BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF053M03

Length=889
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009804979.1|  PREDICTED: probable pectate lyase 5                473   2e-163   Nicotiana sylvestris
ref|XP_009586995.1|  PREDICTED: probable pectate lyase 5                473   3e-163   Nicotiana tomentosiformis
ref|XP_002285340.1|  PREDICTED: probable pectate lyase 5                472   5e-163   Vitis vinifera
ref|XP_010663062.1|  PREDICTED: probable pectate lyase 5                470   2e-162   Vitis vinifera
emb|CAN76500.1|  hypothetical protein VITISV_004734                     470   3e-162   Vitis vinifera
emb|CDP13269.1|  unnamed protein product                                469   4e-162   Coffea canephora [robusta coffee]
ref|XP_011029589.1|  PREDICTED: probable pectate lyase 5                469   5e-162   Populus euphratica
ref|XP_010250930.1|  PREDICTED: probable pectate lyase 5                468   2e-161   Nelumbo nucifera [Indian lotus]
ref|XP_011086701.1|  PREDICTED: probable pectate lyase 5                467   3e-161   Sesamum indicum [beniseed]
ref|XP_003549832.1|  PREDICTED: probable pectate lyase 18 isoform 1     466   8e-161   Glycine max [soybeans]
ref|XP_007155507.1|  hypothetical protein PHAVU_003G207400g             465   2e-160   Phaseolus vulgaris [French bean]
gb|KHN34377.1|  Putative pectate lyase 22                               465   2e-160   Glycine soja [wild soybean]
gb|KJB51152.1|  hypothetical protein B456_008G203900                    460   2e-160   Gossypium raimondii
dbj|BAB59066.1|  pectate lyase                                          464   7e-160   Salix gilgiana
ref|XP_008340139.1|  PREDICTED: probable pectate lyase 5                464   7e-160   
ref|XP_004515847.1|  PREDICTED: probable pectate lyase 22-like          464   1e-159   Cicer arietinum [garbanzo]
ref|XP_003608909.1|  Pectate lyase                                      463   1e-159   Medicago truncatula
ref|XP_007222794.1|  hypothetical protein PRUPE_ppa006665mg             462   3e-159   
ref|XP_007037816.1|  Pectin lyase-like superfamily protein isoform 2    460   3e-159   
ref|XP_010023435.1|  PREDICTED: probable pectate lyase 5                462   3e-159   Eucalyptus grandis [rose gum]
ref|XP_008221954.1|  PREDICTED: probable pectate lyase 5                462   3e-159   Prunus mume [ume]
ref|NP_001242543.1|  uncharacterized protein LOC100779940 precursor     461   6e-159   Glycine max [soybeans]
gb|EYU30593.1|  hypothetical protein MIMGU_mgv1a007569mg                461   7e-159   Erythranthe guttata [common monkey flower]
gb|AFK44189.1|  unknown                                                 461   8e-159   Medicago truncatula
ref|XP_004310004.1|  PREDICTED: probable pectate lyase 5                460   1e-158   Fragaria vesca subsp. vesca
ref|XP_002511275.1|  Pectate lyase precursor, putative                  458   2e-158   
ref|XP_010320956.1|  PREDICTED: probable pectate lyase 5                460   3e-158   Solanum lycopersicum
ref|XP_006341783.1|  PREDICTED: probable pectate lyase 5-like           459   3e-158   Solanum tuberosum [potatoes]
ref|XP_010100325.1|  hypothetical protein L484_027633                   459   3e-158   Morus notabilis
ref|XP_010248740.1|  PREDICTED: probable pectate lyase 18               459   4e-158   Nelumbo nucifera [Indian lotus]
ref|XP_010102919.1|  hypothetical protein L484_018936                   459   4e-158   Morus notabilis
ref|XP_011086987.1|  PREDICTED: probable pectate lyase 22               459   5e-158   Sesamum indicum [beniseed]
ref|XP_008389758.1|  PREDICTED: probable pectate lyase 5                459   6e-158   
ref|XP_008350945.1|  PREDICTED: probable pectate lyase 5                458   9e-158   
gb|KDO69411.1|  hypothetical protein CISIN_1g015569mg                   453   1e-157   Citrus sinensis [apfelsine]
ref|XP_007037815.1|  Pectin lyase-like superfamily protein isoform 1    458   1e-157   Theobroma cacao [chocolate]
gb|KJB51149.1|  hypothetical protein B456_008G203900                    458   1e-157   Gossypium raimondii
ref|XP_008351757.1|  PREDICTED: probable pectate lyase 18               458   1e-157   Malus domestica [apple tree]
ref|XP_009628975.1|  PREDICTED: probable pectate lyase 18               458   2e-157   Nicotiana tomentosiformis
ref|XP_009359258.1|  PREDICTED: probable pectate lyase 5                457   2e-157   Pyrus x bretschneideri [bai li]
gb|ABK92535.1|  unknown                                                 452   2e-157   Populus trichocarpa [western balsam poplar]
gb|KHG22990.1|  hypothetical protein F383_28754                         457   2e-157   Gossypium arboreum [tree cotton]
gb|ADB90477.1|  pectate lyase                                           457   3e-157   Gossypium hirsutum [American cotton]
gb|ADB90475.1|  pectate lyase                                           457   3e-157   Gossypium herbaceum [Arabian cotton]
gb|AEN70985.1|  pectate lyase                                           457   3e-157   Gossypium lobatum
ref|XP_009112069.1|  PREDICTED: probable pectate lyase 22               458   4e-157   Brassica rapa
emb|CDY16732.1|  BnaA09g06500D                                          457   5e-157   Brassica napus [oilseed rape]
gb|KHG19997.1|  hypothetical protein F383_02891                         457   5e-157   Gossypium arboreum [tree cotton]
emb|CDY48132.1|  BnaCnng15740D                                          457   5e-157   Brassica napus [oilseed rape]
emb|CDY65626.1|  BnaC03g74840D                                          458   6e-157   Brassica napus [oilseed rape]
ref|XP_009359518.1|  PREDICTED: probable pectate lyase 18               456   7e-157   Pyrus x bretschneideri [bai li]
ref|XP_009150377.1|  PREDICTED: probable pectate lyase 22               456   7e-157   Brassica rapa
gb|AEN70981.1|  pectate lyase                                           456   8e-157   Gossypium davidsonii
ref|NP_001280201.1|  probable pectate lyase 18 precursor                456   8e-157   Prunus mume [ume]
gb|EYU22243.1|  hypothetical protein MIMGU_mgv1a007460mg                456   9e-157   Erythranthe guttata [common monkey flower]
emb|CDY41506.1|  BnaA06g22590D                                          456   1e-156   Brassica napus [oilseed rape]
gb|AEN70965.1|  pectate lyase                                           456   1e-156   Gossypium schwendimanii
gb|AEN70964.1|  pectate lyase                                           456   1e-156   Gossypium laxum
gb|AEN70963.1|  pectate lyase                                           456   1e-156   Gossypium thurberi
ref|XP_004501839.1|  PREDICTED: probable pectate lyase 5-like           456   1e-156   Cicer arietinum [garbanzo]
ref|XP_004157771.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    456   1e-156   
ref|XP_004152502.1|  PREDICTED: probable pectate lyase 22-like          456   1e-156   Cucumis sativus [cucumbers]
gb|ADB90478.1|  pectate lyase                                           456   1e-156   Gossypium hirsutum [American cotton]
gb|AEN70968.1|  pectate lyase                                           456   1e-156   Gossypium mustelinum
gb|AGC94753.1|  putative pectate lyase                                  455   2e-156   Euphorbia lathyris
gb|AAY85180.1|  pectate lyase                                           455   2e-156   Gossypium hirsutum [American cotton]
gb|KCW83228.1|  hypothetical protein EUGRSUZ_B00168                     457   3e-156   Eucalyptus grandis [rose gum]
gb|AEN70984.1|  pectate lyase                                           455   3e-156   Gossypium gossypioides
ref|XP_011005597.1|  PREDICTED: probable pectate lyase 18               454   4e-156   Populus euphratica
ref|XP_010459939.1|  PREDICTED: probable pectate lyase 22               454   5e-156   Camelina sativa [gold-of-pleasure]
ref|XP_010444201.1|  PREDICTED: probable pectate lyase 22 isoform X3    452   5e-156   Camelina sativa [gold-of-pleasure]
ref|XP_010484044.1|  PREDICTED: probable pectate lyase 22               454   6e-156   Camelina sativa [gold-of-pleasure]
ref|XP_010444198.1|  PREDICTED: probable pectate lyase 22               454   6e-156   Camelina sativa [gold-of-pleasure]
gb|ADB90476.1|  pectate lyase                                           454   6e-156   Gossypium raimondii
gb|AEN70977.1|  pectate lyase                                           454   7e-156   Gossypium hirsutum subsp. latifolium
gb|ADB90479.1|  pectate lyase                                           454   7e-156   Gossypium barbadense [Egyptian cotton]
ref|XP_008439105.1|  PREDICTED: probable pectate lyase 22               454   9e-156   Cucumis melo [Oriental melon]
ref|XP_009137472.1|  PREDICTED: probable pectate lyase 18               453   9e-156   Brassica rapa
emb|CDY11033.1|  BnaA03g46920D                                          453   1e-155   Brassica napus [oilseed rape]
gb|KHG22755.1|  hypothetical protein F383_29653                         453   1e-155   Gossypium arboreum [tree cotton]
emb|CDX92652.1|  BnaC07g39100D                                          452   2e-155   
gb|KDO69407.1|  hypothetical protein CISIN_1g015569mg                   452   2e-155   Citrus sinensis [apfelsine]
ref|XP_006280553.1|  hypothetical protein CARUB_v10026494mg             452   2e-155   Capsella rubella
ref|XP_010026892.1|  PREDICTED: probable pectate lyase 18               452   2e-155   Eucalyptus grandis [rose gum]
ref|XP_007209185.1|  hypothetical protein PRUPE_ppa006392mg             452   2e-155   Prunus persica
ref|XP_006476937.1|  PREDICTED: probable pectate lyase 18-like          454   3e-155   
ref|XP_006439991.1|  hypothetical protein CICLE_v10020423mg             452   4e-155   
ref|XP_002866540.1|  pectate lyase                                      452   4e-155   Arabidopsis lyrata subsp. lyrata
emb|CDY03419.1|  BnaC01g16630D                                          451   5e-155   
gb|KDP30994.1|  hypothetical protein JCGZ_11370                         451   6e-155   Jatropha curcas
ref|XP_002322215.1|  pectate lyase 22 precursor family protein          451   7e-155   
ref|XP_003523121.1|  PREDICTED: probable pectate lyase 18-like          451   9e-155   Glycine max [soybeans]
ref|XP_010545988.1|  PREDICTED: probable pectate lyase 22               451   9e-155   Tarenaya hassleriana [spider flower]
ref|XP_003526981.1|  PREDICTED: probable pectate lyase 18-like          451   9e-155   Glycine max [soybeans]
gb|KJB50292.1|  hypothetical protein B456_008G162500                    451   1e-154   Gossypium raimondii
ref|XP_004299169.1|  PREDICTED: probable pectate lyase 18               451   1e-154   Fragaria vesca subsp. vesca
gb|KDO82123.1|  hypothetical protein CISIN_1g015702mg                   445   2e-154   Citrus sinensis [apfelsine]
gb|KHN05801.1|  Putative pectate lyase 22                               451   2e-154   Glycine soja [wild soybean]
ref|NP_001289258.1|  probable pectate lyase 18 precursor                450   2e-154   Pyrus x bretschneideri [bai li]
ref|XP_011040439.1|  PREDICTED: probable pectate lyase 18               449   3e-154   Populus euphratica
ref|XP_002318694.1|  pectate lyase 22 precursor family protein          449   4e-154   Populus trichocarpa [western balsam poplar]
ref|NP_001280839.1|  probable pectate lyase 18 precursor                449   5e-154   Malus domestica [apple tree]
ref|NP_568967.1|  putative pectate lyase 22                             449   1e-153   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10560.1|  pectate lyase                                          448   2e-153   Arabidopsis thaliana [mouse-ear cress]
gb|KHG12411.1|  hypothetical protein F383_06737                         446   3e-153   Gossypium arboreum [tree cotton]
dbj|BAI94495.1|  pectate lyase                                          447   4e-153   Dianthus caryophyllus [carnation]
ref|XP_004236303.1|  PREDICTED: probable pectate lyase 18               446   5e-153   
ref|XP_007137977.1|  hypothetical protein PHAVU_009G170500g             447   5e-153   Phaseolus vulgaris [French bean]
ref|XP_006484000.1|  PREDICTED: probable pectate lyase 5-like           446   1e-152   Citrus sinensis [apfelsine]
ref|XP_002311747.2|  pectate lyase 5 precursor family protein           445   1e-152   Populus trichocarpa [western balsam poplar]
gb|KDO82120.1|  hypothetical protein CISIN_1g015702mg                   445   2e-152   Citrus sinensis [apfelsine]
ref|XP_006852264.1|  hypothetical protein AMTR_s00049p00173370          445   2e-152   Amborella trichopoda
ref|XP_006438176.1|  hypothetical protein CICLE_v10031429mg             447   2e-152   
ref|XP_011072008.1|  PREDICTED: probable pectate lyase 18               445   2e-152   Sesamum indicum [beniseed]
gb|KFK28033.1|  hypothetical protein AALP_AA8G463100                    444   3e-152   Arabis alpina [alpine rockcress]
emb|CDY56220.1|  BnaAnng14170D                                          444   4e-152   Brassica napus [oilseed rape]
ref|NP_001268051.1|  pectate lyase precursor                            444   4e-152   Vitis vinifera
ref|XP_009105097.1|  PREDICTED: probable pectate lyase 5                444   5e-152   Brassica rapa
emb|CDP15081.1|  unnamed protein product                                444   6e-152   Coffea canephora [robusta coffee]
gb|KJB50293.1|  hypothetical protein B456_008G162500                    444   6e-152   Gossypium raimondii
gb|KJB08081.1|  hypothetical protein B456_001G062400                    443   8e-152   Gossypium raimondii
gb|AFK32131.1|  pectate lyase                                           441   9e-152   Vitis vinifera
gb|KDO69408.1|  hypothetical protein CISIN_1g015569mg                   442   2e-151   Citrus sinensis [apfelsine]
ref|XP_006351443.1|  PREDICTED: probable pectate lyase 18-like          442   2e-151   Solanum tuberosum [potatoes]
ref|XP_006302330.1|  hypothetical protein CARUB_v10020387mg             442   3e-151   Capsella rubella
ref|XP_010531484.1|  PREDICTED: probable pectate lyase 5                442   3e-151   Tarenaya hassleriana [spider flower]
dbj|BAF43572.1|  pectate lyase                                          442   3e-151   Prunus persica
ref|XP_009105327.1|  PREDICTED: probable pectate lyase 5                442   4e-151   Brassica rapa
gb|KDP26717.1|  hypothetical protein JCGZ_17875                         441   6e-151   Jatropha curcas
ref|XP_002887143.1|  pectate lyase family protein                       441   7e-151   Arabidopsis lyrata subsp. lyrata
ref|XP_009762540.1|  PREDICTED: probable pectate lyase 18               440   2e-150   Nicotiana sylvestris
gb|KJB30976.1|  hypothetical protein B456_005G174600                    439   3e-150   Gossypium raimondii
emb|CDY01846.1|  BnaC06g28860D                                          439   3e-150   
emb|CDY08948.1|  BnaC08g11780D                                          439   6e-150   Brassica napus [oilseed rape]
ref|NP_564906.1|  putative pectate lyase 5                              438   1e-149   Arabidopsis thaliana [mouse-ear cress]
gb|AAG28907.1|AC008113_23  F12A21.12                                    437   1e-149   Arabidopsis thaliana [mouse-ear cress]
gb|AAM67091.1|  putative pectate lyase                                  436   4e-149   Arabidopsis thaliana [mouse-ear cress]
emb|CDY24847.1|  BnaA08g14630D                                          436   6e-149   Brassica napus [oilseed rape]
gb|KFK41187.1|  hypothetical protein AALP_AA2G097000                    436   6e-149   Arabis alpina [alpine rockcress]
ref|XP_002515037.1|  Pectate lyase precursor, putative                  436   7e-149   Ricinus communis
ref|XP_007044917.1|  Pectate lyase family protein                       436   1e-148   Theobroma cacao [chocolate]
gb|AAF19195.1|AF206319_1  pectate lyase 1                               435   1e-148   Musa acuminata AAA Group [Cavendish banana]
ref|XP_009109237.1|  PREDICTED: probable pectate lyase 18               435   1e-148   Brassica rapa
ref|XP_009406385.1|  PREDICTED: probable pectate lyase 18               435   1e-148   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK29019.1|  hypothetical protein AALP_AA7G078200                    433   7e-148   Arabis alpina [alpine rockcress]
ref|XP_009138507.1|  PREDICTED: probable pectate lyase 18               432   3e-147   Brassica rapa
ref|XP_009788173.1|  PREDICTED: probable pectate lyase 18               431   4e-147   Nicotiana sylvestris
ref|XP_003638513.1|  Pectate lyase                                      431   5e-147   
ref|XP_006283843.1|  hypothetical protein CARUB_v10004942mg             431   5e-147   Capsella rubella
ref|XP_002314576.1|  pectate lyase 5 precursor family protein           430   9e-147   Populus trichocarpa [western balsam poplar]
ref|XP_002526952.1|  Pectate lyase precursor, putative                  430   9e-147   
emb|CDY34310.1|  BnaA01g14130D                                          429   2e-146   Brassica napus [oilseed rape]
ref|XP_009631254.1|  PREDICTED: probable pectate lyase 18               429   3e-146   Nicotiana tomentosiformis
ref|XP_010682362.1|  PREDICTED: probable pectate lyase 5                429   4e-146   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004489554.1|  PREDICTED: probable pectate lyase 5-like           428   7e-146   Cicer arietinum [garbanzo]
ref|XP_007215475.1|  hypothetical protein PRUPE_ppa006569mg             428   1e-145   Prunus persica
ref|XP_010929962.1|  PREDICTED: probable pectate lyase 5                428   1e-145   Elaeis guineensis
ref|XP_008230481.1|  PREDICTED: pectate lyase-like                      427   1e-145   Prunus mume [ume]
ref|NP_567707.1|  putative pectate lyase 18                             427   1e-145   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007151585.1|  hypothetical protein PHAVU_004G059200g             427   2e-145   Phaseolus vulgaris [French bean]
ref|XP_002867644.1|  pectate lyase family protein                       427   2e-145   
gb|KDP46367.1|  hypothetical protein JCGZ_10207                         426   3e-145   Jatropha curcas
ref|XP_010695977.1|  PREDICTED: probable pectate lyase 18               426   5e-145   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS69872.1|  hypothetical protein M569_04891                         426   7e-145   Genlisea aurea
ref|XP_010448519.1|  PREDICTED: probable pectate lyase 18               426   7e-145   Camelina sativa [gold-of-pleasure]
ref|XP_010433725.1|  PREDICTED: probable pectate lyase 18               426   7e-145   Camelina sativa [gold-of-pleasure]
gb|AAK25850.1|AF360140_1  putative pectate lyase                        425   2e-144   Arabidopsis thaliana [mouse-ear cress]
gb|ACF84425.1|  unknown                                                 419   2e-144   Zea mays [maize]
ref|XP_011042354.1|  PREDICTED: probable pectate lyase 5                424   3e-144   Populus euphratica
gb|EPS58104.1|  pectate lyase                                           422   3e-144   Genlisea aurea
gb|AAM65103.1|  putative pectate lyase                                  424   3e-144   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010239620.1|  PREDICTED: probable pectate lyase 8 isoform X2     423   1e-143   
ref|XP_010239619.1|  PREDICTED: probable pectate lyase 8 isoform X1     424   2e-143   Brachypodium distachyon [annual false brome]
gb|ACN35280.1|  unknown                                                 416   8e-143   Zea mays [maize]
emb|CDY28857.1|  BnaC06g26450D                                          420   9e-143   Brassica napus [oilseed rape]
ref|XP_011010949.1|  PREDICTED: pectate lyase-like                      420   1e-142   Populus euphratica
emb|CAA63496.1|  pectate lyase                                          419   3e-142   Musa acuminata AAA Group [Cavendish banana]
ref|XP_006347419.1|  PREDICTED: probable pectate lyase 18-like          419   3e-142   Solanum tuberosum [potatoes]
ref|XP_007163701.1|  hypothetical protein PHAVU_001G256900g             421   4e-142   Phaseolus vulgaris [French bean]
ref|XP_009391056.1|  PREDICTED: probable pectate lyase 8                420   5e-142   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008800563.1|  PREDICTED: probable pectate lyase 8 isoform X1     420   7e-142   Phoenix dactylifera
ref|XP_011097349.1|  PREDICTED: pectate lyase-like                      418   7e-142   Sesamum indicum [beniseed]
dbj|BAK06362.1|  predicted protein                                      420   7e-142   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008800564.1|  PREDICTED: probable pectate lyase 8 isoform X2     420   8e-142   Phoenix dactylifera
gb|KJB37783.1|  hypothetical protein B456_006G219800                    413   8e-142   Gossypium raimondii
ref|XP_002300069.1|  pectate lyase family protein                       417   1e-141   Populus trichocarpa [western balsam poplar]
gb|EEE60442.1|  hypothetical protein OsJ_13660                          419   1e-141   Oryza sativa Japonica Group [Japonica rice]
gb|EMT28700.1|  hypothetical protein F775_17439                         417   2e-141   
emb|CAA22985.1|  putative pectate lyase                                 417   2e-141   Arabidopsis thaliana [mouse-ear cress]
gb|KJB15669.1|  hypothetical protein B456_002G189900                    417   2e-141   Gossypium raimondii
emb|CAE02420.2|  OSJNBa0095E20.8                                        419   2e-141   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010415362.1|  PREDICTED: probable pectate lyase 5                417   2e-141   Camelina sativa [gold-of-pleasure]
emb|CDY12666.1|  BnaA02g13340D                                          417   3e-141   Brassica napus [oilseed rape]
gb|EEC76710.1|  hypothetical protein OsI_14719                          419   3e-141   Oryza sativa Indica Group [Indian rice]
ref|XP_010935686.1|  PREDICTED: probable pectate lyase 8 isoform X2     416   5e-141   Elaeis guineensis
ref|XP_010470701.1|  PREDICTED: probable pectate lyase 5                416   5e-141   Camelina sativa [gold-of-pleasure]
emb|CDY32557.1|  BnaC02g17500D                                          416   5e-141   Brassica napus [oilseed rape]
ref|XP_010935685.1|  PREDICTED: probable pectate lyase 8 isoform X1     417   6e-141   Elaeis guineensis
ref|XP_009127577.1|  PREDICTED: probable pectate lyase 5                415   8e-141   Brassica rapa
ref|XP_008667903.1|  PREDICTED: pectate lyase 8 isoform X1              418   9e-141   
ref|XP_009340844.1|  PREDICTED: pectate lyase-like                      415   1e-140   Pyrus x bretschneideri [bai li]
ref|XP_010322529.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    414   2e-140   
ref|XP_003618787.1|  Pectate lyase                                      414   2e-140   Medicago truncatula
ref|XP_011073763.1|  PREDICTED: probable pectate lyase 8                415   4e-140   Sesamum indicum [beniseed]
ref|NP_001234029.1|  probable pectate lyase P18 precursor               413   5e-140   
ref|XP_010918897.1|  PREDICTED: probable pectate lyase 8 isoform X2     414   7e-140   Elaeis guineensis
ref|XP_008796023.1|  PREDICTED: probable pectate lyase 5                413   8e-140   Phoenix dactylifera
ref|XP_008804450.1|  PREDICTED: probable pectate lyase 8 isoform X2     413   9e-140   Phoenix dactylifera
ref|XP_004975048.1|  PREDICTED: probable pectate lyase 15-like is...    414   1e-139   Setaria italica
ref|XP_010918895.1|  PREDICTED: probable pectate lyase 8 isoform X1     414   1e-139   Elaeis guineensis
ref|XP_004143054.1|  PREDICTED: probable pectate lyase 5-like           413   1e-139   Cucumis sativus [cucumbers]
ref|XP_009408120.1|  PREDICTED: probable pectate lyase 8                414   1e-139   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008804449.1|  PREDICTED: probable pectate lyase 8 isoform X1     414   1e-139   Phoenix dactylifera
ref|XP_009411363.1|  PREDICTED: probable pectate lyase 8                414   2e-139   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006338637.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    412   2e-139   
ref|XP_003551943.1|  PREDICTED: probable pectate lyase 5-like           412   2e-139   Glycine max [soybeans]
gb|EYU43815.1|  hypothetical protein MIMGU_mgv1a006554mg                413   2e-139   Erythranthe guttata [common monkey flower]
ref|XP_010023767.1|  PREDICTED: probable pectate lyase 8 isoform X1     413   3e-139   Eucalyptus grandis [rose gum]
gb|ABK25017.1|  unknown                                                 412   3e-139   Picea sitchensis
ref|XP_010940647.1|  PREDICTED: probable pectate lyase 8                412   4e-139   Elaeis guineensis
emb|CDO99404.1|  unnamed protein product                                413   4e-139   Coffea canephora [robusta coffee]
ref|XP_004975047.1|  PREDICTED: probable pectate lyase 15-like is...    413   5e-139   Setaria italica
ref|XP_004975046.1|  PREDICTED: probable pectate lyase 15-like is...    414   6e-139   
ref|XP_009400922.1|  PREDICTED: probable pectate lyase 8 isoform X1     412   6e-139   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004304685.1|  PREDICTED: pectate lyase-like                      410   6e-139   Fragaria vesca subsp. vesca
gb|KJB37786.1|  hypothetical protein B456_006G219800                    412   6e-139   Gossypium raimondii
ref|XP_009400924.1|  PREDICTED: probable pectate lyase 8 isoform X2     412   6e-139   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY03964.1|  BnaC02g36790D                                          410   6e-139   
gb|AFK42760.1|  unknown                                                 405   7e-139   Medicago truncatula
gb|KHN07207.1|  Putative pectate lyase 15                               405   8e-139   Glycine soja [wild soybean]
ref|XP_010023768.1|  PREDICTED: probable pectate lyase 1 isoform X2     411   8e-139   Eucalyptus grandis [rose gum]
ref|NP_001141589.1|  uncharacterized protein LOC100273705               412   9e-139   Zea mays [maize]
gb|KHN35421.1|  Putative pectate lyase P18                              405   1e-138   Glycine soja [wild soybean]
ref|XP_007034463.1|  Pectin lyase-like superfamily protein              411   1e-138   
ref|XP_011091390.1|  PREDICTED: probable pectate lyase 8                411   1e-138   
ref|XP_004138973.1|  PREDICTED: probable pectate lyase 15-like          411   1e-138   Cucumis sativus [cucumbers]
ref|XP_004171543.1|  PREDICTED: probable pectate lyase 15-like          411   2e-138   
ref|XP_009384552.1|  PREDICTED: probable pectate lyase 8                411   2e-138   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382167.1|  PREDICTED: probable pectate lyase 8                410   2e-138   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006854398.1|  hypothetical protein AMTR_s00039p00189000          411   3e-138   Amborella trichopoda
gb|EMS64552.1|  hypothetical protein TRIUR3_22914                       414   3e-138   Triticum urartu
ref|XP_004156698.1|  PREDICTED: putative pectate lyase 11-like          409   6e-138   
ref|XP_004142773.1|  PREDICTED: putative pectate lyase 11-like          409   6e-138   Cucumis sativus [cucumbers]
ref|XP_010038352.1|  PREDICTED: probable pectate lyase 8                409   6e-138   Eucalyptus grandis [rose gum]
ref|XP_006591479.1|  PREDICTED: probable pectate lyase 5-like           408   6e-138   Glycine max [soybeans]
emb|CDP16631.1|  unnamed protein product                                408   8e-138   Coffea canephora [robusta coffee]
ref|XP_004289729.1|  PREDICTED: probable pectate lyase 8                409   9e-138   Fragaria vesca subsp. vesca
ref|XP_008458848.1|  PREDICTED: pectate lyase-like                      408   9e-138   Cucumis melo [Oriental melon]
ref|XP_008444399.1|  PREDICTED: probable pectate lyase 5                408   1e-137   Cucumis melo [Oriental melon]
gb|KHG30349.1|  hypothetical protein F383_15991                         410   1e-137   Gossypium arboreum [tree cotton]
gb|KHG06252.1|  hypothetical protein F383_10745                         408   1e-137   Gossypium arboreum [tree cotton]
gb|KJB72155.1|  hypothetical protein B456_011G161900                    409   1e-137   Gossypium raimondii
ref|NP_001147553.1|  pectate lyase 8                                    409   1e-137   
ref|XP_009385867.1|  PREDICTED: probable pectate lyase 8 isoform X2     409   1e-137   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB33886.1|  hypothetical protein B456_006G036300                    407   1e-137   Gossypium raimondii
gb|AAK66161.1|  pectate lyase                                           405   2e-137   Fragaria x ananassa
ref|XP_007140561.1|  hypothetical protein PHAVU_008G123000g             408   2e-137   Phaseolus vulgaris [French bean]
gb|AAF19196.1|AF206320_1  pectate lyase 2                               409   2e-137   Musa acuminata AAA Group [Cavendish banana]
gb|EPS68938.1|  hypothetical protein M569_05827                         406   2e-137   Genlisea aurea
ref|XP_003524720.1|  PREDICTED: pectate lyase-like                      406   3e-137   Glycine max [soybeans]
ref|XP_009397895.1|  PREDICTED: probable pectate lyase 8                408   3e-137   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009385866.1|  PREDICTED: probable pectate lyase 8 isoform X1     409   3e-137   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007222160.1|  hypothetical protein PRUPE_ppa005761mg             407   3e-137   Prunus persica
ref|XP_010450167.1|  PREDICTED: probable pectate lyase 15 isoform X1    408   3e-137   Camelina sativa [gold-of-pleasure]
ref|XP_010435229.1|  PREDICTED: probable pectate lyase 15               408   3e-137   Camelina sativa [gold-of-pleasure]
ref|XP_008460726.1|  PREDICTED: probable pectate lyase 8 isoform X1     407   4e-137   Cucumis melo [Oriental melon]
ref|XP_010440536.1|  PREDICTED: probable pectate lyase 15 isoform X2    408   4e-137   Camelina sativa [gold-of-pleasure]
ref|XP_010532807.1|  PREDICTED: probable pectate lyase 15               408   4e-137   Tarenaya hassleriana [spider flower]
ref|XP_006282594.1|  hypothetical protein CARUB_v10004736mg             408   4e-137   Capsella rubella
ref|XP_004502358.1|  PREDICTED: probable pectate lyase 5-like           406   4e-137   Cicer arietinum [garbanzo]
ref|XP_010450168.1|  PREDICTED: probable pectate lyase 15 isoform X2    408   4e-137   Camelina sativa [gold-of-pleasure]
dbj|BAF43573.1|  pectate lyase                                          406   5e-137   Prunus persica
gb|EYU34765.1|  hypothetical protein MIMGU_mgv1a023431mg                405   5e-137   Erythranthe guttata [common monkey flower]
ref|XP_010440534.1|  PREDICTED: probable pectate lyase 15 isoform X1    408   5e-137   Camelina sativa [gold-of-pleasure]
gb|KHN15224.1|  Putative pectate lyase 15                               400   5e-137   Glycine soja [wild soybean]
ref|XP_003622996.1|  Pectate lyase 1-27                                 407   6e-137   Medicago truncatula
ref|XP_010536660.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    405   6e-137   Tarenaya hassleriana [spider flower]
gb|EPS63108.1|  hypothetical protein M569_11679                         404   6e-137   Genlisea aurea
ref|XP_008460728.1|  PREDICTED: probable pectate lyase 1 isoform X3     404   8e-137   
ref|XP_008460727.1|  PREDICTED: probable pectate lyase 1 isoform X2     406   8e-137   
ref|XP_006604001.1|  PREDICTED: pectate lyase-like                      405   1e-136   
ref|XP_010109687.1|  hypothetical protein L484_015172                   406   1e-136   
ref|XP_010672089.1|  PREDICTED: probable pectate lyase 1                406   1e-136   
ref|XP_010243989.1|  PREDICTED: probable pectate lyase 8                406   1e-136   
gb|EYU32621.1|  hypothetical protein MIMGU_mgv1a006198mg                406   2e-136   
dbj|BAC42832.1|  putative pectate lyase                                 399   2e-136   
ref|XP_002870357.1|  pectate lyase family protein                       407   2e-136   
ref|XP_003552152.2|  PREDICTED: probable pectate lyase 20-like          405   3e-136   
ref|XP_009370039.1|  PREDICTED: probable pectate lyase 8                405   3e-136   
ref|XP_003601871.1|  Pectate lyase                                      404   3e-136   
gb|KDP26417.1|  hypothetical protein JCGZ_17575                         405   4e-136   
ref|XP_008223974.1|  PREDICTED: probable pectate lyase 8                405   4e-136   
ref|XP_006487597.1|  PREDICTED: probable pectate lyase 1-like           405   5e-136   
ref|XP_003555714.2|  PREDICTED: probable pectate lyase 1-like           406   6e-136   
ref|XP_008812405.1|  PREDICTED: probable pectate lyase 8                404   7e-136   
gb|AAX88800.1|  ripening-related pectate lyase                          404   7e-136   
emb|CAN75298.1|  hypothetical protein VITISV_008675                     404   7e-136   
ref|XP_008438392.1|  PREDICTED: probable pectate lyase 8                404   7e-136   
ref|XP_009362042.1|  PREDICTED: probable pectate lyase 8                404   8e-136   
gb|KHF99208.1|  hypothetical protein F383_08934                         404   9e-136   
ref|XP_002265100.1|  PREDICTED: probable pectate lyase 8                404   9e-136   
ref|NP_567409.1|  probable pectate lyase 15                             405   1e-135   
ref|XP_010933172.1|  PREDICTED: probable pectate lyase 8 isoform X2     403   1e-135   
ref|XP_010933171.1|  PREDICTED: probable pectate lyase 8 isoform X1     404   1e-135   
ref|XP_004515610.1|  PREDICTED: probable pectate lyase 8-like           403   1e-135   
ref|XP_003530885.1|  PREDICTED: probable pectate lyase 20-like          404   1e-135   
gb|KJB42428.1|  hypothetical protein B456_007G152500                    403   2e-135   
gb|KDP33375.1|  hypothetical protein JCGZ_12924                         403   2e-135   
ref|XP_004134015.1|  PREDICTED: probable pectate lyase 15-like          403   2e-135   
ref|NP_001190720.1|  probable pectate lyase 15                          403   2e-135   
ref|XP_006447221.1|  hypothetical protein CICLE_v10015474mg             401   2e-135   
gb|KDO40644.1|  hypothetical protein CISIN_1g015623mg                   401   3e-135   
ref|XP_008339288.1|  PREDICTED: probable pectate lyase 8                403   3e-135   
emb|CBI17713.3|  unnamed protein product                                400   3e-135   
emb|CBI33346.3|  unnamed protein product                                402   4e-135   
ref|XP_008360481.1|  PREDICTED: probable pectate lyase 8                402   5e-135   
ref|XP_008391438.1|  PREDICTED: probable pectate lyase 8                402   5e-135   
ref|XP_008447332.1|  PREDICTED: probable pectate lyase 8                401   6e-135   
ref|XP_006420567.1|  hypothetical protein CICLE_v10004783mg             404   6e-135   
ref|XP_010264036.1|  PREDICTED: probable pectate lyase 8                402   6e-135   
ref|XP_007031685.1|  Pectin lyase-like superfamily protein              400   7e-135   
emb|CAB36835.1|  putative pectate lyase A11 (fragment)                  399   7e-135   
ref|XP_010511733.1|  PREDICTED: probable pectate lyase 5                400   8e-135   
ref|XP_006653139.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    402   1e-134   
ref|XP_002285639.2|  PREDICTED: probable pectate lyase 8                402   1e-134   
gb|KCW57296.1|  hypothetical protein EUGRSUZ_H00093                     401   1e-134   
ref|XP_002521130.1|  Pectate lyase precursor, putative                  400   1e-134   
ref|XP_010069078.1|  PREDICTED: probable pectate lyase 8                401   1e-134   
ref|XP_009775177.1|  PREDICTED: probable pectate lyase 8                400   3e-134   
emb|CDY56668.1|  BnaCnng30870D                                          399   3e-134   
emb|CDY53564.1|  BnaC04g55760D                                          400   4e-134   
ref|XP_009349844.1|  PREDICTED: probable pectate lyase 8                400   4e-134   
ref|NP_001052103.1|  Os04g0137100                                       401   4e-134   
ref|XP_004152014.1|  PREDICTED: probable pectate lyase 8-like           399   4e-134   
ref|XP_009107745.1|  PREDICTED: probable pectate lyase 15               400   5e-134   
ref|XP_008235520.1|  PREDICTED: probable pectate lyase 8                399   6e-134   
gb|KJB11588.1|  hypothetical protein B456_001G267300                    398   6e-134   
ref|XP_002301766.2|  hypothetical protein POPTR_0002s23990g             399   6e-134   
ref|XP_004163042.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    397   7e-134   
ref|XP_010532870.1|  PREDICTED: putative pectate lyase 14               399   7e-134   
emb|CDY18738.1|  BnaC08g08780D                                          400   8e-134   
ref|XP_011024740.1|  PREDICTED: probable pectate lyase 20               399   9e-134   
ref|XP_010106682.1|  hypothetical protein L484_004616                   397   1e-133   
ref|NP_189110.1|  probable pectate lyase 10                             398   1e-133   
ref|XP_003535958.1|  PREDICTED: probable pectate lyase 1-like           398   2e-133   
emb|CDX83690.1|  BnaC07g24300D                                          396   3e-133   
gb|ADP09680.1|  pectate lyase                                           397   3e-133   
emb|CDP03845.1|  unnamed protein product                                397   3e-133   
ref|XP_004497757.1|  PREDICTED: probable pectate lyase 15-like          397   3e-133   
ref|XP_009111860.1|  PREDICTED: probable pectate lyase 20               396   3e-133   
gb|KEH41255.1|  pectate lyase family protein                            397   3e-133   
emb|CDY01151.1|  BnaA04g06680D                                          397   4e-133   
ref|XP_007049844.1|  Pectin lyase-like superfamily protein              397   4e-133   
emb|CDY19932.1|  BnaA09g03190D                                          396   4e-133   
ref|XP_007201029.1|  hypothetical protein PRUPE_ppa006229mg             396   4e-133   
ref|XP_004290232.1|  PREDICTED: probable pectate lyase 20               397   4e-133   
ref|XP_002297822.1|  pectate lyase family protein                       397   5e-133   
ref|XP_009593549.1|  PREDICTED: probable pectate lyase 8                397   5e-133   
ref|XP_006854397.1|  hypothetical protein AMTR_s00039p00186640          396   6e-133   
ref|XP_006480190.1|  PREDICTED: probable pectate lyase 8-like           397   6e-133   
gb|KDO65869.1|  hypothetical protein CISIN_1g013239mg                   397   7e-133   
ref|XP_009371193.1|  PREDICTED: probable pectate lyase 8                397   9e-133   
ref|XP_007145412.1|  hypothetical protein PHAVU_007G236800g             396   1e-132   
ref|XP_010528200.1|  PREDICTED: putative pectate lyase 11               395   1e-132   
ref|XP_009139602.1|  PREDICTED: probable pectate lyase 15               396   2e-132   
ref|XP_004247823.1|  PREDICTED: probable pectate lyase 8                395   2e-132   
ref|XP_002321242.2|  pectate lyase family protein                       393   2e-132   
gb|KJB61086.1|  hypothetical protein B456_009G339700                    398   2e-132   
ref|XP_006360328.1|  PREDICTED: probable pectate lyase 15-like          395   2e-132   
ref|XP_009609746.1|  PREDICTED: probable pectate lyase 8                395   3e-132   
dbj|BAF01663.1|  pectate lyase like protein                             389   3e-132   
ref|XP_006307575.1|  hypothetical protein CARUB_v10009197mg             394   4e-132   
emb|CDY61137.1|  BnaC05g48970D                                          394   5e-132   
gb|EYU46355.1|  hypothetical protein MIMGU_mgv1a007094mg                394   5e-132   
ref|XP_009799817.1|  PREDICTED: probable pectate lyase 8                394   5e-132   
ref|XP_011009338.1|  PREDICTED: probable pectate lyase 8                394   6e-132   
ref|XP_010484103.1|  PREDICTED: probable pectate lyase 1                394   6e-132   
ref|XP_010475133.1|  PREDICTED: probable pectate lyase 1                394   6e-132   
dbj|BAB01216.1|  pectate lyase                                          394   9e-132   
gb|KFK33662.1|  hypothetical protein AALP_AA5G043100                    392   1e-131   
ref|XP_011002172.1|  PREDICTED: probable pectate lyase 8                394   1e-131   
ref|XP_002892236.1|  pectate lyase family protein                       393   2e-131   
ref|XP_010447044.1|  PREDICTED: probable pectate lyase 8                392   2e-131   
ref|XP_010556943.1|  PREDICTED: probable pectate lyase 1                392   2e-131   
gb|KFK42808.1|  hypothetical protein AALP_AA1G041400                    392   2e-131   
ref|NP_563715.1|  putative pectate lyase 1                              392   2e-131   
ref|XP_010527219.1|  PREDICTED: probable pectate lyase 10               391   2e-131   
ref|XP_010457526.1|  PREDICTED: probable pectate lyase 1                392   2e-131   
emb|CDX89799.1|  BnaA10g02830D                                          392   2e-131   
ref|XP_009139642.1|  PREDICTED: putative pectate lyase 14               392   2e-131   
sp|O24554.1|PLY_ZINVI  RecName: Full=Pectate lyase; AltName: Full...    391   2e-131   
ref|XP_002304700.1|  pectate lyase family protein                       393   3e-131   
dbj|BAA95715.1|  pectate lyase-like protein                             391   3e-131   
ref|XP_011020694.1|  PREDICTED: probable pectate lyase 8                393   3e-131   
ref|XP_010486231.1|  PREDICTED: probable pectate lyase 8                392   3e-131   
ref|XP_010464311.1|  PREDICTED: probable pectate lyase 8                391   3e-131   
ref|XP_008372438.1|  PREDICTED: probable pectate lyase 8                392   3e-131   
ref|NP_189376.1|  putative pectate lyase 11                             391   4e-131   
gb|EYU17974.1|  hypothetical protein MIMGU_mgv1a006571mg                392   4e-131   
ref|XP_006443655.1|  hypothetical protein CICLE_v10019202mg             399   5e-131   
ref|XP_010502717.1|  PREDICTED: putative pectate lyase 11               390   6e-131   
ref|XP_010514446.1|  PREDICTED: putative pectate lyase 11 isoform X1    390   6e-131   
gb|ABO28478.1|  pectate lyase precursor                                 383   7e-131   
emb|CDY05305.1|  BnaC05g44980D                                          390   7e-131   
gb|KFK38096.1|  hypothetical protein AALP_AA3G068900                    390   7e-131   
gb|ACB12931.1|  pectate lyase 1-27                                      391   9e-131   
ref|XP_006297766.1|  hypothetical protein CARUB_v10013802mg             389   1e-130   
ref|XP_006297767.1|  hypothetical protein CARUB_v10013802mg             390   1e-130   
ref|XP_009119265.1|  PREDICTED: probable pectate lyase 1                390   1e-130   
emb|CDY24654.1|  BnaA05g30530D                                          390   1e-130   
ref|XP_010425491.1|  PREDICTED: putative pectate lyase 11               389   2e-130   
ref|XP_009129418.1|  PREDICTED: putative pectate lyase 11               389   2e-130   
ref|XP_006291220.1|  hypothetical protein CARUB_v10017351mg             389   2e-130   
gb|KHN07962.1|  Putative pectate lyase 22                               390   2e-130   
ref|XP_009111089.1|  PREDICTED: probable pectate lyase 1                389   4e-130   
ref|XP_009147117.1|  PREDICTED: probable pectate lyase 8                388   5e-130   
ref|XP_009151965.1|  PREDICTED: putative pectate lyase 11 isoform X2    388   6e-130   
ref|XP_009151964.1|  PREDICTED: putative pectate lyase 11 isoform X1    388   6e-130   
ref|XP_002884619.1|  pectate lyase family protein                       388   6e-130   
gb|AFZ78654.1|  pectate lyase                                           389   7e-130   
emb|CDX86615.1|  BnaC08g00880D                                          388   8e-130   
ref|XP_010033351.1|  PREDICTED: pectate lyase-like                      387   8e-130   
ref|XP_002875382.1|  predicted protein                                  387   1e-129   
emb|CDY01119.1|  BnaA04g07000D                                          388   1e-129   
ref|NP_187357.1|  putative pectate lyase 8                              387   2e-129   
gb|AAM61584.1|  putative pectate lyase                                  387   2e-129   
ref|XP_006280540.1|  hypothetical protein CARUB_v10026482mg             387   2e-129   
emb|CAN71915.1|  hypothetical protein VITISV_007917                     385   3e-129   
ref|XP_010684949.1|  PREDICTED: probable pectate lyase 8                387   4e-129   
ref|XP_009118623.1|  PREDICTED: probable pectate lyase 1 isoform X2     385   8e-129   
gb|ABR17909.1|  unknown                                                 384   5e-128   
ref|XP_011080166.1|  PREDICTED: probable pectate lyase 8                382   6e-128   
gb|KFK31278.1|  hypothetical protein AALP_AA6G091900                    383   7e-128   
gb|KJB51151.1|  hypothetical protein B456_008G203900                    379   1e-127   
gb|AEX93472.1|  nodulation pectate lyase                                381   2e-127   
gb|KJB10108.1|  hypothetical protein B456_001G184600                    383   2e-127   
gb|KHG26906.1|  hypothetical protein F383_09796                         383   2e-127   
ref|XP_006352706.1|  PREDICTED: probable pectate lyase 10-like          382   2e-127   
gb|ABR26682.1|  pectate lyase                                           381   4e-127   
gb|AAZ31564.1|  pectate lyase isoform 2                                 380   4e-127   
ref|XP_004242391.1|  PREDICTED: probable pectate lyase 8                381   4e-127   
gb|AAK66160.1|  pectate lyase B                                         380   5e-127   
gb|AAZ31566.1|  pectate lyase isoform 4                                 380   5e-127   
emb|CDY20049.1|  BnaA09g02020D                                          380   5e-127   
ref|XP_009111570.1|  PREDICTED: putative pectate lyase 11               380   6e-127   
gb|AAB71208.1|  pectate lyase                                           380   6e-127   
emb|CDY00156.1|  BnaC09g01450D                                          380   6e-127   
ref|XP_009118622.1|  PREDICTED: probable pectate lyase 1 isoform X1     380   1e-126   
gb|AFD54064.1|  nodulation pectate lyase mutant                         379   2e-126   
ref|XP_010547043.1|  PREDICTED: probable pectate lyase 8                379   2e-126   
ref|XP_006285259.1|  hypothetical protein CARUB_v10006630mg             377   3e-126   
ref|XP_006297643.1|  hypothetical protein CARUB_v10013661mg             380   3e-126   
ref|XP_009102560.1|  PREDICTED: probable pectate lyase 9                379   4e-126   
emb|CDX88845.1|  BnaA03g08040D                                          389   5e-126   
gb|KFK39719.1|  hypothetical protein AALP_AA3G279700                    378   6e-126   
ref|XP_002885608.1|  pectate lyase family protein                       379   6e-126   
ref|XP_009102476.1|  PREDICTED: probable pectate lyase 10               379   7e-126   
ref|XP_002863927.1|  pectate lyase family protein                       377   8e-126   
gb|KFK39718.1|  hypothetical protein AALP_AA3G279700                    376   1e-125   
emb|CDY66697.1|  BnaAnng22760D                                          378   1e-125   
emb|CDX77470.1|  BnaA07g06080D                                          379   1e-125   
gb|AAZ31563.1|  pectate lyase isoform 1                                 376   1e-125   
gb|AAM63307.1|  pectate lyase                                           377   2e-125   
ref|NP_568705.1|  putative pectate lyase 20                             377   2e-125   
emb|CAC80136.1|  pectate lyase II enzyme                                378   2e-125   
emb|CDY70583.1|  BnaCnng68920D                                          369   3e-125   
gb|ABR18471.1|  unknown                                                 379   4e-125   
ref|XP_010671109.1|  PREDICTED: probable pectate lyase 5                375   4e-125   
ref|XP_010450305.1|  PREDICTED: putative pectate lyase 14               376   5e-125   
gb|KFK39788.1|  hypothetical protein AALP_AA3G287800                    376   5e-125   
emb|CDY46471.1|  BnaC07g03950D                                          376   6e-125   
ref|XP_009129753.1|  PREDICTED: probable pectate lyase 20               375   7e-125   
emb|CDY33938.1|  BnaA02g30490D                                          375   7e-125   
gb|ABG66730.2|  pectate lyase                                           373   9e-125   
ref|XP_010442341.1|  PREDICTED: probable pectate lyase 20               375   9e-125   
ref|XP_010439830.1|  PREDICTED: probable pectate lyase 20               375   9e-125   
ref|XP_010435301.1|  PREDICTED: putative pectate lyase 14 isoform X1    375   1e-124   
emb|CDY05655.1|  BnaC02g38820D                                          374   1e-124   
ref|XP_010435302.1|  PREDICTED: putative pectate lyase 14 isoform X2    374   2e-124   
gb|ABG66729.2|  pectate lyase                                           373   2e-124   
emb|CDX77400.1|  BnaA07g05380D                                          377   2e-124   
ref|XP_002885665.1|  pectate lyase family protein                       374   3e-124   
ref|XP_002863264.1|  pectate lyase family protein                       373   4e-124   
ref|XP_009624534.1|  PREDICTED: probable pectate lyase 8                374   5e-124   
ref|XP_006297684.1|  hypothetical protein CARUB_v10013715mg             373   9e-124   
gb|KDO69409.1|  hypothetical protein CISIN_1g015569mg                   369   1e-123   
ref|NP_189065.2|  putative pectate lyase 9                              373   1e-123   
ref|XP_009804999.1|  PREDICTED: probable pectate lyase 8                372   1e-123   
ref|XP_010488576.1|  PREDICTED: probable pectate lyase 10               372   2e-123   
ref|XP_010440665.1|  PREDICTED: putative pectate lyase 14               372   2e-123   
ref|XP_010466894.1|  PREDICTED: probable pectate lyase 10               372   2e-123   
emb|CAN78491.1|  hypothetical protein VITISV_004934                     371   2e-123   
ref|XP_010522431.1|  PREDICTED: probable pectate lyase 1                371   3e-123   
emb|CAB41931.1|  pectate lyase like protein                             371   3e-123   
ref|NP_001190715.1|  putative pectate lyase 14                          371   4e-123   
ref|XP_010513666.1|  PREDICTED: probable pectate lyase 10               371   5e-123   
ref|NP_193057.4|  putative pectate lyase 14                             370   6e-123   
ref|XP_010488478.1|  PREDICTED: probable pectate lyase 9                371   6e-123   
gb|ABR17766.1|  unknown                                                 370   8e-123   
gb|EPS60822.1|  hypothetical protein M569_13978                         368   1e-122   



