197.1| EPSP synthase [Phaseolus vulgaris]
Length=522

 Score =   262 bits (670),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 135/151 (89%), Gaps = 1/151 (1%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G +  WTENSVTV GPPR   GR+ LRAIDVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  373  GCKVWWTENSVTVTGPPRDLFGRRVLRAIDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  432

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETE MIA+CTELRKLGATVEEGPDYC+ITPP++L V EIDTYDDHR+ MAFSLAA
Sbjct  433  SWRVKETEEMIAICTELRKLGATVEEGPDYCVITPPKKLKVAEIDTYDDHRIPMAFSLAA  492

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CA+VPVTI DP CTRKTFPDYFEVL++ +KH
Sbjct  493  CADVPVTINDP-CTRKTFPDYFEVLERLTKH  522


 Score =   129 bits (325),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEH DSWDRFL+ GGQKYKSPGNA+VEGDASSASY LAGAA+TGGTVTVE
Sbjct  293  LKLMERFGVSVEHWDSWDRFLVHGGQKYKSPGNAYVEGDASSASYLLAGAAITGGTVTVE  352

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT SLQGDVKFAEVLEKMG +V
Sbjct  353  GCGTKSLQGDVKFAEVLEKMGCKV  376



>gb|EMS45885.1| 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic [Triticum 
urartu]
Length=416

 Score =   274 bits (701),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WT+ SVTV GPPR P GRKHL+A+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  266  GAKVTWTDTSVTVTGPPRQPFGRKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  325

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGATVEEGPDYCIITPPE+LN+T IDTYDDHRMAMAFSLAA
Sbjct  326  SWRVKETERMVAIRTELTKLGATVEEGPDYCIITPPEKLNITAIDTYDDHRMAMAFSLAA  385

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTI+DPGCTRKTFP+YF+VL  F K+
Sbjct  386  CAEVPVTIRDPGCTRKTFPNYFDVLSTFVKN  416


 Score =   117 bits (294),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 80/109 (73%), Gaps = 25/109 (23%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYK-------------------------SPGNAF  784
            LKLMER GV+ EHSDSWDRF I+GGQKYK                         SPGNA+
Sbjct  161  LKLMERFGVTAEHSDSWDRFYIKGGQKYKQWSTNERYQFSVCQIFIDATPLNYGSPGNAY  220

Query  783  VEGDASSASYFLagaavtggtvtVEGCGTSSLQGDVKFAEVLEKMGAEV  637
            VEGDASSASYFLAGAA+TGGTVTVEGCGT+SLQGDVKFAEVLE MGA+V
Sbjct  221  VEGDASSASYFLAGAAITGGTVTVEGCGTTSLQGDVKFAEVLEMMGAKV  269



>gb|ACY30625.1| EPSP synthase [Ginkgo biloba]
Length=353

 Score =   272 bits (695),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +W++NSVTV GPP   S RKHL  IDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  200  GAKVTWSDNSVTVTGPPVKASRRKHLHGIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  259

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKETERM+A+CTELRKLGATVEEGPDYCIITPPERLNVT IDTYDDHRMAMAFSLAA
Sbjct  260  NWRVKETERMLAICTELRKLGATVEEGPDYCIITPPERLNVTSIDTYDDHRMAMAFSLAA  319

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C +VPVTI DPGCTRKTFPDYF+V  + ++H
Sbjct  320  CGDVPVTINDPGCTRKTFPDYFDVFGRVAQH  350


 Score =   119 bits (298),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV+V+  D W+ F I+GGQ YKSPG AFVEGDASSASYFLAGAA+TGGTVTVE
Sbjct  120  LKLMERFGVTVDRHDGWEHFSIKGGQVYKSPGKAFVEGDASSASYFLAGAAITGGTVTVE  179

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMGA+V
Sbjct  180  GCGTSSLQGDVKFAEVLEKMGAKV  203



>ref|XP_011034141.1| PREDICTED: LOW QUALITY PROTEIN: 3-phosphoshikimate 1-carboxyvinyltransferase 
2 [Populus euphratica]
Length=500

 Score =   268 bits (685),  Expect(2) = 8e-99, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ + T+NSVTV G PR  SG KHLRA+DVN+NKMPDVAMTLAVVALFADGPT+IRDVA
Sbjct  350  GAKVTQTKNSVTVTGLPRDSSGWKHLRAVDVNVNKMPDVAMTLAVVALFADGPTSIRDVA  409

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SW VKE ERMIA+CTEL KLGATVEEGPDYC+ITPPE+LNVTEIDTY+D RMAMAFSLAA
Sbjct  410  SWGVKEMERMIAICTELGKLGATVEEGPDYCVITPPEKLNVTEIDTYEDRRMAMAFSLAA  469

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C EVPVTIKDPGCTR+TFPDYFEVL++++KH
Sbjct  470  CGEVPVTIKDPGCTRQTFPDYFEVLERYTKH  500


 Score =   120 bits (302),  Expect(2) = 8e-99, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 74/84 (88%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GV +EHSDSWD F IRG QKYKSPGN+F E DASSASYFLAG A+TGG +TVE
Sbjct  271  LKLMERHGVFIEHSDSWDHFFIRG-QKYKSPGNSFFECDASSASYFLAGTAITGGIITVE  329

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT SLQGDVKFAEVLEKMGA+V
Sbjct  330  GCGTDSLQGDVKFAEVLEKMGAKV  353



>ref|NP_973996.1| putative 5-enolpyruvylshikimate-3-phosphate synthase [Arabidopsis 
thaliana]
 gb|AEE32359.1| putative 5-enolpyruvylshikimate-3-phosphate synthase [Arabidopsis 
thaliana]
Length=489

 Score =   256 bits (653),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 136/176 (77%), Gaps = 25/176 (14%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GP R   G +HLRAIDVNMNKMPDVAMTLAVVALFADGPT IRDVA
Sbjct  314  GCKVSWTENSVTVTGPSRDAFGMRHLRAIDVNMNKMPDVAMTLAVVALFADGPTTIRDVA  373

Query  469  SWRVKETERMIAVCTELRK-------------------------LGATVEEGPDYCIITP  365
            SWRVKETERMIA+CTELRK                         LGATVEEG DYC+ITP
Sbjct  374  SWRVKETERMIAICTELRKVKFFFSLSLSVYSAHSKKFCGICVQLGATVEEGSDYCVITP  433

Query  364  PERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            P+++   EIDTYDDHRMAMAFSLAACA+VP+TI DPGCTRKTFPDYF+VL++ +KH
Sbjct  434  PKKVKPAEIDTYDDHRMAMAFSLAACADVPITINDPGCTRKTFPDYFQVLERITKH  489


 Score =   131 bits (330),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVS EHS+SWDRF ++GGQKYKSPGNA+VEGDASSASYFLAGAA+TG TVTVE
Sbjct  234  LKLMERFGVSAEHSESWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE  293

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMG +V
Sbjct  294  GCGTTSLQGDVKFAEVLEKMGCKV  317



>gb|AHL44841.1| 5-enolpyruvylshikimate-3-phosphate synthase, partial [Amaranthus 
spinosus]
Length=497

 Score =   242 bits (618),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + +WTENSVTV GPPR  SG+KHLRAIDVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  367  GCKVTWTENSVTVTGPPRDSSGKKHLRAIDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  426

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPPE+LN T I+TYDDHRMAMAFSLAA
Sbjct  427  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPEKLNPTAIETYDDHRMAMAFSLAA  486

Query  289  CAEVPVTIKDP  257
            CA+VPVTI DP
Sbjct  487  CADVPVTILDP  497


 Score =   133 bits (334),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLMER GVSVEHSDSWDRF IRGGQKYKSPG A+VEGDASSASYFLAGAAVTGGTVTV+
Sbjct  287  IKLMERFGVSVEHSDSWDRFYIRGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTVTVK  346

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMG +V
Sbjct  347  GCGTSSLQGDVKFAEVLEKMGCKV  370



>gb|AHL44843.1| 5-enolpyruvylshikimate-3-phosphate synthase, partial [Amaranthus 
spinosus]
Length=497

 Score =   242 bits (618),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + +WTENSVTV GPPR  SG+KHLRAIDVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  367  GCKVTWTENSVTVTGPPRDSSGKKHLRAIDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  426

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPPE+LN T I+TYDDHRMAMAFSLAA
Sbjct  427  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPEKLNPTAIETYDDHRMAMAFSLAA  486

Query  289  CAEVPVTIKDP  257
            CA+VPVTI DP
Sbjct  487  CADVPVTILDP  497


 Score =   132 bits (331),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            ++LMER GVSVEHSDSWDRF IRGGQKYKSPG A+VEGDASSASYFLAGAAVTGGTVTV+
Sbjct  287  IRLMERFGVSVEHSDSWDRFYIRGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTVTVK  346

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMG +V
Sbjct  347  GCGTSSLQGDVKFAEVLEKMGCKV  370



>gb|AHL44842.1| 5-enolpyruvylshikimate-3-phosphate synthase, partial [Amaranthus 
spinosus]
Length=497

 Score =   241 bits (614),  Expect(2) = 6e-94, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + +WTENSVTV GPPR  SG+KHLRAIDVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  367  GCKVTWTENSVTVTGPPRDSSGKKHLRAIDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  426

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPPE+LN + I+TYDDHRMAMAFSLAA
Sbjct  427  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPEKLNPSAIETYDDHRMAMAFSLAA  486

Query  289  CAEVPVTIKDP  257
            CA+VPVTI DP
Sbjct  487  CADVPVTILDP  497


 Score =   132 bits (331),  Expect(2) = 6e-94, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            ++LMER GVSVEHSDSWDRF IRGGQKYKSPG A+VEGDASSASYFLAGAAVTGGTVTV+
Sbjct  287  IRLMERFGVSVEHSDSWDRFYIRGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTVTVK  346

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMG +V
Sbjct  347  GCGTSSLQGDVKFAEVLEKMGCKV  370



>dbj|BAK08246.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=153

 Score =   272 bits (696),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WT+ SVTV GPPR P GRKHL+A+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  3    GAKVTWTDTSVTVTGPPRQPFGRKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  62

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+A+ TEL KLGATVEEGPDYCIITPPE+LNVT IDTYDDHRMAMAFSLAA
Sbjct  63   SWRVKETERMVAIRTELTKLGATVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMAFSLAA  122

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTI+DPGCTRKTFP+YF+VL  F K+
Sbjct  123  CAEVPVTIRDPGCTRKTFPNYFDVLSTFVKN  153



>emb|CBI38901.3| unnamed protein product [Vitis vinifera]
Length=463

 Score =   260 bits (665),  Expect(3) = 2e-87, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = -1

Query  655  EDGSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRD  476
            + G++ SWTENSVTV GPPR  SGRKHLRAIDVNMN+MPDVA+TLAVVAL+ADGPTAIRD
Sbjct  323  QTGAKVSWTENSVTVTGPPRDSSGRKHLRAIDVNMNEMPDVAITLAVVALYADGPTAIRD  382

Query  475  VASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSL  296
            VASWRVKETERMIA+CTELRKLGATV EGPDYC+ITPPE+LNVT IDTYDDHRMAMAFSL
Sbjct  383  VASWRVKETERMIAICTELRKLGATVVEGPDYCVITPPEKLNVTSIDTYDDHRMAMAFSL  442

Query  295  AACAEVPVTIKDPGCTRKTFP  233
            AACA+VPVTIKDPGCT++  P
Sbjct  443  AACADVPVTIKDPGCTKEKLP  463


 Score = 90.1 bits (222),  Expect(3) = 2e-87, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 68/85 (80%), Gaps = 14/85 (16%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDR-FLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtV  712
            LK+MER GVSVEH ++WDR FLIRGG+KY             +ASYFLAGAAVTGGTVTV
Sbjct  257  LKVMERFGVSVEHGNTWDRRFLIRGGKKY-------------NASYFLAGAAVTGGTVTV  303

Query  711  EGCGTSSLQGDVKFAEVLEKMGAEV  637
            EGCGTSSLQGDVKFAEVLE+ GA+V
Sbjct  304  EGCGTSSLQGDVKFAEVLEQTGAKV  328


 Score = 21.9 bits (45),  Expect(3) = 2e-87, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -1

Query  907  PYVEMTIKV  881
            PYVEMT+KV
Sbjct  251  PYVEMTLKV  259



>ref|XP_002972123.1| hypothetical protein SELMODRAFT_270937 [Selaginella moellendorffii]
 gb|EFJ27040.1| hypothetical protein SELMODRAFT_270937 [Selaginella moellendorffii]
Length=453

 Score =   236 bits (603),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+   WTE+SVTV GPP +    + L+ IDVNMN MPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  303  GATVEWTESSVTVTGPPVSAKTGRRLKGIDVNMNAMPDVAMTLAVVALYADGPTAIRDVA  362

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYCIITPP+ +    IDTYDDHRMAMAFSLAA
Sbjct  363  SWRVKETERMIAICTELRKLGATVEEGPDYCIITPPKTIKPAAIDTYDDHRMAMAFSLAA  422

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFS  203
            C + P+TI DP C RKTFP YF+V    +
Sbjct  423  CGDTPITINDPSCVRKTFPTYFDVFSSMA  451


 Score =   110 bits (276),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSV+    W++F I G Q Y+SPG A+VEGDASSASYFLAGAA+TGGTV VE
Sbjct  223  LKLMERFGVSVQRYGGWEKFTIAGNQTYRSPGKAYVEGDASSASYFLAGAAITGGTVKVE  282

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFA+VLEKMGA V
Sbjct  283  GCGTTSLQGDVKFAKVLEKMGATV  306



>ref|XP_002993040.1| hypothetical protein SELMODRAFT_162776 [Selaginella moellendorffii]
 gb|EFJ05879.1| hypothetical protein SELMODRAFT_162776 [Selaginella moellendorffii]
Length=453

 Score =   236 bits (601),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+   WTE+SVTV GPP +    + L+ IDVNMN MPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  303  GATVEWTESSVTVTGPPVSTKTGRRLKGIDVNMNAMPDVAMTLAVVALYADGPTAIRDVA  362

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEGPDYCIITPP+ +    IDTYDDHRMAMAFSLAA
Sbjct  363  SWRVKETERMIAICTELRKLGATVEEGPDYCIITPPKTIKPAAIDTYDDHRMAMAFSLAA  422

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFS  203
            C   P+TI DP C RKTFP YF+V    +
Sbjct  423  CGGTPITINDPSCVRKTFPTYFDVFSSMA  451