>ref|XP_009804979.1| PREDICTED: probable pectate lyase 5 [Nicotiana sylvestris]
Length=402

 Score =   473 bits (1216),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 240/268 (90%), Positives = 252/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL++NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSPEHYGW
Sbjct  136  ELMLNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPEHYGW  195

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGL+DAIRGSTAITISNNYMTHHNKVMLLGHS
Sbjct  196  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIRGSTAITISNNYMTHHNKVMLLGHS  255

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D++ +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYA+GGSA PTINSQ
Sbjct  256  DSFTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAVGGSASPTINSQ  315

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPND FNKEVTKHEDAPES+WK WNWRSEGDLMLNGAFF T   AGAS SYAKAS
Sbjct  316  GNRFLAPNDIFNKEVTKHEDAPESEWKTWNWRSEGDLMLNGAFF-TRSGAGASKSYAKAS  374

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPS+LV S+T  AGAL CKKGK C
Sbjct  375  SLSARPSTLVSSITLNAGALGCKKGKRC  402



>ref|XP_009586995.1| PREDICTED: probable pectate lyase 5 [Nicotiana tomentosiformis]
Length=404

 Score =   473 bits (1216),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 240/268 (90%), Positives = 251/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELI+NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSPEHYGW
Sbjct  138  ELILNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPEHYGW  197

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGL+DAIRGSTAITISNNYMTHHNKVMLLGHS
Sbjct  198  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIRGSTAITISNNYMTHHNKVMLLGHS  257

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D++ +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYA+GGSA PTINSQ
Sbjct  258  DSFTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAVGGSASPTINSQ  317

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPND FNKEVTKHEDA ES+WK WNWRSEGDLMLNGAFF T   AGAS SYAKAS
Sbjct  318  GNRFLAPNDIFNKEVTKHEDAAESEWKNWNWRSEGDLMLNGAFF-TRSGAGASKSYAKAS  376

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPS+LV S+T  AGAL CKKGK C
Sbjct  377  SLSARPSTLVSSITVNAGALGCKKGKRC  404



>ref|XP_002285340.1| PREDICTED: probable pectate lyase 5 [Vitis vinifera]
 emb|CBI16836.3| unnamed protein product [Vitis vinifera]
Length=403

 Score =   472 bits (1214),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 240/268 (90%), Positives = 254/268 (95%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNANVRDSP+HYGW
Sbjct  137  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNANVRDSPDHYGW  196

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGLVDAI GSTAITISNNYMTHHNKVMLLGHS
Sbjct  197  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLVDAIHGSTAITISNNYMTHHNKVMLLGHS  256

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDY+HWEMYAIGGSA+PTINSQ
Sbjct  257  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYSHWEMYAIGGSAEPTINSQ  316

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+DRF+KEVTKHEDAP+SQWK WNWRSEGDL+LNGAFFT    AGASSSYAKAS
Sbjct  317  GNRFLAPDDRFSKEVTKHEDAPQSQWKNWNWRSEGDLLLNGAFFTA-SGAGASSSYAKAS  375

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSL+ ++T GAGAL CKKGK C
Sbjct  376  SLGARPSSLITTITNGAGALNCKKGKRC  403



>ref|XP_010663062.1| PREDICTED: probable pectate lyase 5 [Vitis vinifera]
 emb|CBI14899.3| unnamed protein product [Vitis vinifera]
Length=403

 Score =   470 bits (1209),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 238/268 (89%), Positives = 251/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGLNIHDC+QGGN NVRDSP HYG+
Sbjct  137  ELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLNIHDCKQGGNTNVRDSPSHYGF  196

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSH+WVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  197  RTISDGDGVSIFGGSHIWVDHCSLSNCHDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  256

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ
Sbjct  257  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  316

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDRF+KEVTKHEDAPESQWK WNWRSEGDLMLNGA+FT    AGASSSYA+AS
Sbjct  317  GNRFLAPNDRFSKEVTKHEDAPESQWKNWNWRSEGDLMLNGAYFTP-SGAGASSSYARAS  375

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV S+TG AGAL CKKG  C
Sbjct  376  SLGARPSSLVASITGSAGALSCKKGSRC  403



>emb|CAN76500.1| hypothetical protein VITISV_004734 [Vitis vinifera]
Length=403

 Score =   470 bits (1209),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 238/268 (89%), Positives = 251/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGLNIHDC+QGGN NVRDSP HYG+
Sbjct  137  ELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLNIHDCKQGGNTNVRDSPSHYGF  196

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSH+WVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  197  RTISDGDGVSIFGGSHIWVDHCSLSNCHDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  256

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ
Sbjct  257  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  316

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDRF+KEVTKHEDAPESQWK WNWRSEGDLMLNGA+FT    AGASSSYA+AS
Sbjct  317  GNRFLAPNDRFSKEVTKHEDAPESQWKNWNWRSEGDLMLNGAYFTP-SGAGASSSYARAS  375

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV S+TG AGAL CKKG  C
Sbjct  376  SLGARPSSLVASITGSAGALSCKKGSRC  403



>emb|CDP13269.1| unnamed protein product [Coffea canephora]
Length=400

 Score =   469 bits (1208),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 239/268 (89%), Positives = 251/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIAGGPCITIQYVTNII+HGLNIHDC+QGGNA VRDSPEH+GW
Sbjct  134  ELIMNSFKTIDGRGANVHIAGGPCITIQYVTNIIVHGLNIHDCKQGGNAYVRDSPEHFGW  193

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGL+DAI GSTAITISNNY+THHNKVMLLGHS
Sbjct  194  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIHGSTAITISNNYLTHHNKVMLLGHS  253

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY+QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  254  DTYLQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQ  313

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPND F KEVTKHE APES+WK WNWRSEGDLMLNGAFFTT   AGASSSY+KA 
Sbjct  314  GNRFLAPNDIFTKEVTKHEVAPESEWKSWNWRSEGDLMLNGAFFTT-SGAGASSSYSKAY  372

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV SLT GAG+L C+KG  C
Sbjct  373  SLSARPSSLVASLTSGAGSLICRKGSRC  400



>ref|XP_011029589.1| PREDICTED: probable pectate lyase 5 [Populus euphratica]
Length=402

 Score =   469 bits (1207),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 239/268 (89%), Positives = 252/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  136  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPSHYGW  195

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNY+THHNKVMLLGHS
Sbjct  196  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYLTHHNKVMLLGHS  255

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDY+HW+MYAIGGSADPTINSQ
Sbjct  256  DSYKQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYSHWKMYAIGGSADPTINSQ  315

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDRFNKEVTKHEDAP+S+WKGWNWRSEGDL+LNGAFFT    AGASSSYAKAS
Sbjct  316  GNRFLAPNDRFNKEVTKHEDAPQSEWKGWNWRSEGDLLLNGAFFTA-SGAGASSSYAKAS  374

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV S+T GAG+L CKKG  C
Sbjct  375  SLGARPSSLVSSITAGAGSLVCKKGSRC  402



>ref|XP_010250930.1| PREDICTED: probable pectate lyase 5 [Nelumbo nucifera]
Length=406

 Score =   468 bits (1204),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 238/268 (89%), Positives = 251/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVHIAGGPCITIQYV NIIIHGLNIHDC+QGGNANVRDSPEHYGW
Sbjct  140  ELLMNSFKTIDGRGASVHIAGGPCITIQYVNNIIIHGLNIHDCKQGGNANVRDSPEHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDG+SIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  200  RTISDGDGISIFGGSHVWVDHCSLSNCHDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  260  DTYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+AP+DRF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFFT    AGASSSYAKAS
Sbjct  320  GNRFVAPDDRFSKEVTKHEDAPESEWKNWNWRSEGDLMMNGAFFTP-SGAGASSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLVGS+T  AGAL CKKG  C
Sbjct  379  SLGARPSSLVGSITMSAGALGCKKGSRC  406



>ref|XP_011086701.1| PREDICTED: probable pectate lyase 5 [Sesamum indicum]
Length=401

 Score =   467 bits (1202),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 239/268 (89%), Positives = 252/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSPEHYG+
Sbjct  135  ELMMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPEHYGY  194

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNCRDGL+DAI GSTAITISNNYMTHHNKVMLLGHS
Sbjct  195  RTVSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIHGSTAITISNNYMTHHNKVMLLGHS  254

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D++ +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  255  DSFTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQ  314

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+   NKEVTKHEDAPESQWK WNWRSEGDLMLNGAFF T   AGASS+YAKAS
Sbjct  315  GNRFLAPDRVDNKEVTKHEDAPESQWKNWNWRSEGDLMLNGAFF-TRSGAGASSNYAKAS  373

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVGS+T GAG+L CKKGK C
Sbjct  374  SLSARPSSLVGSMTMGAGSLSCKKGKRC  401



>ref|XP_003549832.1| PREDICTED: probable pectate lyase 18 isoform 1 [Glycine max]
Length=406

 Score =   466 bits (1200),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 235/268 (88%), Positives = 253/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTN+IIHG+NIHDC+QGGNA VRDSP HYGW
Sbjct  140  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGINIHDCKQGGNAMVRDSPRHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GST ITISNNYMTHH+KVMLLGHS
Sbjct  200  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTGITISNNYMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  260  DSYTQDKSMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+AP+DRF+KEVTKHEDAPES+WKGWNWRSEGDL++NGAFFT    AGASSSYA+AS
Sbjct  320  GNRFVAPDDRFSKEVTKHEDAPESEWKGWNWRSEGDLLVNGAFFTA-SGAGASSSYARAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVGS+T GAGAL C+KG  C
Sbjct  379  SLSARPSSLVGSITTGAGALSCRKGSRC  406



>ref|XP_007155507.1| hypothetical protein PHAVU_003G207400g [Phaseolus vulgaris]
 gb|ESW27501.1| hypothetical protein PHAVU_003G207400g [Phaseolus vulgaris]
Length=406

 Score =   465 bits (1197),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 234/268 (87%), Positives = 252/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIA GPCITIQYVTN+IIHG+NIHDC+QGGNA VRDSP HYGW
Sbjct  140  ELIMNSFKTIDGRGASVHIANGPCITIQYVTNVIIHGINIHDCKQGGNAMVRDSPRHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  200  RTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  260  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+AP+DRF+KEVTKHEDAPES+WKGWNWRSEGDL++NGAFFT    AGASSSYA+AS
Sbjct  320  GNRFVAPDDRFSKEVTKHEDAPESEWKGWNWRSEGDLLVNGAFFTA-SGAGASSSYARAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVGS+T  AGAL C+KG  C
Sbjct  379  SLSARPSSLVGSITTNAGALTCRKGSRC  406



>gb|KHN34377.1| Putative pectate lyase 22 [Glycine soja]
Length=406

 Score =   465 bits (1197),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 235/268 (88%), Positives = 253/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTN+IIHG+NIHDC+QGGNA VRDSP HYGW
Sbjct  140  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGINIHDCKQGGNAMVRDSPRHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  200  RTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  260  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+AP+DRF+KEVTKHEDA ES+WKGWNWRSEGDL++NGAFFT    AGASSSYA+AS
Sbjct  320  GNRFVAPDDRFSKEVTKHEDAAESEWKGWNWRSEGDLLVNGAFFTA-SGAGASSSYARAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVGS+T GAGAL C+KG  C
Sbjct  379  SLSARPSSLVGSITTGAGALTCRKGSRC  406



>gb|KJB51152.1| hypothetical protein B456_008G203900 [Gossypium raimondii]
Length=274

 Score =   460 bits (1184),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 235/268 (88%), Positives = 247/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  8    ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGW  67

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDH SLSNC DGLVDAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  68   RTISDGDGVSIFGGSHVWVDHNSLSNCNDGLVDAIHGSTAITISNNYMTHHDKVMLLGHS  127

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  128  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  187

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF APNDRF+KEVTKHEDAPES WK WNWRSEGDLM+NGAFFT    AGASSSY+KAS
Sbjct  188  GNRFTAPNDRFSKEVTKHEDAPESDWKSWNWRSEGDLMVNGAFFTA-SGAGASSSYSKAS  246

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV ++T  AG+L CKKG  C
Sbjct  247  SLGARPSSLVATITTNAGSLNCKKGSRC  274



>dbj|BAB59066.1| pectate lyase [Salix gilgiana]
Length=409

 Score =   464 bits (1194),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 237/268 (88%), Positives = 251/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG+NIHDC++GGNA+VRDSP HYGW
Sbjct  143  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGVNIHDCKRGGNAHVRDSPSHYGW  202

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNY+THHNKVMLLGHS
Sbjct  203  RTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYLTHHNKVMLLGHS  262

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSADPTINSQ
Sbjct  263  DSYKQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWKMYAIGGSADPTINSQ  322

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDRFNKEVTKHEDAP+S WKGWNWRSEGDL+LNGAFFT    AGASSSYAKAS
Sbjct  323  GNRFLAPNDRFNKEVTKHEDAPQSAWKGWNWRSEGDLLLNGAFFTA-SGAGASSSYAKAS  381

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL AR SSLV S+T GAG+L CKKG  C
Sbjct  382  SLGARSSSLVSSITAGAGSLVCKKGSRC  409



>ref|XP_008340139.1| PREDICTED: probable pectate lyase 5 [Malus domestica]
 ref|XP_008361827.1| PREDICTED: probable pectate lyase 5 [Malus domestica]
Length=401

 Score =   464 bits (1193),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 235/268 (88%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRG+SVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSPEH+GW
Sbjct  135  ELMMNSFKTIDGRGSSVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPEHFGW  194

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RTLSDGDGVSIFGGSHVWVDH SLSNCRDGL+DAI GST+ITISNNYMTHHNKVMLLGHS
Sbjct  195  RTLSDGDGVSIFGGSHVWVDHNSLSNCRDGLIDAIHGSTSITISNNYMTHHNKVMLLGHS  254

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGLIQRMPRCRHG FHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  255  DSYTQDKNMQVTIAFNHFGEGLIQRMPRCRHGNFHVVNNDYTHWEMYAIGGSASPTINSQ  314

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDRFNKEVTKHEDAP+ +W  WNWRS GDL+LNGAFFT    AGAS+SY+KAS
Sbjct  315  GNRFLAPNDRFNKEVTKHEDAPQKEWSKWNWRSSGDLLLNGAFFTA-SGAGASTSYSKAS  373

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV SLT GAG+L CKKG  C
Sbjct  374  SLSARPSSLVSSLTAGAGSLRCKKGSRC  401



>ref|XP_004515847.1| PREDICTED: probable pectate lyase 22-like [Cicer arietinum]
Length=411

 Score =   464 bits (1193),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 233/268 (87%), Positives = 254/268 (95%), Gaps = 0/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIA GPCITIQYVTN+IIHG+NIHDC+QGGNA VRDSP HYGW
Sbjct  144  ELIMNSFKTIDGRGASVHIANGPCITIQYVTNVIIHGINIHDCKQGGNAMVRDSPRHYGW  203

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  204  RTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  263

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  264  DTYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  323

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+APNDRF+KEVTKHEDA E++WKGWNWR+EGDLM+NGAFFT+SG+ G+SSSYA+AS
Sbjct  324  GNRFVAPNDRFSKEVTKHEDAAENEWKGWNWRTEGDLMVNGAFFTSSGAGGSSSSYARAS  383

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVG++T  AGAL C+KG  C
Sbjct  384  SLSARPSSLVGTITTTAGALNCRKGSRC  411



>ref|XP_003608909.1| Pectate lyase [Medicago truncatula]
 gb|AES91106.1| pectate lyase family protein [Medicago truncatula]
Length=407

 Score =   463 bits (1192),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 235/268 (88%), Positives = 254/268 (95%), Gaps = 0/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTN+IIHG++IHDC+QGGNA VRDSP HYGW
Sbjct  140  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGIHIHDCKQGGNAMVRDSPGHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  200  RTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  260  DTYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+AP+DRF+KEVTKHEDAPE +WKGWNWRSEGDL++NGAFFT SG+ GASSSYA+AS
Sbjct  320  GNRFVAPDDRFSKEVTKHEDAPEGEWKGWNWRSEGDLLINGAFFTPSGAGGASSSYARAS  379

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVG++T GAG L CKKG  C
Sbjct  380  SLSARPSSLVGTITTGAGVLGCKKGSRC  407



>ref|XP_007222794.1| hypothetical protein PRUPE_ppa006665mg [Prunus persica]
 gb|EMJ23993.1| hypothetical protein PRUPE_ppa006665mg [Prunus persica]
Length=401

 Score =   462 bits (1189),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 234/268 (87%), Positives = 247/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  135  ELMMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPSHYGW  194

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGL+DAI GST+ITISNNYMTHHNKVMLLGHS
Sbjct  195  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIHGSTSITISNNYMTHHNKVMLLGHS  254

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHG FHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  255  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGNFHVVNNDYTHWEMYAIGGSASPTINSQ  314

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDRFNKE+TKHEDAP+ +W  WNWRS GDL+LNGAFFT    AGASSSYA+AS
Sbjct  315  GNRFLAPNDRFNKEITKHEDAPQKEWSKWNWRSSGDLLLNGAFFTA-SGAGASSSYARAS  373

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV SLT GAG+L C+KG  C
Sbjct  374  SLGARPSSLVSSLTAGAGSLKCRKGSRC  401



>ref|XP_007037816.1| Pectin lyase-like superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY22317.1| Pectin lyase-like superfamily protein isoform 2 [Theobroma cacao]
Length=345

 Score =   460 bits (1183),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 235/268 (88%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  79   ELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGW  138

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFG SHVWVDH SLSNC+DGLVDAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  139  RTISDGDGVSIFGSSHVWVDHNSLSNCKDGLVDAIHGSTAITISNNYMTHHDKVMLLGHS  198

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  199  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  258

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP DRF+KEVTKHEDAPES+WKGWNWRSEGDLM+NGAFFT    AGASSSYAKAS
Sbjct  259  GNRFTAPEDRFSKEVTKHEDAPESEWKGWNWRSEGDLMVNGAFFTP-SGAGASSSYAKAS  317

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV ++T  AGAL CKKG  C
Sbjct  318  SLGARPSSLVATITTNAGALNCKKGSRC  345



>ref|XP_010023435.1| PREDICTED: probable pectate lyase 5 [Eucalyptus grandis]
 gb|KCW59688.1| hypothetical protein EUGRSUZ_H02448 [Eucalyptus grandis]
Length=406

 Score =   462 bits (1189),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 232/268 (87%), Positives = 252/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGLNIHDC+QGGNA VRDSP+HYGW
Sbjct  140  ELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLNIHDCKQGGNAYVRDSPDHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSH+WVDHCSLSNCRDGL+DAIRG+TAIT+SNNY+THHNKVMLLGHS
Sbjct  200  RTVSDGDGVSIFGGSHIWVDHCSLSNCRDGLIDAIRGATAITLSNNYLTHHNKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYA+GGSA PTINSQ
Sbjct  260  DSYTQDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAVGGSAAPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+AP+D FNKEVTKHEDAP+S+WK WNWRSEGDLM+NGAFFT    AGASSSYAKAS
Sbjct  320  GNRFVAPDDAFNKEVTKHEDAPQSEWKHWNWRSEGDLMVNGAFFTA-SGAGASSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSS+VGS+T  AG L CKKGK C
Sbjct  379  SLGARPSSVVGSITASAGTLGCKKGKRC  406



>ref|XP_008221954.1| PREDICTED: probable pectate lyase 5 [Prunus mume]
Length=401

 Score =   462 bits (1188),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 234/268 (87%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  135  ELMMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPSHYGW  194

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGL+DAI GST+ITISNNYMTHHNKVMLLGHS
Sbjct  195  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIHGSTSITISNNYMTHHNKVMLLGHS  254

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHG FHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  255  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGNFHVVNNDYTHWEMYAIGGSASPTINSQ  314

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDRFNKE+TKHEDAP+ +W  WNWRS GDL+LNGAFFT+   AGASSSYA+AS
Sbjct  315  GNRFLAPNDRFNKEITKHEDAPQKEWSKWNWRSSGDLLLNGAFFTS-SGAGASSSYARAS  373

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV SLT GAG+L C+KG  C
Sbjct  374  SLGARPSSLVSSLTAGAGSLKCRKGSRC  401



>ref|NP_001242543.1| uncharacterized protein LOC100779940 precursor [Glycine max]
 gb|ACU21247.1| unknown [Glycine max]
Length=406

 Score =   461 bits (1187),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 233/268 (87%), Positives = 252/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            E IMNSFKTIDGRGASVHIAGGPCITIQYVTN+IIHG+NIHDC+QGGNA VRDSP HYGW
Sbjct  140  ERIMNSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGINIHDCKQGGNAMVRDSPRHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  200  RTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINS+
Sbjct  260  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSR  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+AP+DRF+KEVTKHEDA ES+WKGWNWRSEGDL++NGAFFT    AGASSSYA+AS
Sbjct  320  GNRFVAPDDRFSKEVTKHEDAAESEWKGWNWRSEGDLLVNGAFFTA-SGAGASSSYARAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVGS+T GAGAL C+KG  C
Sbjct  379  SLSARPSSLVGSITTGAGALTCRKGSRC  406



>gb|EYU30593.1| hypothetical protein MIMGU_mgv1a007569mg [Erythranthe guttata]
Length=403

 Score =   461 bits (1186),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 232/268 (87%), Positives = 251/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL++NSFKTIDGRGASVHIAGGPCITIQYVTN+I+HGLNIHDC+QGGNA VRDSP+HYGW
Sbjct  137  ELMLNSFKTIDGRGASVHIAGGPCITIQYVTNVIVHGLNIHDCKQGGNAYVRDSPDHYGW  196

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGL+DAI GSTAITISNNY THHNKVMLLGHS
Sbjct  197  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIHGSTAITISNNYFTHHNKVMLLGHS  256

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  257  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  316

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+   NKEVTKHEDAP+S+WK WNWRSEGDL+LNGAFF T   AG+SS+YAKAS
Sbjct  317  GNRFLAPDRANNKEVTKHEDAPQSKWKNWNWRSEGDLLLNGAFF-TRSGAGSSSNYAKAS  375

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVG++T GAG+L CKKG+ C
Sbjct  376  SLSARPSSLVGTITVGAGSLGCKKGRRC  403



>gb|AFK44189.1| unknown [Medicago truncatula]
Length=407

 Score =   461 bits (1186),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 234/268 (87%), Positives = 253/268 (94%), Gaps = 0/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTN+IIHG++IHDC+QGGNA VRDSP HYGW
Sbjct  140  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGIHIHDCKQGGNAMVRDSPGHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  200  RTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  260  DTYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+AP+DRF+KEVTK EDAPE +WKGWNWRSEGDL++NGAFFT SG+ GASSSYA+AS
Sbjct  320  GNRFVAPDDRFSKEVTKQEDAPEGEWKGWNWRSEGDLLINGAFFTPSGAGGASSSYARAS  379

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVG++T GAG L CKKG  C
Sbjct  380  SLSARPSSLVGTITTGAGVLGCKKGSRC  407



>ref|XP_004310004.1| PREDICTED: probable pectate lyase 5 [Fragaria vesca subsp. vesca]
Length=402

 Score =   460 bits (1184),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 237/268 (88%), Positives = 246/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGA+VHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  136  ELMMNSFKTIDGRGANVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPGHYGW  195

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGL+DAI GSTAITISNNYMTHHNKVMLLGHS
Sbjct  196  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIHGSTAITISNNYMTHHNKVMLLGHS  255

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHG FHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  256  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGNFHVVNNDYTHWEMYAIGGSASPTINSQ  315

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDRFNKEVTKHEDAP+  W  WNWRS GDLMLNGAFFT    AGASSSYAKAS
Sbjct  316  GNRFLAPNDRFNKEVTKHEDAPQKDWSKWNWRSSGDLMLNGAFFTA-SGAGASSSYAKAS  374

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV S+T GAG+L CKKG  C
Sbjct  375  SLGARPSSLVSSITAGAGSLKCKKGSRC  402



>ref|XP_002511275.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF51877.1| Pectate lyase precursor, putative [Ricinus communis]
Length=353

 Score =   458 bits (1178),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 235/268 (88%), Positives = 251/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGL+IHDC+QGGNA VRDSP HYGW
Sbjct  87   ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLHIHDCKQGGNAYVRDSPRHYGW  146

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSH+WVDH SLSNC DGLVDAI GSTAIT+SNN+MTHH+KVMLLGHS
Sbjct  147  RTISDGDGVSIFGGSHIWVDHNSLSNCNDGLVDAIHGSTAITVSNNFMTHHDKVMLLGHS  206

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  207  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQ  266

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+AP++RF+KEVTKHEDAPESQWK WNWRSEGDL++NGAFF     AGASSSYAKAS
Sbjct  267  GNRFVAPDNRFSKEVTKHEDAPESQWKNWNWRSEGDLLVNGAFFRA-TGAGASSSYAKAS  325

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVGS+T GAGALPCKKG  C
Sbjct  326  SLSARPSSLVGSITVGAGALPCKKGARC  353



>ref|XP_010320956.1| PREDICTED: probable pectate lyase 5 [Solanum lycopersicum]
Length=401

 Score =   460 bits (1183),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 237/268 (88%), Positives = 250/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL++NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSP+HYGW
Sbjct  135  ELMLNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPQHYGW  194

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNYMTHHNKVMLLGHS
Sbjct  195  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYMTHHNKVMLLGHS  254

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D++ +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  255  DSFTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  314

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPND FNKEVTKHEDA ES+WK WNWRSEGDLMLNGAFF     AGASSSYAKAS
Sbjct  315  GNRFLAPNDIFNKEVTKHEDAAESEWKNWNWRSEGDLMLNGAFF-IRSGAGASSSYAKAS  373

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPS+LV S+T  AGAL CKKGK C
Sbjct  374  SLSARPSTLVNSITMNAGALGCKKGKRC  401



>ref|XP_006341783.1| PREDICTED: probable pectate lyase 5-like [Solanum tuberosum]
Length=401

 Score =   459 bits (1182),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 237/268 (88%), Positives = 250/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL++NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSP+HYGW
Sbjct  135  ELMLNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPQHYGW  194

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNN+MTHHNKVMLLGHS
Sbjct  195  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNFMTHHNKVMLLGHS  254

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DT+ +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  255  DTFTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  314

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPND FNKEVTKHEDA ES+WK WNWRSEGDLMLNGAFF     AGASSSYAKAS
Sbjct  315  GNRFLAPNDIFNKEVTKHEDAAESEWKNWNWRSEGDLMLNGAFF-IRSGAGASSSYAKAS  373

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPS+LV S+T  AGAL CKKGK C
Sbjct  374  SLSARPSTLVNSITMNAGALGCKKGKKC  401



>ref|XP_010100325.1| hypothetical protein L484_027633 [Morus notabilis]
 gb|EXB82459.1| hypothetical protein L484_027633 [Morus notabilis]
Length=406

 Score =   459 bits (1182),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 229/268 (85%), Positives = 249/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL++NSFKTIDGRGASVHIAGGPCITIQYVTN+IIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  140  ELMVNSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGLNIHDCKQGGNAYVRDSPSHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RTLSDGDGVSIFGGSH+WVDHCSLSNCRDGL+DAI GSTAITISNNYMTHHNKVMLLGHS
Sbjct  200  RTLSDGDGVSIFGGSHIWVDHCSLSNCRDGLIDAIHGSTAITISNNYMTHHNKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  260  DSYKQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPN++ NKE+TKHEDA +S+WK WNWRS GDL++NGAFFT    AGASS+YAKAS
Sbjct  320  GNRFLAPNNKDNKEITKHEDAAQSEWKKWNWRSSGDLLMNGAFFTA-SGAGASSNYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV ++T GAG+L C+KG  C
Sbjct  379  SLSARPSSLVSTITSGAGSLKCRKGSRC  406



>ref|XP_010248740.1| PREDICTED: probable pectate lyase 18 [Nelumbo nucifera]
Length=405

 Score =   459 bits (1182),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 234/268 (87%), Positives = 250/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYV+NIIIHGL+IHDC+QGGNANVRDSP HYGW
Sbjct  139  ELIMNSFKTIDGRGASVHIAGGPCITIQYVSNIIIHGLHIHDCKQGGNANVRDSPTHYGW  198

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSH+WVDHCSLSNC DGL+DAI GSTAIT+SNNY THH+KVMLLGHS
Sbjct  199  RTISDGDGVSIFGGSHIWVDHCSLSNCHDGLIDAIHGSTAITLSNNYFTHHDKVMLLGHS  258

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  259  DTYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQ  318

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP++RF+KEVTKHEDAPES+W+ WNWRSEGDL+LNGAFFT    AGASSSYAKAS
Sbjct  319  GNRFLAPDNRFSKEVTKHEDAPESEWRHWNWRSEGDLLLNGAFFTP-SGAGASSSYAKAS  377

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLVGS+T  AGAL CKKG  C
Sbjct  378  SLGARPSSLVGSITTAAGALNCKKGSRC  405



>ref|XP_010102919.1| hypothetical protein L484_018936 [Morus notabilis]
 gb|EXB94437.1| hypothetical protein L484_018936 [Morus notabilis]
Length=410

 Score =   459 bits (1182),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 232/268 (87%), Positives = 250/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGLNIHDC+ GGNA VRDSP HYGW
Sbjct  144  ELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLNIHDCKPGGNAMVRDSPRHYGW  203

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC+DGL+DAI GSTAIT+SNNYMTHH+KVMLLGHS
Sbjct  204  RTISDGDGVSIFGGSHVWVDHCSLSNCQDGLIDAIHGSTAITLSNNYMTHHDKVMLLGHS  263

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  264  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  323

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+ RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFFT    AGASSSYAKAS
Sbjct  324  GNRFLAPDKRFSKEVTKHEDAPESEWKNWNWRSEGDLMVNGAFFTA-SGAGASSSYAKAS  382

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPS+LVG++T  AGAL C+KG  C
Sbjct  383  SLGARPSTLVGTITTNAGALSCRKGSRC  410



>ref|XP_011086987.1| PREDICTED: probable pectate lyase 22 [Sesamum indicum]
Length=404

 Score =   459 bits (1181),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 235/268 (88%), Positives = 247/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIA GPCITIQYVTNIIIHG++IHDC+QGGNA VRDSP HYGW
Sbjct  138  ELIMNSFKTIDGRGASVHIANGPCITIQYVTNIIIHGVHIHDCKQGGNAMVRDSPRHYGW  197

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHHNKVMLLGHS
Sbjct  198  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHNKVMLLGHS  257

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D Y QDKGMQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  258  DLYPQDKGMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQ  317

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDRFNKEVTK+EDA ES+WK WNWRSEGDLMLNGAFFT    AGASSSYAKAS
Sbjct  318  GNRFLAPNDRFNKEVTKYEDAAESEWKNWNWRSEGDLMLNGAFFTA-SGAGASSSYAKAS  376

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSL+ S+T  +GAL C+KG  C
Sbjct  377  SLGARPSSLITSITAASGALNCRKGSRC  404



>ref|XP_008389758.1| PREDICTED: probable pectate lyase 5 [Malus domestica]
Length=402

 Score =   459 bits (1180),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 235/268 (88%), Positives = 247/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSPEH+GW
Sbjct  136  ELMMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPEHFGW  195

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RTLSDGDGVSIFGGSHVWVDH SLSNCRDGL+DAI GST+ITISNNYMTHH+KVMLLGHS
Sbjct  196  RTLSDGDGVSIFGGSHVWVDHNSLSNCRDGLIDAIHGSTSITISNNYMTHHDKVMLLGHS  255

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHG FHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  256  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGNFHVVNNDYTHWEMYAIGGSASPTINSQ  315

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDRFNKEVTKHEDAP+ +W  WNWRS GDL+LNGAFFT    AGASSSYAKAS
Sbjct  316  GNRFLAPNDRFNKEVTKHEDAPQKEWSKWNWRSSGDLLLNGAFFTA-SGAGASSSYAKAS  374

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV SLT GAG+L CKKG  C
Sbjct  375  SLGARPSSLVSSLTAGAGSLRCKKGSRC  402



>ref|XP_008350945.1| PREDICTED: probable pectate lyase 5 [Malus domestica]
 ref|XP_008350949.1| PREDICTED: probable pectate lyase 5 [Malus domestica]
Length=402

 Score =   458 bits (1179),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 235/268 (88%), Positives = 247/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSPEH+GW
Sbjct  136  ELMMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPEHFGW  195

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RTLSDGDGVSIFGGSHVWVDH SLSNCRDGL+DAI GST+ITISNNYMTHH+KVMLLGHS
Sbjct  196  RTLSDGDGVSIFGGSHVWVDHNSLSNCRDGLIDAIHGSTSITISNNYMTHHDKVMLLGHS  255

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHG FHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  256  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGNFHVVNNDYTHWEMYAIGGSASPTINSQ  315

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDRFNKEVTKHEDAP+ +W  WNWRS GDL+LNGAFFT    AGASSSYAKAS
Sbjct  316  GNRFLAPNDRFNKEVTKHEDAPQKEWSKWNWRSSGDLLLNGAFFTA-SGAGASSSYAKAS  374

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV SLT GAG+L CKKG  C
Sbjct  375  SLGARPSSLVSSLTAGAGSLRCKKGSRC  402



>gb|KDO69411.1| hypothetical protein CISIN_1g015569mg [Citrus sinensis]
Length=274

 Score =   453 bits (1166),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 229/268 (85%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC++GGNA VRDSP H+GW
Sbjct  8    ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKKGGNAMVRDSPRHFGW  67

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGG+H+WVDHCSLSNC DGLVDAI GSTAITISNN+MTHH+KVMLLGHS
Sbjct  68   RTVSDGDGVSIFGGTHIWVDHCSLSNCDDGLVDAIHGSTAITISNNFMTHHDKVMLLGHS  127

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQVTIAFNHFGEGL+QR+PRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  128  DTYTQDKNMQVTIAFNHFGEGLVQRIPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  187

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP+  F+KEVTKHEDAPES+W+ WNWRSEGDLM+NGAFFT    AGASSSYA+AS
Sbjct  188  GNRFAAPDRAFSKEVTKHEDAPESEWRNWNWRSEGDLMVNGAFFTA-SGAGASSSYARAS  246

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPS+LVG +TG AGAL CKKG  C
Sbjct  247  SLGARPSALVGPITGSAGALICKKGARC  274



>ref|XP_007037815.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY22316.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
Length=404

 Score =   458 bits (1178),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 235/268 (88%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  138  ELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGW  197

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFG SHVWVDH SLSNC+DGLVDAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  198  RTISDGDGVSIFGSSHVWVDHNSLSNCKDGLVDAIHGSTAITISNNYMTHHDKVMLLGHS  257

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  258  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  317

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP DRF+KEVTKHEDAPES+WKGWNWRSEGDLM+NGAFFT    AGASSSYAKAS
Sbjct  318  GNRFTAPEDRFSKEVTKHEDAPESEWKGWNWRSEGDLMVNGAFFTP-SGAGASSSYAKAS  376

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV ++T  AGAL CKKG  C
Sbjct  377  SLGARPSSLVATITTNAGALNCKKGSRC  404



>gb|KJB51149.1| hypothetical protein B456_008G203900 [Gossypium raimondii]
Length=404

 Score =   458 bits (1178),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 235/268 (88%), Positives = 247/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  138  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGW  197

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDH SLSNC DGLVDAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  198  RTISDGDGVSIFGGSHVWVDHNSLSNCNDGLVDAIHGSTAITISNNYMTHHDKVMLLGHS  257

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  258  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  317

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF APNDRF+KEVTKHEDAPES WK WNWRSEGDLM+NGAFFT    AGASSSY+KAS
Sbjct  318  GNRFTAPNDRFSKEVTKHEDAPESDWKSWNWRSEGDLMVNGAFFTA-SGAGASSSYSKAS  376

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV ++T  AG+L CKKG  C
Sbjct  377  SLGARPSSLVATITTNAGSLNCKKGSRC  404



>ref|XP_008351757.1| PREDICTED: probable pectate lyase 18 [Malus domestica]
Length=411

 Score =   458 bits (1179),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 233/268 (87%), Positives = 250/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGLNIHDC+QGGNA VR+SPEH+GW
Sbjct  145  ELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLNIHDCKQGGNAMVRNSPEHFGW  204

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  205  RTISDGDGVSIFGGSHVWVDHCSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  264

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  265  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  324

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP+ RF+KEVTKHEDAPES+WK WNWRSEGDLMLNGAFF     AGASSSYA+AS
Sbjct  325  GNRFAAPDIRFSKEVTKHEDAPESEWKNWNWRSEGDLMLNGAFFRA-SGAGASSSYARAS  383

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLVGS+T  AGAL C+KG  C
Sbjct  384  SLGARPSSLVGSITTTAGALSCRKGSHC  411



>ref|XP_009628975.1| PREDICTED: probable pectate lyase 18 [Nicotiana tomentosiformis]
Length=407

 Score =   458 bits (1178),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 229/268 (85%), Positives = 250/268 (93%), Gaps = 0/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG+++HDC+QGGNA VR SP HYGW
Sbjct  140  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGIHVHDCKQGGNAMVRSSPSHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC+DGL+DAI GSTAITISNN+MTHH+KVMLLGHS
Sbjct  200  RTISDGDGVSIFGGSHVWVDHCSLSNCKDGLIDAIMGSTAITISNNFMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y+QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  260  DSYVQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+ RF+KEVTKHEDAPES+WK WNWR+EGDLMLNGA+FT SG+   SSSYAKAS
Sbjct  320  GNRFLAPDIRFSKEVTKHEDAPESEWKNWNWRTEGDLMLNGAYFTQSGAGAKSSSYAKAS  379

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV +L  G+GAL C+KG  C
Sbjct  380  SLSARPSSLVSNLVSGSGALNCRKGSRC  407



>ref|XP_009359258.1| PREDICTED: probable pectate lyase 5 [Pyrus x bretschneideri]
Length=401

 Score =   457 bits (1177),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 236/268 (88%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRG+SVHIAGGPCITIQYVTNIIIHGLNIHDC QGGNA VRDSPEH+GW
Sbjct  135  ELMMNSFKTIDGRGSSVHIAGGPCITIQYVTNIIIHGLNIHDCTQGGNAYVRDSPEHFGW  194

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RTLSDGDGVSIFGGSHVWVDH SLSNCRDGL+DAI GST+ITISNNYMTHHNKVMLLGHS
Sbjct  195  RTLSDGDGVSIFGGSHVWVDHNSLSNCRDGLIDAIHGSTSITISNNYMTHHNKVMLLGHS  254

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGLIQRMPRCRHG FHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  255  DSYTQDKNMQVTIAFNHFGEGLIQRMPRCRHGNFHVVNNDYTHWEMYAIGGSASPTINSQ  314

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDRFNKEVTKHEDAP+++W  WNWRS GDL+LNGAFFT    AGASSSY+KAS
Sbjct  315  GNRFLAPNDRFNKEVTKHEDAPQTEWSKWNWRSSGDLLLNGAFFTA-SGAGASSSYSKAS  373

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV SLT GAG+L CKKG  C
Sbjct  374  SLSARPSSLVSSLTTGAGSLRCKKGSRC  401



>gb|ABK92535.1| unknown [Populus trichocarpa]
Length=274

 Score =   452 bits (1164),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 230/268 (86%), Positives = 251/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGL+IHDC+QGGNA VRDSP+H+GW
Sbjct  8    ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLHIHDCKQGGNAMVRDSPKHFGW  67

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGG+HVWVDH SLSNC DGLVDAI GS+AITISNNYMTHH+KVMLLGHS
Sbjct  68   RTVSDGDGVSIFGGTHVWVDHNSLSNCNDGLVDAIHGSSAITISNNYMTHHDKVMLLGHS  127

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  128  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  187

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+AP+ RF+KEVTKHEDAPES+WK WNWRSEGDL++NGAFFT    AGASSSYA+AS
Sbjct  188  GNRFVAPDIRFSKEVTKHEDAPESEWKHWNWRSEGDLLMNGAFFTA-SGAGASSSYARAS  246

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLVG++T GAGAL C+KG  C
Sbjct  247  SLGARPSSLVGTITVGAGALGCRKGARC  274



>gb|KHG22990.1| hypothetical protein F383_28754 [Gossypium arboreum]
Length=404

 Score =   457 bits (1176),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 234/268 (87%), Positives = 247/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  138  ELLMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGW  197

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDH SLSNC DGLVDAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  198  RTISDGDGVSIFGGSHVWVDHNSLSNCNDGLVDAIHGSTAITISNNYMTHHDKVMLLGHS  257

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  258  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  317

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF APNDRF+KEVTKHEDAPES WK WNWRSEGDLM+NGAFFT    AGASSSY+KAS
Sbjct  318  GNRFTAPNDRFSKEVTKHEDAPESDWKNWNWRSEGDLMVNGAFFTG-SGAGASSSYSKAS  376

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV ++T  AG+L CKKG  C
Sbjct  377  SLGARPSSLVATITTNAGSLNCKKGSRC  404



>gb|ADB90477.1| pectate lyase [Gossypium hirsutum]
Length=411

 Score =   457 bits (1177),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 233/268 (87%), Positives = 249/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  145  ELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGW  204

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  205  RTISDGDGVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  264

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  265  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  324

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF APN+RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF +   AGASSSYAKAS
Sbjct  325  GNRFTAPNNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIS-SGAGASSSYAKAS  383

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV ++T  AGAL CKKG  C
Sbjct  384  SLGARPSSLVATITTNAGALNCKKGSRC  411



>gb|ADB90475.1| pectate lyase [Gossypium herbaceum]
Length=411

 Score =   457 bits (1177),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 233/268 (87%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  145  ELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGW  204

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  205  RTISDGDGVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  264

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  265  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  324

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF APN+RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF     AGASSSYAKAS
Sbjct  325  GNRFTAPNNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIA-SGAGASSSYAKAS  383

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV ++T  AGAL CKKG  C
Sbjct  384  SLGARPSSLVATITTNAGALNCKKGSRC  411



>gb|AEN70985.1| pectate lyase [Gossypium lobatum]
Length=411

 Score =   457 bits (1176),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 233/268 (87%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  145  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGW  204

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  205  RTISDGDGVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  264

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  265  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  324

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF APN+RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF     AGASSSYA+AS
Sbjct  325  GNRFTAPNNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIA-SGAGASSSYARAS  383

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV ++T  AGAL CKKG  C
Sbjct  384  SLGARPSSLVATITTNAGALNCKKGSRC  411



>ref|XP_009112069.1| PREDICTED: probable pectate lyase 22 [Brassica rapa]
Length=428

 Score =   458 bits (1178),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 231/269 (86%), Positives = 248/269 (92%), Gaps = 1/269 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHYGW
Sbjct  160  ELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYGW  219

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHS
Sbjct  220  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHS  279

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY+QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  280  DTYVQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  339

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssyaka  173
            GNRFLAPN  F+KEVTKHEDAPES+W  WNWRSEGDLMLNGAFFT +    G SSSY+KA
Sbjct  340  GNRFLAPNGPFDKEVTKHEDAPESEWSHWNWRSEGDLMLNGAFFTLSGAGPGKSSSYSKA  399

Query  172  sslsARPSSLVGSLTGGAGALPCKKGKSC  86
            SSL+ARPSS VG +T  +GAL CKKG  C
Sbjct  400  SSLAARPSSHVGEITIASGALSCKKGSHC  428



>emb|CDY16732.1| BnaA09g06500D [Brassica napus]
Length=428

 Score =   457 bits (1177),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 231/269 (86%), Positives = 248/269 (92%), Gaps = 1/269 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHYGW
Sbjct  160  ELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYGW  219

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHS
Sbjct  220  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHS  279

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY+QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  280  DTYVQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  339