 Score =   112 bits (279),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSV+   +W++F I G Q Y+SPG A+VEGDASSASYFLAGAA+TGGTV VE
Sbjct  223  LKLMERFGVSVQRYGAWEKFTIAGNQTYRSPGKAYVEGDASSASYFLAGAAITGGTVKVE  282

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFA+VLEKMGA V
Sbjct  283  GCGTTSLQGDVKFAKVLEKMGATV  306



>gb|AAT45236.1| 5-enol-pyruvylshikimate-phosphate synthase, partial [Erigeron 
annuus]
Length=358

 Score =   211 bits (536),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SGRKHLRA+DVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  250  GAEVTWTENSVTVKGPPRDSSGRKHLRAVDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  309

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDD  323
            SWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LNVT IDTYDD
Sbjct  310  SWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLNVTAIDTYDD  358


 Score =   136 bits (342),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEHSDSWDRF IRGGQKYKSPGNA+VEGDASSASYFLAGAA+TGGT+TVE
Sbjct  170  LKLMERFGVSVEHSDSWDRFFIRGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTITVE  229

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVL +MGAEV
Sbjct  230  GCGTSSLQGDVKFAEVLGQMGAEV  253



>dbj|BAE20403.1| 5-enolpyruvylshikimate-3-phosphate synthase [Lactuca sativa]
Length=231

 Score =   211 bits (536),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR PSGRKHLRA+DVNMNKMPDVAMTLAVVAL+ADGPT IRDVA
Sbjct  122  GAEVTWTENSVTVKGPPRNPSGRKHLRAVDVNMNKMPDVAMTLAVVALYADGPTTIRDVA  181

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDH  320
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPPE+LNV  IDTYDDH
Sbjct  182  SWRVKETERMIAICTELRKLGATVEEGADYCVITPPEKLNVAAIDTYDDH  231


 Score =   135 bits (339),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEH+DSWDRF +RGGQKYKSPGNA+VEGDASSASYFLAGAA+TGGT+TVE
Sbjct  42   LKLMERFGVSVEHTDSWDRFFVRGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTITVE  101

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVL +MGAEV
Sbjct  102  GCGTSSLQGDVKFAEVLGQMGAEV  125



>dbj|BAE20404.1| 5-enolpyruvylshikimate-3-phosphate synthase [Lactuca sativa]
Length=231

 Score =   213 bits (541),  Expect(2) = 8e-85, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVTVKGPPR PSGRKHLR +DVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  122  GAQVTWTENSVTVKGPPRDPSGRKHLRPVDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  181

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDH  320
            SWRVKETERMIA+CTELRKLGATVEEGPDYCIITPP +LNVT IDTYDDH
Sbjct  182  SWRVKETERMIAICTELRKLGATVEEGPDYCIITPPXKLNVTAIDTYDDH  231


 Score =   129 bits (325),  Expect(2) = 8e-85, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSV+HSD+WDRF ++GGQKYKSPGNA+VEGDASSASYFLAGAA+TGGT+TVE
Sbjct  42   LKLMERFGVSVQHSDTWDRFHVQGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTITVE  101

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVL +MGA+V
Sbjct  102  GCGTSSLQGDVKFAEVLGQMGAQV  125



>gb|AAK20397.1|AF349754_1 5-enolpyruvylshikimate 3-phosphate synthase [Lolium rigidum]
Length=347

 Score =   216 bits (549),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WT+ SVTV GPPR P GRKHL+A+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  233  GAKVTWTDTSVTVTGPPRQPFGRKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  292

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMA  305
            SWRVKETERM+A+CTEL KLGATVEEGPDYCIITPPE+LNVT IDTYDDHRMAMA
Sbjct  293  SWRVKETERMVAICTELTKLGATVEEGPDYCIITPPEKLNVTAIDTYDDHRMAMA  347


 Score =   126 bits (316),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV+ EHSDSWDRF I+GGQK KSPGNA+VEGDASSASYFLAGAA+TGGTVTV+
Sbjct  153  LRLMERFGVTAEHSDSWDRFYIKGGQKXKSPGNAYVEGDASSASYFLAGAAITGGTVTVQ  212

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  213  GCGTTSLQGDVKFAEVLEMMGAKV  236



>ref|XP_001760785.1| predicted protein [Physcomitrella patens]
 gb|EDQ74524.1| predicted protein [Physcomitrella patens]
Length=454

 Score =   221 bits (564),  Expect(2) = 6e-84, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++  WTE+SVTV G P  P   K L++IDV+MN MPDVAMTLAV+ LF+DGP AIRDV 
Sbjct  304  GAKVEWTEHSVTVTGAPVDPRTGKRLKSIDVDMNAMPDVAMTLAVLGLFSDGPVAIRDVE  363

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKETERM A+  EL KLGA VEEG DYCI+TPP+R+   +I+TYDDHRMAMAFSLAA
Sbjct  364  NWRVKETERMRAIVDELTKLGAEVEEGQDYCIVTPPKRITPAKIETYDDHRMAMAFSLAA  423

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C +VP+TI DPGCTRKTFP YF  L+K  +H
Sbjct  424  CGDVPITILDPGCTRKTFPTYFTELEKLCQH  454


 Score =   117 bits (294),  Expect(2) = 6e-84, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV VE    W+RF I+GGQ YKSPGNA+VEGDASSASYFLAGAAVTGGT+TVE
Sbjct  224  LRLMERFGVKVERHGGWERFSIKGGQTYKSPGNAYVEGDASSASYFLAGAAVTGGTITVE  283

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFA VLEKMGA+V
Sbjct  284  GCGTSSLQGDVKFAAVLEKMGAKV  307



>gb|AAT45237.1| 5-enol-pyruvylshikimate-phosphate synthase [Erigeron annuus]
Length=360

 Score =   202 bits (514),  Expect(2) = 9e-83, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +WTENSVTVKGPPR  SGR HLR +DVNMNKMPDVAMTLAVVAL+A+GPTAIRDVA
Sbjct  252  GAEVTWTENSVTVKGPPRNSSGRGHLRPVDVNMNKMPDVAMTLAVVALYABGPTAIRDVA  311

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDD  323
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPPE+LNVT IDTYDD
Sbjct  312  SWRVKETERMIAICTELRKLGATVEEGTDYCVITPPEKLNVTAIDTYDD  360


 Score =   133 bits (334),  Expect(2) = 9e-83, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEH+D+WDRF +RGGQKYKSPGNA+VEGDASSASYFLAGAA+TGGTVTVE
Sbjct  172  LKLMERFGVSVEHNDTWDRFHVRGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVE  231

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVL +MGAEV
Sbjct  232  GCGTSSLQGDVKFAEVLGQMGAEV  255



>ref|XP_001771376.1| predicted protein [Physcomitrella patens]
 gb|EDQ63766.1| predicted protein [Physcomitrella patens]
Length=473

 Score =   214 bits (544),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+   W +++VTV G P   +  K L+AIDV+MN MPDVAMTLAV+ LFADGP AIRDV 
Sbjct  323  GATVQWGDHTVTVTGAPADFTTGKRLKAIDVDMNAMPDVAMTLAVLGLFADGPVAIRDVE  382

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKETERM A+  EL KLGA VEEG DYCI+TPP+R+   ++DTYDDHRMAMAFSLAA
Sbjct  383  NWRVKETERMRAIVDELTKLGAEVEEGQDYCIVTPPKRITPAKVDTYDDHRMAMAFSLAA  442

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C +  +TI+DPGCTRKTFP YF  L+K  +H
Sbjct  443  CGDTAITIRDPGCTRKTFPTYFTELEKLCQH  473


 Score =   118 bits (295),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV V+  D W+RF I+GGQ YKSPG+A+VEGDASSASYFLAGAAVTGGT+TVE
Sbjct  243  LRLMERFGVKVDRHDGWERFSIKGGQTYKSPGSAYVEGDASSASYFLAGAAVTGGTITVE  302

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLEKMGA V
Sbjct  303  GCGTTSLQGDVKFAEVLEKMGATV  326



>gb|AAT45234.1| 5-enol-pyruvylshikimate-phosphate synthase, partial [Amaranthus 
tuberculatus]
Length=357

 Score =   197 bits (501),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + +WT+NSVTV GPPR  SGRKHLRAIDVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  250  GCKVTWTDNSVTVTGPPRESSGRKHLRAIDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  309

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYD  326
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPPE+LN T I+TYD
Sbjct  310  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPEKLNPTAIETYD  357


 Score =   131 bits (329),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            ++LMER GVSVEHSDSWDRF IRGGQKYKSPG A+VEGDASSASYFLAGAAVTGGTVTV+
Sbjct  170  IRLMERFGVSVEHSDSWDRFFIRGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTVTVK  229

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMG +V
Sbjct  230  GCGTSSLQGDVKFAEVLEKMGCKV  253



>gb|EMT11485.1| 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic [Aegilops 
tauschii]
Length=153

 Score =   250 bits (639),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 132/151 (87%), Gaps = 6/151 (4%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WT+ SVT+ GPPR P GRKHL+A+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  2    GAKVTWTDTSVTITGPPRQPFGRKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  61

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERM+ + TEL K      EGPDYCII PPE+LN+T IDTYDDHRMAMAFSLAA
Sbjct  62   SWRVKETERMVVIRTELTK------EGPDYCIIMPPEKLNITAIDTYDDHRMAMAFSLAA  115

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            CAEVPVTI+DPGCTRKTFP+YF+VL  F K+
Sbjct  116  CAEVPVTIRDPGCTRKTFPNYFDVLSTFVKN  146



>emb|CDX74729.1| BnaA05g04750D [Brassica napus]
Length=435

 Score =   224 bits (570),  Expect(2) = 5e-79, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G + SWTENSVTV GP R   G +HL A+DVNM+KMPDVAMTLAVVALFADGPT IRDVA
Sbjct  147  GCKVSWTENSVTVTGPSRDAFGMRHLGAVDVNMDKMPDVAMTLAVVALFADGPTTIRDVA  206

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            SWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP ++   EIDTYDDHRMAM FSLAA
Sbjct  207  SWRVKETERMIAICTELRKLGATVEEGSDYCVITPPAKVKPAEIDTYDDHRMAMTFSLAA  266

Query  289  CAEVPVTIKDPGCTRKTF  236
            CA+VPVTIKD   T   F
Sbjct  267  CADVPVTIKDLSLTTSKF  284


 Score = 99.4 bits (246),  Expect(2) = 5e-79, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 58/76 (76%), Gaps = 11/76 (14%)
 Frame = -2

Query  864  VSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVEGCGTSSLQ  685
            VS EHSDSWDRF ++GG KYKSPGNA+VEGDAS              TVTVEGCGT+SLQ
Sbjct  86   VSAEHSDSWDRFFVKGGHKYKSPGNAYVEGDASIGE-----------TVTVEGCGTTSLQ  134

Query  684  GDVKFAEVLEKMGAEV  637
            GDVKFAEVLEKMG +V
Sbjct  135  GDVKFAEVLEKMGCKV  150



>gb|ABK26355.1| unknown [Picea sitchensis]
Length=148

 Score =   241 bits (616),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 127/149 (85%), Gaps = 4/149 (3%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WTENSVTV G  +     K L  IDVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  2    GAKVTWTENSVTVTGAQKG----KRLHGIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  57

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKETERM+A+CTELRKLGATVEEG DYCIITPPE+L    IDTYDDHRMAMAFSLAA
Sbjct  58   NWRVKETERMVAICTELRKLGATVEEGHDYCIITPPEKLKRASIDTYDDHRMAMAFSLAA  117

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFS  203
            C +VPVTI DP CTRKTFPDYF+V ++ S
Sbjct  118  CGDVPVTINDPSCTRKTFPDYFDVFRRVS  146



>ref|XP_009376251.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2 [Pyrus 
x bretschneideri]
Length=119

 Score =   235 bits (599),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/119 (93%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = -1

Query  553  MNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCI  374
            MN MPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIA+CTELRKLGATVEEGPDYCI
Sbjct  1    MNNMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAICTELRKLGATVEEGPDYCI  60

Query  373  ITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            ITPPE+LNVT IDTYDDHRMAMAFSLAAC +VPVTIKDPGCTRKTFPDYFEVL+KF+KH
Sbjct  61   ITPPEKLNVTAIDTYDDHRMAMAFSLAACGDVPVTIKDPGCTRKTFPDYFEVLRKFTKH  119



>ref|XP_009375142.1| PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2-like 
[Pyrus x bretschneideri]
Length=119

 Score =   234 bits (596),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/119 (92%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = -1

Query  553  MNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCI  374
            MNKMPD+AMTLAVVALFADGPTAIRDVASWRVKETERMIA+CTELRKLGATVEEGPDYCI
Sbjct  1    MNKMPDIAMTLAVVALFADGPTAIRDVASWRVKETERMIAICTELRKLGATVEEGPDYCI  60

Query  373  ITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            ITPPE+LNVT IDTYDDHRMAMAFSLAAC +VPVTIK PGCTRKTFPDYFEVL+KF+KH
Sbjct  61   ITPPEKLNVTAIDTYDDHRMAMAFSLAACGDVPVTIKAPGCTRKTFPDYFEVLRKFTKH  119



>ref|XP_003059707.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55659.1| predicted protein [Micromonas pusilla CCMP1545]
Length=459

 Score =   203 bits (516),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 112/150 (75%), Gaps = 9/150 (6%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++  W +N VTV GP         L+AIDVNMN MPD AMTLAV AL+ADG T IRDVA
Sbjct  313  GAKVEWGKNDVTVTGPG------GKLKAIDVNMNAMPDAAMTLAVAALYADGVTTIRDVA  366

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTE---IDTYDDHRMAMAFS  299
            SWRVKETERMIA+CTELRKLG  V EG DYC+ITPP    + E   +DTYDDHRMAMAFS
Sbjct  367  SWRVKETERMIAICTELRKLGCDVFEGEDYCVITPPASGKINEGIDVDTYDDHRMAMAFS  426

Query  298  LAACAEVPVTIKDPGCTRKTFPDYFEVLQK  209
            LAAC  V VTI DP CT+KTFP+YF+ L +
Sbjct  427  LAACGGVGVTINDPTCTKKTFPNYFDALAE  456


 Score = 96.7 bits (239),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLMER GV V   D   RF+++GGQ YKSPG AFVEGDASSASYFLAGA +TGG V V 
Sbjct  233  VKLMERFGVEVGVFDDMQRFVVKGGQTYKSPGEAFVEGDASSASYFLAGATITGGKVKVI  292

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT SLQGD KFA+ +  MGA+V
Sbjct  293  GCGTDSLQGDTKFADTMGLMGAKV  316