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssyaka  173
            GNRFLAPN  F+KEVTKHEDAPES+W  WNWRSEGDLMLNGAFFT +    G SSSY+KA
Sbjct  340  GNRFLAPNGPFDKEVTKHEDAPESEWSHWNWRSEGDLMLNGAFFTLSGAGPGKSSSYSKA  399

Query  172  sslsARPSSLVGSLTGGAGALPCKKGKSC  86
            SSL+ARPSS VG +T  +GAL CKKG  C
Sbjct  400  SSLAARPSSHVGEITIASGALSCKKGSHC  428



>gb|KHG19997.1| hypothetical protein F383_02891 [Gossypium arboreum]
Length=411

 Score =   457 bits (1175),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 233/268 (87%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  145  ELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGW  204

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  205  RTISDGDGVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  264

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  265  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  324

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF APN+RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF     AGASSSYAKAS
Sbjct  325  GNRFTAPNNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIA-SGAGASSSYAKAS  383

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV ++T  AGAL CKKG  C
Sbjct  384  SLGARPSSLVATITTNAGALNCKKGSHC  411



>emb|CDY48132.1| BnaCnng15740D [Brassica napus]
Length=428

 Score =   457 bits (1176),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 231/269 (86%), Positives = 248/269 (92%), Gaps = 1/269 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHYGW
Sbjct  160  ELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYGW  219

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHS
Sbjct  220  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHS  279

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY+QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  280  DTYVQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  339

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssyaka  173
            GNRFLAPN  F+KEVTKHEDAPES+W  WNWRSEGDLMLNGAFFT +    G SSSY+KA
Sbjct  340  GNRFLAPNGPFDKEVTKHEDAPESEWSHWNWRSEGDLMLNGAFFTLSGAGPGKSSSYSKA  399

Query  172  sslsARPSSLVGSLTGGAGALPCKKGKSC  86
            SSL+ARPSS VG +T  +GAL CKKG  C
Sbjct  400  SSLAARPSSHVGEITIASGALSCKKGSHC  428



>emb|CDY65626.1| BnaC03g74840D [Brassica napus]
Length=454

 Score =   458 bits (1179),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 229/269 (85%), Positives = 247/269 (92%), Gaps = 1/269 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKT+DGRGASVHIAGGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHYGW
Sbjct  186  ELIMNSFKTLDGRGASVHIAGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYGW  245

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHS
Sbjct  246  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHS  305

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  306  DTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  365

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssyaka  173
            GNRF+AP+D F+KEVTKHEDAPES+W  WNWRSEGDLMLNGAFFT +      SSSY++A
Sbjct  366  GNRFVAPDDSFSKEVTKHEDAPESEWSHWNWRSEGDLMLNGAFFTLSGAGPTKSSSYSRA  425

Query  172  sslsARPSSLVGSLTGGAGALPCKKGKSC  86
            SSL+ARPSS VG +T  +GAL CKKG  C
Sbjct  426  SSLAARPSSNVGEITISSGALSCKKGSHC  454



>ref|XP_009359518.1| PREDICTED: probable pectate lyase 18 [Pyrus x bretschneideri]
Length=411

 Score =   456 bits (1174),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 233/268 (87%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSP H+GW
Sbjct  145  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAMVRDSPGHFGW  204

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  205  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  264

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  265  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  324

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+AP+ RF+KEVTKHEDAPE +WK WNWRSEGDLMLNGAFF     AGASSSYA+AS
Sbjct  325  GNRFVAPDIRFSKEVTKHEDAPEGEWKNWNWRSEGDLMLNGAFFRA-SGAGASSSYARAS  383

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLVGS+T  AGAL C+KG  C
Sbjct  384  SLGARPSSLVGSITTAAGALSCRKGSHC  411



>ref|XP_009150377.1| PREDICTED: probable pectate lyase 22 [Brassica rapa]
Length=413

 Score =   456 bits (1174),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 228/269 (85%), Positives = 248/269 (92%), Gaps = 1/269 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN +VRDSPEHYGW
Sbjct  145  ELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTDVRDSPEHYGW  204

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHS
Sbjct  205  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHS  264

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  265  DTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  324

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssyaka  173
            GNRFLAP++ F+KEVTKHEDAPES+W  WNWRSEGDLMLNGAFFT +      SSSY++A
Sbjct  325  GNRFLAPDNSFSKEVTKHEDAPESEWSRWNWRSEGDLMLNGAFFTLSGAGPTKSSSYSRA  384

Query  172  sslsARPSSLVGSLTGGAGALPCKKGKSC  86
            SSL+ARPSS VG +T  +GAL CKKG  C
Sbjct  385  SSLAARPSSNVGEITISSGALSCKKGSHC  413



>gb|AEN70981.1| pectate lyase [Gossypium davidsonii]
 gb|AEN70982.1| pectate lyase [Gossypium klotzschianum]
Length=411

 Score =   456 bits (1174),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 232/268 (87%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  145  ELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGW  204

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  205  RTISDGDGVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  264

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  265  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  324

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP++RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF     AGASSSYAKAS
Sbjct  325  GNRFTAPDNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIA-SGAGASSSYAKAS  383

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV ++T  AGAL CKKG  C
Sbjct  384  SLGARPSSLVATITTNAGALNCKKGSRC  411



>ref|NP_001280201.1| probable pectate lyase 18 precursor [Prunus mume]
 dbj|BAE48664.1| Pectate lyase [Prunus mume]
Length=413

 Score =   456 bits (1174),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 230/268 (86%), Positives = 250/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGL+IHDC+QGGNA VR SPEHYGW
Sbjct  147  ELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLHIHDCKQGGNAMVRSSPEHYGW  206

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC+DGLVDAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  207  RTISDGDGVSIFGGSHVWVDHCSLSNCKDGLVDAIHGSTAITISNNYMTHHDKVMLLGHS  266

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  267  DSYTEDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  326

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP+ RF+KEVTKHEDAPES+W+ WNWRSEGDLM+NGAFFT    AGASSSYA+AS
Sbjct  327  GNRFAAPDIRFSKEVTKHEDAPESEWRNWNWRSEGDLMINGAFFTA-SGAGASSSYARAS  385

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+PSSLVGS+T  +GAL C+KG  C
Sbjct  386  SLGAKPSSLVGSITTASGALSCRKGSRC  413



>gb|EYU22243.1| hypothetical protein MIMGU_mgv1a007460mg [Erythranthe guttata]
Length=406

 Score =   456 bits (1173),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 228/268 (85%), Positives = 250/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIA GPCITIQYVTNIIIHG+++HDC+QGGNA VRDSP HYGW
Sbjct  140  ELIMNSFKTIDGRGASVHIANGPCITIQYVTNIIIHGIHVHDCKQGGNAMVRDSPRHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  200  RTISDGDGVSIFGGSHVWVDHVSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDKGMQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  260  DSYTQDKGMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+DRF+KEVTK+EDAPES+WK WNWRSEGDLMLNGA+FT    A +SSSYAKAS
Sbjct  320  GNRFLAPDDRFSKEVTKYEDAPESEWKNWNWRSEGDLMLNGAYFTP-SGARSSSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPS+L+ S+T G+GAL C+KG  C
Sbjct  379  SLGARPSTLISSITSGSGALNCRKGSRC  406



>emb|CDY41506.1| BnaA06g22590D [Brassica napus]
Length=413

 Score =   456 bits (1173),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 228/269 (85%), Positives = 248/269 (92%), Gaps = 1/269 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN +VRDSPEHYGW
Sbjct  145  ELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTDVRDSPEHYGW  204

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHS
Sbjct  205  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHS  264

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  265  DTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  324

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssyaka  173
            GNRFLAP++ F+KEVTKHEDAPES+W  WNWRSEGDLMLNGAFFT +      SSSY++A
Sbjct  325  GNRFLAPDNSFSKEVTKHEDAPESEWSHWNWRSEGDLMLNGAFFTLSGAGPTKSSSYSRA  384

Query  172  sslsARPSSLVGSLTGGAGALPCKKGKSC  86
            SSL+ARPSS VG +T  +GAL CKKG  C
Sbjct  385  SSLAARPSSNVGEITISSGALSCKKGSHC  413



>gb|AEN70965.1| pectate lyase [Gossypium schwendimanii]
Length=411

 Score =   456 bits (1173),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 230/268 (86%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  145  ELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGW  204

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  205  RTMSDGDGVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  264

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  265  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  324

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP++RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF     AG+SSSYA+AS
Sbjct  325  GNRFTAPDNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIA-SGAGSSSSYARAS  383

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV ++T  AGAL CKKG  C
Sbjct  384  SLGARPSSLVATITTNAGALNCKKGSRC  411



>gb|AEN70964.1| pectate lyase [Gossypium laxum]
 gb|AEN70983.1| pectate lyase [Gossypium aridum]
Length=411

 Score =   456 bits (1173),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 231/268 (86%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  145  ELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGW  204

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  205  RTISDGDGVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  264

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  265  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  324

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP++RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF     AGASSSYA+AS
Sbjct  325  GNRFTAPDNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIA-SGAGASSSYARAS  383

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV ++T  AGAL CKKG  C
Sbjct  384  SLGARPSSLVATITTNAGALNCKKGSRC  411



>gb|AEN70963.1| pectate lyase [Gossypium thurberi]
 gb|AEN70966.1| pectate lyase [Gossypium turneri]
 gb|AEN70979.1| pectate lyase [Gossypium armourianum]
 gb|AEN70980.1| pectate lyase [Gossypium harknessii]
 gb|AEN70986.1| pectate lyase [Gossypium trilobum]
 gb|KJB19533.1| hypothetical protein B456_003G108300 [Gossypium raimondii]
Length=411

 Score =   456 bits (1173),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 232/268 (87%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  145  ELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGW  204

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  205  RTISDGDGVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  264

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  265  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  324

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP++RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF     AGASSSYAKAS
Sbjct  325  GNRFTAPDNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIA-SGAGASSSYAKAS  383

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV ++T  AGAL CKKG  C
Sbjct  384  SLGARPSSLVATITTNAGALNCKKGSRC  411



>ref|XP_004501839.1| PREDICTED: probable pectate lyase 5-like [Cicer arietinum]
Length=407

 Score =   456 bits (1172),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 230/268 (86%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTN+IIHG+NIHDC+QGGNA VRDSP HYGW
Sbjct  141  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGINIHDCKQGGNAMVRDSPGHYGW  200

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  201  RTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  260

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +D+ MQVTIAFNHFGEGL+QRMPRCR GYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  261  DSYTEDRNMQVTIAFNHFGEGLVQRMPRCRLGYFHVVNNDYTHWEMYAIGGSANPTINSQ  320

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+APNDRF+KEVTK+EDA ES+WK WNWRSEGDLMLNGAFFT    A +SSSYA+AS
Sbjct  321  GNRFVAPNDRFSKEVTKYEDASESEWKNWNWRSEGDLMLNGAFFTA-SGAESSSSYARAS  379

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVGS+T  AG L CKKG  C
Sbjct  380  SLSARPSSLVGSITVAAGTLNCKKGSPC  407



>ref|XP_004157771.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 22-like 
[Cucumis sativus]
Length=413

 Score =   456 bits (1173),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 231/268 (86%), Positives = 250/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGN +VRDSP H+G+
Sbjct  147  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNTDVRDSPRHFGF  206

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  207  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  266

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  267  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQ  326

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+APNDRF+KEVTK+EDAPES+WK W+WRSEGDLMLNGA+FT    AGASSSYA+AS
Sbjct  327  GNRFVAPNDRFSKEVTKYEDAPESEWKNWHWRSEGDLMLNGAYFTA-SGAGASSSYARAS  385

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLVG++T  AGAL C+KG  C
Sbjct  386  SLGARPSSLVGTITTNAGALNCRKGSRC  413



>ref|XP_004152502.1| PREDICTED: probable pectate lyase 22-like [Cucumis sativus]
 gb|KGN64357.1| hypothetical protein Csa_1G049960 [Cucumis sativus]
Length=413

 Score =   456 bits (1173),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 231/268 (86%), Positives = 250/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGN +VRDSP H+G+
Sbjct  147  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNTDVRDSPRHFGF  206

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  207  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  266

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  267  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQ  326

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+APNDRF+KEVTK+EDAPES+WK W+WRSEGDLMLNGA+FT    AGASSSYA+AS
Sbjct  327  GNRFVAPNDRFSKEVTKYEDAPESEWKNWHWRSEGDLMLNGAYFTA-SGAGASSSYARAS  385

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLVG++T  AGAL C+KG  C
Sbjct  386  SLGARPSSLVGTITTNAGALNCRKGSRC  413



>gb|ADB90478.1| pectate lyase [Gossypium hirsutum]
 gb|ADB90480.1| pectate lyase [Gossypium barbadense]
 gb|AEN70970.1| pectate lyase [Gossypium darwinii]
 gb|AEN70972.1| pectate lyase [Gossypium tomentosum]
 gb|AEN70974.1| pectate lyase [Gossypium barbadense var. brasiliense]
 gb|AEN70976.1| pectate lyase [Gossypium barbadense var. peruvianum]
 gb|AEN70978.1| pectate lyase [Gossypium hirsutum subsp. latifolium]
Length=411

 Score =   456 bits (1172),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 232/268 (87%), Positives = 249/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  145  ELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGW  204

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  205  RTISDGDGVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  264

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  265  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  324

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP++RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF +   AGASSSYAKAS
Sbjct  325  GNRFTAPDNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIS-SGAGASSSYAKAS  383

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV ++T  AGAL CKKG  C
Sbjct  384  SLGARPSSLVATITTNAGALNCKKGSRC  411



>gb|AEN70968.1| pectate lyase [Gossypium mustelinum]
Length=411

 Score =   456 bits (1172),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 232/268 (87%), Positives = 249/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  145  ELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGW  204

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  205  RTISDGDGVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  264

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  265  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  324

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP++RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF +   AGASSSYAKAS
Sbjct  325  GNRFTAPDNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIS-SGAGASSSYAKAS  383

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV ++T  AGAL CKKG  C
Sbjct  384  SLGARPSSLVATITTNAGALNCKKGSRC  411



>gb|AGC94753.1| putative pectate lyase [Euphorbia lathyris]
Length=404

 Score =   455 bits (1171),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 229/268 (85%), Positives = 246/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIA GPCITIQYVTN+IIHG+NIHDC+ GGNA VRDSP HYGW
Sbjct  138  ELIMNSFKTIDGRGASVHIAEGPCITIQYVTNVIIHGINIHDCKSGGNAYVRDSPGHYGW  197

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDG+SIFGGSHVW+DHCSL+NC DGL+DAI GSTAITISNNYMTHHNKVMLLGHS
Sbjct  198  RTISDGDGISIFGGSHVWIDHCSLANCNDGLIDAIHGSTAITISNNYMTHHNKVMLLGHS  257

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DT++QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDY+HWEMYAIGGSA+PTINSQ
Sbjct  258  DTFLQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYSHWEMYAIGGSANPTINSQ  317

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDRFNKEVTKHE+A E +WK WNWRSEGDL+LNGAFFT    A ASSSYAKAS
Sbjct  318  GNRFLAPNDRFNKEVTKHEEAGEDEWKNWNWRSEGDLLLNGAFFTK-SGAAASSSYAKAS  376

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV S+T  AGAL CKKG  C
Sbjct  377  SLGARPSSLVNSITAAAGALLCKKGSRC  404



>gb|AAY85180.1| pectate lyase [Gossypium hirsutum]
Length=411

 Score =   455 bits (1171),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 231/268 (86%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  145  ELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGW  204

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  205  RTISDGDGVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  264

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  265  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  324

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP++RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF +   AGASSSYAKAS
Sbjct  325  GNRFTAPDNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIS-SGAGASSSYAKAS  383

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL  RPSSLV ++T  AGAL CKKG  C
Sbjct  384  SLGVRPSSLVATITTNAGALNCKKGSRC  411



>gb|KCW83228.1| hypothetical protein EUGRSUZ_B00168 [Eucalyptus grandis]
Length=484

 Score =   457 bits (1177),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 228/268 (85%), Positives = 249/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKT+DGRGASVHIAGGPCIT+Q+VTNIIIHGL+IHDC+QGGNANVR SP HYGW
Sbjct  218  ELIMNSFKTLDGRGASVHIAGGPCITVQFVTNIIIHGLHIHDCKQGGNANVRSSPRHYGW  277

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSH+WVDHCSLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  278  RTISDGDGVSIFGGSHIWVDHCSLSNCKDGLIDAIEGSTAITISNNYMTHHDKVMLLGHS  337

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ
Sbjct  338  DSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  397

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP+ RF+KEVTKHE AP+S+W+ WNWRSEGDL+LNGAFFT    AGASSSYAKAS
Sbjct  398  GNRFTAPDKRFSKEVTKHEVAPQSEWRNWNWRSEGDLLLNGAFFTP-SGAGASSSYAKAS  456

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLVG++TG AG L CKKG  C
Sbjct  457  SLGARPSSLVGTITGNAGTLGCKKGSRC  484



>gb|AEN70984.1| pectate lyase [Gossypium gossypioides]
Length=411

 Score =   455 bits (1170),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 231/268 (86%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  145  ELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGW  204

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNY+THH+KVMLLGHS
Sbjct  205  RTISDGDGVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYLTHHDKVMLLGHS  264

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  265  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  324

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP++RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF     AGASSSYAKAS
Sbjct  325  GNRFTAPDNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIA-SGAGASSSYAKAS  383

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV ++T  AGAL CKKG  C
Sbjct  384  SLGARPSSLVATITTNAGALNCKKGSRC  411



>ref|XP_011005597.1| PREDICTED: probable pectate lyase 18 [Populus euphratica]
Length=403

 Score =   454 bits (1168),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 231/268 (86%), Positives = 252/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGL+IHDC+QGGNA VRDSP+H+GW
Sbjct  137  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLHIHDCKQGGNAMVRDSPQHFGW  196

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGG+HVWVDH SLSNC DGLVDAI GS+AITISNNYMTHH+KVMLLGHS
Sbjct  197  RTISDGDGVSIFGGTHVWVDHNSLSNCNDGLVDAIHGSSAITISNNYMTHHDKVMLLGHS  256

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  257  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  316

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+AP+ RF+KEVTKHEDAPES+WK WNWRSEGDL++NGAFFT    AGASSSYA+AS
Sbjct  317  GNRFVAPDIRFSKEVTKHEDAPESEWKHWNWRSEGDLLVNGAFFTA-SGAGASSSYARAS  375

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLVG++TGGAGAL C+KG  C
Sbjct  376  SLGARPSSLVGTITGGAGALGCRKGARC  403



>ref|XP_010459939.1| PREDICTED: probable pectate lyase 22 [Camelina sativa]
Length=412

 Score =   454 bits (1169),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 228/269 (85%), Positives = 247/269 (92%), Gaps = 1/269 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHYGW
Sbjct  144  ELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYGW  203

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHS
Sbjct  204  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHS  263

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  264  DTYAQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  323

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssyaka  173
            GNRFLAP+D  +KEVTKHEDAPES+W+ WNWRSEGDLMLNGAFFT +      SSSY+KA
Sbjct  324  GNRFLAPDDSDSKEVTKHEDAPESEWQSWNWRSEGDLMLNGAFFTYSGAGPTKSSSYSKA  383

Query  172  sslsARPSSLVGSLTGGAGALPCKKGKSC  86
            SSL+ARPSS VG +T  +GAL CK+G  C
Sbjct  384  SSLAARPSSHVGEITVASGALSCKRGSRC  412



>ref|XP_010444201.1| PREDICTED: probable pectate lyase 22 isoform X3 [Camelina sativa]
Length=365

 Score =   452 bits (1164),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 228/269 (85%), Positives = 247/269 (92%), Gaps = 1/269 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHYGW
Sbjct  97   ELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYGW  156

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHS
Sbjct  157  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHS  216

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  217  DTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  276

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssyaka  173
            GNRFLAP+D  +KEVTKHEDAPES+W+ WNWRSEGDLMLNGAFFT +      SSSY+KA
Sbjct  277  GNRFLAPDDSDSKEVTKHEDAPESEWQSWNWRSEGDLMLNGAFFTYSGAGPTKSSSYSKA  336

Query  172  sslsARPSSLVGSLTGGAGALPCKKGKSC  86
            SSL+ARPSS VG +T  +GAL CK+G  C
Sbjct  337  SSLAARPSSHVGEITVASGALSCKRGSRC  365



>ref|XP_010484044.1| PREDICTED: probable pectate lyase 22 [Camelina sativa]
Length=413

 Score =   454 bits (1168),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 228/269 (85%), Positives = 247/269 (92%), Gaps = 1/269 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHYGW
Sbjct  145  ELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYGW  204

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHS
Sbjct  205  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHS  264

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  265  DTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  324

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssyaka  173
            GNRFLAP+D  +KEVTKHEDAPES+W+ WNWRSEGDLMLNGAFFT +      SSSY+KA
Sbjct  325  GNRFLAPDDSDSKEVTKHEDAPESEWQSWNWRSEGDLMLNGAFFTYSGAGPTKSSSYSKA  384

Query  172  sslsARPSSLVGSLTGGAGALPCKKGKSC  86
            SSL+ARPSS VG +T  +GAL CK+G  C
Sbjct  385  SSLAARPSSHVGEITVASGALSCKRGSRC  413



>ref|XP_010444198.1| PREDICTED: probable pectate lyase 22 [Camelina sativa]
 ref|XP_010444199.1| PREDICTED: probable pectate lyase 22 isoform X1 [Camelina sativa]
 ref|XP_010444200.1| PREDICTED: probable pectate lyase 22 isoform X2 [Camelina sativa]
Length=413

 Score =   454 bits (1168),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 228/269 (85%), Positives = 247/269 (92%), Gaps = 1/269 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHYGW
Sbjct  145  ELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYGW  204

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHS
Sbjct  205  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHS  264

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  265  DTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  324

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssyaka  173
            GNRFLAP+D  +KEVTKHEDAPES+W+ WNWRSEGDLMLNGAFFT +      SSSY+KA
Sbjct  325  GNRFLAPDDSDSKEVTKHEDAPESEWQSWNWRSEGDLMLNGAFFTYSGAGPTKSSSYSKA  384

Query  172  sslsARPSSLVGSLTGGAGALPCKKGKSC  86
            SSL+ARPSS VG +T  +GAL CK+G  C
Sbjct  385  SSLAARPSSHVGEITVASGALSCKRGSRC  413



>gb|ADB90476.1| pectate lyase [Gossypium raimondii]
Length=411

 Score =   454 bits (1168),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 231/268 (86%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  145  ELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGW  204

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  205  RTISDGDGVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  264

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            ++Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  265  NSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  324

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP++RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF     AGASSSYAKAS
Sbjct  325  GNRFTAPDNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIA-SGAGASSSYAKAS  383

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV ++T  AGAL CKKG  C
Sbjct  384  SLGARPSSLVATITTNAGALNCKKGSRC  411



>gb|AEN70977.1| pectate lyase [Gossypium hirsutum subsp. latifolium]
Length=411

 Score =   454 bits (1168),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 232/268 (87%), Positives = 247/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  145  ELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGW  204

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  205  RTISDGDGVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  264

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  265  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  324

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF APN+RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF     AGASSSYAKAS
Sbjct  325  GNRFTAPNNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIA-SGAGASSSYAKAS  383

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV ++T  AGA  CKKG  C
Sbjct  384  SLGARPSSLVATITTNAGAHNCKKGSRC  411



>gb|ADB90479.1| pectate lyase [Gossypium barbadense]
 gb|AEN70967.1| pectate lyase [Gossypium mustelinum]
 gb|AEN70969.1| pectate lyase [Gossypium darwinii]
 gb|AEN70971.1| pectate lyase [Gossypium tomentosum]
 gb|AEN70973.1| pectate lyase [Gossypium barbadense var. brasiliense]
 gb|AEN70975.1| pectate lyase [Gossypium barbadense var. peruvianum]
Length=411

 Score =   454 bits (1167),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 232/268 (87%), Positives = 247/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGW
Sbjct  145  ELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGW  204

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  205  RTISDGDGVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  264

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  265  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  324

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF APN+RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF     AGASSSYAKAS
Sbjct  325  GNRFTAPNNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIA-SGAGASSSYAKAS  383

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV ++T  AGA  CKKG  C
Sbjct  384  SLGARPSSLVATITTNAGAHNCKKGSRC  411



>ref|XP_008439105.1| PREDICTED: probable pectate lyase 22 [Cucumis melo]
Length=411

 Score =   454 bits (1167),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 231/268 (86%), Positives = 250/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+ GGN +VRDSP H+G+
Sbjct  145  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKPGGNTDVRDSPRHFGF  204

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  205  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  264

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  265  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQ  324

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+APNDRF+KEVTK+EDAPES+WK W+WRSEGDLMLNGAFFT+   AGASSSYA+AS
Sbjct  325  GNRFVAPNDRFSKEVTKYEDAPESEWKNWHWRSEGDLMLNGAFFTS-SGAGASSSYARAS  383

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLVG++T  AGAL C+KG  C
Sbjct  384  SLGARPSSLVGTITTNAGALNCRKGSRC  411



>ref|XP_009137472.1| PREDICTED: probable pectate lyase 18 [Brassica rapa]
Length=406

 Score =   453 bits (1166),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 245/268 (91%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPC+TIQYVTNIIIHG++IHDC++GGNA VR SP HYGW
Sbjct  140  ELIMNSFKTIDGRGASVHIAGGPCVTIQYVTNIIIHGVHIHDCKRGGNAMVRSSPRHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAIT+SNNYMTHH+KVMLLGHS
Sbjct  200  RTVSDGDGVSIFGGSHVWVDHCSLSNCEDGLIDAIMGSTAITLSNNYMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY +DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  260  DTYARDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+APN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT       SSSYAKAS
Sbjct  320  GNRFVAPNIRFSKEVTKHEDAPESEWKRWNWRSSGDLLLNGAFFTP-SGGAQSSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+PSSLVG LT G+GAL C+KG  C
Sbjct  379  SLGAKPSSLVGPLTVGSGALNCRKGSRC  406



>emb|CDY11033.1| BnaA03g46920D [Brassica napus]
Length=406

 Score =   453 bits (1166),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 226/268 (84%), Positives = 245/268 (91%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPC+TIQYVTNIIIHG++IHDC++GGNA VR SP HYGW
Sbjct  140  ELIMNSFKTIDGRGASVHIAGGPCVTIQYVTNIIIHGVHIHDCKRGGNAMVRSSPRHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAIT+SNNYMTHH+KVMLLGHS
Sbjct  200  RTVSDGDGVSIFGGSHVWVDHCSLSNCEDGLIDAIMGSTAITLSNNYMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  260  DTYARDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+APN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT       SSSYAKAS
Sbjct  320  GNRFVAPNIRFSKEVTKHEDAPESEWKRWNWRSSGDLLLNGAFFTP-SGGAQSSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+PSSLVG LT G+GAL C+KG  C
Sbjct  379  SLGAKPSSLVGPLTVGSGALNCRKGSRC  406



>gb|KHG22755.1| hypothetical protein F383_29653 [Gossypium arboreum]
Length=408

 Score =   453 bits (1166),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 228/268 (85%), Positives = 246/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGA+VHIAGGPCITIQYV+N+IIHG++IHDC++GGNA VRDSP HYGW
Sbjct  142  ELLMNSFKTIDGRGANVHIAGGPCITIQYVSNVIIHGISIHDCKRGGNAYVRDSPSHYGW  201

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGD VSIFGGSHVWVDHCSLSNC DGLVDAI+GSTAITISNNYMTHHNKVMLLGHS
Sbjct  202  RTISDGDAVSIFGGSHVWVDHCSLSNCTDGLVDAIQGSTAITISNNYMTHHNKVMLLGHS  261

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGE L+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ
Sbjct  262  DSYKQDKNMQVTIAFNHFGERLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  321

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+AP++  +KEVTKHEDAP+S+WK WNWRSEGDLMLNGAFFT     G SSSYAKAS
Sbjct  322  GNRFVAPDNVNSKEVTKHEDAPQSKWKEWNWRSEGDLMLNGAFFTA-SGKGTSSSYAKAS  380

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV SLT GAGAL CKKG  C
Sbjct  381  SLGARPSSLVNSLTAGAGALVCKKGSRC  408



>emb|CDX92652.1| BnaC07g39100D [Brassica napus]
Length=406

 Score =   452 bits (1164),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 245/268 (91%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPC+TIQYVTNIIIHG++IHDC++GGNA VR SP HYGW
Sbjct  140  ELIMNSFKTIDGRGASVHIAGGPCVTIQYVTNIIIHGVHIHDCKRGGNAMVRSSPRHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAIT+SNNYMTHH+KVMLLGHS
Sbjct  200  RTVSDGDGVSIFGGSHVWVDHCSLSNCEDGLIDAIMGSTAITLSNNYMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY +DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  260  DTYARDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+APN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT       SSSYAKAS
Sbjct  320  GNRFVAPNIRFSKEVTKHEDAPESEWKRWNWRSSGDLLLNGAFFTP-SGGAQSSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+PSSLVG LT G+GAL C+KG  C
Sbjct  379  SLGAKPSSLVGPLTVGSGALNCRKGSRC  406



>gb|KDO69407.1| hypothetical protein CISIN_1g015569mg [Citrus sinensis]
Length=404

 Score =   452 bits (1164),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 229/268 (85%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC++GGNA VRDSP H+GW
Sbjct  138  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKKGGNAMVRDSPRHFGW  197

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGG+H+WVDHCSLSNC DGLVDAI GSTAITISNN+MTHH+KVMLLGHS
Sbjct  198  RTVSDGDGVSIFGGTHIWVDHCSLSNCDDGLVDAIHGSTAITISNNFMTHHDKVMLLGHS  257

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQVTIAFNHFGEGL+QR+PRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  258  DTYTQDKNMQVTIAFNHFGEGLVQRIPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  317

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP+  F+KEVTKHEDAPES+W+ WNWRSEGDLM+NGAFFT    AGASSSYA+AS
Sbjct  318  GNRFAAPDRAFSKEVTKHEDAPESEWRNWNWRSEGDLMVNGAFFTA-SGAGASSSYARAS  376

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPS+LVG +TG AGAL CKKG  C
Sbjct  377  SLGARPSALVGPITGSAGALICKKGARC  404



>ref|XP_006280553.1| hypothetical protein CARUB_v10026494mg [Capsella rubella]
 gb|EOA13451.1| hypothetical protein CARUB_v10026494mg [Capsella rubella]
Length=412

 Score =   452 bits (1164),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 229/269 (85%), Positives = 247/269 (92%), Gaps = 1/269 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKT+DGRGASVHIAGGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHYG+
Sbjct  144  ELIMNSFKTLDGRGASVHIAGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYGY  203

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNYMTHHNKVMLLGHS
Sbjct  204  RTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYMTHHNKVMLLGHS  263

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  264  DTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  323

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssyaka  173
            GNRFLAP+D  +KEVTKHEDAPES+W+GWNWRSEGDLMLNGAFF  +      SSSY+KA
Sbjct  324  GNRFLAPDDSDSKEVTKHEDAPESEWQGWNWRSEGDLMLNGAFFRFSGAGPTKSSSYSKA  383

Query  172  sslsARPSSLVGSLTGGAGALPCKKGKSC  86
            SSL+ARPSS VG +T  +GAL CK+G  C
Sbjct  384  SSLAARPSSHVGEITVASGALSCKRGSLC  412



>ref|XP_010026892.1| PREDICTED: probable pectate lyase 18 [Eucalyptus grandis]
Length=408