>ref|XP_002505432.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66690.1| predicted protein [Micromonas sp. RCC299]
Length=229

 Score =   201 bits (511),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 109/148 (74%), Gaps = 9/148 (6%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++  W +N VTV GP         L+AIDVNMN MPD AMTLAV AL+ADG T IRDV 
Sbjct  83   GAKVEWGKNDVTVTGPG------GKLKAIDVNMNAMPDAAMTLAVAALYADGVTTIRDVG  136

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTE---IDTYDDHRMAMAFS  299
            SWRVKETERMIA+CTE+RKLG  V EG DYC+ITPP    + E   IDTYDDHRMAMAFS
Sbjct  137  SWRVKETERMIAICTEMRKLGCDVYEGADYCVITPPGSGKINEGVSIDTYDDHRMAMAFS  196

Query  298  LAACAEVPVTIKDPGCTRKTFPDYFEVL  215
            LAAC  V VTI DP CT+KTFP YF+ L
Sbjct  197  LAACGGVGVTIMDPTCTKKTFPTYFDAL  224


 Score = 97.1 bits (240),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLMER GV V+  D   RF+++GGQ Y+SPG AFVEGDASSASYFLAGAA+TGG V V 
Sbjct  3    VKLMERFGVEVQVFDDMQRFVVKGGQTYQSPGEAFVEGDASSASYFLAGAAITGGKVKVI  62

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT SLQGD KFA+ +  MGA+V
Sbjct  63   GCGTDSLQGDTKFADTMGLMGAKV  86



>ref|XP_001422572.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00889.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=436

 Score =   204 bits (519),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 115/157 (73%), Gaps = 13/157 (8%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+   W  NSVT  GP      +  L+AIDVNMN MPD AMTLAV ALFADG T IRDVA
Sbjct  286  GATLEWGPNSVTCTGP------KGPLKAIDVNMNAMPDAAMTLAVAALFADGITTIRDVA  339

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN-------VTEIDTYDDHRMA  311
            SWRVKETERMIA+CTELRKLG  V EG DYC+ITPP +L+         +IDTYDDHRMA
Sbjct  340  SWRVKETERMIAICTELRKLGCDVFEGADYCVITPPHKLDPPAKMKANVDIDTYDDHRMA  399

Query  310  MAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK  200
            MAF+LAAC +V V I DP CT+KTFP YF+VL+  +K
Sbjct  400  MAFALAACGDVDVVINDPKCTKKTFPTYFDVLKSVAK  436


 Score = 93.2 bits (230),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            + LMER GV VE +D    F I+GGQKY SPG+AFVEGDASSASYFLAGA +TGGTVTV 
Sbjct  206  ITLMERFGVKVEKADDLQSFKIQGGQKYISPGSAFVEGDASSASYFLAGATITGGTVTVI  265

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCG+ S+QGD  FA  +E+MGA +
Sbjct  266  GCGSESIQGDTNFAYTMEQMGATL  289



>gb|AHF20163.1| 5-enolpyruvylshikimate-3-phosphate synthase, partial [Musa acuminata 
AAA Group]
Length=157

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -1

Query  556  NMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYC  377
             ++ MPDVAMTLAVVALFADGPTAIRDVASWRVKETERM+A+CTELRKLGATVEEGPD+C
Sbjct  38   TIHPMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMVAICTELRKLGATVEEGPDFC  97

Query  376  IITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            IITPPE+LN+T IDTYDDHRMAMAFS+AACA+VPVTI+DPGCTRKTFPDYF+VLQ+F+KH
Sbjct  98   IITPPEKLNITAIDTYDDHRMAMAFSIAACADVPVTIRDPGCTRKTFPDYFDVLQRFTKH  157



>ref|XP_005645595.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21051.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Coccomyxa subellipsoidea 
C-169]
Length=436

 Score =   202 bits (514),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 112/145 (77%), Gaps = 5/145 (3%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +W   S+T+ GPPR      +L+ ID + N +PD AMTLAV ALFA+GPT IR+V 
Sbjct  290  GADVTWGPYSITITGPPRG-----NLQGIDHDCNDIPDAAMTLAVAALFAEGPTRIRNVY  344

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKETERM A+  EL KLGA VEEG DYC+ITPPE+L    IDTYDDHRMAMAFSLAA
Sbjct  345  NWRVKETERMKAIVAELGKLGAQVEEGRDYCVITPPEKLKRVAIDTYDDHRMAMAFSLAA  404

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVL  215
            C +VPVTI DPGCTRKTFP YF+VL
Sbjct  405  CGDVPVTINDPGCTRKTFPTYFDVL  429


 Score = 91.3 bits (225),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            ++LMER GV V+  D      I  GQ Y SPG A+VEGDASSASYFLAGA +TGGT+TVE
Sbjct  210  IRLMERFGVKVDRLDGLQHMHIPPGQTYVSPGEAYVEGDASSASYFLAGATITGGTMTVE  269

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCG+ SLQGDV+FAEV+  MGA+V
Sbjct  270  GCGSDSLQGDVRFAEVMGLMGADV  293



>emb|CEG02121.1| RNA 3'-terminal phosphate cyclase/enolpyruvate transferase, alpha/beta 
[Ostreococcus tauri]
Length=474

 Score =   202 bits (513),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 112/153 (73%), Gaps = 13/153 (8%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+   W  NSV   GP      +  L+AIDVNMN MPD AMTLAV ALFADG T IRDVA
Sbjct  324  GATLEWGPNSVKCTGP------QGPLKAIDVNMNAMPDAAMTLAVAALFADGVTTIRDVA  377

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN-------VTEIDTYDDHRMA  311
            SWRVKETERMIA+CTELRKLG  V EG DYC+ITPP +LN         +IDTYDDHRMA
Sbjct  378  SWRVKETERMIAICTELRKLGCDVFEGSDYCVITPPHKLNPPAKMRANVDIDTYDDHRMA  437

Query  310  MAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQ  212
            MAF+LAAC +V V I DP CT+KTFP YF+VL+
Sbjct  438  MAFALAACGDVDVIINDPTCTKKTFPTYFDVLK  470


 Score = 91.7 bits (226),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            + LMER GV VE S     F I+GGQKY SPG+AFVEGDASSASYFLAGA +TGGTVTV 
Sbjct  244  ITLMERFGVKVEKSADLQSFKIQGGQKYVSPGSAFVEGDASSASYFLAGATITGGTVTVI  303

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCG+ S+QGD  FA  +E+MGA +
Sbjct  304  GCGSESIQGDTNFAYTMEQMGATL  327



>gb|EYU31981.1| hypothetical protein MIMGU_mgv1a006251mg [Erythranthe guttata]
Length=450

 Score =   149 bits (376),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G   +WTENSVTVKGPPR  SGRKHLRA+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  369  GCEVTWTENSVTVKGPPRDASGRKHLRAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  428

Query  469  SWRVKETERMIAVCTELRKL  410
            SWRV ETERMIA+CTELRK+
Sbjct  429  SWRVTETERMIAICTELRKV  448


 Score =   142 bits (357),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            LKLMER GVSVEHSDSWDRFLIRGGQKYKSPGNA+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  289  LKLMERFGVSVEHSDSWDRFLIRGGQKYKSPGNAYVEGDASSASYFLAGAAVTGGTVTVE  348

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLEKMG EV
Sbjct  349  GCGTSSLQGDVKFAEVLEKMGCEV  372



>ref|XP_003083034.1| 5-enolpyruvylshikimate-3-phosphate (ISS) [Ostreococcus tauri]
Length=316

 Score =   200 bits (509),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 112/153 (73%), Gaps = 13/153 (8%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+   W  NSV   GP      +  L+AIDVNMN MPD AMTLAV ALFADG T IRDVA
Sbjct  166  GATLEWGPNSVKCTGP------QGPLKAIDVNMNAMPDAAMTLAVAALFADGVTTIRDVA  219

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN-------VTEIDTYDDHRMA  311
            SWRVKETERMIA+CTELRKLG  V EG DYC+ITPP +LN         +IDTYDDHRMA
Sbjct  220  SWRVKETERMIAICTELRKLGCDVFEGSDYCVITPPHKLNPPAKMRANVDIDTYDDHRMA  279

Query  310  MAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQ  212
            MAF+LAAC +V V I DP CT+KTFP YF+VL+
Sbjct  280  MAFALAACGDVDVIINDPTCTKKTFPTYFDVLK  312


 Score = 90.9 bits (224),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            + LMER GV VE S     F I+GGQKY SPG+AFVEGDASSASYFLAGA +TGGTVTV 
Sbjct  86   ITLMERFGVKVEKSADLQSFKIQGGQKYVSPGSAFVEGDASSASYFLAGATITGGTVTVI  145

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCG+ S+QGD  FA  +E+MGA +
Sbjct  146  GCGSESIQGDTNFAYTMEQMGATL  169



>ref|XP_007509973.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Bathycoccus prasinos]
 emb|CCO19088.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Bathycoccus prasinos]
Length=496

 Score =   196 bits (498),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 109/147 (74%), Gaps = 7/147 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+   WT NSVT  GP         L+AIDVNMN MPD AMTLAV ALFADG T IRDVA
Sbjct  348  GATLEWTANSVTCTGPKDG-----KLKAIDVNMNAMPDAAMTLAVAALFADGTTTIRDVA  402

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPE-RLNV-TEIDTYDDHRMAMAFSL  296
            SWRVKETERMIA+CTE RKLGA V EG DYC+ITPP+   N    IDTYDDHRMAMAF+L
Sbjct  403  SWRVKETERMIAICTETRKLGAEVVEGSDYCVITPPKGGFNKGVAIDTYDDHRMAMAFAL  462

Query  295  AACAEVPVTIKDPGCTRKTFPDYFEVL  215
            AAC +  + I DP  T+KTFP+YF+VL
Sbjct  463  AACGDENIIINDPKVTKKTFPNYFDVL  489


 Score = 94.4 bits (233),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLMER GV V+ ++    F I+GGQ YKSPG+ FVEGDASSASYFLAGA +TGG VTVE
Sbjct  268  IKLMERFGVKVDAAEDLQSFKIQGGQTYKSPGSIFVEGDASSASYFLAGATITGGKVTVE  327

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCG  S+QGD KFA  +E+MGA +
Sbjct  328  GCGLDSIQGDTKFAYTMEQMGATL  351


 Score = 21.9 bits (45),  Expect(3) = 2e-69, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -1

Query  907  PYVEMTIKV  881
            PYVEMTIK+
Sbjct  262  PYVEMTIKL  270



>gb|ABM68632.1| plastid EPSP synthase [Dunaliella salina]
Length=514

 Score =   204 bits (518),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 115/151 (76%), Gaps = 3/151 (2%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++  W+  S+ + GP    +  K L+ ID + N +PD AMTLAV ALFAD PT IR+V 
Sbjct  367  GAKVEWSLYSIKITGPS---AFGKPLQGIDHDCNDIPDAAMTLAVAALFADKPTTIRNVY  423

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKETERM+A+  E RKLGATVEEG DYC+ITPP+++    IDTYDDHRMAMAFSLAA
Sbjct  424  NWRVKETERMVAIVNETRKLGATVEEGRDYCVITPPKQIQSAAIDTYDDHRMAMAFSLAA  483

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            C  VPVTI DPGCTRKTFPDYF VL+  ++H
Sbjct  484  CGPVPVTINDPGCTRKTFPDYFRVLESVTQH  514


 Score = 86.3 bits (212),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +++MER GV+VE  +      I   Q YK+ G AFVEGDASSASYFLAGA +TGGTV VE
Sbjct  287  VQIMERFGVTVERLNGLQHMRIPPNQTYKTSGEAFVEGDASSASYFLAGATITGGTVVVE  346

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCG++S+QGDV+FAEV+  MGA+V
Sbjct  347  GCGSASVQGDVRFAEVMGLMGAKV  370



>gb|ADI18434.1| 5-enolpyruvylshikimate-3-phosphate synthase [uncultured delta 
proteobacterium HF4000_08N17]
Length=427

 Score =   197 bits (502),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 108/150 (72%), Gaps = 8/150 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++  W    V + G          L  IDV+MN+MPD AMTLAV ALFA GPTAIR++ 
Sbjct  286  GAKVEWEPQQVKLTG--------NSLNGIDVDMNQMPDAAMTLAVAALFASGPTAIRNIY  337

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKETER+ AV TELRKLGA VEEG DY +I PPE++   EIDTYDDHRMAMAFSLAA
Sbjct  338  NWRVKETERLQAVSTELRKLGAEVEEGYDYLVIQPPEQIRKAEIDTYDDHRMAMAFSLAA  397

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSK  200
            C E P+TI +PGC  KTFPDYFEVL    +
Sbjct  398  CGESPITINNPGCVSKTFPDYFEVLNGLCR  427


 Score = 88.6 bits (218),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LM   GVSV H +   R      Q Y+SPG+ FVEGDASSASYFLAGAA+T GTVTV+
Sbjct  208  LRLMRSFGVSVNHENF--RLFHIPRQTYRSPGSIFVEGDASSASYFLAGAAITKGTVTVK  265

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT SLQGD +FAEVLEKMGA+V
Sbjct  266  GCGTDSLQGDARFAEVLEKMGAKV  289



>ref|XP_002946713.1| hypothetical protein VOLCADRAFT_79287 [Volvox carteri f. nagariensis]
 gb|EFJ51939.1| hypothetical protein VOLCADRAFT_79287 [Volvox carteri f. nagariensis]
Length=509

 Score =   192 bits (489),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 118/157 (75%), Gaps = 10/157 (6%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++  W+  S+T+ GP  + SG+  +  ID + N +PD AMTLAV ALFAD PTAIR+V 
Sbjct  357  GAKVEWSPYSITITGP--SASGQP-ITGIDHDCNDIPDAAMTLAVAALFADRPTAIRNVY  413

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPE------RLNVTEIDTYDDHRMAM  308
            +WRVKETERM+A+ TELRKLGATVEEG DYCI+TPP       + NV  IDTYDDHRMAM
Sbjct  414  NWRVKETERMVAIVTELRKLGATVEEGRDYCIVTPPPGGVAGVKPNVA-IDTYDDHRMAM  472

Query  307  AFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            AFSL A A VPV I+DPGCTRKTFP YF+V +  +KH
Sbjct  473  AFSLVAAAGVPVIIRDPGCTRKTFPTYFKVFESVAKH  509


 Score = 93.2 bits (230),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLMER GV VE  D      I  GQ+Y SPG A+VEGDASSASYFLAGA +TGGT+TVE
Sbjct  277  VKLMERFGVRVERLDGLQHLRIPAGQRYVSPGEAYVEGDASSASYFLAGATITGGTITVE  336

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCG+ SLQGDV+FAEV+  +GA+V
Sbjct  337  GCGSDSLQGDVRFAEVMGLLGAKV  360



>ref|WP_029734606.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Deltaproteobacteria 
bacterium SCGC AAA003-F15]
Length=427

 Score =   197 bits (500),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 107/148 (72%), Gaps = 8/148 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++  W    V + G          L  IDV+MN+MPD AMTLAV ALFA GPTAIR++ 
Sbjct  286  GAKVEWEPQQVKLTG--------NSLNGIDVDMNQMPDAAMTLAVAALFASGPTAIRNIY  337

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKETER+ AV TELRKLGA VEEG DY +I PPE++   EIDTYDDHRMAMAFSLAA
Sbjct  338  NWRVKETERLQAVSTELRKLGAEVEEGYDYLVIQPPEQIRKAEIDTYDDHRMAMAFSLAA  397

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKF  206
            C E P+TI +PGC  KTFPDYFEVL   
Sbjct  398  CGESPMTINNPGCVSKTFPDYFEVLNGL  425


 Score = 87.8 bits (216),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LM   GVSV H +   R      Q Y+SPG+ FVEGDASSASYFLAGAA+T GTVTV+
Sbjct  208  LRLMRSFGVSVNHENF--RLFHIPRQTYRSPGSIFVEGDASSASYFLAGAAITKGTVTVK  265

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT SLQGD +FAEV+EKMGA+V
Sbjct  266  GCGTDSLQGDARFAEVMEKMGAKV  289



>ref|XP_005647657.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23113.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Coccomyxa subellipsoidea 
C-169]
Length=434

 Score =   192 bits (487),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 108/147 (73%), Gaps = 5/147 (3%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+   W+  S+T+ GP R       L+ ID + N +PD AMTLAV A+FA+G T IR+V 
Sbjct  288  GADVRWSPYSITITGPARG-----SLKGIDHDCNDIPDAAMTLAVAAIFAEGQTRIRNVY  342

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKETERM A+  EL KLGA VEEG DYC+ITPP +L    IDTYDDHRMAMAFSLAA
Sbjct  343  NWRVKETERMKAIVAELGKLGADVEEGRDYCVITPPAQLKPAAIDTYDDHRMAMAFSLAA  402

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQK  209
            C +VPVTI DPGCTRKTFP YF VL+ 
Sbjct  403  CGDVPVTINDPGCTRKTFPTYFSVLES  429


 Score = 92.0 bits (227),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            ++LMER GV VE  D      I  GQ Y SPG +FVEGDASSASYFLAGA +TGGT+TVE
Sbjct  208  VRLMERFGVKVERLDGLQHMHIPPGQTYVSPGESFVEGDASSASYFLAGATITGGTMTVE  267

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCG+ SLQGDV+FAEV+  MGA+V
Sbjct  268  GCGSDSLQGDVRFAEVMGLMGADV  291



>ref|XP_001702942.1| 5-enolpyruvylshikimate-3-phosphate synthase [Chlamydomonas reinhardtii]
 gb|EDO96795.1| 5-enolpyruvylshikimate-3-phosphate synthase [Chlamydomonas reinhardtii]
Length=512

 Score =   190 bits (482),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 115/157 (73%), Gaps = 10/157 (6%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++  W+  S+T+ GP    +  K +  ID + N +PD AMTLAV ALFAD PTAIR+V 
Sbjct  360  GAKVEWSPYSITITGPS---AFGKPITGIDHDCNDIPDAAMTLAVAALFADRPTAIRNVY  416

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPE------RLNVTEIDTYDDHRMAM  308
            +WRVKETERM+A+ TELRKLGA VEEG DYCI+TPP       + NV  IDTYDDHRMAM
Sbjct  417  NWRVKETERMVAIVTELRKLGAEVEEGRDYCIVTPPPGGVKGVKANVG-IDTYDDHRMAM  475

Query  307  AFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
            AFSL A A VPV I+DPGCTRKTFP YF+V +  ++H
Sbjct  476  AFSLVAAAGVPVVIRDPGCTRKTFPTYFKVFESVAQH  512


 Score = 92.0 bits (227),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLMER GV VE  +      I  GQ YK+PG A+VEGDASSASYFLAGA +TGGTVTVE
Sbjct  280  VKLMERFGVVVERLNGLQHLRIPAGQTYKTPGEAYVEGDASSASYFLAGATITGGTVTVE  339

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCG+ SLQGDV+FAEV+  +GA+V
Sbjct  340  GCGSDSLQGDVRFAEVMGLLGAKV  363



>gb|KJB49296.1| hypothetical protein B456_008G113600 [Gossypium raimondii]
Length=453

 Score =   149 bits (377),  Expect(3) = 1e-66, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WT+NSVTV GPPR  SGRKHLRAIDVNMNKMPDVAMTLAVVAL+ADGPTAIRDVA
Sbjct  371  GAKVTWTKNSVTVTGPPRNSSGRKHLRAIDVNMNKMPDVAMTLAVVALYADGPTAIRDVA  430

Query  469  SWRVKETERMIAVCTELRKL  410
            SWRVKETERMIA+CTELRK+
Sbjct  431  SWRVKETERMIAICTELRKV  450


 Score =   131 bits (329),  Expect(3) = 1e-66, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            +KLM+R GV+VEH+DSWDRF IRGGQKY SPGNA+VEGDASSASYFLAGAAVTGGTVTVE
Sbjct  291  IKLMKRFGVTVEHTDSWDRFFIRGGQKYMSPGNAYVEGDASSASYFLAGAAVTGGTVTVE  350

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGTSSLQGDVKFAEVLE MGA+V
Sbjct  351  GCGTSSLQGDVKFAEVLEMMGAKV  374


 Score = 21.9 bits (45),  Expect(3) = 1e-66, Method: Compositional matrix adjust.
 Identities = 8/9 (89%), Positives = 9/9 (100%), Gaps = 0/9 (0%)
 Frame = -1

Query  907  PYVEMTIKV  881
            PYVEMTIK+
Sbjct  285  PYVEMTIKL  293



>ref|WP_019307719.1| hypothetical protein [SAR324 cluster bacterium SCGC AAA240-J09]
Length=427

 Score =   191 bits (484),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 105/145 (72%), Gaps = 8/145 (6%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++  W    V + G          L  IDV+MN+MPD AMTL V +LFA GPTAIR++ 
Sbjct  286  GAKVEWEPQQVKLTG--------NSLNGIDVDMNQMPDAAMTLVVASLFASGPTAIRNIY  337

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKETER+ AV  ELRKLGA VEEG DY +I PPE++   EIDTY+DHRMAMAFSLAA
Sbjct  338  NWRVKETERLQAVSKELRKLGAEVEEGYDYLVIQPPEQIRKAEIDTYEDHRMAMAFSLAA  397

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVL  215
            C E P+TI +PGC  KTFPDYFEVL
Sbjct  398  CGESPITINNPGCVSKTFPDYFEVL  422


 Score = 87.0 bits (214),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LM+  GVSV H +   R      Q Y+SPG+  VEGDASSASYFLAGAA+T GTVTV+
Sbjct  208  LRLMQSFGVSVNHENF--RLFHIPRQTYRSPGSIIVEGDASSASYFLAGAAITKGTVTVK  265

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT SLQGD +FAEVLEKMGA+V
Sbjct  266  GCGTDSLQGDARFAEVLEKMGAKV  289



>ref|XP_011397128.1| 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM24241.1| 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic [Auxenochlorella 
protothecoides]
Length=447

 Score =   185 bits (470),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 107/150 (71%), Gaps = 6/150 (4%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+   W  +++T+ GPP  P G   LR +D     +PD AMTLAV ALFA G T IRDV 
Sbjct  301  GASVDWAPHTITITGPP--PGG---LRGVDAGCVDIPDAAMTLAVAALFAHGATTIRDVG  355

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPP-ERLNVTEIDTYDDHRMAMAFSLA  293
            SWRVKETERM A+C EL KLGA+VEEG   C+ITPP   +   EI+TYDDHRMAMAFSLA
Sbjct  356  SWRVKETERMKAICAELGKLGASVEEGETSCVITPPVGGVRAAEIETYDDHRMAMAFSLA  415

Query  292  ACAEVPVTIKDPGCTRKTFPDYFEVLQKFS  203
            AC   P+TI DPGCTRKTFP YF+VL+  +
Sbjct  416  ACGGQPITILDPGCTRKTFPTYFDVLEGVT  445


 Score = 91.3 bits (225),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV+V   +      I  GQ+Y SPG  FVEGDASSASYFLAGAA+TGG +TV 
Sbjct  221  LRLMERFGVTVHRLEGLQHLHIPAGQRYASPGTVFVEGDASSASYFLAGAAITGGRLTVH  280

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCG+ SLQGDV+FAEVL  MGA V
Sbjct  281  GCGSDSLQGDVRFAEVLGAMGASV  304



>ref|WP_018051446.1| hypothetical protein, partial [SAR324 cluster bacterium SCGC 
AB-629-O05]
Length=310

 Score =   191 bits (486),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 107/148 (72%), Gaps = 8/148 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++  W    + + G          L  IDV+MN+MPD AMTLAV ALFA GPTAIR++ 
Sbjct  169  GAKVEWEPQQIKLTG--------NSLNGIDVDMNQMPDAAMTLAVAALFAFGPTAIRNIY  220

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WR+KETER+ AV TELRKLGA VEEG DY +I PPE++   EIDTYDDHR+AMAFSLAA
Sbjct  221  NWRIKETERLQAVSTELRKLGAEVEEGYDYLVIQPPEQIRKAEIDTYDDHRIAMAFSLAA  280

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKF  206
            C E P+TI +PGC  KTFPDYFEVL   
Sbjct  281  CGESPMTINNPGCVSKTFPDYFEVLNGL  308


 Score = 83.6 bits (205),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 63/84 (75%), Gaps = 2/84 (2%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LM   GVSV H +   R      Q Y+SPG+  VEGDASSASYFLAGAA+T GTVTV+
Sbjct  91   LRLMRSFGVSVNHENF--RLFQIPRQTYRSPGSIVVEGDASSASYFLAGAAITKGTVTVK  148

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCG  SLQGD +FAEVLEKMGA+V
Sbjct  149  GCGIDSLQGDARFAEVLEKMGAKV  172



>ref|WP_010151544.1| 3-phosphoshikimate 1-carboxyvinyltransferase [SAR324 cluster 
bacterium JCVI-SC AAA005]
Length=431

 Score =   187 bits (475),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 110/149 (74%), Gaps = 7/149 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+   W  N +TV+G     SG  +L+ ID++MN+MPD AMTLAV ALFA G TAIR++ 
Sbjct  286  GAEVGWQANKITVQG-----SG--NLKGIDMDMNEMPDAAMTLAVTALFAKGTTAIRNIY  338

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WR+KETER+ AV  EL+KLGA+V+EG DY II PP  L   EI TYDDHRMAMAFSLAA
Sbjct  339  NWRLKETERLKAVSCELKKLGASVDEGEDYLIIVPPRELMPAEISTYDDHRMAMAFSLAA  398

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFS  203
            C+EVP+TI +P C  KTFPDYF  L K +
Sbjct  399  CSEVPITILNPTCVNKTFPDYFNQLSKLT  427


 Score = 87.4 bits (215),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            ++LM R GV+V  S+ +  F I   Q Y+SP   FVEGDASSASYFLAGAA+TGG+VTV 
Sbjct  206  IRLMSRFGVNVVVSEDFRNFYINAPQNYQSPETYFVEGDASSASYFLAGAAITGGSVTVV  265

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT SLQGD +FA+VLE MGAEV
Sbjct  266  GCGTESLQGDAQFAKVLEMMGAEV  289



>ref|WP_043954047.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter sp. 
YD4]
 gb|KIS42912.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter sp. 
YD4]
Length=427

 Score =   173 bits (439),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  298  RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGA  357

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
            TVEEG DY  ITPPE+L   EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  358  TVEEGEDYIRITPPEKLQFAEIGTYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYF  417

Query  223  EVLQKFS  203
            E L + S
Sbjct  418  EQLARIS  424


 Score = 90.9 bits (224),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LME  GV VE+   + RF++RGGQ+Y+SPG   VEGDASSASYFLA  A+ GGTV V 
Sbjct  205  LHLMETFGVVVENQ-HYQRFVVRGGQQYQSPGQYLVEGDASSASYFLAAGAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA V
Sbjct  264  GIGRNSVQGDIRFADVLEKMGATV  287



>ref|WP_031520206.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Cronobacter sp. 
1383]
Length=428

 Score =   171 bits (434),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 97/128 (76%), Gaps = 0/128 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L  ID++MN +PD AMT+A  ALFA+G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  299  RSALNGIDMDMNHIPDAAMTIATTALFANGTTTLRNIYNWRVKETDRLFAMATELRKVGA  358

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
             VEEG DY  +TPP  LNV EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  359  EVEEGHDYIRVTPPATLNVAEIGTYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYF  418

Query  223  EVLQKFSK  200
            E L + S+
Sbjct  419  EQLARISR  426


 Score = 92.0 bits (227),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 68/84 (81%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV VE+  S+ RF++RGGQ+Y+SPG+  VEGDASSASYFLA AA+ GGTV V 
Sbjct  206  LHLMKTFGVEVENQ-SYQRFVVRGGQQYQSPGHYLVEGDASSASYFLAAAAIKGGTVKVT  264

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA +
Sbjct  265  GIGRNSVQGDIRFADVLEKMGATI  288



>dbj|GAM56373.1| 5-enolpyruvylshikimate-3-phosphate synthase [Vibrio sp. JCM 19231]
Length=427

 Score =   175 bits (443),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = -1

Query  589  SGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKL  410
            S +  L+A+D++ N +PD AMT+A  ALFA+G TAIR+V +WRVKET+R+ A+ TELRK+
Sbjct  297  SRKGELKAVDMDFNHIPDAAMTIATAALFAEGTTAIRNVYNWRVKETDRLAAMATELRKV  356

Query  409  GATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPD  230
            GATVEEG DY I+TPP +L    IDTYDDHRMAM FSL A ++ PVTI DP CT KTFPD
Sbjct  357  GATVEEGEDYIIVTPPAQLTHAAIDTYDDHRMAMCFSLVALSDTPVTINDPKCTSKTFPD  416