 Score =   452 bits (1164),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 228/268 (85%), Positives = 249/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKT+DGRGASVHIAGGPCIT+Q+VTNIIIHGL+IHDC+QGGNANVR SP HYGW
Sbjct  142  ELIMNSFKTLDGRGASVHIAGGPCITVQFVTNIIIHGLHIHDCKQGGNANVRSSPRHYGW  201

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSH+WVDHCSLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  202  RTISDGDGVSIFGGSHIWVDHCSLSNCKDGLIDAIEGSTAITISNNYMTHHDKVMLLGHS  261

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ
Sbjct  262  DSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  321

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP+ RF+KEVTKHE AP+S+W+ WNWRSEGDL+LNGAFFT    AGASSSYAKAS
Sbjct  322  GNRFTAPDKRFSKEVTKHEVAPQSEWRNWNWRSEGDLLLNGAFFTP-SGAGASSSYAKAS  380

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLVG++TG AG L CKKG  C
Sbjct  381  SLGARPSSLVGTITGNAGTLGCKKGSRC  408



>ref|XP_007209185.1| hypothetical protein PRUPE_ppa006392mg [Prunus persica]
 gb|ABV32549.1| pectase lyase [Prunus persica]
 gb|EMJ10384.1| hypothetical protein PRUPE_ppa006392mg [Prunus persica]
Length=413

 Score =   452 bits (1164),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 228/268 (85%), Positives = 249/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCIT+Q+VTNIIIHGL+IHDC+ GGNA VR SPEHYGW
Sbjct  147  ELIMNSFKTIDGRGASVHIAGGPCITVQFVTNIIIHGLHIHDCKPGGNAMVRSSPEHYGW  206

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC+DGLVDAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  207  RTISDGDGVSIFGGSHVWVDHCSLSNCKDGLVDAIHGSTAITISNNYMTHHDKVMLLGHS  266

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  267  DSYTEDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  326

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP+ RF+KEVTKHEDAPES+W+ WNWRSEGDLM+NGAFFT    AGASSSYA+AS
Sbjct  327  GNRFAAPDIRFSKEVTKHEDAPESEWRNWNWRSEGDLMINGAFFTA-SGAGASSSYARAS  385

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+PSSLVGS+T  +GAL C+KG  C
Sbjct  386  SLGAKPSSLVGSITTASGALSCRKGSRC  413



>ref|XP_006476937.1| PREDICTED: probable pectate lyase 18-like [Citrus sinensis]
Length=449

 Score =   454 bits (1167),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 228/268 (85%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC++GGNA VRDSP H+GW
Sbjct  183  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKKGGNAMVRDSPRHFGW  242

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGG+H+WVDHCSLSNC DGLVDAI GSTAITISNN+MTHH+KVMLLGHS
Sbjct  243  RTVSDGDGVSIFGGTHIWVDHCSLSNCDDGLVDAIHGSTAITISNNFMTHHDKVMLLGHS  302

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQVTIAFNHFGEGL+QR+PRCRHGYFHVVNNDYTHWEMYA+GGSA+PTINSQ
Sbjct  303  DTYTQDKNMQVTIAFNHFGEGLVQRIPRCRHGYFHVVNNDYTHWEMYAVGGSANPTINSQ  362

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP+  F+KEVTKHEDAPES+W+ WNWRSEGDLM+NGAFFT    AGASSSYA+AS
Sbjct  363  GNRFAAPDRAFSKEVTKHEDAPESEWRNWNWRSEGDLMVNGAFFTA-SGAGASSSYARAS  421

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPS+LVG +TG AGAL CKKG  C
Sbjct  422  SLGARPSALVGPITGSAGALICKKGARC  449



>ref|XP_006439991.1| hypothetical protein CICLE_v10020423mg [Citrus clementina]
 gb|ESR53231.1| hypothetical protein CICLE_v10020423mg [Citrus clementina]
Length=404

 Score =   452 bits (1162),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 229/268 (85%), Positives = 247/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC++GGNA VRDSP H+GW
Sbjct  138  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKKGGNAMVRDSPRHFGW  197

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGG+HVWVDHCSLSNC DGLVDAI GSTAITISNN+MTHH+KVMLLGHS
Sbjct  198  RTVSDGDGVSIFGGTHVWVDHCSLSNCDDGLVDAIHGSTAITISNNFMTHHDKVMLLGHS  257

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQ TIAFNHFGEGL+QR+PRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  258  DTYTQDKNMQATIAFNHFGEGLVQRIPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  317

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP+  F+KEVTKHEDAPES+W+ WNWRSEGDLM+NGAFFT    AGASSSYA+AS
Sbjct  318  GNRFAAPDRAFSKEVTKHEDAPESEWRNWNWRSEGDLMVNGAFFTA-SGAGASSSYARAS  376

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPS+LVG +TG AGAL CKKG  C
Sbjct  377  SLGARPSALVGPITGSAGALICKKGARC  404



>ref|XP_002866540.1| pectate lyase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42799.1| pectate lyase [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   452 bits (1162),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 226/269 (84%), Positives = 248/269 (92%), Gaps = 1/269 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHYG+
Sbjct  142  ELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYGY  201

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHS
Sbjct  202  RTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHS  261

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY+QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  262  DTYVQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  321

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssyaka  173
            GNRFLAP+D  +KEVTKHEDAPE++W+ WNWRSEGDLMLNGAFFT +      SSSY+KA
Sbjct  322  GNRFLAPDDSSSKEVTKHEDAPENEWRNWNWRSEGDLMLNGAFFTYSGAGPTKSSSYSKA  381

Query  172  sslsARPSSLVGSLTGGAGALPCKKGKSC  86
            SSL+ARPSS VG +T  +GAL CK+G  C
Sbjct  382  SSLAARPSSHVGEITIASGALSCKRGSHC  410



>emb|CDY03419.1| BnaC01g16630D [Brassica napus]
Length=406

 Score =   451 bits (1161),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 226/268 (84%), Positives = 246/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG+++HDC+QGGNA VR SP H+GW
Sbjct  140  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGIHLHDCKQGGNAMVRSSPRHFGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAIT+SNNYMTHH+KVMLLGHS
Sbjct  200  RTISDGDGVSIFGGSHVWVDHCSLSNCDDGLIDAIMGSTAITLSNNYMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY +DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  260  DTYTRDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+APN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT      +SSSYAKAS
Sbjct  320  GNRFVAPNIRFSKEVTKHEDAPESEWKSWNWRSSGDLLLNGAFFTP-SGGASSSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLVG LT G+GAL C+KG  C
Sbjct  379  SLGARPSSLVGPLTVGSGALNCRKGSRC  406



>gb|KDP30994.1| hypothetical protein JCGZ_11370 [Jatropha curcas]
Length=411

 Score =   451 bits (1161),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 229/268 (85%), Positives = 251/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKT+DGRGASVHIAGGPCITIQ+VTNIIIHGL+IHDC+QGGNA VRDSP+HYGW
Sbjct  145  ELIMNSFKTLDGRGASVHIAGGPCITIQFVTNIIIHGLHIHDCKQGGNAYVRDSPQHYGW  204

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFG SH+WVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  205  RTISDGDGVSIFGASHIWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  264

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  265  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  324

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP++RF+KEVTKHEDAPES+W+ WNWRSEGDLM+NGAFF     AGASSSYAKAS
Sbjct  325  GNRFLAPDNRFSKEVTKHEDAPESEWRNWNWRSEGDLMMNGAFFKA-SGAGASSSYAKAS  383

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPS+LVG++T  AGAL CKKG  C
Sbjct  384  SLSARPSTLVGTITVAAGALGCKKGSRC  411



>ref|XP_002322215.1| pectate lyase 22 precursor family protein [Populus trichocarpa]
 gb|EEF06342.1| pectate lyase 22 precursor family protein [Populus trichocarpa]
Length=403

 Score =   451 bits (1160),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 230/268 (86%), Positives = 251/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGL+IHDC+QGGNA VRDSP+H+GW
Sbjct  137  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLHIHDCKQGGNAMVRDSPKHFGW  196

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGG+HVWVDH SLSNC DGLVDAI GS+AITISNNYMTHH+KVMLLGHS
Sbjct  197  RTVSDGDGVSIFGGTHVWVDHNSLSNCNDGLVDAIHGSSAITISNNYMTHHDKVMLLGHS  256

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  257  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  316

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+AP+ RF+KEVTKHEDAPES+WK WNWRSEGDL++NGAFFT    AGASSSYA+AS
Sbjct  317  GNRFVAPDIRFSKEVTKHEDAPESEWKHWNWRSEGDLLMNGAFFTA-SGAGASSSYARAS  375

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLVG++T GAGAL C+KG  C
Sbjct  376  SLGARPSSLVGTITVGAGALGCRKGARC  403



>ref|XP_003523121.1| PREDICTED: probable pectate lyase 18-like [Glycine max]
Length=408

 Score =   451 bits (1160),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 228/268 (85%), Positives = 249/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVH+AGGPCITIQYVTN+IIHG++IHDC+QGGNA VRDSP HYGW
Sbjct  142  ELLMNSFKTIDGRGASVHVAGGPCITIQYVTNVIIHGIHIHDCKQGGNAMVRDSPRHYGW  201

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  202  RTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  261

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCR GYFHVVNNDYTHWEMYAIGGSA+PTIN Q
Sbjct  262  DSYTQDKDMQVTIAFNHFGEGLVQRMPRCRLGYFHVVNNDYTHWEMYAIGGSANPTINCQ  321

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+AP+DRF+KEVTK ED PES+W+ WNWRSEGDL++NGAFFT    AGASSSYA+AS
Sbjct  322  GNRFVAPDDRFSKEVTKREDTPESEWQDWNWRSEGDLLVNGAFFTA-SGAGASSSYARAS  380

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVGS+T GAGAL CKKG  C
Sbjct  381  SLSARPSSLVGSITTGAGALSCKKGSPC  408



>ref|XP_010545988.1| PREDICTED: probable pectate lyase 22 [Tarenaya hassleriana]
Length=412

 Score =   451 bits (1160),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 228/268 (85%), Positives = 243/268 (91%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVHIAGGPCITIQYVTN+IIHG++IHDC+QGGNA VRDSP HYGW
Sbjct  146  ELMMNSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGVHIHDCKQGGNAMVRDSPRHYGW  205

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNN+MTHHNKVMLLGHS
Sbjct  206  RTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNHMTHHNKVMLLGHS  265

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  266  DTYAQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQ  325

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
             NRFLAPN  F+KEVTKHEDAPE++WK WNWRSEGDL LNGAFF        SSSY+KAS
Sbjct  326  ANRFLAPNIAFSKEVTKHEDAPENEWKNWNWRSEGDLFLNGAFFRA-SGKDVSSSYSKAS  384

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSA+PSS VG +T  AGAL CKKG SC
Sbjct  385  SLSAQPSSRVGDITTTAGALNCKKGSSC  412



>ref|XP_003526981.1| PREDICTED: probable pectate lyase 18-like [Glycine max]
Length=408

 Score =   451 bits (1160),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 228/268 (85%), Positives = 250/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVH+AGGPCITIQYVTN+IIHG++IHDC+QGGNA VRDSP HYGW
Sbjct  142  ELLMNSFKTIDGRGASVHVAGGPCITIQYVTNVIIHGIHIHDCKQGGNAMVRDSPRHYGW  201

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVW+DHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  202  RTVSDGDGVSIFGGSHVWIDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  261

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D Y QDK MQVTIAFNHFGEGL+QRMPRCR GYFHVVNNDYTHWEMYAIGGSA+PTIN Q
Sbjct  262  DAYTQDKAMQVTIAFNHFGEGLVQRMPRCRLGYFHVVNNDYTHWEMYAIGGSANPTINCQ  321

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+AP+DRF+KEVTK EDAPES+W+ WNWRSEGDL++NGAFFT+   AGASSSYA+AS
Sbjct  322  GNRFVAPDDRFSKEVTKREDAPESEWQDWNWRSEGDLLVNGAFFTS-SGAGASSSYARAS  380

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVGS+T GAGAL CKKG  C
Sbjct  381  SLSARPSSLVGSITTGAGALSCKKGSPC  408



>gb|KJB50292.1| hypothetical protein B456_008G162500 [Gossypium raimondii]
Length=408

 Score =   451 bits (1159),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 227/268 (85%), Positives = 245/268 (91%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL++NSFKTIDGRGA+VHIAGGPCITIQYV+N+IIHG++IHDC++GGNA VRDSP HYGW
Sbjct  142  ELLVNSFKTIDGRGANVHIAGGPCITIQYVSNVIIHGISIHDCKRGGNAYVRDSPSHYGW  201

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGD VSIFGGSHVWVDHCSLSNC DGLVDAI+GSTAITISNNYMTHHNKVMLLGHS
Sbjct  202  RTISDGDAVSIFGGSHVWVDHCSLSNCTDGLVDAIQGSTAITISNNYMTHHNKVMLLGHS  261

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK  QVTIAFN+FGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ
Sbjct  262  DSYKQDKNTQVTIAFNYFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  321

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF APN+  +KEVTKHEDAP+S+WK WNWRSEGDLMLNGAFFT     G SSSYAKAS
Sbjct  322  GNRFAAPNNVNSKEVTKHEDAPQSKWKEWNWRSEGDLMLNGAFFTA-SGKGTSSSYAKAS  380

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV SLT GAGAL CKKG  C
Sbjct  381  SLGARPSSLVNSLTAGAGALVCKKGSRC  408



>ref|XP_004299169.1| PREDICTED: probable pectate lyase 18 [Fragaria vesca subsp. vesca]
Length=412

 Score =   451 bits (1159),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 228/268 (85%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKT+DGRGASVHI+GGPCIT+QYVTNIIIHGLNIHDC+ GGNA VRDSP H+GW
Sbjct  146  ELIMNSFKTLDGRGASVHISGGPCITVQYVTNIIIHGLNIHDCKPGGNAMVRDSPNHFGW  205

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGLVDAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  206  RTISDGDGVSIFGGSHVWVDHCSLSNCADGLVDAIHGSTAITISNNYMTHHDKVMLLGHS  265

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  266  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  325

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP+ RF+KEVTKHEDAPES+W+ WNWRSEGD+++NGAFFT    AGASSSYAKAS
Sbjct  326  GNRFAAPDIRFSKEVTKHEDAPESEWRNWNWRSEGDMLINGAFFTA-SGAGASSSYAKAS  384

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLVGS+T  +GAL C+KG  C
Sbjct  385  SLGARPSSLVGSITTTSGALNCRKGSRC  412



>gb|KDO82123.1| hypothetical protein CISIN_1g015702mg [Citrus sinensis]
Length=274

 Score =   445 bits (1145),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 235/268 (88%), Positives = 252/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHG+NIHDC++GGNANVRDSP HYGW
Sbjct  8    ELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGINIHDCKRGGNANVRDSPSHYGW  67

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHHNKVMLLGHS
Sbjct  68   RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHNKVMLLGHS  127

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DT+ QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYA+GGSA PTINSQ
Sbjct  128  DTFTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYALGGSASPTINSQ  187

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+APNDRFNKEVTK+EDAPES+WK WNWRSEGDLM+NGAFFT    AGASSSYAKAS
Sbjct  188  GNRFVAPNDRFNKEVTKYEDAPESEWKNWNWRSEGDLMVNGAFFTP-SGAGASSSYAKAS  246

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSL+ S+T GAG+L C+KGK C
Sbjct  247  SLGARPSSLISSITAGAGSLNCRKGKPC  274



>gb|KHN05801.1| Putative pectate lyase 22 [Glycine soja]
Length=412

 Score =   451 bits (1159),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 228/268 (85%), Positives = 249/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVH+AGGPCITIQYVTN+IIHG++IHDC+QGGNA VRDSP HYGW
Sbjct  146  ELLMNSFKTIDGRGASVHVAGGPCITIQYVTNVIIHGIHIHDCKQGGNAMVRDSPRHYGW  205

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  206  RTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  265

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCR GYFHVVNNDYTHWEMYAIGGSA+PTIN Q
Sbjct  266  DSYTQDKDMQVTIAFNHFGEGLVQRMPRCRLGYFHVVNNDYTHWEMYAIGGSANPTINCQ  325

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+AP+DRF+KEVTK ED PES+W+ WNWRSEGDL++NGAFFT    AGASSSYA+AS
Sbjct  326  GNRFVAPDDRFSKEVTKREDTPESEWQDWNWRSEGDLLVNGAFFTA-SGAGASSSYARAS  384

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVGS+T GAGAL CKKG  C
Sbjct  385  SLSARPSSLVGSITTGAGALSCKKGSPC  412



>ref|NP_001289258.1| probable pectate lyase 18 precursor [Pyrus x bretschneideri]
 gb|AHX37592.1| pectate lyase [Pyrus x bretschneideri]
Length=414

 Score =   450 bits (1158),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 227/268 (85%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGL+IHDC+QGGNA VR SP H+GW
Sbjct  148  ELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLHIHDCKQGGNAMVRSSPSHFGW  207

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC+DGLVDAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  208  RTVSDGDGVSIFGGSHVWVDHCSLSNCKDGLVDAIYGSTAITISNNYMTHHDKVMLLGHS  267

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ
Sbjct  268  DSYTKDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  327

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP+ R +KEVTKHEDAPES+WK WNWRSEGDL+LNGAFFT    AGASSSYA+AS
Sbjct  328  GNRFAAPDIRSSKEVTKHEDAPESEWKNWNWRSEGDLLLNGAFFTA-SGAGASSSYARAS  386

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+PSSLVG++T  +GAL C+KG  C
Sbjct  387  SLGAKPSSLVGAITTASGALSCRKGSRC  414



>ref|XP_011040439.1| PREDICTED: probable pectate lyase 18 [Populus euphratica]
Length=403

 Score =   449 bits (1156),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 229/268 (85%), Positives = 247/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC++GGNA VRDSP H+GW
Sbjct  137  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKKGGNAMVRDSPNHFGW  196

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGG+H+WVDH SLSNC DGLVDAI GS+AITISNNYMTHH+KVMLLGHS
Sbjct  197  RTVSDGDGVSIFGGAHIWVDHNSLSNCDDGLVDAIHGSSAITISNNYMTHHDKVMLLGHS  256

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  257  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  316

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+AP+ RF+KEVTKHEDAP+S+WK WNWRSEGDL+LNGAFF     AGASSSYA+AS
Sbjct  317  GNRFVAPDIRFSKEVTKHEDAPQSEWKNWNWRSEGDLLLNGAFFVA-SGAGASSSYARAS  375

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLVG +T GAGAL CKKG  C
Sbjct  376  SLGARPSSLVGPITMGAGALNCKKGTRC  403



>ref|XP_002318694.1| pectate lyase 22 precursor family protein [Populus trichocarpa]
 gb|EEE96914.1| pectate lyase 22 precursor family protein [Populus trichocarpa]
Length=403

 Score =   449 bits (1155),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 229/268 (85%), Positives = 247/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC++GGNA VRDSP H+GW
Sbjct  137  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKRGGNAMVRDSPNHFGW  196

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGG+H+WVDH SLSNC DGLVDAI GS+AITISNNYMTHH+KVMLLGHS
Sbjct  197  RTVSDGDGVSIFGGAHIWVDHNSLSNCNDGLVDAIHGSSAITISNNYMTHHDKVMLLGHS  256

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  257  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  316

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+AP+ RF+KEVTKHEDAPES+WK WNWRSEGDL+LNGAFF     AGASSSYA+AS
Sbjct  317  GNRFVAPDIRFSKEVTKHEDAPESEWKNWNWRSEGDLLLNGAFFVA-SGAGASSSYARAS  375

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLVG +T GAGAL C+KG  C
Sbjct  376  SLGARPSSLVGPITMGAGALNCRKGGRC  403



>ref|NP_001280839.1| probable pectate lyase 18 precursor [Malus domestica]
 ref|XP_008346717.1| PREDICTED: probable pectate lyase 18 [Malus domestica]
 gb|AAQ84042.1| pectate lyase [Malus domestica]
Length=418

 Score =   449 bits (1156),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 228/268 (85%), Positives = 247/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGL+IHDC+QGGNA VR SP H+GW
Sbjct  152  ELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLHIHDCKQGGNAMVRSSPRHFGW  211

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC+DGLVDAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  212  RTVSDGDGVSIFGGSHVWVDHCSLSNCKDGLVDAIYGSTAITISNNYMTHHDKVMLLGHS  271

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y  DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ
Sbjct  272  DSYTNDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  331

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP+ R +KEVTKHEDAPES+WK WNWRSEGDLMLNGAFFT    AGASSSYA+AS
Sbjct  332  GNRFAAPDIRSSKEVTKHEDAPESEWKNWNWRSEGDLMLNGAFFTA-SGAGASSSYARAS  390

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+PSSLVG++T  +GAL C+KG  C
Sbjct  391  SLGAKPSSLVGAITTASGALSCRKGSRC  418



>ref|NP_568967.1| putative pectate lyase 22 [Arabidopsis thaliana]
 sp|Q93Z25.1|PLY22_ARATH RecName: Full=Probable pectate lyase 22; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL25610.1| AT5g63180/MDC12_15 [Arabidopsis thaliana]
 gb|AED97715.1| putative pectate lyase 22 [Arabidopsis thaliana]
Length=432

 Score =   449 bits (1155),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 225/269 (84%), Positives = 246/269 (91%), Gaps = 1/269 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHYG+
Sbjct  164  ELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYGY  223

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHS
Sbjct  224  RTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHS  283

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  284  DTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  343

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssyaka  173
            GNRFLAP+D  +KEVTKHEDAPE +W+ WNWRSEGDL+LNGAFFT +      SSSY+KA
Sbjct  344  GNRFLAPDDSSSKEVTKHEDAPEDEWRNWNWRSEGDLLLNGAFFTYSGAGPAKSSSYSKA  403

Query  172  sslsARPSSLVGSLTGGAGALPCKKGKSC  86
            SSL+ARPSS VG +T  +GAL CK+G  C
Sbjct  404  SSLAARPSSHVGEITIASGALSCKRGSHC  432



>dbj|BAB10560.1| pectate lyase [Arabidopsis thaliana]
Length=410

 Score =   448 bits (1152),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 225/269 (84%), Positives = 246/269 (91%), Gaps = 1/269 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHYG+
Sbjct  142  ELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYGY  201

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHS
Sbjct  202  RTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHS  261

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  262  DTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  321

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssyaka  173
            GNRFLAP+D  +KEVTKHEDAPE +W+ WNWRSEGDL+LNGAFFT +      SSSY+KA
Sbjct  322  GNRFLAPDDSSSKEVTKHEDAPEDEWRNWNWRSEGDLLLNGAFFTYSGAGPAKSSSYSKA  381

Query  172  sslsARPSSLVGSLTGGAGALPCKKGKSC  86
            SSL+ARPSS VG +T  +GAL CK+G  C
Sbjct  382  SSLAARPSSHVGEITIASGALSCKRGSHC  410



>gb|KHG12411.1| hypothetical protein F383_06737 [Gossypium arboreum]
Length=380

 Score =   446 bits (1147),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 229/268 (85%), Positives = 246/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGL+IHDC+QGGNA VRDSP HYGW
Sbjct  114  ELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLHIHDCKQGGNAMVRDSPRHYGW  173

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT SDGDGVSIFGGSH+WVDH SLSNC+DGL+DAI GSTAITISNN+MTHH+KVMLLGHS
Sbjct  174  RTTSDGDGVSIFGGSHIWVDHNSLSNCKDGLIDAIYGSTAITISNNHMTHHDKVMLLGHS  233

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFG+GLIQRMPRCR GYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  234  DSYMKDKNMQVTIAFNHFGKGLIQRMPRCRRGYFHVVNNDYTHWEMYAIGGSANPTINSQ  293

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF APND F+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF T   AGASSSYAKAS
Sbjct  294  GNRFTAPNDIFSKEVTKHEDAPESEWKNWNWRSEGDLMVNGAFF-TRSGAGASSSYAKAS  352

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSS V S+T  AGAL CKKG  C
Sbjct  353  SLGARPSSHVASITTNAGALNCKKGSRC  380



>dbj|BAI94495.1| pectate lyase [Dianthus caryophyllus]
Length=407

 Score =   447 bits (1149),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 226/268 (84%), Positives = 242/268 (90%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHI+GGPCITIQYVTNIIIHG+N+HDC+ GGNA VR SP HYGW
Sbjct  141  ELIMNSFKTIDGRGASVHISGGPCITIQYVTNIIIHGINVHDCKPGGNAMVRSSPRHYGW  200

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVS+FG S VWVDH SLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  201  RTVSDGDGVSLFGASQVWVDHVSLSNCADGLIDAIMGSTAITISNNYMTHHDKVMLLGHS  260

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y  DK MQ TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  261  DSYSPDKNMQATIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  320

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDRF KEVTKHEDAPE +WK WNWRSEGDLMLNGAFFT    AGASSSYA+AS
Sbjct  321  GNRFLAPNDRFKKEVTKHEDAPEGEWKNWNWRSEGDLMLNGAFFTP-SGAGASSSYARAS  379

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPS+LVG+LTG AG+L C+KG  C
Sbjct  380  SLGARPSTLVGTLTGSAGSLVCRKGSRC  407



>ref|XP_004236303.1| PREDICTED: probable pectate lyase 18 [Solanum lycopersicum]
Length=403

 Score =   446 bits (1148),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 233/268 (87%), Positives = 248/268 (93%), Gaps = 0/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP HYGW
Sbjct  136  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPSHYGW  195

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  196  RTVSDGDGVSIFGGSHVWVDHCSLSNCKDGLIDAIMGSTAITISNNYMTHHDKVMLLGHS  255

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ
Sbjct  256  DTYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  315

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+ RF+KEVTKHEDAPES+WK WNWR++GDLMLNGAFFT SG    SSSYAKAS
Sbjct  316  GNRFLAPDIRFSKEVTKHEDAPESEWKNWNWRTDGDLMLNGAFFTRSGVRTGSSSYAKAS  375

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV +L   +GAL CKKG  C
Sbjct  376  SLSARPSSLVANLVSSSGALNCKKGSRC  403



>ref|XP_007137977.1| hypothetical protein PHAVU_009G170500g [Phaseolus vulgaris]
 gb|ESW09971.1| hypothetical protein PHAVU_009G170500g [Phaseolus vulgaris]
Length=410

 Score =   447 bits (1149),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVHIAGGPCIT+QYVTN+IIHG+++HDC+QGGNA VR SP HYGW
Sbjct  142  ELLMNSFKTIDGRGASVHIAGGPCITVQYVTNVIIHGIHLHDCKQGGNAMVRSSPRHYGW  201

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  202  RTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  261

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCR GYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  262  DSYTQDKDMQVTIAFNHFGEGLVQRMPRCRLGYFHVVNNDYTHWEMYAIGGSANPTINSQ  321

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+AP+DRF+KEVTK E+A ES+W+GWNWRSEGDL++NGAFFT    AGASSSYA+AS
Sbjct  322  GNRFVAPDDRFSKEVTKREEAAESEWQGWNWRSEGDLLVNGAFFTA-SGAGASSSYARAS  380

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV S+T GAGAL CKK   C
Sbjct  381  SLSARPSSLVASITTGAGALSCKKASPC  408



>ref|XP_006484000.1| PREDICTED: probable pectate lyase 5-like [Citrus sinensis]
Length=402

 Score =   446 bits (1146),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 236/268 (88%), Positives = 252/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG+NIHDC++GGNANVRDSP HYGW
Sbjct  136  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGINIHDCKRGGNANVRDSPSHYGW  195

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHHNKVMLLGHS
Sbjct  196  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHNKVMLLGHS  255

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DT+ QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYA+GGSA PTINSQ
Sbjct  256  DTFTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYALGGSASPTINSQ  315

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+APNDRFNKEVTK+EDAPES+WK WNWRSEGDLM+NGAFFT    AGASSSYAKAS
Sbjct  316  GNRFVAPNDRFNKEVTKYEDAPESEWKNWNWRSEGDLMVNGAFFTP-SGAGASSSYAKAS  374

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSL+ S+T GAG+L C+KGK C
Sbjct  375  SLGARPSSLISSITAGAGSLNCRKGKPC  402



>ref|XP_002311747.2| pectate lyase 5 precursor family protein [Populus trichocarpa]
 gb|ABK94358.1| unknown [Populus trichocarpa]
 gb|EEE89114.2| pectate lyase 5 precursor family protein [Populus trichocarpa]
Length=402

 Score =   445 bits (1145),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 237/268 (88%), Positives = 252/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHG+NIHDC+QGGNA VRDSP HYGW
Sbjct  136  ELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGINIHDCKQGGNAYVRDSPGHYGW  195

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNY+THHNKVMLLGHS
Sbjct  196  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYLTHHNKVMLLGHS  255

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDY+HW+MYAIGGSADPTINSQ
Sbjct  256  DSYKQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYSHWKMYAIGGSADPTINSQ  315

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDRFNKEVTKHEDAP+S+WKGWNWRSEGDL+LNGAFFT    AGASSSYAKAS
Sbjct  316  GNRFLAPNDRFNKEVTKHEDAPQSEWKGWNWRSEGDLLLNGAFFTA-SGAGASSSYAKAS  374

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV S+T GAG+L CKKG  C
Sbjct  375  SLGARPSSLVSSITAGAGSLACKKGSRC  402



>gb|KDO82120.1| hypothetical protein CISIN_1g015702mg [Citrus sinensis]
Length=402

 Score =   445 bits (1144),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 235/268 (88%), Positives = 252/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHG+NIHDC++GGNANVRDSP HYGW
Sbjct  136  ELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGINIHDCKRGGNANVRDSPSHYGW  195

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHHNKVMLLGHS
Sbjct  196  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHNKVMLLGHS  255

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DT+ QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYA+GGSA PTINSQ
Sbjct  256  DTFTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYALGGSASPTINSQ  315

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+APNDRFNKEVTK+EDAPES+WK WNWRSEGDLM+NGAFFT    AGASSSYAKAS
Sbjct  316  GNRFVAPNDRFNKEVTKYEDAPESEWKNWNWRSEGDLMVNGAFFTP-SGAGASSSYAKAS  374

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSL+ S+T GAG+L C+KGK C
Sbjct  375  SLGARPSSLISSITAGAGSLNCRKGKPC  402



>ref|XP_006852264.1| hypothetical protein AMTR_s00049p00173370 [Amborella trichopoda]
 gb|ERN13731.1| hypothetical protein AMTR_s00049p00173370 [Amborella trichopoda]
Length=409

 Score =   445 bits (1144),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 234/268 (87%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNS+KTIDGRGASVHIA GPCIT+QYVTNIIIHG++IHDC+QGGNA VRDSP HYGW
Sbjct  143  ELIMNSYKTIDGRGASVHIANGPCITVQYVTNIIIHGIHIHDCKQGGNAMVRDSPNHYGW  202

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RTLSDGDGVSIFGGSH+WVDHC+LSNCRDGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  203  RTLSDGDGVSIFGGSHIWVDHCTLSNCRDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  262

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGLIQRMPRCR GYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  263  DSYAQDKNMQVTIAFNHFGEGLIQRMPRCRFGYFHVVNNDYTHWEMYAIGGSASPTINSQ  322

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+DRFNKEVTKHEDAPES+WK WNWRSEGDLMLNGAFFT    AGASSSY +AS
Sbjct  323  GNRFLAPDDRFNKEVTKHEDAPESEWKNWNWRSEGDLMLNGAFFTP-SGAGASSSYNRAS  381

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVG +T  AGAL CKKG  C
Sbjct  382  SLSARPSSLVGGITVSAGALNCKKGSRC  409



>ref|XP_006438176.1| hypothetical protein CICLE_v10031429mg [Citrus clementina]
 gb|ESR51416.1| hypothetical protein CICLE_v10031429mg [Citrus clementina]
Length=469

 Score =   447 bits (1150),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 236/268 (88%), Positives = 252/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG+NIHDC++GGNANVRDSP HYGW
Sbjct  203  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGINIHDCKRGGNANVRDSPSHYGW  262

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHHNKVMLLGHS
Sbjct  263  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHNKVMLLGHS  322

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DT+ QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYA+GGSA PTINSQ
Sbjct  323  DTFTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYALGGSASPTINSQ  382

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+APNDRFNKEVTK+EDAPES+WK WNWRSEGDLM+NGAFFT    AGASSSYAKAS
Sbjct  383  GNRFVAPNDRFNKEVTKYEDAPESEWKNWNWRSEGDLMVNGAFFTP-SGAGASSSYAKAS  441

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSL+ S+T GAG+L C+KGK C
Sbjct  442  SLGARPSSLISSITAGAGSLNCRKGKPC  469



>ref|XP_011072008.1| PREDICTED: probable pectate lyase 18 [Sesamum indicum]
Length=405

 Score =   445 bits (1144),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 235/268 (88%), Positives = 250/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIA GPCITIQYVTNIIIHG++IHDC+QGGNA VRDSP HYGW
Sbjct  139  ELIMNSFKTIDGRGASVHIANGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRDSPRHYGW  198

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  199  RTISDGDGVSIFGGSHVWVDHCSLSNCHDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  258

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDKGMQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  259  DSYTQDKGMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  318

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDRF+KEVTKHEDAPE++WK WNWRSEGDLMLNGA+FT    AGASSSYAKAS
Sbjct  319  GNRFLAPNDRFSKEVTKHEDAPETEWKNWNWRSEGDLMLNGAYFTP-SGAGASSSYAKAS  377

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV S+T G+GAL C+KG  C
Sbjct  378  SLGARPSSLVSSITSGSGALNCRKGSRC  405



>gb|KFK28033.1| hypothetical protein AALP_AA8G463100 [Arabis alpina]
Length=411

 Score =   444 bits (1143),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 224/269 (83%), Positives = 244/269 (91%), Gaps = 1/269 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHYG+
Sbjct  143  ELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYGY  202

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHS
Sbjct  203  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHS  262

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  263  DTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  322

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFF-TTsgsagasssyaka  173
            GNRFLAP+D  +KEVTKHEDAPE +W  WNWRSEGDL+LNGAFF  +      SSSY+KA
Sbjct  323  GNRFLAPDDSESKEVTKHEDAPEDEWSHWNWRSEGDLLLNGAFFRLSGAGPAKSSSYSKA  382

Query  172  sslsARPSSLVGSLTGGAGALPCKKGKSC  86
            SSL+ARPSS VG +T  +GAL CK+G  C
Sbjct  383  SSLAARPSSHVGEITVASGALSCKRGSHC  411



>emb|CDY56220.1| BnaAnng14170D [Brassica napus]
Length=406

 Score =   444 bits (1142),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 223/268 (83%), Positives = 240/268 (90%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIAGG CIT+QYVTNIIIHG++IHDC++ GNA VRDSP HYGW
Sbjct  140  ELIMNSFKTIDGRGANVHIAGGACITVQYVTNIIIHGISIHDCKKRGNAYVRDSPSHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT SDGD VSIFGGSHVWVDHCSLSNC DGLVD I GSTAITISNNY+THH+KVMLLGHS
Sbjct  200  RTASDGDAVSIFGGSHVWVDHCSLSNCADGLVDVIHGSTAITISNNYLTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTINSQ
Sbjct  260  DSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWKMYAIGGSAAPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPND+  KEVTK+EDAP+S+WK WNWRSEGDL LNGAFFT      ASS YAKAS
Sbjct  320  GNRFLAPNDKVFKEVTKYEDAPQSKWKNWNWRSEGDLFLNGAFFTP-SGGRASSKYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV S+TG AGAL CKKG  C
Sbjct  379  SLSARPSSLVASVTGNAGALSCKKGSRC  406



>ref|NP_001268051.1| pectate lyase precursor [Vitis vinifera]
 gb|AAF63756.1|AF243475_1 pectate lyase [Vitis vinifera]
Length=398

 Score =   444 bits (1141),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 245/268 (91%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVHIAGGPCITI Y +NIIIHGL+IHDC+QGGNAN+R+SP H GW
Sbjct  132  ELVMNSFKTIDGRGASVHIAGGPCITIHYASNIIIHGLHIHDCKQGGNANIRNSPHHSGW  191

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
             T+SDGDGVSIFGG H+WVDHCSLSNC DGL+DAI GSTAITISNN+MTHH+KVMLLGHS
Sbjct  192  WTVSDGDGVSIFGGRHIWVDHCSLSNCHDGLIDAIHGSTAITISNNFMTHHDKVMLLGHS  251

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ
Sbjct  252  DSYTEDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  311

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDRF K VTKHEDAPES+W+ WNWRSEGDLMLNGAFF     AGASSSYA+ S
Sbjct  312  GNRFLAPNDRFKKAVTKHEDAPESEWRHWNWRSEGDLMLNGAFFLQ-SGAGASSSYARRS  370

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVGS+T G+GAL C+KG  C
Sbjct  371  SLSARPSSLVGSITLGSGALGCRKGSRC  398



>ref|XP_009105097.1| PREDICTED: probable pectate lyase 5 [Brassica rapa]
 emb|CDY56520.1| BnaA07g38610D [Brassica napus]
Length=407

 Score =   444 bits (1142),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 226/268 (84%), Positives = 242/268 (90%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVHIAGG CIT+QYVTNIIIHG+NIHDC++ GNA VRDSP HYGW
Sbjct  141  ELMMNSFKTIDGRGASVHIAGGACITVQYVTNIIIHGVNIHDCKKRGNAYVRDSPSHYGW  200

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT SDGD VSIFGGSHVWVDHCSLSNC DGLVDAIRGSTAITISNNY+THHNKVMLLGHS
Sbjct  201  RTASDGDAVSIFGGSHVWVDHCSLSNCDDGLVDAIRGSTAITISNNYLTHHNKVMLLGHS  260

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTINSQ
Sbjct  261  DSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTINSQ  320

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPND   KEVTK+EDAP+S+WK WNWRSEGDL LNGAFFT      ASSSYAKAS
Sbjct  321  GNRFLAPNDHVFKEVTKYEDAPQSKWKNWNWRSEGDLFLNGAFFTP-SGGRASSSYAKAS  379

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV S+TG AG+L C+KG  C
Sbjct  380  SLSARPSSLVASVTGNAGSLSCRKGSRC  407



>emb|CDP15081.1| unnamed protein product [Coffea canephora]
Length=408

 Score =   444 bits (1141),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 237/268 (88%), Positives = 250/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG+NIHDC+QGGNANVR SP HYGW
Sbjct  142  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGINIHDCKQGGNANVRSSPSHYGW  201

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAI+GSTAITISNN+ THH+KVMLLG S
Sbjct  202  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIQGSTAITISNNFFTHHDKVMLLGAS  261

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  262  DTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQ  321

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+DRFNKEVTK+EDAPES+WK WNWRSEGDLMLNGAFF T   A ASSSYA+AS
Sbjct  322  GNRFLAPDDRFNKEVTKYEDAPESEWKSWNWRSEGDLMLNGAFF-TQAGASASSSYARAS  380

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPS+LV +LT GAG L C+KG SC
Sbjct  381  SLSARPSTLVSALTSGAGVLGCRKGSSC  408



>gb|KJB50293.1| hypothetical protein B456_008G162500 [Gossypium raimondii]
Length=414

 Score =   444 bits (1142),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 227/274 (83%), Positives = 245/274 (89%), Gaps = 7/274 (3%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL++NSFKTIDGRGA+VHIAGGPCITIQYV+N+IIHG++IHDC++GGNA VRDSP HYGW
Sbjct  142  ELLVNSFKTIDGRGANVHIAGGPCITIQYVSNVIIHGISIHDCKRGGNAYVRDSPSHYGW  201

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGD VSIFGGSHVWVDHCSLSNC DGLVDAI+GSTAITISNNYMTHHNKVMLLGHS
Sbjct  202  RTISDGDAVSIFGGSHVWVDHCSLSNCTDGLVDAIQGSTAITISNNYMTHHNKVMLLGHS  261

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMP------RCRHGYFHVVNNDYTHWEMYAIGGSAD  368
            D+Y QDK  QVTIAFN+FGEGL+QRMP      RCRHGYFHVVNNDYTHWEMYAIGGSAD
Sbjct  262  DSYKQDKNTQVTIAFNYFGEGLVQRMPSFQLVYRCRHGYFHVVNNDYTHWEMYAIGGSAD  321

Query  367  PTINSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagass  188
            PTINSQGNRF APN+  +KEVTKHEDAP+S+WK WNWRSEGDLMLNGAFFT     G SS
Sbjct  322  PTINSQGNRFAAPNNVNSKEVTKHEDAPQSKWKEWNWRSEGDLMLNGAFFTA-SGKGTSS  380

Query  187  syakasslsARPSSLVGSLTGGAGALPCKKGKSC  86
            SYAKASSL ARPSSLV SLT GAGAL CKKG  C
Sbjct  381  SYAKASSLGARPSSLVNSLTAGAGALVCKKGSRC  414



>gb|KJB08081.1| hypothetical protein B456_001G062400 [Gossypium raimondii]
Length=401

 Score =   443 bits (1140),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 228/268 (85%), Positives = 246/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHI GGPCITIQ+VTNIIIHGL+IHDC+QGGNA VRDSP HYGW
Sbjct  135  ELIMNSFKTIDGRGASVHITGGPCITIQFVTNIIIHGLHIHDCKQGGNAMVRDSPRHYGW  194

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT SDGDGVSIFGGSH+WVDH SLSNC+DGL+DAI GSTAITISNN+MTHH+KVMLLGHS
Sbjct  195  RTTSDGDGVSIFGGSHIWVDHNSLSNCKDGLIDAIYGSTAITISNNHMTHHDKVMLLGHS  254

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFG+GLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  255  DSYMKDKNMQVTIAFNHFGKGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  314

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF APND F+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF T   AGASSSYAKAS
Sbjct  315  GNRFTAPNDIFSKEVTKHEDAPESEWKNWNWRSEGDLMVNGAFF-TRSGAGASSSYAKAS  373

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSS V ++T  AGAL CKKG  C
Sbjct  374  SLGARPSSHVATITTNAGALNCKKGSRC  401



>gb|AFK32131.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32132.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32133.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32134.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32135.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32136.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32137.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32138.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32139.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32140.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32141.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32142.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32143.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32144.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32145.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32146.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32147.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32148.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32149.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32150.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32151.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32152.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32153.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32154.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32155.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32156.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32157.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32158.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32159.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32160.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32161.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32162.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32163.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32164.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32165.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32166.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32167.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32168.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32169.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32170.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32171.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32172.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32173.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32174.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32175.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32176.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32177.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32178.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32179.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32180.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32181.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32182.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32183.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32184.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32185.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32186.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32187.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32188.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32189.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32190.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32191.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32192.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32193.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32194.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32195.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32196.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32197.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32198.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32199.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32200.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32201.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32202.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32203.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32204.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32205.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32206.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32207.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32208.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32209.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32210.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32211.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32212.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32213.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32214.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32215.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32216.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32217.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32218.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32219.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32220.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32221.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32222.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32223.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32224.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32225.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32226.1| pectate lyase, partial [Vitis vinifera]
Length=351

 Score =   441 bits (1134),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 224/268 (84%), Positives = 244/268 (91%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVHIAGGPCITI Y +NIIIHGL+IHDC+QGGNAN+R+SP H GW
Sbjct  85   ELVMNSFKTIDGRGASVHIAGGPCITIHYASNIIIHGLHIHDCKQGGNANIRNSPHHSGW  144

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
             T+SDGDGVSIF G H+WVDHCSLSNC DGL+DAI GSTAITISNN+MTHH+KVMLLGHS
Sbjct  145  WTVSDGDGVSIFXGRHIWVDHCSLSNCHDGLIDAIHGSTAITISNNFMTHHDKVMLLGHS  204

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ
Sbjct  205  DSYTEDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  264

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDRF K VTKHEDAPES+W+ WNWRSEGDLMLNGAFF      GASSSYA+AS
Sbjct  265  GNRFLAPNDRFKKAVTKHEDAPESEWRHWNWRSEGDLMLNGAFFLQ-SXXGASSSYARAS  323

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVGS+T G+GAL C+KG  C
Sbjct  324  SLSARPSSLVGSITLGSGALXCRKGSRC  351



>gb|KDO69408.1| hypothetical protein CISIN_1g015569mg [Citrus sinensis]
Length=402

 Score =   442 bits (1138),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 227/268 (85%), Positives = 246/268 (92%), Gaps = 3/268 (1%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC++GGNA VRDSP H+GW
Sbjct  138  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKKGGNAMVRDSPRHFGW  197

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGG+H+WVDHCSLSNC DGLVDAI GSTAITISNN+MTHH+KVMLLGHS
Sbjct  198  RTVSDGDGVSIFGGTHIWVDHCSLSNCDDGLVDAIHGSTAITISNNFMTHHDKVMLLGHS  257

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQVTIAFNHFGEGL+QR+P  RHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  258  DTYTQDKNMQVTIAFNHFGEGLVQRIP--RHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  315

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP+  F+KEVTKHEDAPES+W+ WNWRSEGDLM+NGAFFT    AGASSSYA+AS
Sbjct  316  GNRFAAPDRAFSKEVTKHEDAPESEWRNWNWRSEGDLMVNGAFFTA-SGAGASSSYARAS  374

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPS+LVG +TG AGAL CKKG  C
Sbjct  375  SLGARPSALVGPITGSAGALICKKGARC  402



>ref|XP_006351443.1| PREDICTED: probable pectate lyase 18-like [Solanum tuberosum]
Length=403

 Score =   442 bits (1137),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 233/268 (87%), Positives = 250/268 (93%), Gaps = 0/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP HYGW
Sbjct  136  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPSHYGW  195

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  196  RTISDGDGVSIFGGSHVWVDHCSLSNCMDGLIDAIMGSTAITISNNYMTHHDKVMLLGHS  255

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ
Sbjct  256  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  315

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+ RF+KEVTKHEDAPES+WK WNWR++GDLMLNGAFFT SG+  +SSSYAKAS
Sbjct  316  GNRFLAPDIRFSKEVTKHEDAPESEWKNWNWRTDGDLMLNGAFFTRSGAGASSSSYAKAS  375

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVG+L   +GAL CKKG  C
Sbjct  376  SLSARPSSLVGNLVSSSGALNCKKGSRC  403



>ref|XP_006302330.1| hypothetical protein CARUB_v10020387mg [Capsella rubella]
 gb|EOA35228.1| hypothetical protein CARUB_v10020387mg [Capsella rubella]
Length=409

 Score =   442 bits (1137),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 240/268 (90%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRG +VHIAGG CIT+QYVTN+IIHG+NIHDC++ GNA VRDSP HYGW
Sbjct  143  ELIMNSFKTIDGRGVNVHIAGGACITVQYVTNVIIHGINIHDCKRKGNAYVRDSPSHYGW  202

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT SDGD VSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHHNKVMLLGHS
Sbjct  203  RTASDGDAVSIFGGSHVWVDHCSLSNCADGLIDAIHGSTAITISNNYMTHHNKVMLLGHS  262

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTINSQ
Sbjct  263  DSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTINSQ  322

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPND   KEVTK+EDAP+S+WK WNWRSEGDL LNGAFFT      ASSSYAKAS
Sbjct  323  GNRFLAPNDHVFKEVTKYEDAPQSKWKKWNWRSEGDLFLNGAFFTA-SGGRASSSYAKAS  381

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV S+TG AGAL CKKG  C
Sbjct  382  SLSARPSSLVASVTGSAGALFCKKGSRC  409



>ref|XP_010531484.1| PREDICTED: probable pectate lyase 5 [Tarenaya hassleriana]
Length=404

 Score =   442 bits (1137),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 221/268 (82%), Positives = 241/268 (90%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRG+SVHIAGG C+TIQYVTNIIIHG+N+HDC++ GN  VRDSP HYGW
Sbjct  138  ELIMNSFKTIDGRGSSVHIAGGACVTIQYVTNIIIHGINVHDCKRAGNTYVRDSPSHYGW  197

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT SDGD +SIFGGSHVWVDHCSLSNC+DGL+DAI GSTAITISNNYMTHHNKVMLLGHS
Sbjct  198  RTASDGDAISIFGGSHVWVDHCSLSNCQDGLIDAIHGSTAITISNNYMTHHNKVMLLGHS  257

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTINSQ
Sbjct  258  DSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTINSQ  317

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDR  KEVTK+EDAP+S+WK WNWRSEGD+ LNGAFFT      ASSSYAKAS
Sbjct  318  GNRFLAPNDRVFKEVTKYEDAPQSEWKKWNWRSEGDMFLNGAFFTA-SGKAASSSYAKAS  376

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL+ARPS+LV S+T  AGAL CKKG  C
Sbjct  377  SLAARPSTLVASVTANAGALVCKKGSRC  404



>dbj|BAF43572.1| pectate lyase [Prunus persica]
Length=413

 Score =   442 bits (1137),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 245/268 (91%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPC    +VTNIIIHGL+IHDC+ GGNA VR SPEHYGW
Sbjct  147  ELIMNSFKTIDGRGASVHIAGGPCNHRPFVTNIIIHGLHIHDCKPGGNAMVRSSPEHYGW  206

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC+DGLVDAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  207  RTISDGDGVSIFGGSHVWVDHCSLSNCKDGLVDAIHGSTAITISNNYMTHHDKVMLLGHS  266

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  267  DSYTEDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  326

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF AP+ RF+KEVTKHEDAPES+W+ WNWRSEGDLM+NGAFFT    AGASSSYA+AS
Sbjct  327  GNRFAAPDIRFSKEVTKHEDAPESEWRNWNWRSEGDLMINGAFFTA-SGAGASSSYARAS  385

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+PSSLVGS+T  +GAL C+KG  C
Sbjct  386  SLGAKPSSLVGSITTASGALSCRKGSRC  413



>ref|XP_009105327.1| PREDICTED: probable pectate lyase 5 [Brassica rapa]
Length=406

 Score =   442 bits (1136),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 222/268 (83%), Positives = 239/268 (89%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIAGG CIT+QYVTNIIIHG++IHDC++ GNA VRDSP HYGW
Sbjct  140  ELIMNSFKTIDGRGANVHIAGGACITVQYVTNIIIHGVSIHDCKKRGNAYVRDSPSHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT SDGD VSIFGGSHVWVDHCSLSNC DGLVD I GSTAITISNNY+THH+KVMLLGHS
Sbjct  200  RTASDGDAVSIFGGSHVWVDHCSLSNCADGLVDVIHGSTAITISNNYLTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHF EGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTINSQ
Sbjct  260  DSYTRDKNMQVTIAFNHFDEGLVQRMPRCRHGYFHVVNNDYTHWKMYAIGGSAAPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPND+  KEVTK+EDAP+S+WK WNWRSEGDL LNGAFFT      ASS YAKAS
Sbjct  320  GNRFLAPNDKVFKEVTKYEDAPQSKWKNWNWRSEGDLFLNGAFFTP-SGGRASSKYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV S+TG AGAL CKKG  C
Sbjct  379  SLSARPSSLVASVTGNAGALSCKKGSRC  406



>gb|KDP26717.1| hypothetical protein JCGZ_17875 [Jatropha curcas]
Length=407

 Score =   441 bits (1134),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 235/268 (88%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHG+NIHDC+ GGNA VRDSP HYGW
Sbjct  141  ELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGINIHDCKSGGNAYVRDSPNHYGW  200

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSL+NC DGL+DAI GSTAITISNNYMTHHNKVMLLGHS
Sbjct  201  RTISDGDGVSIFGGSHVWVDHCSLANCNDGLIDAIHGSTAITISNNYMTHHNKVMLLGHS  260

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDY+HWEMYAIGGSA PTINSQ
Sbjct  261  DSYTQDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYSHWEMYAIGGSASPTINSQ  320

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDRFNKEVTKHEDAPES+WK WNWRSEGD +LNGAFFT    AGASSSYAKAS
Sbjct  321  GNRFLAPNDRFNKEVTKHEDAPESEWKNWNWRSEGDSLLNGAFFTP-SGAGASSSYAKAS  379

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV S+T GAGAL CKKG  C
Sbjct  380  SLGARPSSLVTSITAGAGALACKKGSRC  407



>ref|XP_002887143.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63402.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=408

 Score =   441 bits (1134),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 228/268 (85%), Positives = 241/268 (90%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGG CITIQYVTNIIIHGLNIHDC++ GNA VRDSP HYGW
Sbjct  142  ELIMNSFKTIDGRGASVHIAGGACITIQYVTNIIIHGLNIHDCKRKGNAYVRDSPSHYGW  201

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT SDGD VSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNY+THHNKVMLLGHS
Sbjct  202  RTASDGDAVSIFGGSHVWVDHCSLSNCDDGLIDAIHGSTAITISNNYLTHHNKVMLLGHS  261

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTINSQ
Sbjct  262  DSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTINSQ  321

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPND   KEVTK+EDAP+S+WK WNWRSEGDL LNGAFFT     GASSSYAKAS
Sbjct  322  GNRFLAPNDHVFKEVTKYEDAPQSKWKKWNWRSEGDLFLNGAFFTP-SGGGASSSYAKAS  380

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV S+T  AGAL C+KG  C
Sbjct  381  SLSARPSSLVASVTSNAGALFCRKGSRC  408



>ref|XP_009762540.1| PREDICTED: probable pectate lyase 18 [Nicotiana sylvestris]
Length=407

 Score =   440 bits (1131),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 230/268 (86%), Positives = 250/268 (93%), Gaps = 0/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP HYGW
Sbjct  140  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPSHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC+DGL+DAI GSTAITISNN+MTHH+KVMLLGHS
Sbjct  200  RTISDGDGVSIFGGSHVWVDHCSLSNCKDGLIDAIMGSTAITISNNFMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y+QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  260  DSYVQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+ RF+KEVTKHEDAPES+WK WNWR+EGDLMLNGA+FT SG+   SSSYAKAS
Sbjct  320  GNRFLAPDIRFSKEVTKHEDAPESEWKNWNWRTEGDLMLNGAYFTQSGAGAKSSSYAKAS  379

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV +L  G+GAL C+KG  C
Sbjct  380  SLSARPSSLVSNLVSGSGALNCRKGSRC  407



>gb|KJB30976.1| hypothetical protein B456_005G174600 [Gossypium raimondii]
Length=406

 Score =   439 bits (1130),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 236/268 (88%), Positives = 247/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRG SVHI+GGPCIT+QYVTNIIIHG+NIHDC++GGNA VRDSP HYGW
Sbjct  140  ELLMNSFKTIDGRGVSVHISGGPCITVQYVTNIIIHGINIHDCKRGGNAYVRDSPTHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNY+THHNKVMLLGHS
Sbjct  200  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYLTHHNKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ
Sbjct  260  DTYKQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPND  NKEVTKHEDAP+SQWK WNWRSEGDLMLNGAFFT     GASSSYAKAS
Sbjct  320  GNRFLAPNDADNKEVTKHEDAPQSQWKHWNWRSEGDLMLNGAFFTA-SGTGASSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV SLT GAGAL CKKG  C
Sbjct  379  SLGARPSSLVSSLTAGAGALVCKKGSHC  406



>emb|CDY01846.1| BnaC06g28860D [Brassica napus]
Length=406

 Score =   439 bits (1130),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 221/268 (82%), Positives = 238/268 (89%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+ HIAGG CIT+QYVTNIIIHG++IHDC++ GNA VRDSP HYGW
Sbjct  140  ELIMNSFKTIDGRGANAHIAGGACITVQYVTNIIIHGISIHDCKKRGNAYVRDSPSHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT SDGD VSIFGGSHVWVDHCSLSNC DGLVD I GSTAITISNNY+THH+KVMLLGHS
Sbjct  200  RTASDGDAVSIFGGSHVWVDHCSLSNCEDGLVDVIHGSTAITISNNYLTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW MYAIGGSA PTINSQ
Sbjct  260  DSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWGMYAIGGSAAPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPN++  KEVTK+EDAP+S+WK WNWRSEGDL LNGAFFT      ASS YAKAS
Sbjct  320  GNRFLAPNNKVFKEVTKYEDAPQSKWKNWNWRSEGDLFLNGAFFTP-SGGRASSMYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV S+TG AGAL CKKG  C
Sbjct  379  SLSARPSSLVASVTGNAGALSCKKGSRC  406



>emb|CDY08948.1| BnaC08g11780D [Brassica napus]
Length=406

 Score =   439 bits (1128),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 228/268 (85%), Positives = 244/268 (91%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG++IHDC+ GGNA VR SP HYGW
Sbjct  140  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGIHIHDCKPGGNAMVRSSPRHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAIT+SNNYMTHH+KVMLLGHS
Sbjct  200  RTISDGDGVSIFGGSHVWVDHCSLSNCEDGLIDAIMGSTAITLSNNYMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY +DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ
Sbjct  260  DTYTRDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+ RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT       SSSYAKAS
Sbjct  320  GNRFLAPDIRFSKEVTKHEDAPESEWKSWNWRSSGDLLLNGAFFTP-SGGATSSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLVG LT G+GAL C+KG  C
Sbjct  379  SLGARPSSLVGPLTVGSGALNCRKGSRC  406



>ref|NP_564906.1| putative pectate lyase 5 [Arabidopsis thaliana]
 sp|Q9FXD8.2|PLY5_ARATH RecName: Full=Probable pectate lyase 5; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL58893.1|AF462797_1 At1g67750/F12A21_12 [Arabidopsis thaliana]
 gb|AAM26656.1| At1g67750/F12A21_12 [Arabidopsis thaliana]
 gb|AEE34690.1| putative pectate lyase 5 [Arabidopsis thaliana]
Length=408

 Score =   438 bits (1126),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 240/268 (90%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGG CIT+QYVTNIIIHG+NIHDC++ GNA VRDSP HYGW
Sbjct  142  ELIMNSFKTIDGRGASVHIAGGACITVQYVTNIIIHGVNIHDCKRKGNAYVRDSPSHYGW  201

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT SDGD VSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNY++HHNKVMLLGHS
Sbjct  202  RTASDGDAVSIFGGSHVWVDHCSLSNCADGLIDAIHGSTAITISNNYLSHHNKVMLLGHS  261

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTINSQ
Sbjct  262  DSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTINSQ  321

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPND   KEVTK+EDAP S+WK WNWRSEGDL LNGAFFT     GASSSYAKAS
Sbjct  322  GNRFLAPNDHVFKEVTKYEDAPRSKWKKWNWRSEGDLFLNGAFFTP-SGGGASSSYAKAS  380

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV S+T  AGAL C+KG  C
Sbjct  381  SLSARPSSLVASVTSNAGALFCRKGSRC  408



>gb|AAG28907.1|AC008113_23 F12A21.12 [Arabidopsis thaliana]
Length=392

 Score =   437 bits (1124),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 240/268 (90%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGG CIT+QYVTNIIIHG+NIHDC++ GNA VRDSP HYGW
Sbjct  126  ELIMNSFKTIDGRGASVHIAGGACITVQYVTNIIIHGVNIHDCKRKGNAYVRDSPSHYGW  185

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT SDGD VSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNY++HHNKVMLLGHS
Sbjct  186  RTASDGDAVSIFGGSHVWVDHCSLSNCADGLIDAIHGSTAITISNNYLSHHNKVMLLGHS  245

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTINSQ
Sbjct  246  DSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTINSQ  305

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPND   KEVTK+EDAP S+WK WNWRSEGDL LNGAFFT     GASSSYAKAS
Sbjct  306  GNRFLAPNDHVFKEVTKYEDAPRSKWKKWNWRSEGDLFLNGAFFTP-SGGGASSSYAKAS  364

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV S+T  AGAL C+KG  C
Sbjct  365  SLSARPSSLVASVTSNAGALFCRKGSRC  392



>gb|AAM67091.1| putative pectate lyase [Arabidopsis thaliana]
Length=406

 Score =   436 bits (1122),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 224/268 (84%), Positives = 239/268 (89%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGG CIT+QYVTNIIIHG+NIHDC++ GNA VRDSP HYGW
Sbjct  140  ELIMNSFKTIDGRGASVHIAGGACITVQYVTNIIIHGVNIHDCKRKGNAYVRDSPSHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT SDGD VSIFGGSHVWVDHCSLSNC DGL+DAI  STAITISNNY++HHNKVMLLGHS
Sbjct  200  RTASDGDAVSIFGGSHVWVDHCSLSNCADGLIDAIHASTAITISNNYLSHHNKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTINSQ
Sbjct  260  DSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPND   KEVTK+EDAP S+WK WNWRSEGDL LNGAFFT     GASSSYAKAS
Sbjct  320  GNRFLAPNDHVFKEVTKYEDAPRSKWKKWNWRSEGDLFLNGAFFTP-SGGGASSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV S+T  AGAL C+KG  C
Sbjct  379  SLSARPSSLVASVTSNAGALFCRKGSRC  406



>emb|CDY24847.1| BnaA08g14630D [Brassica napus]
Length=406

 Score =   436 bits (1121),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 227/268 (85%), Positives = 244/268 (91%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG++IHDC+ GGNA VR SP HYGW
Sbjct  140  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGIHIHDCKPGGNAMVRSSPRHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAIT+SNNYMTHH+KVMLLGHS
Sbjct  200  RTISDGDGVSIFGGSHVWVDHCSLSNCEDGLIDAIIGSTAITLSNNYMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY +DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  260  DTYTRDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+ RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT       SSSYAKAS
Sbjct  320  GNRFLAPDIRFSKEVTKHEDAPESEWKSWNWRSSGDLLLNGAFFTP-SGGATSSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLVG LT G+GAL C+KG  C
Sbjct  379  SLGARPSSLVGPLTVGSGALNCRKGSRC  406



>gb|KFK41187.1| hypothetical protein AALP_AA2G097000 [Arabis alpina]
Length=406

 Score =   436 bits (1121),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 224/268 (84%), Positives = 239/268 (89%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRG SVHIAGG CIT+QYVTNIIIHG++IHDC++ GNA VRDSP HYGW
Sbjct  140  ELIMNSFKTIDGRGTSVHIAGGACITVQYVTNIIIHGISIHDCKRKGNAYVRDSPSHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT SDGD VSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNY+THHNKVMLLGHS
Sbjct  200  RTASDGDAVSIFGGSHVWVDHCSLSNCADGLIDAIHGSTAITISNNYLTHHNKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW MYAIGGSA PTINSQ
Sbjct  260  DSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWHMYAIGGSAAPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDR  KEVTK+ED P+S+WK WNWRSEGDL LNGAFFT     GASSSYAKAS
Sbjct  320  GNRFLAPNDRVFKEVTKYEDTPQSKWKHWNWRSEGDLFLNGAFFTP-SGGGASSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV S+T  AGAL C+KG  C
Sbjct  379  SLSARPSSLVASVTSNAGALVCRKGSRC  406



>ref|XP_002515037.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF47591.1| Pectate lyase precursor, putative [Ricinus communis]
Length=404

 Score =   436 bits (1120),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 231/268 (86%), Positives = 249/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHG+NIHDC++GGNA VRDSP HYGW
Sbjct  138  ELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGINIHDCKRGGNAYVRDSPSHYGW  197

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGS+VWVDHCSLSNC DGL+DAI GSTAITISNNYMTHHNKVMLLGHS
Sbjct  198  RTISDGDGVSIFGGSYVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHNKVMLLGHS  257

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D++ QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  258  DSFTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  317

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDRFNKEVTKHEDA +++WK WNWRSEGDL+LNGAFFT     GASSSYA+AS
Sbjct  318  GNRFLAPNDRFNKEVTKHEDAAQNEWKHWNWRSEGDLLLNGAFFTA-SGFGASSSYARAS  376