Query  229  YFEVLQKF  206
            YF+ LQ  
Sbjct  417  YFDKLQGL  424


 Score = 87.8 bits (216),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L +M++ GV VE+ D + RF+++GGQ Y +PG+  VEGDASSASYFLA AA+ GG + V 
Sbjct  206  LHIMKQFGVEVENQD-YQRFVVKGGQTYTAPGDFLVEGDASSASYFLAAAAIGGGEIKVT  264

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G  S+QGD++FA+ LEKMGAE+
Sbjct  265  GIGKDSIQGDIQFADALEKMGAEI  288



>ref|WP_004725419.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Vibrio furnissii]
 gb|EEX41380.1| 5-Enolpyruvylshikimate-3-phosphate synthase [Vibrio furnissii 
CIP 102972]
Length=426

 Score =   177 bits (450),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 105/149 (70%), Gaps = 8/149 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+   W E+ V  +        R  L A+D++ N +PD AMT+A  ALFA+G TAIR+V 
Sbjct  285  GAHIEWGEDYVIAR--------RGELNAVDLDFNHIPDAAMTIATAALFANGTTAIRNVY  336

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKET+R+ A+ TELRK+GATVEEG DY IITPP++L    IDTYDDHRMAM FSL A
Sbjct  337  NWRVKETDRLAAMATELRKVGATVEEGEDYIIITPPQKLIHAAIDTYDDHRMAMCFSLVA  396

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFS  203
             ++ PVTI DP CT KTFPDYF+   + S
Sbjct  397  LSDTPVTINDPKCTSKTFPDYFDKFAQLS  425


 Score = 84.7 bits (208),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 62/84 (74%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L +ME+ GV V ++D +  F+I  GQ Y SPGN  VEGDASSASYFLA AA+ GG V V 
Sbjct  206  LHIMEQFGVQVINND-YQEFVIPAGQSYVSPGNFLVEGDASSASYFLAAAAIKGGQVKVT  264

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FAE LEKMGA +
Sbjct  265  GIGKNSIQGDIQFAEALEKMGAHI  288



>ref|WP_007374139.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Kosakonia radicincitans]
 gb|EJI88164.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Kosakonia radicincitans 
DSM 16656]
Length=427

 Score =   172 bits (435),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  298  RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGA  357

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
            TVEEG D+  ITPPE+L   EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  358  TVEEGEDFIRITPPEKLQFAEIGTYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYF  417

Query  223  EVLQKFS  203
            E L + S
Sbjct  418  EQLARIS  424


 Score = 90.5 bits (223),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LME  GV VE+   + RF++RGGQ+Y+SPG   VEGDASSASYFLA  A+ GGTV V 
Sbjct  205  LHLMETFGVLVENQ-HYQRFVVRGGQQYQSPGQYLVEGDASSASYFLAAGAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA V
Sbjct  264  GIGRNSVQGDIRFADVLEKMGATV  287



>gb|EPF18700.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Cedecea davisae 
DSM 4568]
Length=428

 Score =   172 bits (435),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 106/149 (71%), Gaps = 8/149 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +W ++ ++ +        R  L AID++MN +PD AMT+A  ALFA G T +R++ 
Sbjct  285  GAKVTWGDDFISCE--------RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTMRNIY  336

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKET+R+ A+ TELRK+GA VEEG DY  +TPP +L   EI TY+DHRMAM FSL A
Sbjct  337  NWRVKETDRLSAMATELRKVGAEVEEGEDYITVTPPAKLQFAEIGTYNDHRMAMCFSLVA  396

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFS  203
             ++ PVTI DPGCT KTFPDYF+ L + S
Sbjct  397  LSDTPVTILDPGCTAKTFPDYFDQLARIS  425


 Score = 90.5 bits (223),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV VE+ D + RF+IRG Q+Y+SPG   VEGDASSASYFLA  A+ GGTV V 
Sbjct  206  LHLMKTFGVEVENRD-YRRFIIRGAQQYQSPGAYLVEGDASSASYFLAAGAIKGGTVKVT  264

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA+V
Sbjct  265  GIGRNSVQGDIRFADVLEKMGAKV  288



>ref|WP_039899165.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Cedecea davisae]
Length=427

 Score =   172 bits (435),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 106/149 (71%), Gaps = 8/149 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +W ++ ++ +        R  L AID++MN +PD AMT+A  ALFA G T +R++ 
Sbjct  284  GAKVTWGDDFISCE--------RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTMRNIY  335

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKET+R+ A+ TELRK+GA VEEG DY  +TPP +L   EI TY+DHRMAM FSL A
Sbjct  336  NWRVKETDRLSAMATELRKVGAEVEEGEDYITVTPPAKLQFAEIGTYNDHRMAMCFSLVA  395

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFS  203
             ++ PVTI DPGCT KTFPDYF+ L + S
Sbjct  396  LSDTPVTILDPGCTAKTFPDYFDQLARIS  424


 Score = 90.5 bits (223),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV VE+ D + RF+IRG Q+Y+SPG   VEGDASSASYFLA  A+ GGTV V 
Sbjct  205  LHLMKTFGVEVENRD-YRRFIIRGAQQYQSPGAYLVEGDASSASYFLAAGAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA+V
Sbjct  264  GIGRNSVQGDIRFADVLEKMGAKV  287



>gb|EJF29387.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter sp. 
Ag1]
Length=428

 Score =   174 bits (440),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 106/149 (71%), Gaps = 8/149 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +W ++ +T +        R  L AID++MN +PD AMT+A  ALFA G T +R++ 
Sbjct  285  GAKVTWGDDFITCE--------RGELNAIDMDMNHIPDAAMTIATAALFAKGSTTLRNIY  336

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKET+R+ A+ TELRK+GA VEEG DY  +TPP +L   EI TY+DHRMAM FSL A
Sbjct  337  NWRVKETDRLSAMATELRKVGAEVEEGEDYISVTPPAKLTFAEIGTYNDHRMAMCFSLVA  396

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFS  203
             ++ PVTI DPGCT KTFPDYFE L + S
Sbjct  397  LSDTPVTILDPGCTAKTFPDYFEQLARIS  425


 Score = 88.2 bits (217),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV VE+ D +  FLIRG Q+Y+SPG   VEGDASSASYFLA  A+ GG V V 
Sbjct  206  LHLMKTFGVEVENRD-YRSFLIRGAQQYQSPGAYLVEGDASSASYFLAAGAIKGGVVKVT  264

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA+V
Sbjct  265  GIGRNSVQGDIRFADVLEKMGAKV  288



>ref|WP_042481982.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Vibrio diazotrophicus]
Length=426

 Score =   172 bits (436),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 101/149 (68%), Gaps = 8/149 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+   W ++ V  +        R  L A+D++ N +PD AMT+A  ALFA G TAIR+V 
Sbjct  285  GAEIEWGDDYVIAR--------RGELNAVDLDFNHIPDAAMTIATTALFAKGTTAIRNVY  336

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKET+R+ A+ TELRK+GA VEEG DY +ITPP +L    IDTYDDHRMAM FSL A
Sbjct  337  NWRVKETDRLSAMATELRKVGAEVEEGEDYIVITPPAKLTHAAIDTYDDHRMAMCFSLVA  396

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFS  203
             ++ PVTI DP CT KTFPDYFE     S
Sbjct  397  LSDTPVTINDPKCTSKTFPDYFEKFANLS  425


 Score = 89.7 bits (221),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L +ME+ GV VE+ D +  F++R GQ Y SPGN  VEGDASSASYFLA AA+ GG + V 
Sbjct  206  LHIMEQFGVQVENHD-YQEFVVRAGQNYVSPGNFLVEGDASSASYFLAAAAIKGGEIKVT  264

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+ LEKMGAE+
Sbjct  265  GIGKNSIQGDIQFADALEKMGAEI  288



>ref|WP_034810093.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter sp. 
Ag1]
Length=427

 Score =   174 bits (440),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 106/149 (71%), Gaps = 8/149 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +W ++ +T +        R  L AID++MN +PD AMT+A  ALFA G T +R++ 
Sbjct  284  GAKVTWGDDFITCE--------RGELNAIDMDMNHIPDAAMTIATAALFAKGSTTLRNIY  335

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKET+R+ A+ TELRK+GA VEEG DY  +TPP +L   EI TY+DHRMAM FSL A
Sbjct  336  NWRVKETDRLSAMATELRKVGAEVEEGEDYISVTPPAKLTFAEIGTYNDHRMAMCFSLVA  395

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFS  203
             ++ PVTI DPGCT KTFPDYFE L + S
Sbjct  396  LSDTPVTILDPGCTAKTFPDYFEQLARIS  424


 Score = 88.2 bits (217),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV VE+ D +  FLIRG Q+Y+SPG   VEGDASSASYFLA  A+ GG V V 
Sbjct  205  LHLMKTFGVEVENRD-YRSFLIRGAQQYQSPGAYLVEGDASSASYFLAAGAIKGGVVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA+V
Sbjct  264  GIGRNSVQGDIRFADVLEKMGAKV  287



>ref|WP_035885858.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Kosakonia radicincitans]
 gb|KDE37521.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Kosakonia radicincitans 
UMEnt01/12]
Length=427

 Score =   173 bits (439),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  298  RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGA  357

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
            TVEEG DY  ITPPE+L   EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  358  TVEEGEDYIRITPPEKLQFAEIGTYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYF  417

Query  223  EVLQKFS  203
            E L + S
Sbjct  418  EQLARIS  424


 Score = 87.8 bits (216),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LME   V VE+   + RF++RGGQ+Y+SPG   VEGDASSASYFLA  A+ GGTV V 
Sbjct  205  LHLMETFDVLVENQ-HYQRFVVRGGQQYQSPGQYLVEGDASSASYFLAAGAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA V
Sbjct  264  GIGRNSVQGDIRFADVLEKMGATV  287



>ref|WP_032183857.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli]
 gb|KDW33437.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
2-156-04_S3_C2]
Length=427

 Score =   175 bits (444),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 106/150 (71%), Gaps = 8/150 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  SW ++ ++          R  L AID++MN +PD AMT+A  ALFA G T +R++ 
Sbjct  284  GATISWGDDYISCT--------RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIY  335

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKET+R+ A+ TELRK+GA VEEG DY  ITPPE+LN  EI TY+DHRMAM FSL A
Sbjct  336  NWRVKETDRLFAMATELRKVGAEVEEGHDYIRITPPEKLNFAEIATYNDHRMAMCFSLVA  395

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSK  200
             ++ PVTI DP CT KTFPDYFE L + S+
Sbjct  396  LSDTPVTILDPKCTAKTFPDYFEQLARISQ  425


 Score = 85.9 bits (211),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV +E+   + +F+++GGQ Y+SPG   VEGDASSASYFLA AA+ GGTV V 
Sbjct  205  LNLMKTFGVEIENQ-HYQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA +
Sbjct  264  GIGRNSMQGDIRFADVLEKMGATI  287



>ref|WP_014204899.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Vibrio furnissii]
 gb|ADT86780.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Vibrio furnissii 
NCTC 11218]
Length=426

 Score =   176 bits (447),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 104/149 (70%), Gaps = 8/149 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+   W E+ V  +        R  L A+D++ N +PD AMT+A  ALFA+G TAIR+V 
Sbjct  285  GAHIEWGEDYVIAR--------RGELNAVDLDFNHIPDAAMTIATAALFANGTTAIRNVY  336

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKET+R+ A+ TELRK+GATVEEG DY IITPP++L    IDTYDDHRMAM FSL A
Sbjct  337  NWRVKETDRLAAMATELRKVGATVEEGEDYIIITPPQKLIHAAIDTYDDHRMAMCFSLVA  396

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFS  203
              + PVTI DP CT KTFPDYF+   + S
Sbjct  397  LRDTPVTINDPKCTSKTFPDYFDKFAQLS  425


 Score = 84.7 bits (208),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 62/84 (74%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L +ME+ GV V ++D +  F+I  GQ Y SPGN  VEGDASSASYFLA AA+ GG V V 
Sbjct  206  LHIMEQFGVQVINND-YQEFVIPAGQSYVSPGNFLVEGDASSASYFLAAAAIKGGQVKVT  264

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FAE LEKMGA +
Sbjct  265  GIGKNSIQGDIQFAEALEKMGAHI  288



>ref|WP_001558910.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli]
 gb|ELE44127.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
KTE66]
Length=427

 Score =   175 bits (444),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A VALFA G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  298  RGELNAIDMDMNHIPDAAMTIATVALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGA  357

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
             VEEG DY  ITPPE+LN  EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  358  EVEEGHDYIRITPPEKLNFAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYF  417

Query  223  EVLQKFSK  200
            E L + S+
Sbjct  418  EQLARISQ  425


 Score = 85.9 bits (211),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV +E+   + +F+++GGQ Y+SPG   VEGDASSASYFLA AA+ GGTV V 
Sbjct  205  LNLMKTFGVEIENQ-HYQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA +
Sbjct  264  GIGRNSMQGDIRFADVLEKMGATI  287



>ref|WP_001471310.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli]
 gb|ELD23850.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
KTE210]
 gb|ELF88303.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
KTE29]
 gb|ENA09197.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
P0299917.1]
 gb|ENC36575.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
P02997067.6]
 gb|EST69696.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
P4-96]
 gb|EST71654.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
P4-NR]
 emb|CDL29520.1| 5-Enolpyruvylshikimate-3-phosphate synthase [Escherichia coli 
ISC7]
Length=427

 Score =   174 bits (442),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  298  RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGA  357

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
             VEEG DY  ITPPE+LN  EI TY+DHRMAM FSL A +++PVTI DP CT KTFPDYF
Sbjct  358  EVEEGHDYIRITPPEKLNFAEIATYNDHRMAMCFSLVALSDIPVTILDPKCTAKTFPDYF  417

Query  223  EVLQKFSK  200
            E L + S+
Sbjct  418  EQLARISQ  425


 Score = 86.3 bits (212),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV VE+   + +F+++GGQ Y+SPG   VEGDASSASYFLA AA+ GGTV V 
Sbjct  205  LNLMKTFGVEVENQ-HYQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA +
Sbjct  264  GIGRNSMQGDIRFADVLEKMGATI  287



>ref|WP_032080257.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Vibrio fluvialis]
Length=426

 Score =   176 bits (447),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 105/149 (70%), Gaps = 8/149 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++  W ++ V  +        R  L A+D++ N +PD AMT+A  ALFA G TAIR+V 
Sbjct  285  GAQIEWGDDYVIAR--------RGELNAVDLDFNHIPDAAMTIATTALFASGTTAIRNVY  336