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV S+T GAG+L CKKG  C
Sbjct  377  SLGARPSSLVSSITAGAGSLVCKKGSRC  404



>ref|XP_007044917.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY00749.1| Pectate lyase family protein [Theobroma cacao]
Length=406

 Score =   436 bits (1120),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 232/268 (87%), Positives = 250/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGA+VHIAGGPCITIQYVTNIIIHG+NIHDC++GGNA VRDSP HYGW
Sbjct  140  ELLMNSFKTIDGRGANVHIAGGPCITIQYVTNIIIHGINIHDCKRGGNAYVRDSPSHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISN+Y+THHNKVMLLGHS
Sbjct  200  RTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNSYLTHHNKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA+PTINSQ
Sbjct  260  DSYKQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWDMYAIGGSANPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPN+ +NKEVTKHEDAP+SQWK WNWRSEGDLMLNGAFFT     GASSSYAKAS
Sbjct  320  GNRFLAPNNEYNKEVTKHEDAPQSQWKHWNWRSEGDLMLNGAFFTP-SGTGASSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLVGSLT GAG+L CK+G  C
Sbjct  379  SLGARPSSLVGSLTAGAGSLVCKEGSRC  406



>gb|AAF19195.1|AF206319_1 pectate lyase 1 [Musa acuminata AAA Group]
Length=407

 Score =   435 bits (1119),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 239/268 (89%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNS KTIDGRGASVHI+GGPCITIQYVTNIIIHG++IHDC+QGGNA VRDSP HYGW
Sbjct  141  ELIMNSHKTIDGRGASVHISGGPCITIQYVTNIIIHGVHIHDCKQGGNAYVRDSPGHYGW  200

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHC+LSNC DGL+DAI GSTAITISNNY++HH+KVMLLGHS
Sbjct  201  RTVSDGDGVSIFGGSHVWVDHCTLSNCHDGLIDAIHGSTAITISNNYLSHHDKVMLLGHS  260

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D    DK MQVTIAFNHFGE L+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  261  DELTSDKSMQVTIAFNHFGEDLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQ  320

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDRF KEVTK EDA ES+WK WNWRSEGD MLNGAFFT    AGASSSYAKAS
Sbjct  321  GNRFLAPNDRFAKEVTKREDAQESEWKKWNWRSEGDQMLNGAFFTP-SGAGASSSYAKAS  379

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL AR SSLVG++T  AG L CKKG  C
Sbjct  380  SLGARSSSLVGTITVSAGVLSCKKGSRC  407



>ref|XP_009109237.1| PREDICTED: probable pectate lyase 18 [Brassica rapa]
Length=406

 Score =   435 bits (1119),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 226/268 (84%), Positives = 244/268 (91%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVH+AGGPCITIQYVTNIIIHG++IHDC+ GGNA VR SP HYGW
Sbjct  140  ELIMNSFKTIDGRGASVHMAGGPCITIQYVTNIIIHGIHIHDCKPGGNAMVRSSPRHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAIT+SNNYMTHH+KVMLLGHS
Sbjct  200  RTISDGDGVSIFGGSHVWVDHCSLSNCEDGLIDAIIGSTAITLSNNYMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY +DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  260  DTYTRDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+ RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT       SSSYAKAS
Sbjct  320  GNRFLAPDIRFSKEVTKHEDAPESEWKSWNWRSSGDLLLNGAFFTP-SGGATSSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLVG LT G+GAL C+KG  C
Sbjct  379  SLGARPSSLVGPLTVGSGALNCRKGSRC  406



>ref|XP_009406385.1| PREDICTED: probable pectate lyase 18 [Musa acuminata subsp. malaccensis]
Length=407

 Score =   435 bits (1119),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 239/268 (89%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNS KTIDGRGASVHI+GGPCITIQYVTNIIIHG++IHDC+QGGNA VRDSP HYGW
Sbjct  141  ELIMNSHKTIDGRGASVHISGGPCITIQYVTNIIIHGVHIHDCKQGGNAYVRDSPGHYGW  200

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHC+LSNC DGL+DAI GSTAITISNNY++HH+KVMLLGHS
Sbjct  201  RTVSDGDGVSIFGGSHVWVDHCTLSNCHDGLIDAIHGSTAITISNNYLSHHDKVMLLGHS  260

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D    DK MQVTIAFNHFGE L+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  261  DELTSDKSMQVTIAFNHFGEDLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQ  320

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDRF KEVTK EDA ES+WK WNWRSEGD MLNGAFFT    AGASSSYAKAS
Sbjct  321  GNRFLAPNDRFAKEVTKREDAQESEWKKWNWRSEGDQMLNGAFFTP-SGAGASSSYAKAS  379

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL AR SSLVG++T  AG L CKKG  C
Sbjct  380  SLGARSSSLVGTITVSAGVLSCKKGSRC  407



>gb|KFK29019.1| hypothetical protein AALP_AA7G078200 [Arabis alpina]
Length=407

 Score =   433 bits (1114),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 226/268 (84%), Positives = 245/268 (91%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP HYGW
Sbjct  141  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPRHYGW  200

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLS+C DGL+DAI GSTAIT+SNN+MTHH+KVMLLGHS
Sbjct  201  RTVSDGDGVSIFGGSHVWVDHCSLSSCADGLIDAIMGSTAITLSNNFMTHHDKVMLLGHS  260

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ
Sbjct  261  DTYGRDKIMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  320

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+APN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT      +SS+YAKAS
Sbjct  321  GNRFVAPNIRFSKEVTKHEDAPESEWKNWNWRSSGDLLLNGAFFTP-SGGASSSTYAKAS  379

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLVG LT  +GAL C+KG  C
Sbjct  380  SLGARPSSLVGPLTLSSGALNCRKGSRC  407



>ref|XP_009138507.1| PREDICTED: probable pectate lyase 18 [Brassica rapa]
Length=406

 Score =   432 bits (1110),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 226/268 (84%), Positives = 245/268 (91%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG++IHDC+ GGNA VR SP H+GW
Sbjct  140  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGIHIHDCKPGGNAMVRSSPRHFGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAIT+SNNYMTHH+KVMLLGHS
Sbjct  200  RTISDGDGVSIFGGSHVWVDHCSLSNCDDGLIDAIMGSTAITLSNNYMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY +DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  260  DTYTRDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+APN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT      +SSSYAKAS
Sbjct  320  GNRFVAPNIRFSKEVTKHEDAPESEWKSWNWRSSGDLLLNGAFFTP-SGGASSSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLVG LT G+GAL C+KG  C
Sbjct  379  SLGARPSSLVGPLTLGSGALNCRKGSRC  406



>ref|XP_009788173.1| PREDICTED: probable pectate lyase 18 [Nicotiana sylvestris]
Length=406

 Score =   431 bits (1109),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 249/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG++IHDC+QGGN  VR SP+HYGW
Sbjct  140  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGIHIHDCKQGGNTMVRSSPQHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSH+WVDHCSLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  200  RTISDGDGVSIFGGSHIWVDHCSLSNCKDGLIDAIMGSTAITISNNYMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+++QDK MQVT+AFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  260  DSHVQDKNMQVTVAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+ RF+KEVTKHEDAPES+WK WNWR++GDLMLNGA+F     A ASSSYAKAS
Sbjct  320  GNRFLAPDIRFSKEVTKHEDAPESEWKKWNWRTDGDLMLNGAYF-IQSGAAASSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSA+PSSLV S+  GAGAL C+KG  C
Sbjct  379  SLSAKPSSLVTSIVSGAGALTCRKGSRC  406



>ref|XP_003638513.1| Pectate lyase [Medicago truncatula]
 gb|KEH35001.1| pectate lyase family protein [Medicago truncatula]
Length=406

 Score =   431 bits (1109),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 229/268 (85%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG++IHDC+QGGNA VRDSP H+GW
Sbjct  140  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRDSPRHFGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  200  RTISDGDGVSIFGGSHVWVDHCSLSNCEDGLIDAIYGSTAITISNNYMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y  DK MQVTIAFNHFGEGL+QRMPRCR GYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  260  DSYTHDKNMQVTIAFNHFGEGLVQRMPRCRLGYFHVVNNDYTHWEMYAIGGSANPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+APN+RF+KEVTK+EDA ES+WK WNWRSEGDLM+NGAFFT     GASSSYA+AS
Sbjct  320  GNRFVAPNNRFSKEVTKYEDAAESEWKHWNWRSEGDLMVNGAFFTK-SGGGASSSYARAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSS+VGS+T GAG L CKKG  C
Sbjct  379  SLSARPSSIVGSITIGAGTLNCKKGSPC  406



>ref|XP_006283843.1| hypothetical protein CARUB_v10004942mg [Capsella rubella]
 gb|EOA16741.1| hypothetical protein CARUB_v10004942mg [Capsella rubella]
Length=409

 Score =   431 bits (1109),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 226/268 (84%), Positives = 246/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHI+GGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP H+GW
Sbjct  143  ELIMNSFKTIDGRGASVHISGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPRHFGW  202

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAIT+SNN+MTHH+KVMLLGHS
Sbjct  203  RTISDGDGVSIFGGSHVWVDHCSLSNCEDGLIDAIMGSTAITLSNNHMTHHDKVMLLGHS  262

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY +DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  263  DTYTRDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  322

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT      ASSSYAKAS
Sbjct  323  GNRFLAPNIRFSKEVTKHEDAPESEWKRWNWRSSGDLLLNGAFFTP-SGGAASSSYAKAS  381

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+PSSLVG LT G+GAL C+KG  C
Sbjct  382  SLGAKPSSLVGPLTSGSGALNCRKGSRC  409



>ref|XP_002314576.1| pectate lyase 5 precursor family protein [Populus trichocarpa]
 gb|EEF00747.1| pectate lyase 5 precursor family protein [Populus trichocarpa]
Length=402

 Score =   430 bits (1106),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 233/268 (87%), Positives = 246/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIAGGPCITIQYVTNIIIHG+NIHDC+QGGNA VRDSP HYGW
Sbjct  136  ELIMNSFKTIDGRGANVHIAGGPCITIQYVTNIIIHGINIHDCKQGGNAYVRDSPSHYGW  195

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGS VWVDHCSLSNC DGL+DAI GSTAITISN+Y T HNKVMLLGHS
Sbjct  196  RTISDGDGVSIFGGSQVWVDHCSLSNCNDGLIDAIHGSTAITISNSYFTRHNKVMLLGHS  255

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTINSQ
Sbjct  256  DSYKQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWKMYAIGGSAAPTINSQ  315

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDRF KEVTKHE AP+SQWK WNWRS+GDLMLNGAFFT    AGASSSYA+AS
Sbjct  316  GNRFLAPNDRFKKEVTKHEAAPQSQWKRWNWRSDGDLMLNGAFFTP-SGAGASSSYARAS  374

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV S+T GAGAL CKKG  C
Sbjct  375  SLSARPSSLVSSITAGAGALVCKKGSRC  402



>ref|XP_002526952.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF35439.1| Pectate lyase precursor, putative [Ricinus communis]
Length=396

 Score =   430 bits (1106),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 216/268 (81%), Positives = 237/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVHIA GPCITI Y TNIIIHGLNIHDC+QGGN ++RDSP+H+GW
Sbjct  130  ELVMNSFKTIDGRGASVHIANGPCITIHYATNIIIHGLNIHDCKQGGNGDIRDSPDHFGW  189

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
             T SDGDGVSIF   H+WVDHCSLSNC DGL+DAI GSTAIT+SNN+ THH+KVMLLGHS
Sbjct  190  WTQSDGDGVSIFASKHIWVDHCSLSNCHDGLIDAIHGSTAITLSNNFFTHHDKVMLLGHS  249

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  250  DSYTQDKDMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  309

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+ R  KEVTKHEDAPES+W+ WNWRSEGD +LNGAFF     AGASS+YA+AS
Sbjct  310  GNRFLAPDAREKKEVTKHEDAPESEWRHWNWRSEGDQLLNGAFFRQ-SGAGASSTYARAS  368

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV S+T  AGAL C+KG  C
Sbjct  369  SLSARPSSLVNSITRTAGALNCRKGSRC  396



>emb|CDY34310.1| BnaA01g14130D [Brassica napus]
Length=406

 Score =   429 bits (1104),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 244/268 (91%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG++IHDC+ GGNA VR SP H+GW
Sbjct  140  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGIHIHDCKPGGNAMVRSSPRHFGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI  STAIT+SNNYMTHH+KVMLLGHS
Sbjct  200  RTISDGDGVSIFGGSHVWVDHCSLSNCDDGLIDAIMDSTAITLSNNYMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY +DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  260  DTYTRDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+APN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT      +SSSYAKAS
Sbjct  320  GNRFVAPNIRFSKEVTKHEDAPESEWKSWNWRSSGDLLLNGAFFTP-SGGASSSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLVG LT G+GAL C+KG  C
Sbjct  379  SLGARPSSLVGPLTVGSGALNCRKGSRC  406



>ref|XP_009631254.1| PREDICTED: probable pectate lyase 18 [Nicotiana tomentosiformis]
Length=406

 Score =   429 bits (1103),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 223/268 (83%), Positives = 248/268 (93%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHI GGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP+HYGW
Sbjct  140  ELIMNSFKTIDGRGASVHITGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPQHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSH+WVDHCSLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  200  RTISDGDGVSIFGGSHIWVDHCSLSNCKDGLIDAIMGSTAITISNNYMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+++QDK MQVT+AFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  260  DSHVQDKNMQVTVAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+ RF+KEVTKHEDAPES+WK WNWR++GDLMLNGA+F     A ASSSYAKAS
Sbjct  320  GNRFLAPDIRFSKEVTKHEDAPESEWKKWNWRTDGDLMLNGAYFIQ-SGAAASSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSA+PSSL+ S+   AGAL C+KG  C
Sbjct  379  SLSAKPSSLITSIVSSAGALTCRKGSPC  406



>ref|XP_010682362.1| PREDICTED: probable pectate lyase 5 [Beta vulgaris subsp. vulgaris]
Length=404

 Score =   429 bits (1102),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 218/268 (81%), Positives = 242/268 (90%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL++NSFKTIDGRGA++HIAGGPCITIQYVTN+IIHG++IHDC+ GGNA VRD+P HYGW
Sbjct  138  ELMVNSFKTIDGRGANIHIAGGPCITIQYVTNVIIHGIHIHDCKPGGNAMVRDTPTHYGW  197

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDG+SIFGGSH+WVDHCSLS+C DGL+DAI GSTAITISNNYMTHHNKVMLLGHS
Sbjct  198  RTISDGDGISIFGGSHIWVDHCSLSSCTDGLIDAIHGSTAITISNNYMTHHNKVMLLGHS  257

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+  +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  258  DSLTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  317

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPND  NKEVTK E+ P+S WK WNWRS+GDLMLNGAFFT+   AGASSSYA+AS
Sbjct  318  GNRFLAPNDPDNKEVTKREEWPKSVWKKWNWRSQGDLMLNGAFFTS-SGAGASSSYARAS  376

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL+ARPS+ VGSLT  AG L CKK   C
Sbjct  377  SLNARPSTFVGSLTMSAGVLNCKKSSHC  404



>ref|XP_004489554.1| PREDICTED: probable pectate lyase 5-like [Cicer arietinum]
Length=405

 Score =   428 bits (1101),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 214/268 (80%), Positives = 239/268 (89%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL++NSFKTIDGRGASVHIA G CITI YV+NIIIHG+N+HDC+  GN N+RDSPEHYG+
Sbjct  139  ELLVNSFKTIDGRGASVHIANGGCITIHYVSNIIIHGINVHDCKPRGNTNIRDSPEHYGF  198

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
             T+SDGDG+SIF   H+WVDHCSLSNCRDGL+D I GSTAITISNNYMTHH+KVMLLGHS
Sbjct  199  WTVSDGDGISIFNSKHIWVDHCSLSNCRDGLIDVIHGSTAITISNNYMTHHDKVMLLGHS  258

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  259  DSYTQDKDMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  318

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPN+RF+KEVTK+E+AP+S+W  WNWRSEGDL LNGAFF     AGASS YA+AS
Sbjct  319  GNRFLAPNNRFSKEVTKYENAPQSEWNNWNWRSEGDLFLNGAFF-RQSGAGASSIYARAS  377

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV S+T  +GAL CKKG  C
Sbjct  378  SLSARPSSLVASITTTSGALNCKKGVRC  405



>ref|XP_007215475.1| hypothetical protein PRUPE_ppa006569mg [Prunus persica]
 gb|EMJ16674.1| hypothetical protein PRUPE_ppa006569mg [Prunus persica]
Length=405

 Score =   428 bits (1100),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 228/268 (85%), Positives = 246/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVHIAGGPCITI Y TNIIIHG+NIHDC+Q GN N+RDSP+H GW
Sbjct  139  ELVMNSFKTIDGRGASVHIAGGPCITIHYATNIIIHGINIHDCKQAGNGNIRDSPQHSGW  198

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
             T+SDGDGVSIFGG H+WVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  199  WTISDGDGVSIFGGKHIWVDHCSLSNCHDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  258

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDKGMQVT+AFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  259  DSYTQDKGMQVTVAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQ  318

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPN RFNKEVTKHEDAPES+W+GWNWRSEGDLMLNGA+F     AGASSSYA+AS
Sbjct  319  GNRFLAPNTRFNKEVTKHEDAPESEWRGWNWRSEGDLMLNGAYF-RQSGAGASSSYARAS  377

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVGS+T  AGAL C+KG  C
Sbjct  378  SLSARPSSLVGSITTTAGALICRKGSRC  405



>ref|XP_010929962.1| PREDICTED: probable pectate lyase 5 [Elaeis guineensis]
Length=409

 Score =   428 bits (1100),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 231/268 (86%), Positives = 245/268 (91%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNS+KT+DGRGASVHIAGGPCITIQYV +IIIHG++IHDC+QGGNA VRDSPEHYGW
Sbjct  143  ELIMNSYKTLDGRGASVHIAGGPCITIQYVDHIIIHGVHIHDCKQGGNAYVRDSPEHYGW  202

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHC+LS+C DGLVDAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  203  RTVSDGDGVSIFGGSHVWVDHCTLSSCHDGLVDAIHGSTAITISNNYMTHHDKVMLLGHS  262

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+ + DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  263  DSLMVDKNMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQ  322

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+DRF KEVTK EDA ESQWK WNWRSEGDLMLNGAFFT    AGASSSYAKAS
Sbjct  323  GNRFLAPDDRFAKEVTKREDASESQWKNWNWRSEGDLMLNGAFFTP-SGAGASSSYAKAS  381

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV S+T  AGAL CKKG  C
Sbjct  382  SLGARPSSLVSSITMSAGALVCKKGSRC  409



>ref|XP_008230481.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=405

 Score =   427 bits (1099),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 246/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVHIAGGPCITI Y TNIIIHG++IHDC+Q GN N+R+SPEH GW
Sbjct  139  ELVMNSFKTIDGRGASVHIAGGPCITIHYATNIIIHGIHIHDCKQAGNGNIRNSPEHSGW  198

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
             T+SDGDGVSIFGG H+WVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  199  WTISDGDGVSIFGGKHIWVDHCSLSNCHDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  258

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDKGMQVT+AFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINS+
Sbjct  259  DSYTQDKGMQVTVAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSE  318

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPN RFNKEVTKHEDAPES+W+GWNWRSEGD+MLNGA+F     AGASSSYA+AS
Sbjct  319  GNRFLAPNTRFNKEVTKHEDAPESEWRGWNWRSEGDMMLNGAYFRQ-SGAGASSSYARAS  377

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVGS+T  AGAL C+KG  C
Sbjct  378  SLSARPSSLVGSITTTAGALICRKGSRC  405



>ref|NP_567707.1| putative pectate lyase 18 [Arabidopsis thaliana]
 ref|NP_001190827.1| putative pectate lyase 18 [Arabidopsis thaliana]
 sp|Q9C5M8.2|PLY18_ARATH RecName: Full=Probable pectate lyase 18; AltName: Full=Pectate 
lyase A10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAW38990.1| At4g24780 [Arabidopsis thaliana]
 gb|AEE84955.1| putative pectate lyase 18 [Arabidopsis thaliana]
 gb|AEE84956.1| putative pectate lyase 18 [Arabidopsis thaliana]
Length=408

 Score =   427 bits (1099),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 244/268 (91%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHI+GGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP H+GW
Sbjct  142  ELIMNSFKTIDGRGASVHISGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPRHFGW  201

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCS SNC DGL+DAI GSTAIT+SNN+MTHH+KVMLLGHS
Sbjct  202  RTISDGDGVSIFGGSHVWVDHCSFSNCEDGLIDAIMGSTAITLSNNHMTHHDKVMLLGHS  261

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  262  DTYSRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  321

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT      ASSSYAKAS
Sbjct  322  GNRFLAPNIRFSKEVTKHEDAPESEWKRWNWRSSGDLLLNGAFFTP-SGGAASSSYAKAS  380

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+PSSLVG LT  +GAL C+KG  C
Sbjct  381  SLGAKPSSLVGPLTSTSGALNCRKGSRC  408



>ref|XP_007151585.1| hypothetical protein PHAVU_004G059200g [Phaseolus vulgaris]
 gb|ESW23579.1| hypothetical protein PHAVU_004G059200g [Phaseolus vulgaris]
Length=403

 Score =   427 bits (1098),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 215/268 (80%), Positives = 239/268 (89%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL++NSFKTIDGRGASVHIAGG CITI YV+N+I+HG++IHDC+  GN N+RDSPEH G+
Sbjct  137  ELLVNSFKTIDGRGASVHIAGGGCITIHYVSNVIVHGIHIHDCKPTGNTNIRDSPEHSGF  196

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
             T SDGDGVSIF   HVW+DHCSLSNCRDGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  197  WTQSDGDGVSIFNSKHVWIDHCSLSNCRDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  256

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  257  DSYTQDKDMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  316

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPN RF+KEVTKHEDAP+S+W  WNWRSEGD+ LNGA+F     AGASS YA+AS
Sbjct  317  GNRFLAPNIRFSKEVTKHEDAPQSEWMSWNWRSEGDMFLNGAYF-RQSGAGASSIYARAS  375

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVGS+T  AGAL C+KG  C
Sbjct  376  SLSARPSSLVGSMTITAGALTCRKGNRC  403



>ref|XP_002867644.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43903.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=406

 Score =   427 bits (1098),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 244/268 (91%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHI+GGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP H+GW
Sbjct  140  ELIMNSFKTIDGRGASVHISGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPRHFGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCS SNC DGL+DAI GSTAIT+SNN+MTHH+KVMLLGHS
Sbjct  200  RTISDGDGVSIFGGSHVWVDHCSFSNCEDGLIDAIMGSTAITLSNNHMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  260  DTYSRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT      ASSSYAKAS
Sbjct  320  GNRFLAPNIRFSKEVTKHEDAPESEWKRWNWRSSGDLLLNGAFFTP-SGGAASSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+PSSLVG LT  +GAL C+KG  C
Sbjct  379  SLGAKPSSLVGPLTSTSGALNCRKGSRC  406



>gb|KDP46367.1| hypothetical protein JCGZ_10207 [Jatropha curcas]
Length=403

 Score =   426 bits (1096),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 213/268 (79%), Positives = 235/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNS+KTIDGRGASVHIAGGPCITI Y TNIIIHGL+IHDC++GGN N+RDSP H GW
Sbjct  137  ELVMNSYKTIDGRGASVHIAGGPCITIHYATNIIIHGLHIHDCKRGGNGNIRDSPHHSGW  196

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
             T SDGDG+SIF   H+WVDHCSLSNC+DGL+DAI GSTAITIS+N+MTHH+KVMLLGHS
Sbjct  197  WTQSDGDGISIFSSKHIWVDHCSLSNCQDGLIDAIHGSTAITISSNFMTHHDKVMLLGHS  256

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  257  DSYTQDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  316

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDR  KEVTKHE APES+W  WNWRSEGDL LNGAFF     AGASSSY +A 
Sbjct  317  GNRFLAPNDRSKKEVTKHEHAPESEWMHWNWRSEGDLFLNGAFF-RRSGAGASSSYGRAF  375

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPS+LV S+T  AGAL C++G  C
Sbjct  376  SLSARPSTLVDSMTRTAGALSCRRGSRC  403



>ref|XP_010695977.1| PREDICTED: probable pectate lyase 18 [Beta vulgaris subsp. vulgaris]
Length=406

 Score =   426 bits (1095),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 246/268 (92%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG+NIHDC+QGGNA VR +P HYGW
Sbjct  140  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGINIHDCKQGGNAMVRSNPHHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVS+FG SHVWVDHCSLSNC DGL+DAI GSTAITISNN+MTHH+KVMLLGHS
Sbjct  200  RTISDGDGVSLFGASHVWVDHCSLSNCADGLIDAIMGSTAITISNNFMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y  DK MQ TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  260  DSYTADKNMQATIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+ RF+KEVTKHEDAPE++WK WNWRSEGDLMLNGAFFT    AGAS+SYA+AS
Sbjct  320  GNRFLAPDRRFSKEVTKHEDAPENEWKNWNWRSEGDLMLNGAFFTP-SGAGASASYARAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPS+LVGS+T  +GAL C+KG  C
Sbjct  379  SLGARPSTLVGSITAASGALNCRKGARC  406



>gb|EPS69872.1| hypothetical protein M569_04891, partial [Genlisea aurea]
Length=401

 Score =   426 bits (1094),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 220/268 (82%), Positives = 243/268 (91%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHI+ GPCIT+Q+VTNIIIHG++IHDC+ GGNA VRDSP HYGW
Sbjct  135  ELIMNSFKTIDGRGASVHISNGPCITVQFVTNIIIHGIHIHDCKPGGNAMVRDSPRHYGW  194

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFG SHVWVDHCSLS+C DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  195  RTISDGDGVSIFGASHVWVDHCSLSSCADGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  254

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D Y+QD+ MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  255  DAYVQDQSMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQ  314

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+DRF KEVTK+EDA ES+WK WNWR+EGDLMLNGA+FT     GASS+YA+AS
Sbjct  315  GNRFLAPDDRFKKEVTKYEDAAESEWKNWNWRTEGDLMLNGAYFTP-SGTGASSTYARAS  373

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL AR SSLVGS+T G+G L C+KG  C
Sbjct  374  SLGARSSSLVGSITAGSGVLTCRKGSRC  401



>ref|XP_010448519.1| PREDICTED: probable pectate lyase 18 [Camelina sativa]
Length=406

 Score =   426 bits (1094),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 223/268 (83%), Positives = 243/268 (91%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRG SVHI+GGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP H+GW
Sbjct  140  ELIMNSFKTIDGRGVSVHISGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPRHFGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAIT+SNN+MTHH+KVMLLGHS
Sbjct  200  RTISDGDGVSIFGGSHVWVDHCSLSNCEDGLIDAIMGSTAITLSNNHMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY +DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  260  DTYTRDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT      ASSSYAKAS
Sbjct  320  GNRFLAPNIRFSKEVTKHEDAPESEWKSWNWRSSGDLLLNGAFFTP-SGGAASSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+PSSLVG LT  +GAL C+K   C
Sbjct  379  SLGAKPSSLVGPLTFSSGALNCRKSSRC  406



>ref|XP_010433725.1| PREDICTED: probable pectate lyase 18 [Camelina sativa]
 ref|XP_010438969.1| PREDICTED: probable pectate lyase 18 [Camelina sativa]
Length=408

 Score =   426 bits (1095),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 223/268 (83%), Positives = 243/268 (91%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRG SVHI+GGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP H+GW
Sbjct  142  ELIMNSFKTIDGRGVSVHISGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPRHFGW  201

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAIT+SNN+MTHH+KVMLLGHS
Sbjct  202  RTISDGDGVSIFGGSHVWVDHCSLSNCEDGLIDAIMGSTAITLSNNHMTHHDKVMLLGHS  261

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY +DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  262  DTYTRDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  321

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT      ASSSYAKAS
Sbjct  322  GNRFLAPNIRFSKEVTKHEDAPESEWKSWNWRSSGDLLLNGAFFTP-SGGAASSSYAKAS  380

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+PSSLVG LT  +GAL C+K   C
Sbjct  381  SLGAKPSSLVGPLTFSSGALNCRKSSRC  408



>gb|AAK25850.1|AF360140_1 putative pectate lyase [Arabidopsis thaliana]
Length=408

 Score =   425 bits (1092),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 224/268 (84%), Positives = 243/268 (91%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHI+GGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP H+GW
Sbjct  142  ELIMNSFKTIDGRGASVHISGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPRHFGW  201

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCS SNC DGL+DAI GSTAIT+SNN+MTHH+KVMLLGHS
Sbjct  202  RTISDGDGVSIFGGSHVWVDHCSFSNCEDGLIDAIMGSTAITLSNNHMTHHDKVMLLGHS  261

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY +DK M VTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  262  DTYSRDKNMHVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  321

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT      ASSSYAKAS
Sbjct  322  GNRFLAPNIRFSKEVTKHEDAPESEWKRWNWRSSGDLLLNGAFFTP-SGGAASSSYAKAS  380

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+PSSLVG LT  +GAL C+KG  C
Sbjct  381  SLGAKPSSLVGPLTSTSGALNCRKGSRC  408



>gb|ACF84425.1| unknown [Zea mays]
 tpg|DAA38669.1| TPA: hypothetical protein ZEAMMB73_698118 [Zea mays]
Length=274

 Score =   419 bits (1078),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 207/268 (77%), Positives = 237/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G C+TIQYVTN+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  8    ELIMNSFKTIDGRGANVHIANGACVTIQYVTNVIIHGLHIHDCRPTGNAMVRSSPSHYGW  67

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGDGVSIFG SHVWVDHCSLSNC DGL+DAI GSTAIT+SNNY THHN+VMLLGHS
Sbjct  68   RTMADGDGVSIFGSSHVWVDHCSLSNCADGLIDAIMGSTAITLSNNYFTHHNEVMLLGHS  127

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  128  DSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQ  187

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  +  ++ WK WNWRSEGDL+LNGA+FT    AGAS+SY++AS
Sbjct  188  GNRYLAPTNPFAKEVTKRVETAQTVWKSWNWRSEGDLLLNGAYFTP-SGAGASASYSRAS  246

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VG++T  AGAL C+KG +C
Sbjct  247  SLGAKSSSMVGTITSDAGALSCRKGAAC  274



>ref|XP_011042354.1| PREDICTED: probable pectate lyase 5 [Populus euphratica]
Length=402

 Score =   424 bits (1090),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 230/268 (86%), Positives = 244/268 (91%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIAGGPCITIQYVTNIIIHG+NIHDC++GGNA VRDSP HYGW
Sbjct  136  ELIMNSFKTIDGRGANVHIAGGPCITIQYVTNIIIHGINIHDCKRGGNAYVRDSPSHYGW  195

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGS VWVDHCSLS C DGL+DAI GSTAITISN+Y T HNKVMLLGHS
Sbjct  196  RTISDGDGVSIFGGSQVWVDHCSLSKCNDGLIDAIHGSTAITISNSYFTRHNKVMLLGHS  255

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTINSQ
Sbjct  256  DSYKQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWKMYAIGGSAAPTINSQ  315

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDRF KEVTKHE A +SQWK WNWRS+GDLMLNGAFFT    AGASSSYA+AS
Sbjct  316  GNRFLAPNDRFKKEVTKHEAASQSQWKRWNWRSQGDLMLNGAFFTP-SGAGASSSYARAS  374

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV S+T GAGAL CKKG  C
Sbjct  375  SLSARPSSLVSSITAGAGALVCKKGSRC  402