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKET+R+ A+ TELRK+GATVEEG DY IITPPE+L    IDTYDDHRMAM FSL A
Sbjct  337  NWRVKETDRLAAMATELRKVGATVEEGEDYIIITPPEQLIHAAIDTYDDHRMAMCFSLVA  396

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFS  203
             ++ PVTI DP CT KTFPDYF+   + S
Sbjct  397  LSDTPVTINDPKCTSKTFPDYFDKFAQLS  425


 Score = 84.3 bits (207),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L +ME+ GV V ++D +  F+I  GQ Y +PGN  VEGDASSASYFLA AA+ GG V V 
Sbjct  206  LHIMEQFGVQVINND-YQEFVIPAGQSYVAPGNFLVEGDASSASYFLAAAAIKGGQVKVT  264

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FAE LEKMGA++
Sbjct  265  GIGKNSIQGDIQFAEALEKMGAQI  288



>ref|WP_044362276.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Vibrio fluvialis]
Length=426

 Score =   176 bits (447),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 105/149 (70%), Gaps = 8/149 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++  W ++ V  +        R  L A+D++ N +PD AMT+A  ALFA G TAIR+V 
Sbjct  285  GAQIEWGDDYVIAR--------RGELNAVDLDFNHIPDAAMTIATTALFASGTTAIRNVY  336

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKET+R+ A+ TELRK+GATVEEG DY IITPPE+L    IDTYDDHRMAM FSL A
Sbjct  337  NWRVKETDRLAAMATELRKVGATVEEGEDYIIITPPEQLIHAAIDTYDDHRMAMCFSLVA  396

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFS  203
             ++ PVTI DP CT KTFPDYF+   + S
Sbjct  397  LSDTPVTINDPKCTSKTFPDYFDKFAQLS  425


 Score = 84.3 bits (207),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L +ME+ GV V ++D +  F+I  GQ Y +PGN  VEGDASSASYFLA AA+ GG V V 
Sbjct  206  LHIMEQFGVQVINND-YQEFVIPAGQSYVAPGNFLVEGDASSASYFLAAAAIKGGQVKVT  264

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FAE LEKMGA++
Sbjct  265  GIGKNSIQGDIQFAEALEKMGAQI  288



>ref|WP_017445862.1| hypothetical protein [Gayadomonas joobiniege]
Length=428

 Score =   174 bits (441),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 105/151 (70%), Gaps = 7/151 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++  W +  + V       +G+  L  +DV++N +PD AMT+A  ALFA GPTAIR++ 
Sbjct  285  GAKVEWADEYIQV-------TGQGQLTGVDVDLNHIPDAAMTIATTALFAKGPTAIRNIY  337

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKET+R+ A+ TELRK+GA VEEG DY I+ PP+ +    IDTY+DHR+AM FSLAA
Sbjct  338  NWRVKETDRLYAMATELRKVGAEVEEGEDYIIVNPPQEITTAAIDTYNDHRIAMCFSLAA  397

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
              + P+ I DP CT KTFP+YFE+ +   +H
Sbjct  398  MGDNPIIINDPKCTAKTFPNYFELFESVVQH  428


 Score = 86.7 bits (213),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 62/84 (74%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM + GV V H D++  F ++GGQ Y++PG   VEGDASSASYFLA AA+ GGTV V 
Sbjct  206  LHLMRQFGVEVSH-DNYQSFYVKGGQTYQAPGRILVEGDASSASYFLAAAAIKGGTVKVN  264

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G  S+QGD KFAEVLE MGA+V
Sbjct  265  GVGLKSVQGDAKFAEVLELMGAKV  288



>ref|WP_013366857.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter lignolyticus]
 gb|ADO49124.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter lignolyticus 
SCF1]
Length=427

 Score =   170 bits (431),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  298  RGELNAIDMDMNHIPDAAMTIATTALFAKGTTTMRNIYNWRVKETDRLFAMATELRKVGA  357

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
             VEEG D+  +TPP RLN  EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  358  EVEEGEDFIRVTPPARLNTAEIGTYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYF  417

Query  223  EVLQKFS  203
            E L + S
Sbjct  418  EQLARIS  424


 Score = 90.5 bits (223),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 68/84 (81%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV+V++  S+ RF+++GGQ Y+SPG+  VEGDASSASYFLA AA+ GGTV V 
Sbjct  205  LHLMKTFGVTVDNQ-SYQRFVVKGGQHYQSPGSYLVEGDASSASYFLAAAAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G SS+QGD++FA+VLEKMGA +
Sbjct  264  GIGRSSVQGDIRFADVLEKMGATI  287



>gb|KGQ11427.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Beauveria bassiana 
D1-5]
Length=428

 Score =   172 bits (436),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 106/149 (71%), Gaps = 8/149 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +W ++ ++ +        R  L AID++MN +PD AMT+A  ALFA G T +R++ 
Sbjct  285  GAKVTWGDDFISCE--------RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIY  336

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKET+R+ A+ TELRK+GA VEEG DY  +TPP +L   EI TY+DHRMAM FSL A
Sbjct  337  NWRVKETDRLSAMATELRKVGAEVEEGEDYIRVTPPAKLTFAEIGTYNDHRMAMCFSLVA  396

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFS  203
             ++ PVTI DPGCT KTFPDYFE L + S
Sbjct  397  LSDTPVTILDPGCTAKTFPDYFEQLARIS  425


 Score = 88.6 bits (218),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV VE+ D +  FLIRG Q+Y+SPG   VEGDASSASYFLA  A+ GG V V 
Sbjct  206  LHLMKTFGVEVENRD-YRSFLIRGAQQYQSPGAYLVEGDASSASYFLAAGAIKGGVVKVT  264

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA+V
Sbjct  265  GIGRNSVQGDIRFADVLEKMGAKV  288



>ref|WP_038888220.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Cronobacter dublinensis]
Length=428

 Score =   170 bits (431),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 105/150 (70%), Gaps = 8/150 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+R +W E+ ++          R  L AID++MN +PD AMT+A  ALFA+G T +R++ 
Sbjct  285  GARITWGEDFISCT--------RGELHAIDMDMNHIPDAAMTIATTALFANGTTTLRNIY  336

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKET+R+ A+ TELRK+GATVEEG D+  +TPP +L   +I TY+DHRMAM FSL A
Sbjct  337  NWRVKETDRLAAMATELRKVGATVEEGHDFITVTPPAQLQFADIGTYNDHRMAMCFSLVA  396

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSK  200
             ++ PVTI DP CT KTFPDYF  L + S 
Sbjct  397  LSDTPVTILDPKCTAKTFPDYFTQLARISH  426


 Score = 90.1 bits (222),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 68/84 (81%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV VE+ + + RF+I+GGQ+Y+SPG+  VEGDASSASYFLA AA+ GGTV V 
Sbjct  206  LHLMKTFGVEVENQN-YQRFVIQGGQQYQSPGHYLVEGDASSASYFLAAAAIRGGTVKVT  264

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA +
Sbjct  265  GIGRNSVQGDIRFADVLEKMGARI  288



>ref|WP_039296633.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Cedecea neteri]
 gb|AIR61497.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Cedecea neteri]
Length=427

 Score =   172 bits (435),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 106/149 (71%), Gaps = 8/149 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +W ++ ++ +        R  L AID++MN +PD AMT+A  ALFA G T +R++ 
Sbjct  284  GAKVTWGDDFISCE--------RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIY  335

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKET+R+ A+ TELRK+GA VEEG DY  +TPP +L   EI TY+DHRMAM FSL A
Sbjct  336  NWRVKETDRLSAMATELRKVGAEVEEGEDYIRVTPPAKLTFAEIGTYNDHRMAMCFSLVA  395

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFS  203
             ++ PVTI DPGCT KTFPDYFE L + S
Sbjct  396  LSDTPVTILDPGCTAKTFPDYFEQLARIS  424


 Score = 88.2 bits (217),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV VE+ D +  FLIRG Q+Y+SPG   VEGDASSASYFLA  A+ GG V V 
Sbjct  205  LHLMKTFGVEVENRD-YRSFLIRGAQQYQSPGAYLVEGDASSASYFLAAGAIKGGVVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA+V
Sbjct  264  GIGRNSVQGDIRFADVLEKMGAKV  287



>ref|WP_000445234.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli]
 gb|EGX10077.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
STEC_MHI813]
Length=427

 Score =   173 bits (439),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  298  RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGA  357

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
             VEEG DY  ITPPE+LN  EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  358  EVEEGHDYIRITPPEKLNFAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYF  417

Query  223  EVLQKFSK  200
            E L + S+
Sbjct  418  EQLARISQ  425


 Score = 87.0 bits (214),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV +E+   + +F+++GGQ Y+SPG   VEGDASSASYFLA AA+ GGTV V 
Sbjct  205  LNLMKTFGVEIENQ-HYQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G SS+QGD++FA+VLEKMGA +
Sbjct  264  GIGRSSMQGDIRFADVLEKMGATI  287



>ref|WP_002463073.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia hermannii]
 dbj|GAB50463.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia hermannii 
NBRC 105704]
Length=428

 Score =   167 bits (422),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 105/150 (70%), Gaps = 8/150 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +W ++ +           R  L AID++MN +PD AMT+A  ALFA G T +R++ 
Sbjct  285  GAQITWGDDYIACT--------RGDLNAIDMDMNHIPDAAMTIATTALFAKGTTTLRNIY  336

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKET+R+ A+ TELRK+GATVEEG D+  ITPP +L   +I TY+DHRMAM FSL A
Sbjct  337  NWRVKETDRLAAMATELRKVGATVEEGHDFITITPPGQLRFADIGTYNDHRMAMCFSLVA  396

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSK  200
             ++ PVTI DP CT KTFPDYF+ L + S+
Sbjct  397  LSDTPVTILDPKCTAKTFPDYFQQLARLSQ  426


 Score = 93.2 bits (230),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV+VE+ D + RF+IRGGQ+Y++PG   VEGDASSASYFLA AA+ GGT+ V 
Sbjct  206  LHLMKAFGVNVENGD-YQRFVIRGGQRYQTPGEYLVEGDASSASYFLAAAAIKGGTIKVT  264

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA++
Sbjct  265  GIGRNSVQGDIRFADVLEKMGAQI  288



>ref|WP_014069581.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter asburiae]
 gb|AEN64159.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter asburiae 
LF7a]
Length=427

 Score =   168 bits (425),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = -1

Query  574  LRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVE  395
            L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA VE
Sbjct  301  LNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGAEVE  360

Query  394  EGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVL  215
            EG DY  +TPP +L V EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYFE L
Sbjct  361  EGEDYIRVTPPAKLQVAEIGTYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQL  420

Query  214  QKFS  203
             + S
Sbjct  421  ARIS  424


 Score = 92.4 bits (228),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 67/84 (80%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV VE+  ++ RF++RGGQ+Y+SPGN  VEGDASSASYFLA  A+ GGTV V 
Sbjct  205  LHLMKTFGVDVENQ-AYQRFVVRGGQQYQSPGNYLVEGDASSASYFLAAGAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA V
Sbjct  264  GIGRNSVQGDIRFADVLEKMGAVV  287



>ref|WP_039306126.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Cedecea neteri]
 gb|AIR65812.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Cedecea neteri]
Length=427

 Score =   172 bits (436),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 106/149 (71%), Gaps = 8/149 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +W ++ ++ +        R  L AID++MN +PD AMT+A  ALFA G T +R++ 
Sbjct  284  GAKVTWGDDFISCE--------RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIY  335

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKET+R+ A+ TELRK+GA VEEG DY  +TPP +L   EI TY+DHRMAM FSL A
Sbjct  336  NWRVKETDRLSAMATELRKVGAEVEEGEDYIRVTPPAKLTFAEIGTYNDHRMAMCFSLVA  395

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFS  203
             ++ PVTI DPGCT KTFPDYFE L + S
Sbjct  396  LSDTPVTILDPGCTAKTFPDYFEQLARIS  424


 Score = 88.2 bits (217),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV VE+ D +  FLIRG Q+Y+SPG   VEGDASSASYFLA  A+ GG V V 
Sbjct  205  LHLMKTFGVEVENRD-YRSFLIRGAQQYQSPGAYLVEGDASSASYFLAAGAIKGGVVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA+V
Sbjct  264  GIGRNSVQGDIRFADVLEKMGAKV  287



>ref|WP_001602104.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli]
 gb|ELG89936.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
KTE146]
Length=427

 Score =   174 bits (441),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R++A+ TELRK+GA
Sbjct  298  RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLLAMATELRKVGA  357

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
             VEEG DY  ITPPE+LN  EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  358  EVEEGHDYIRITPPEKLNFAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYF  417

Query  223  EVLQKFSK  200
            E L + S+
Sbjct  418  EQLARISQ  425


 Score = 85.9 bits (211),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV +E+   + +F+++GGQ Y+SPG   VEGDASSASYFLA AA+ GGTV V 
Sbjct  205  LNLMKTFGVEIENQ-HYQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA +
Sbjct  264  GIGRNSMQGDIRFADVLEKMGATI  287



>ref|WP_032639263.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter cloacae]
 gb|KDF49302.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter cloacae 
BWH 43]
Length=427

 Score =   167 bits (423),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 103/149 (69%), Gaps = 8/149 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +W ++ ++             L AID++MN +PD AMT+A  ALFA G T +R++ 
Sbjct  284  GAKVTWGDDFISCT--------HGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIY  335

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKET+R+ A+ TELRK+GA VEEG DY  +TPP +L   EI TY+DHRMAM FSL A
Sbjct  336  NWRVKETDRLFAMATELRKVGAEVEEGEDYIRVTPPAKLQFAEIGTYNDHRMAMCFSLVA  395

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFS  203
             ++ PVTI DP CT KTFPDYFE L + S
Sbjct  396  LSDTPVTILDPKCTAKTFPDYFEQLARIS  424


 Score = 93.2 bits (230),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 67/84 (80%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV VE+  S+ RF++RG Q+Y+SPGN  VEGDASSASYFLA  A+ GGTV V 
Sbjct  205  LHLMKTFGVEVENQ-SYQRFIVRGAQRYQSPGNYLVEGDASSASYFLAAGAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA+V
Sbjct  264  GIGRNSVQGDIRFADVLEKMGAKV  287



>dbj|GAM62314.1| 5-enolpyruvylshikimate-3-phosphate synthase [Vibrio sp. JCM 19232]
Length=285

 Score =   175 bits (443),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -1

Query  589  SGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKL  410
            S +  L+A+D++ N +PD AMT+A  ALFA+G TAIR+V +WRVKET+R+ A+ TELRK+
Sbjct  155  SRKGELKAVDMDFNHIPDAAMTIATAALFAEGTTAIRNVYNWRVKETDRLAAMATELRKV  214

Query  409  GATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPD  230
            GATVEEG DY I+TPP +L    IDTYDDHRMAM FSL A ++ PVTI DP CT KTFPD
Sbjct  215  GATVEEGEDYIIVTPPAQLTHAAIDTYDDHRMAMCFSLVALSDTPVTINDPKCTSKTFPD  274

Query  229  YFEVLQ  212
            YF+ LQ
Sbjct  275  YFDKLQ  280


 Score = 85.5 bits (210),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L +M++ GV VE+ D + RF+++GGQ Y +PG+  VEGDASSASYFLA AA+ GG + V 
Sbjct  64   LHIMKQFGVEVENQD-YQRFVVKGGQTYTAPGDFLVEGDASSASYFLAAAAIGGGEIKVT  122

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G  S+QGD++FA+ L KMGAE+
Sbjct  123  GIGKDSIQGDIQFADALAKMGAEI  146



>ref|WP_019083452.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Yersinia enterocolitica]
Length=428

 Score =   176 bits (446),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 106/150 (71%), Gaps = 8/150 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ SW ++ +           R  L+ ID++MN +PD AMT+A  ALFADGPT IR++ 
Sbjct  285  GAKISWGDDYIECS--------RGELQGIDMDMNHIPDAAMTIATTALFADGPTVIRNIY  336

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKET+R+ A+ TELRK+GA VEEGPDY  + PP +L   EI TY+DHRMAM FSL A
Sbjct  337  NWRVKETDRLSAMATELRKVGAEVEEGPDYIRVVPPAQLIAAEIGTYNDHRMAMCFSLVA  396

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSK  200
             ++ PVTI DP CT KTFPDYFE L + S+
Sbjct  397  LSDTPVTILDPKCTAKTFPDYFEQLARLSQ  426


 Score = 84.0 bits (206),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 62/84 (74%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV V H +++  F I+GGQ Y SPG   VEGDASSASYFLA AA+ GGTV V 
Sbjct  206  LHLMQAFGVDVVH-ENYQIFHIKGGQTYHSPGTYLVEGDASSASYFLAAAAIKGGTVRVT  264

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G  S+QGD KFA+VLEKMGA++
Sbjct  265  GIGKKSVQGDTKFADVLEKMGAKI  288



>gb|ESA60561.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
113303]
Length=459

 Score =   173 bits (439),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  330  RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGA  389

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
             VEEG DY  ITPPE+LN  EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  390  EVEEGHDYIRITPPEKLNFAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYF  449

Query  223  EVLQKFSK  200
            E L + S+
Sbjct  450  EQLARISQ  457


 Score = 86.3 bits (212),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV VE+   + +F+++GGQ Y+SPG   VEGDASSASYFLA AA+ GGTV V 
Sbjct  237  LNLMKTFGVEVENQ-HYQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT  295

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA +
Sbjct  296  GIGRNSMQGDIRFADVLEKMGATI  319



>ref|WP_041910626.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter sp. 
BIDMC 29]
 gb|EUM12404.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter sp. 
BIDMC 29]
Length=427

 Score =   169 bits (427),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = -1

Query  574  LRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVE  395
            L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA VE
Sbjct  301  LNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGAEVE  360

Query  394  EGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVL  215
            EG DY  +TPP +LN  EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYFE L
Sbjct  361  EGEDYIRVTPPAKLNFAEIGTYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQL  420

Query  214  QKFS  203
             + S
Sbjct  421  ARIS  424


 Score = 91.3 bits (225),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV VE+  S+ RF++RG Q+Y+SPGN  VEGDASSASYFLA  A+ GGTV V 
Sbjct  205  LHLMKTFGVEVENQ-SYQRFVVRGAQQYQSPGNYLVEGDASSASYFLAAGAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA V
Sbjct  264  GIGRNSVQGDIRFADVLEKMGAVV  287



>ref|WP_038415776.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter cloacae]
 gb|AIN22153.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter cloacae 
ECNIH3]
 gb|AIN27496.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter cloacae 
ECR091]
 gb|AIX58610.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter cloacae]
Length=427

 Score =   167 bits (422),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = -1

Query  574  LRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVE  395
            L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA VE
Sbjct  301  LNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGAVVE  360

Query  394  EGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVL  215
            EG DY  +TPP +L   EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYFE L
Sbjct  361  EGEDYIRVTPPAKLQFAEIGTYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQL  420

Query  214  QKFS  203
             + S
Sbjct  421  ARIS  424


 Score = 93.2 bits (230),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 67/84 (80%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV VE+  S+ RF++RGGQ+Y+SPGN  VEGDASSASYFLA  A+ GGTV V 
Sbjct  205  LHLMKTFGVEVENQ-SYQRFVVRGGQQYQSPGNYLVEGDASSASYFLAAGAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA V
Sbjct  264  GIGRNSVQGDIRFADVLEKMGAVV  287



>ref|WP_034457199.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Buttiauxella agrestis]
Length=427

 Score =   171 bits (434),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 106/149 (71%), Gaps = 8/149 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +W ++ ++ +        R  L AID++MN +PD AMT+A  ALFA G T +R++ 
Sbjct  284  GAKITWGDDFISCE--------RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIY  335

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKET+R+ A+ TELRK+GA VEEG DY  +TPP +L V EI TY+DHRMAM FSL A
Sbjct  336  NWRVKETDRLSAMATELRKVGAVVEEGEDYISVTPPAQLQVAEIGTYNDHRMAMCFSLVA  395

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFS  203
             ++ PVTI DP CT KTFPDYFE L + S
Sbjct  396  LSDTPVTILDPKCTAKTFPDYFEQLARIS  424


 Score = 88.2 bits (217),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV VE+ D +  F+IRGGQ+Y SPG   VEGDASSASYFLA  A+ GGTV V 
Sbjct  205  LHLMKTFGVDVENRD-YRSFVIRGGQQYTSPGAYLVEGDASSASYFLAAGAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA++
Sbjct  264  GIGRNSVQGDIRFADVLEKMGAKI  287



>ref|WP_033815685.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli]
Length=427

 Score =   173 bits (439),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  298  RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGA  357

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
             VEEG DY  ITPPE+LN  EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  358  EVEEGHDYIRITPPEKLNFAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYF  417

Query  223  EVLQKFSK  200
            E L + S+
Sbjct  418  EQLARISQ  425


 Score = 86.7 bits (213),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV VE+   + +F+++GGQ Y+SPG   VEGDASSASYFLA AA+ GGTV V 
Sbjct  205  LNLMKTFGVEVENQ-HYQQFVVKGGQPYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA +
Sbjct  264  GIGRNSMQGDIRFADVLEKMGATI  287



>ref|WP_000445237.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli]
 gb|EGW74915.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
STEC_B2F1]
 gb|EIH36139.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
96.0497]
 gb|EZE66637.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
O91:H21 str. 2009C-4646]
 gb|KDV38728.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
O146:H21 str. 2010C-3325]
 gb|KDV47156.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
O91:H21 str. 2009C-3740]
 gb|KFV22257.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli]
 gb|KIH15157.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli]
Length=427

 Score =   173 bits (439),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  298  RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGA  357

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
             VEEG DY  ITPPE+LN  EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  358  EVEEGHDYIRITPPEKLNFAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYF  417

Query  223  EVLQKFSK  200
            E L + S+
Sbjct  418  EQLARISQ  425


 Score = 86.3 bits (212),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV VE+   + +F+++GGQ Y+SPG   VEGDASSASYFLA AA+ GGTV V 
Sbjct  205  LNLMKTFGVEVENQ-HYQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA +
Sbjct  264  GIGRNSMQGDIRFADVLEKMGATI  287



>ref|WP_014883218.1| MULTISPECIES: 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter 
cloacae complex]
 gb|AFP69408.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter cloacae 
subsp. cloacae ENHKU01]
 gb|ESN26401.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter sp. 
MGH 23]
 gb|ESN28551.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter sp. 
MGH 22]
 gb|EUL88050.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter cloacae 
UCI 24]
 gb|KDF75606.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter cloacae 
UCI 29]
 gb|AIX55501.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter cloacae]
Length=427

 Score =   168 bits (425),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  298  RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLYAMATELRKVGA  357

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
             VEEG DY  +TPP +L   EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  358  EVEEGEDYIRVTPPAKLQFAEIGTYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYF  417

Query  223  EVLQKFS  203
            E L + S
Sbjct  418  EQLARIS  424


 Score = 91.7 bits (226),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV VE+  S+ RF++RG Q+Y+SPGN  VEGDASSASYFLA  A+ GGTV V 
Sbjct  205  LHLMKTFGVEVENQ-SYQRFVVRGAQQYQSPGNYLVEGDASSASYFLAAGAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA V
Sbjct  264  GIGRNSVQGDIRFADVLEKMGATV  287



>ref|WP_042108061.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli]
Length=427

 Score =   174 bits (440),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  298  RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGA  357

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
             VEEG DY  ITPPE+LN  EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  358  EVEEGHDYICITPPEKLNFAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYF  417

Query  223  EVLQKFSK  200
            E L + S+
Sbjct  418  EQLARISQ  425


 Score = 85.9 bits (211),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV +E+   + +F+++GGQ Y+SPG   VEGDASSASYFLA AA+ GGTV V 
Sbjct  205  LNLMKTFGVEIENQ-HYQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA +
Sbjct  264  GIGRNSMQGDIRFADVLEKMGATI  287



>ref|WP_024548375.1| MULTISPECIES: 3-phosphoshikimate 1-carboxyvinyltransferase [Cronobacter]
Length=428

 Score =   169 bits (428),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 97/128 (76%), Gaps = 0/128 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A  ALFA+G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  299  RGELNAIDMDMNHIPDAAMTIATAALFANGTTTLRNIFNWRVKETDRLFAMATELRKVGA  358

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
             VEEG D+  ITPP  LN  EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  359  QVEEGHDFIRITPPASLNFAEIGTYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYF  418

Query  223  EVLQKFSK  200
            + L + S+
Sbjct  419  DQLARISR  426


 Score = 90.5 bits (223),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 67/84 (80%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM   GV+VE+ +++ RF++RGGQ Y+SPG   VEGDASSASYFLA AA+ GGTV V 
Sbjct  206  LHLMNTFGVNVEN-ENYQRFVVRGGQHYQSPGQYLVEGDASSASYFLAAAAIKGGTVKVT  264

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA +
Sbjct  265  GIGRNSVQGDIRFADVLEKMGATI  288



>dbj|GAM76538.1| 5-enolpyruvylshikimate-3-phosphate synthase [Vibrio sp. JCM 19241]
Length=427

 Score =   174 bits (441),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = -1

Query  589  SGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKL  410
            S +  L+A+D++ N +PD AMT+A  ALFA+G TAIR+V +WRVKET+R+ A+ TELRK+
Sbjct  297  SRKGELKAVDMDFNHIPDAAMTIATAALFAEGTTAIRNVYNWRVKETDRLAAMATELRKV  356

Query  409  GATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPD  230
            GATVEEG DY I+TPP +L    IDTYDDHRMAM FSL A ++ PVTI DP CT KTFPD
Sbjct  357  GATVEEGEDYIIVTPPVQLTHAAIDTYDDHRMAMCFSLVALSDTPVTINDPKCTSKTFPD  416

Query  229  YFEVLQKF  206
            YF+ LQ  
Sbjct  417  YFDKLQGL  424


 Score = 85.5 bits (210),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L +M++ GV VE+ D + RF+++GGQ Y +PG+  VEGDASSASYFLA AA+ GG + V 
Sbjct  206  LHIMKQFGVEVENQD-YQRFVVKGGQTYTAPGDFLVEGDASSASYFLAAAAIGGGEIKVT  264

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G  S+QGD++FA+ L KMGAE+
Sbjct  265  GIGKDSIQGDIQFADALAKMGAEI  288



>ref|WP_000445175.1| MULTISPECIES: 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia]
 gb|EOQ76358.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
KTE33]
 gb|EOU44279.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia sp. 
KTE114]
 gb|EOU80501.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia sp. 
KTE31]
 gb|EQV92716.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
KOEGE 71 (186a)]
Length=427

 Score =   173 bits (439),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 106/150 (71%), Gaps = 8/150 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  SW ++ ++          R  L AID++MN +PD AMT+A  ALFA G T +R++ 
Sbjct  284  GAAISWGDDYISCT--------RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIY  335

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKET+R+ A+ TELRK+GA VEEG D+  ITPPE+LN  EI TY+DHRMAM FSL A
Sbjct  336  NWRVKETDRLFAMATELRKVGAEVEEGHDFIRITPPEKLNFAEIATYNDHRMAMCFSLVA  395

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSK  200
             ++ PVTI DP CT KTFPDYFE L + S+
Sbjct  396  LSDTPVTILDPKCTAKTFPDYFEQLARISQ  425


 Score = 86.3 bits (212),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV +E+   + +F+++GGQ Y+SPG   VEGDASSASYFLA AA+ GGTV V 
Sbjct  205  LNLMKTFGVEIENQ-HYQKFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA +
Sbjct  264  GIGRNSMQGDIRFADVLEKMGAAI  287



>ref|WP_032637070.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter cloacae]
 gb|KDF42827.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter cloacae 
BIDMC 67]
Length=427

 Score =   168 bits (425),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  298  RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLYAMATELRKVGA  357

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
             VEEG DY  +TPP +L   EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  358  EVEEGEDYIRVTPPAKLQFAEIGTYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYF  417

Query  223  EVLQKFS  203
            E L + S
Sbjct  418  EQLARIS  424


 Score = 91.7 bits (226),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV VE+  S+ RF++RG Q+Y+SPGN  VEGDASSASYFLA  A+ GGTV V 
Sbjct  205  LHLMKTFGVEVENQ-SYQRFVVRGAQQYQSPGNYLVEGDASSASYFLAAGAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA V
Sbjct  264  GIGRNSVQGDIRFADVLEKMGATV  287



>ref|WP_021577203.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli]
 gb|ERA08994.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
UMEA 3718-1]
Length=427

 Score =   173 bits (438),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  298  RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGA  357

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
             VEEG DY  ITPPE+LN  EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  358  EVEEGHDYIRITPPEKLNFAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYF  417

Query  223  EVLQKFSK  200
            E L + S+
Sbjct  418  EQLARISQ  425


 Score = 86.7 bits (213),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV VE+   + +F+++GGQ Y+SPG   VEGDASSASYFLA AA+ GGTV V 
Sbjct  205  LNLMKTFGVEVENQ-HYQQFVVKGGQPYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA +
Sbjct  264  GIGRNSMQGDIRFADVLEKMGATI  287



>ref|WP_040076330.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacteriaceae 
bacterium ATCC 29904]
 gb|KGB01338.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacteriaceae 
bacterium ATCC 29904]
Length=427

 Score =   171 bits (433),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 104/149 (70%), Gaps = 8/149 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G+  +W E+ ++          R  L AID++MN +PD AMT+A  ALFA G T +R++ 
Sbjct  284  GATVTWGEDFISCT--------RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIY  335

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKET+R+ A+ TELRK+GA VEEG DY  +TPP +L V EI TY+DHRMAM FSL A
Sbjct  336  NWRVKETDRLFAMATELRKVGAEVEEGEDYIRVTPPAQLQVAEIGTYNDHRMAMCFSLVA  395

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFS  203
             ++ PVTI DP CT KTFPDYFE L + S
Sbjct  396  LSDTPVTILDPKCTAKTFPDYFEQLGRIS  424


 Score = 88.6 bits (218),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  G+ VE+  ++ RF++RG Q+Y+SPG+  VEGDASSASYFLA  A+ GGTV V 
Sbjct  205  LHLMQTFGIEVENH-AYQRFVVRGAQQYQSPGHYLVEGDASSASYFLAAGAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA V
Sbjct  264  GIGRNSVQGDIRFADVLEKMGATV  287



>gb|ABR25383.1| 5-enolpyruvylshikimate-3-phosphate synthase [Oryza sativa Indica 
Group]
Length=273

 Score =   130 bits (328),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +WT+ SVTV GPPR P G+KHL+A+DVNMNKMPDVAMTLAVVALFADGPTAIRDVA
Sbjct  200  GAKVTWTDTSVTVTGPPREPYGKKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  259

Query  469  SWRVKETERMIAV  431
            SWRVKETERM+A+
Sbjct  260  SWRVKETERMVAI  272


 Score =   128 bits (322),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L+LMER GV  EHSDSWDRF I+GGQKYKSPGNA+VEGDASSASYFLAGAA+TGGTVTV+
Sbjct  120  LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVQ  179

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            GCGT+SLQGDVKFAEVLE MGA+V
Sbjct  180  GCGTTSLQGDVKFAEVLEMMGAKV  203



>pdb|3FK0|A Chain A, E. Coli Epsp Synthase (Tips Mutation) Liganded With 
S3p
 pdb|3FK1|A Chain A, E. Coli Epsp Synthase (Tips Mutation) Liganded With 
S3p And Glyphosate
Length=427

 Score =   174 bits (440),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  298  RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGA  357

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
             VEEG DY  ITPPE+LN  EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  358  EVEEGHDYIRITPPEKLNFAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYF  417

Query  223  EVLQKFSK  200
            E L + S+
Sbjct  418  EQLARISQ  425


 Score = 85.9 bits (211),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV +E+   + +F+++GGQ Y+SPG   VEGDASSASYFLA AA+ GGTV V 
Sbjct  205  LNLMKTFGVEIENQ-HYQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA +
Sbjct  264  GIGRNSMQGDIRFADVLEKMGATI  287



>ref|WP_001382116.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli]
 gb|ENA65995.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
178900]
Length=427

 Score =   174 bits (440),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  298  RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGA  357

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
             VEEG DY  ITPPE+LN  EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  358  EVEEGHDYIRITPPEKLNFAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYF  417

Query  223  EVLQKFSK  200
            E L + S+
Sbjct  418  EQLARISQ  425


 Score = 85.9 bits (211),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV +E+   + +F+++GGQ Y+SPG   VEGDASSASYFLA AA+ GGTV V 
Sbjct  205  LNLMKTFGVEIENQ-HYQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA +
Sbjct  264  GIGRNSMQGDIRFADVLEKMGATI  287



>ref|WP_043864967.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter aerogenes]
 gb|KIU35333.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Enterobacter aerogenes]
Length=428

 Score =   167 bits (422),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 105/150 (70%), Gaps = 8/150 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +W ++ +           R  L AID++MN +PD AMT+A  ALFA G T +R++ 
Sbjct  285  GAQITWGDDYIACT--------RGDLNAIDMDMNHIPDAAMTIATTALFAKGTTTLRNIY  336

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKET+R+ A+ TELRK+GATVEEG D+  ITPP +L   +I TY+DHRMAM FSL A
Sbjct  337  NWRVKETDRLAAMATELRKVGATVEEGHDFITITPPGQLRFADIGTYNDHRMAMCFSLVA  396

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSK  200
             ++ PVTI DP CT KTFPDYF+ L + S+
Sbjct  397  LSDTPVTILDPKCTAKTFPDYFQQLARLSQ  426


 Score = 92.8 bits (229),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 68/84 (81%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV VE+ D + RF+IRGGQ+Y++PG   VEGDASSASYFLA AA+ GGT+ V 
Sbjct  206  LHLMKAFGVDVENGD-YQRFVIRGGQRYQTPGEYLVEGDASSASYFLAAAAIKGGTIKVT  264

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA++
Sbjct  265  GIGRNSVQGDIRFADVLEKMGAQI  288



>ref|WP_038482812.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Cedecea neteri]
 gb|AIR04024.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Cedecea neteri]
 gb|KHE41510.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Cedecea neteri]
Length=427

 Score =   173 bits (438),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 106/149 (71%), Gaps = 8/149 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +W ++ ++ +        R  L AID++MN +PD AMT+A  ALFA G T +R++ 
Sbjct  284  GAKVTWGDDFISCE--------RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIY  335

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKET+R+ A+ TELRK+GA VEEG DY  +TPP +L   EI TY+DHRMAM FSL A
Sbjct  336  NWRVKETDRLSAMATELRKVGAEVEEGEDYITVTPPAKLTFAEIGTYNDHRMAMCFSLVA  395

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFS  203
             ++ PVTI DPGCT KTFPDYFE L + S
Sbjct  396  LSDTPVTILDPGCTAKTFPDYFEQLARIS  424


 Score = 86.7 bits (213),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV VE+ D +  F+IRG Q+Y+SPG   VEGDASSASYFLA  AV GG V V 
Sbjct  205  LHLMKTFGVEVENRD-YRSFVIRGAQEYQSPGAYLVEGDASSASYFLAAGAVKGGVVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA+V
Sbjct  264  GIGRNSVQGDIRFADVLEKMGAKV  287



>ref|WP_004873749.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Yersinia mollaretii]
 gb|EEQ12115.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Yersinia mollaretii 
ATCC 43969]
Length=428

 Score =   172 bits (437),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 106/151 (70%), Gaps = 8/151 (5%)
 Frame = -1

Query  649  GSRSSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVA  470
            G++ +W ++ +           R  L+ ID++MN +PD AMT+A  ALFADGPT IR++ 
Sbjct  285  GAKVTWGDDYIECS--------RGELQGIDMDMNHIPDAAMTIATTALFADGPTIIRNIY  336

Query  469  SWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA  290
            +WRVKET+R+ A+ TELRK+GA VEEG DY  + PP +L   EI TY+DHRMAM FSL A
Sbjct  337  NWRVKETDRLSAMATELRKVGAQVEEGEDYIRVVPPAQLITAEIGTYNDHRMAMCFSLVA  396

Query  289  CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH  197
             + +P+TI DP CT KTFPDYFE L + S++
Sbjct  397  LSNIPITILDPKCTAKTFPDYFEQLARLSQN  427


 Score = 87.0 bits (214),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV VEH +++  F I+GGQ Y++PG   VEGDASSASYFLA AA+ GGTV V 
Sbjct  206  LHLMKAFGVDVEH-ENYQIFHIKGGQTYRTPGTYLVEGDASSASYFLAAAAIKGGTVRVT  264

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G  S+QGD KFA+VLEKMGA+V
Sbjct  265  GIGKKSVQGDTKFADVLEKMGAKV  288



>ref|WP_032223555.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli]
 emb|CDP68269.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
D6-113.11]
 emb|CDU35460.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
D6-113.11]
Length=427

 Score =   173 bits (439),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  298  RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGA  357

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
             VEEG DY  ITPPE+LN  EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  358  EVEEGHDYIRITPPEKLNFAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYF  417

Query  223  EVLQKFSK  200
            E L + S+
Sbjct  418  EQLARISQ  425


 Score = 85.9 bits (211),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV +E+   + +F+++GGQ Y+SPG   VEGDASSASYFLA AA+ GGTV V 
Sbjct  205  LNLMKTFGVEIENQ-HYQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA +
Sbjct  264  GIGRNSMQGDIRFADVLEKMGATI  287



>ref|WP_029399027.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli]
Length=427

 Score =   174 bits (440),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  298  RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGA  357

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
             VEEG DY  ITPPE+LN  EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  358  EVEEGHDYIRITPPEKLNFAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTTKTFPDYF  417

Query  223  EVLQKFSK  200
            E L + S+
Sbjct  418  EQLARISQ  425


 Score = 85.9 bits (211),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV +E+   + +F+++GGQ Y+SPG   VEGDASSASYFLA AA+ GGTV V 
Sbjct  205  LNLMKTFGVEIENQ-HYQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA +
Sbjct  264  GIGRNSMQGDIRFADVLEKMGATI  287



>sp|O87006.1|AROA_SHIDY RecName: Full=3-phosphoshikimate 1-carboxyvinyltransferase; AltName: 
Full=5-enolpyruvylshikimate-3-phosphate synthase; Short=EPSP 
synthase; Short=EPSPS [Shigella dysenteriae]
 gb|AAC32745.1| EPSP synthase AroA [Shigella dysenteriae]
Length=427

 Score =   173 bits (439),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  298  RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGA  357

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
             VEEG DY  ITPPE+LN  EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  358  EVEEGHDYIRITPPEKLNFAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYF  417

Query  223  EVLQKFSK  200
            E L + S+
Sbjct  418  EQLARISQ  425


 Score = 85.9 bits (211),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV +E+   + +F+++GGQ Y+SPG   VEGDASSASYFLA AA+ GGTV V 
Sbjct  205  LNLMKTFGVEIENQ-HYQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA +
Sbjct  264  GIGRNSMQGDIRFADVLEKMGATI  287



>ref|WP_000445238.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli]
 gb|EGI22264.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
M718]
 gb|ESA66897.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
113290]
Length=427

 Score =   173 bits (439),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  298  RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGA  357

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
             VEEG DY  ITPPE+LN  EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  358  EVEEGHDYIRITPPEKLNFAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTGKTFPDYF  417

Query  223  EVLQKFSK  200
            E L + S+
Sbjct  418  EQLARISQ  425


 Score = 85.9 bits (211),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV +E+   + +F+++GGQ Y+SPG   VEGDASSASYFLA AA+ GGTV V 
Sbjct  205  LNLMKTFGVEIENQ-HYQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA +
Sbjct  264  GIGRNSMQGDIRFADVLEKMGATI  287



>ref|WP_001710157.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli]
 gb|EMV93626.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
2865200]
Length=427

 Score =   173 bits (439),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  298  RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGA  357

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
             VEEG DY  ITPPE+LN  EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  358  EVEEGHDYIRITPPEKLNFAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYF  417

Query  223  EVLQKFSK  200
            E L + S+
Sbjct  418  EQLARISQ  425


 Score = 85.9 bits (211),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV +E+   + +F+++GGQ Y+SPG   VEGDASSASYFLA AA+ GGTV V 
Sbjct  205  LNLMKTFGVEIENQ-HYQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA +
Sbjct  264  GIGRNSMQGDIRFADVLEKMGATI  287



>ref|WP_001550903.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli]
 gb|ELD84041.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
KTE236]
 gb|ELD89870.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
KTE237]
 gb|ELE61983.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
KTE76]
 gb|ELF56762.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
KTE9]
 gb|ELG53277.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
KTE115]
 gb|EOV28380.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
KTE199]
 gb|EOW35275.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
KTE121]
 gb|EQO65594.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
HVH 41 (4-2677849)]
 gb|EQW03927.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
KOEGE 118 (317a)]
 gb|EQW31608.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
UMEA 3033-1]
 gb|EQX35227.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
UMEA 3163-1]
 gb|ESA30340.1| 5-Enolpyruvylshikimate-3-phosphate synthase [Escherichia coli 
SCD2]
 gb|ETE28549.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
LAU-EC10]
 emb|CDK47275.1| 5-Enolpyruvylshikimate-3-phosphate synthase [Escherichia coli 
IS1]
 gb|EYE06329.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
1-110-08_S4_C1]
 gb|KDG97688.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
UCI 65]
 gb|KDU06130.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
3-267-03_S1_C2]
 gb|KDW77119.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
1-392-07_S1_C1]
 gb|KDW84877.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
1-392-07_S1_C2]
 gb|KEJ17950.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
6-175-07_S1_C2]
 gb|KEM54380.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
6-175-07_S1_C3]
Length=427

 Score =   173 bits (439),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  298  RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGA  357

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
             VEEG DY  ITPPE+LN  EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  358  EVEEGHDYIRITPPEKLNFAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYF  417

Query  223  EVLQKFSK  200
            E L + S+
Sbjct  418  EQLARISQ  425


 Score = 85.9 bits (211),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV +E+   + +F+++GGQ Y+SPG   VEGDASSASYFLA AA+ GGTV V 
Sbjct  205  LNLMKTFGVEIENQ-HYQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA +
Sbjct  264  GIGRNSMQGDIRFADVLEKMGATI  287



>ref|WP_032294001.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli]
 gb|KEN14868.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Escherichia coli 
7-233-03_S4_C2]
Length=427

 Score =   173 bits (439),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = -1

Query  583  RKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA  404
            R  L AID++MN +PD AMT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA
Sbjct  298  RGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGA  357

Query  403  TVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF  224
             VEEG DY  ITPPE+LN  EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF
Sbjct  358  EVEEGHDYIRITPPEKLNFAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYF  417

Query  223  EVLQKFSK  200
            E L + S+
Sbjct  418  EQLARISQ  425


 Score = 85.9 bits (211),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -2

Query  888  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLagaavtggtvtVE  709
            L LM+  GV +E+   + +F+++GGQ Y+SPG   VEGDASSASYFLA AA+ GGTV V 
Sbjct  205  LNLMKTFGVEIENQ-HYQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT  263

Query  708  GCGTSSLQGDVKFAEVLEKMGAEV  637
            G G +S+QGD++FA+VLEKMGA +
Sbjct  264  GIGRNSMQGDIRFADVLEKMGATI  287



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2035318454400