>gb|EPS58104.1| pectate lyase, partial [Genlisea aurea]
Length=354

 Score =   422 bits (1085),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 216/268 (81%), Positives = 241/268 (90%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRG+ VHIA GPCITIQYVTN++IHG++IH C+ GGNA VRDSP HYGW
Sbjct  88   ELIMNSFKTIDGRGSVVHIADGPCITIQYVTNVVIHGVHIHGCRPGGNAMVRDSPRHYGW  147

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHC+LS+C DGL+DA+ GSTAITISNNYMTHH+KVMLLGHS
Sbjct  148  RTVSDGDGVSIFGGSHVWVDHCTLSDCADGLIDAVHGSTAITISNNYMTHHDKVMLLGHS  207

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D Y+QDKGMQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  208  DEYVQDKGMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQ  267

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+ RF+KEVTK+EDAPES+W  WNWR+EGDLMLNGA+FT     GA+S+YA+AS
Sbjct  268  GNRFLAPDLRFSKEVTKYEDAPESEWSNWNWRTEGDLMLNGAYFTP-SGTGAASTYARAS  326

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSS V  LT  AGAL C++G  C
Sbjct  327  SLGARPSSSVAGLTAAAGALNCRRGSRC  354



>gb|AAM65103.1| putative pectate lyase [Arabidopsis thaliana]
Length=406

 Score =   424 bits (1090),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 224/268 (84%), Positives = 243/268 (91%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHI+GGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP H+GW
Sbjct  140  ELIMNSFKTIDGRGASVHISGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPRHFGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCS SNC DGL+DAI GSTAIT+SNN+MTHH+KVMLLGHS
Sbjct  200  RTISDGDGVSIFGGSHVWVDHCSFSNCEDGLIDAIMGSTAITLSNNHMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  260  DTYSRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPN RF+KEVTK EDAPES+WK WNWRS GDL+LNGAFFT      ASSSYAKAS
Sbjct  320  GNRFLAPNIRFSKEVTKDEDAPESEWKRWNWRSSGDLLLNGAFFTP-SGGAASSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+PSSLVG LT  +GAL C+KG  C
Sbjct  379  SLGAKPSSLVGPLTSTSGALNCRKGSRC  406



>ref|XP_010239620.1| PREDICTED: probable pectate lyase 8 isoform X2 [Brachypodium 
distachyon]
Length=424

 Score =   423 bits (1088),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 211/268 (79%), Positives = 237/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  158  ELIMNSFKTIDGRGANVHIANGACITIQYVTNVIIHGLHIHDCRPTGNAMVRSSPSHYGW  217

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD VSIFG SHVWVDHCSLSNC DGLVDAI GSTAIT+SNNY THHN+VMLLGHS
Sbjct  218  RTMADGDAVSIFGSSHVWVDHCSLSNCADGLVDAIMGSTAITVSNNYFTHHNEVMLLGHS  277

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  278  DSYLKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQ  337

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  +  ++ WKGWNWRSEGDL+LNGAFFT    AGAS+SY++AS
Sbjct  338  GNRYLAPTNPFAKEVTKRVETAQTTWKGWNWRSEGDLLLNGAFFTP-SGAGASASYSRAS  396

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VG++T GAG L C+KG SC
Sbjct  397  SLGAKSSSMVGTITSGAGVLSCRKGSSC  424



>ref|XP_010239619.1| PREDICTED: probable pectate lyase 8 isoform X1 [Brachypodium 
distachyon]
Length=450

 Score =   424 bits (1089),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 211/268 (79%), Positives = 237/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  184  ELIMNSFKTIDGRGANVHIANGACITIQYVTNVIIHGLHIHDCRPTGNAMVRSSPSHYGW  243

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD VSIFG SHVWVDHCSLSNC DGLVDAI GSTAIT+SNNY THHN+VMLLGHS
Sbjct  244  RTMADGDAVSIFGSSHVWVDHCSLSNCADGLVDAIMGSTAITVSNNYFTHHNEVMLLGHS  303

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  304  DSYLKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQ  363

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  +  ++ WKGWNWRSEGDL+LNGAFFT    AGAS+SY++AS
Sbjct  364  GNRYLAPTNPFAKEVTKRVETAQTTWKGWNWRSEGDLLLNGAFFTP-SGAGASASYSRAS  422

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VG++T GAG L C+KG SC
Sbjct  423  SLGAKSSSMVGTITSGAGVLSCRKGSSC  450



>gb|ACN35280.1| unknown [Zea mays]
 gb|AFW57902.1| hypothetical protein ZEAMMB73_963462 [Zea mays]
 gb|AFW57903.1| hypothetical protein ZEAMMB73_963462 [Zea mays]
Length=274

 Score =   416 bits (1068),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 207/268 (77%), Positives = 235/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G CITIQY+TN+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  8    ELIMNSFKTIDGRGANVHIANGACITIQYITNVIIHGLHIHDCKPTGNAMVRSSPSHYGW  67

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGDGVSIFG SHVWVDHCSLSNC DGL+DAI GSTAIT+SNNY THHN+VMLLGHS
Sbjct  68   RTMADGDGVSIFGSSHVWVDHCSLSNCADGLIDAIMGSTAITVSNNYFTHHNEVMLLGHS  127

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  128  DSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQ  187

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  +   + WK WNWRSEGDL+LNGA+FT    AGAS+SY++AS
Sbjct  188  GNRYLAPTNPFAKEVTKRVETAHTVWKRWNWRSEGDLLLNGAYFTP-SGAGASASYSRAS  246

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VG++T  AGAL C KG +C
Sbjct  247  SLGAKSSSMVGTITLDAGALSCHKGAAC  274



>emb|CDY28857.1| BnaC06g26450D [Brassica napus]
Length=407

 Score =   420 bits (1080),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 224/268 (84%), Positives = 242/268 (90%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVHIAGG CIT+QYVTNIIIHG+NIHDC++ GNA VRDSP HYGW
Sbjct  141  ELMMNSFKTIDGRGASVHIAGGACITVQYVTNIIIHGINIHDCKKRGNAYVRDSPSHYGW  200

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT SDGD VSIFGGSHVWVDHCSLSNC DGLVDAIRGSTAITISNNY+THHNKVMLLGHS
Sbjct  201  RTASDGDAVSIFGGSHVWVDHCSLSNCDDGLVDAIRGSTAITISNNYLTHHNKVMLLGHS  260

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTINSQ
Sbjct  261  DSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTINSQ  320

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPND   KEVTK+EDAP+S+WK WNWRSEGDL LNGAFFT      +SSSYAKAS
Sbjct  321  GNRFLAPNDHVFKEVTKYEDAPQSKWKNWNWRSEGDLFLNGAFFTP-SGGRSSSSYAKAS  379

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSS+V S+TG AG+L C+KG  C
Sbjct  380  SLSARPSSVVASVTGNAGSLSCRKGSRC  407



>ref|XP_011010949.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=403

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 219/268 (82%), Positives = 240/268 (90%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNS+KTIDGRGASVHIAGGPCITI Y TNIIIHG++IHDC+QGGN ++RDSP H+GW
Sbjct  137  ELVMNSYKTIDGRGASVHIAGGPCITIHYATNIIIHGIHIHDCKQGGNGDIRDSPRHFGW  196

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
             T SDGDGVSIF   H+WVDHCSLSNC DGL+DAI GSTAITISNN+MTHH+KVMLLGHS
Sbjct  197  WTPSDGDGVSIFASKHIWVDHCSLSNCHDGLIDAIHGSTAITISNNFMTHHDKVMLLGHS  256

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  257  DSYTQDKDMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQ  316

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPN RFNKEVTKHEDAPES+W+ WNWRSEGDLMLNGA+F     AGASSSYA+A 
Sbjct  317  GNRFLAPNRRFNKEVTKHEDAPESEWRHWNWRSEGDLMLNGAYFRQ-SGAGASSSYARAY  375

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVGS+T  +G L C+KG  C
Sbjct  376  SLSARPSSLVGSMTLTSGVLNCRKGSRC  403



>emb|CAA63496.1| pectate lyase [Musa acuminata AAA Group]
Length=398

 Score =   419 bits (1076),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 219/269 (81%), Positives = 233/269 (87%), Gaps = 2/269 (1%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNS KTIDGRGASVHI+GGPCITIQYVTNIIIHG++IHDC+QGGNA VRDSP HYGW
Sbjct  131  ELIMNSHKTIDGRGASVHISGGPCITIQYVTNIIIHGVHIHDCKQGGNAYVRDSPGHYGW  190

Query  709  RTLSDGDGVSIFGGSH-VWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGH  533
            RT+SDGDGVSIFGG    WVDHC+L NC DGL+DAI GSTAITISNNY+ HH+KVMLLGH
Sbjct  191  RTVSDGDGVSIFGGQPPSWVDHCTLFNCHDGLIDAIHGSTAITISNNYLRHHDKVMLLGH  250

Query  532  SDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINS  353
            SD    DK MQVTIAFNHFGE L+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINS
Sbjct  251  SDELTSDKSMQVTIAFNHFGEDLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINS  310

Query  352  QGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyaka  173
            QGNRFLAPNDRF KEVTK EDA ES+WK WNWRSEGD MLNGAFFT    AGASSS+AKA
Sbjct  311  QGNRFLAPNDRFAKEVTKREDAQESEWKKWNWRSEGDQMLNGAFFTP-SGAGASSSHAKA  369

Query  172  sslsARPSSLVGSLTGGAGALPCKKGKSC  86
            SSL  R SSLVG++T  AG L CKKG  C
Sbjct  370  SSLGPRSSSLVGTITVSAGVLSCKKGSRC  398



>ref|XP_006347419.1| PREDICTED: probable pectate lyase 18-like [Solanum tuberosum]
Length=405

 Score =   419 bits (1077),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 208/268 (78%), Positives = 238/268 (89%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIAGGPCITIQYVTN+IIHG++IHDC+QGGNA VR +P HYGW
Sbjct  139  ELIMNSFKTIDGRGATVHIAGGPCITIQYVTNVIIHGIHIHDCKQGGNAMVRSTPHHYGW  198

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSH+W+DHCSLSNC DGL+DAI GSTAITISNNYMT H+KVMLLGHS
Sbjct  199  RTISDGDGVSIFGGSHIWIDHCSLSNCVDGLIDAIMGSTAITISNNYMTKHDKVMLLGHS  258

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+++QDK MQVTIAFNHFGEGL+QR+PRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  259  DSHVQDKNMQVTIAFNHFGEGLVQRIPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  318

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLA + RF+KEVTKHE +PES+WK WNWRS+GDLMLNGAFF  SG+  +S+    +S
Sbjct  319  GNRFLASDIRFSKEVTKHEISPESEWKNWNWRSDGDLMLNGAFFVKSGAGASSNYAKASS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
              +   SSL+ SL  GAGAL C++G  C
Sbjct  379  LSAKS-SSLISSLVSGAGALSCREGSRC  405



>ref|XP_007163701.1| hypothetical protein PHAVU_001G256900g [Phaseolus vulgaris]
 gb|ESW35695.1| hypothetical protein PHAVU_001G256900g [Phaseolus vulgaris]
Length=452

 Score =   421 bits (1081),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 245/268 (91%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG+NIHDC+QGGNA VRDSP HYGW
Sbjct  186  ELMMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGINIHDCKQGGNAYVRDSPTHYGW  245

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RTLSDGDG+SIFGGSHVWVDHCSLSNCRDGL+DAI GSTAITISNNYMTHHNKVMLLGHS
Sbjct  246  RTLSDGDGISIFGGSHVWVDHCSLSNCRDGLIDAIHGSTAITISNNYMTHHNKVMLLGHS  305

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DT+ +DK MQVTIAFNHFGEGL+QRMPRCR+GYFHVVNNDYTHW+MYAIGGSA PTINSQ
Sbjct  306  DTFTRDKNMQVTIAFNHFGEGLVQRMPRCRYGYFHVVNNDYTHWKMYAIGGSAAPTINSQ  365

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPND   KEVTK E++ +S+WK WNWRS GDLMLNGAFFT    AGASSSYA+AS
Sbjct  366  GNRFLAPNDHTFKEVTKRENSAQSKWKNWNWRSTGDLMLNGAFFTA-SGAGASSSYARAS  424

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL+A+PSSLV S+T  AG+L C+KG  C
Sbjct  425  SLAAKPSSLVSSITASAGSLACRKGSRC  452



>ref|XP_009391056.1| PREDICTED: probable pectate lyase 8 [Musa acuminata subsp. malaccensis]
Length=453

 Score =   420 bits (1080),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 212/268 (79%), Positives = 233/268 (87%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  187  ELIMNSFKTIDGRGANVHIANGACITIQYVTNVIIHGLHIHDCKPTGNAMVRSSPSHYGW  246

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGDGVSIFG SHVWVDHCSLSNC DGLVDA+ GSTAIT+SNNY THHN+VMLLGHS
Sbjct  247  RTMADGDGVSIFGSSHVWVDHCSLSNCADGLVDAVMGSTAITVSNNYFTHHNEVMLLGHS  306

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  307  DSYERDKSMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  366

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  D   S WK WNWRSEGDL+LNGA+FT    AGAS+SYA+AS
Sbjct  367  GNRYLAPTNPFAKEVTKRVDTDASLWKNWNWRSEGDLLLNGAYFTP-SGAGASTSYARAS  425

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+PSS+VG+LT  AGAL C+ G  C
Sbjct  426  SLGAKPSSMVGTLTSDAGALSCRAGTQC  453



>ref|XP_008800563.1| PREDICTED: probable pectate lyase 8 isoform X1 [Phoenix dactylifera]
Length=456

 Score =   420 bits (1079),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 210/268 (78%), Positives = 237/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G CITIQ+V+NIIIHGL+IHDC+  GNA VR SP HYGW
Sbjct  190  ELIMNSFKTIDGRGANVHIANGACITIQFVSNIIIHGLHIHDCKATGNAMVRSSPSHYGW  249

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGDGVSIFG SHVWVDHCSLSNC DGLVDA+ GSTAITISNNY+THHN+VMLLGHS
Sbjct  250  RTMADGDGVSIFGSSHVWVDHCSLSNCADGLVDAVMGSTAITISNNYLTHHNEVMLLGHS  309

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  310  DSYEKDKDMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  369

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  D+  ++WK WNWRSEGDL+LNGA+FT    AGAS+SY++AS
Sbjct  370  GNRYLAPANAFAKEVTKRLDSSSNEWKSWNWRSEGDLLLNGAYFTP-SGAGASASYSRAS  428

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+PSS+VG++T GAGAL C+K   C
Sbjct  429  SLGAKPSSMVGTMTSGAGALSCRKAAQC  456



>ref|XP_011097349.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=406

 Score =   418 bits (1075),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 210/268 (78%), Positives = 232/268 (87%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNS KTIDGRGASVHIAGG CITI +VTN+IIHG++IHDC + GN  +RDSPEH GW
Sbjct  140  ELVMNSHKTIDGRGASVHIAGGACITIHHVTNVIIHGIHIHDCVKAGNGIIRDSPEHKGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
              +SDGDG+SIFGG  +WVDHCSLSNC DGL+DAI GSTAITISNNY THH+KVMLLGHS
Sbjct  200  WEVSDGDGISIFGGRDIWVDHCSLSNCNDGLIDAIHGSTAITISNNYFTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTI SQ
Sbjct  260  DEYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTIYSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPNDR  K+VTKHEDAPES+W+ WNWRSEGDLMLNGA+F      GA ++YA+AS
Sbjct  320  GNRFLAPNDRDRKQVTKHEDAPESEWRHWNWRSEGDLMLNGAYFLQ-SGTGAGATYARAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV S+T  AGAL CK+G  C
Sbjct  379  SLSARPSSLVASITTAAGALNCKRGARC  406



>dbj|BAK06362.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=466

 Score =   420 bits (1080),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 208/268 (78%), Positives = 235/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  200  ELIMNSFKTIDGRGANVHIANGACITIQYVTNVIIHGLHIHDCRPTGNAMVRSSPSHYGW  259

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD VSIFG SHVWVDHCSLSNC DGL+DAI GSTAIT+SNNY THHN+VMLLGHS
Sbjct  260  RTIADGDAVSIFGASHVWVDHCSLSNCADGLIDAIMGSTAITVSNNYFTHHNEVMLLGHS  319

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  320  DSYLKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQ  379

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  +  ++ WK WNWRSEGD++LNGAFFT    AGAS+SY++AS
Sbjct  380  GNRYLAPTNPFAKEVTKRVETAQTTWKAWNWRSEGDMLLNGAFFTP-SGAGASASYSRAS  438

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+V ++T GAGAL C KG SC
Sbjct  439  SLGAKSSSMVATITSGAGALSCHKGSSC  466



>ref|XP_008800564.1| PREDICTED: probable pectate lyase 8 isoform X2 [Phoenix dactylifera]
Length=455

 Score =   420 bits (1079),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 210/268 (78%), Positives = 237/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G CITIQ+V+NIIIHGL+IHDC+  GNA VR SP HYGW
Sbjct  189  ELIMNSFKTIDGRGANVHIANGACITIQFVSNIIIHGLHIHDCKATGNAMVRSSPSHYGW  248

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGDGVSIFG SHVWVDHCSLSNC DGLVDA+ GSTAITISNNY+THHN+VMLLGHS
Sbjct  249  RTMADGDGVSIFGSSHVWVDHCSLSNCADGLVDAVMGSTAITISNNYLTHHNEVMLLGHS  308

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  309  DSYEKDKDMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  368

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  D+  ++WK WNWRSEGDL+LNGA+FT    AGAS+SY++AS
Sbjct  369  GNRYLAPANAFAKEVTKRLDSSSNEWKSWNWRSEGDLLLNGAYFTP-SGAGASASYSRAS  427

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+PSS+VG++T GAGAL C+K   C
Sbjct  428  SLGAKPSSMVGTMTSGAGALSCRKAAQC  455



>gb|KJB37783.1| hypothetical protein B456_006G219800 [Gossypium raimondii]
Length=274

 Score =   413 bits (1061),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 206/268 (77%), Positives = 234/268 (87%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRG +VHIA G CITIQYVTN+IIHGL+IHDC+  GNA VR SP H+GW
Sbjct  8    ELIMNSFKTIDGRGVNVHIANGACITIQYVTNVIIHGLHIHDCKPTGNAMVRSSPSHFGW  67

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD +SIFG SH+WVDH SLSNC DGLVDA+ GSTAITISNN+MTHHN+VMLLGHS
Sbjct  68   RTMADGDAISIFGSSHIWVDHNSLSNCADGLVDAVMGSTAITISNNHMTHHNEVMLLGHS  127

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  128  DSYTRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  187

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+ AP + F KEVTK  D  E QWK WNWRSEGDL+LNGA+FT    AGAS+SYA+AS
Sbjct  188  GNRYAAPTNPFAKEVTKRVDTAEGQWKSWNWRSEGDLLLNGAYFTP-SGAGASASYARAS  246

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VG++T  AGALPC++GK C
Sbjct  247  SLGAKSSSMVGAMTSNAGALPCRRGKQC  274



>ref|XP_002300069.1| pectate lyase family protein [Populus trichocarpa]
 gb|EEE84874.1| pectate lyase family protein [Populus trichocarpa]
Length=403

 Score =   417 bits (1073),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 219/268 (82%), Positives = 239/268 (89%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNS+KTIDGRGASVHIAGGPCITI Y TNIIIHG++IHDC+QGGN ++RDSP H GW
Sbjct  137  ELVMNSYKTIDGRGASVHIAGGPCITIHYATNIIIHGIHIHDCKQGGNGDIRDSPRHSGW  196

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
             T SDGDGVSIF   H+WVDHCSLSNC DGL+DAI GSTAITISNN+MTHH+KVMLLGHS
Sbjct  197  WTPSDGDGVSIFASKHIWVDHCSLSNCHDGLIDAIHGSTAITISNNFMTHHDKVMLLGHS  256

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  257  DSYTQDKDMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  316

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPN RFNKEVTKHEDAPES+W+ WNWRSEGDLMLNGA+F     AGASSSYA+A 
Sbjct  317  GNRFLAPNRRFNKEVTKHEDAPESEWRHWNWRSEGDLMLNGAYFRQ-SGAGASSSYARAY  375

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVGS+T  +G L C+KG  C
Sbjct  376  SLSARPSSLVGSMTLTSGVLNCRKGSRC  403



>gb|EEE60442.1| hypothetical protein OsJ_13660 [Oryza sativa Japonica Group]
Length=443

 Score =   419 bits (1076),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/268 (78%), Positives = 237/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  177  ELIMNSFKTIDGRGANVHIANGACITIQYVTNVIIHGLHIHDCRPTGNAMVRSSPSHYGW  236

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD VSIFG SH+WVDHCSLSNC DGL+DAI GSTAIT+SNNY THHN+VMLLGHS
Sbjct  237  RTMADGDAVSIFGASHIWVDHCSLSNCADGLIDAIMGSTAITVSNNYFTHHNEVMLLGHS  296

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  297  DSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQ  356

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  +  ++ WKGWNWRSEGDL+LNGAFFT    AGAS+SY++AS
Sbjct  357  GNRYLAPTNPFAKEVTKRVETAQTIWKGWNWRSEGDLLLNGAFFTP-SGAGASASYSRAS  415

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VG++T GAGAL C+ G +C
Sbjct  416  SLGAKSSSMVGTITSGAGALSCRGGSAC  443



>gb|EMT28700.1| hypothetical protein F775_17439 [Aegilops tauschii]
Length=399

 Score =   417 bits (1071),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 208/268 (78%), Positives = 234/268 (87%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  133  ELIMNSFKTIDGRGANVHIANGACITIQYVTNVIIHGLHIHDCRPTGNAMVRSSPSHYGW  192

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
             T++DGD VSIFG SHVWVDHCSLSNC DGLVDAI GSTAIT+SNNY THHN+VMLLGHS
Sbjct  193  STMADGDAVSIFGASHVWVDHCSLSNCADGLVDAIMGSTAITVSNNYFTHHNEVMLLGHS  252

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  253  DSYLKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQ  312

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  +  ++ WK WNWRSEGD++LNGAFFT    AGAS+SY++AS
Sbjct  313  GNRYLAPTNPFAKEVTKRVETAQTTWKAWNWRSEGDMLLNGAFFTP-SGAGASASYSRAS  371

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+V ++T GAGAL C KG SC
Sbjct  372  SLGAKSSSMVATITSGAGALSCHKGSSC  399



>emb|CAA22985.1| putative pectate lyase [Arabidopsis thaliana]
 emb|CAB79388.1| putative pectate lyase [Arabidopsis thaliana]
Length=404

 Score =   417 bits (1071),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 223/268 (83%), Positives = 242/268 (90%), Gaps = 3/268 (1%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGASVHI+GGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP H+GW
Sbjct  140  ELIMNSFKTIDGRGASVHISGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPRHFGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHCS SNC DGL+DAI GSTAIT+SNN+MTHH+KVMLLGHS
Sbjct  200  RTISDGDGVSIFGGSHVWVDHCSFSNCEDGLIDAIMGSTAITLSNNHMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DTY +DK MQVTIAFNHFGEGL+QRMP  RHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  260  DTYSRDKNMQVTIAFNHFGEGLVQRMP--RHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  317

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT      ASSSYAKAS
Sbjct  318  GNRFLAPNIRFSKEVTKHEDAPESEWKRWNWRSSGDLLLNGAFFTP-SGGAASSSYAKAS  376

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+PSSLVG LT  +GAL C+KG  C
Sbjct  377  SLGAKPSSLVGPLTSTSGALNCRKGSRC  404



>gb|KJB15669.1| hypothetical protein B456_002G189900 [Gossypium raimondii]
Length=406

 Score =   417 bits (1071),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 222/268 (83%), Positives = 237/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRG SVHIAGGPCITIQY TNIIIHG+NIHDC++GGN  VRDSP HYGW
Sbjct  140  ELLMNSFKTIDGRGVSVHIAGGPCITIQYATNIIIHGINIHDCKRGGNLYVRDSPTHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT SDGDGVSIFG SHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  200  RTTSDGDGVSIFGSSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW MYAIGGSA+PTINSQ
Sbjct  260  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWIMYAIGGSANPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+   NKEVTK E+ P  +WK WNWRS GDLMLNGAFFT     GA SSYAKAS
Sbjct  320  GNRFLAPDKMNNKEVTKRENTPRKKWKKWNWRSRGDLMLNGAFFTP-SGTGALSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV S+T GAGAL C+KG+ C
Sbjct  379  SLSARPSSLVSSVTAGAGALVCRKGRRC  406



>emb|CAE02420.2| OSJNBa0095E20.8 [Oryza sativa Japonica Group]
 emb|CAH65848.1| OSIGBa0147B06.7 [Oryza sativa Indica Group]
Length=472

 Score =   419 bits (1077),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 208/268 (78%), Positives = 237/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  206  ELIMNSFKTIDGRGANVHIANGACITIQYVTNVIIHGLHIHDCRPTGNAMVRSSPSHYGW  265

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD VSIFG SH+WVDHCSLSNC DGL+DAI GSTAIT+SNNY THHN+VMLLGHS
Sbjct  266  RTMADGDAVSIFGASHIWVDHCSLSNCADGLIDAIMGSTAITVSNNYFTHHNEVMLLGHS  325

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  326  DSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQ  385

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  +  ++ WKGWNWRSEGDL+LNGAFFT    AGAS+SY++AS
Sbjct  386  GNRYLAPTNPFAKEVTKRVETAQTIWKGWNWRSEGDLLLNGAFFTP-SGAGASASYSRAS  444

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VG++T GAGAL C+ G +C
Sbjct  445  SLGAKSSSMVGTITSGAGALSCRGGSAC  472



>ref|XP_010415362.1| PREDICTED: probable pectate lyase 5 [Camelina sativa]
Length=408

 Score =   417 bits (1071),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 224/268 (84%), Positives = 240/268 (90%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRG +VHIAGG CIT+QYVTNIIIHG+NIHDC++ GNA VRDSP HYGW
Sbjct  142  ELIMNSFKTIDGRGVNVHIAGGACITVQYVTNIIIHGINIHDCKRKGNAYVRDSPSHYGW  201

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT SDGD VSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNY+THHNKVMLLGHS
Sbjct  202  RTASDGDAVSIFGGSHVWVDHCSLSNCADGLIDAIHGSTAITISNNYLTHHNKVMLLGHS  261

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTINSQ
Sbjct  262  DSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTINSQ  321

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPND   KEVTK+EDAP+S+WK WNWRSEGDL LNGAFFT      ASSSYAKAS
Sbjct  322  GNRFLAPNDHVFKEVTKYEDAPQSKWKKWNWRSEGDLFLNGAFFTA-SGGRASSSYAKAS  380

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSS+V S+TG AGAL CKKG  C
Sbjct  381  SLSARPSSVVASVTGSAGALFCKKGSRC  408



>emb|CDY12666.1| BnaA02g13340D [Brassica napus]
Length=406

 Score =   417 bits (1071),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 240/268 (90%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGA+VHIAGG CIT QYVTNIIIHG+NIHDC++ GNA VRDSP HYGW
Sbjct  140  ELLMNSFKTIDGRGANVHIAGGACITAQYVTNIIIHGINIHDCKKRGNAYVRDSPSHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT SDGD +SIFGGSHVWVDHCSLSNC DGLVDAI GSTAITISNNY+THHNKVMLLGHS
Sbjct  200  RTASDGDAISIFGGSHVWVDHCSLSNCADGLVDAIHGSTAITISNNYLTHHNKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTINSQ
Sbjct  260  DSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPND   KEVTK+EDAP+S+WK WNWRSEGDL LNGAFFT      ASSSYAKAS
Sbjct  320  GNRFLAPNDHVFKEVTKYEDAPQSKWKKWNWRSEGDLFLNGAFFTP-AGGRASSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV S+TG AGAL CKKG  C
Sbjct  379  SLSARPSSLVASVTGNAGALYCKKGSRC  406



>gb|EEC76710.1| hypothetical protein OsI_14719 [Oryza sativa Indica Group]
Length=473

 Score =   419 bits (1077),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 208/268 (78%), Positives = 237/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  207  ELIMNSFKTIDGRGANVHIANGACITIQYVTNVIIHGLHIHDCRPTGNAMVRSSPSHYGW  266

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD VSIFG SH+WVDHCSLSNC DGL+DAI GSTAIT+SNNY THHN+VMLLGHS
Sbjct  267  RTMADGDAVSIFGASHIWVDHCSLSNCADGLIDAIMGSTAITVSNNYFTHHNEVMLLGHS  326

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  327  DSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQ  386

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  +  ++ WKGWNWRSEGDL+LNGAFFT    AGAS+SY++AS
Sbjct  387  GNRYLAPTNPFAKEVTKRVETAQTIWKGWNWRSEGDLLLNGAFFTP-SGAGASASYSRAS  445

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VG++T GAGAL C+ G +C
Sbjct  446  SLGAKSSSMVGTITSGAGALSCRGGSAC  473



>ref|XP_010935686.1| PREDICTED: probable pectate lyase 8 isoform X2 [Elaeis guineensis]
Length=425

 Score =   416 bits (1070),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 210/268 (78%), Positives = 235/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G CITIQ++TN+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  159  ELIMNSFKTIDGRGANVHIANGACITIQFITNVIIHGLHIHDCKPTGNAMVRSSPSHYGW  218

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD VSIFG SHVWVDHCSLSNC DGLVDAI GSTAITISNN++THHN+VMLLGHS
Sbjct  219  RTMADGDAVSIFGSSHVWVDHCSLSNCADGLVDAIMGSTAITISNNHLTHHNEVMLLGHS  278

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  279  DSYERDKDMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  338

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  DA  S WK WNWRSEGDL+LNGA+FT    AGAS+SY++AS
Sbjct  339  GNRYLAPANPFAKEVTKRLDASSSAWKNWNWRSEGDLLLNGAYFTP-SGAGASASYSRAS  397

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+PSS+VG++T GAGAL C+K   C
Sbjct  398  SLGAKPSSMVGTITSGAGALSCRKAAQC  425



>ref|XP_010470701.1| PREDICTED: probable pectate lyase 5 [Camelina sativa]
Length=408

 Score =   416 bits (1069),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 223/268 (83%), Positives = 240/268 (90%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRG +VHIAGG CIT+QYVTNIIIHG+NIHDC++ GNA VRDSP HYGW
Sbjct  142  ELLMNSFKTIDGRGVNVHIAGGACITVQYVTNIIIHGINIHDCKRKGNAYVRDSPSHYGW  201

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT SDGD VSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNY+THHNKVMLLGHS
Sbjct  202  RTASDGDAVSIFGGSHVWVDHCSLSNCADGLIDAIHGSTAITISNNYLTHHNKVMLLGHS  261

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTINSQ
Sbjct  262  DSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTINSQ  321

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPND   KEVTK+EDAP+S+WK WNWRSEGDL LNGAFFT      ASSSYAKAS
Sbjct  322  GNRFLAPNDHVFKEVTKYEDAPQSKWKKWNWRSEGDLFLNGAFFTA-SGGRASSSYAKAS  380

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSS+V S+TG AGAL CKKG  C
Sbjct  381  SLSARPSSVVASVTGSAGALFCKKGSRC  408



>emb|CDY32557.1| BnaC02g17500D [Brassica napus]
Length=406

 Score =   416 bits (1069),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 224/268 (84%), Positives = 240/268 (90%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGA+VHIAGG CIT QYVTNIIIHG+NIHDC++ GNA VRDSP HYGW
Sbjct  140  ELLMNSFKTIDGRGANVHIAGGACITAQYVTNIIIHGINIHDCKKRGNAYVRDSPSHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT SDGD +SIFGGSHVWVDHCSLSNC DGLVDAI GSTAITISNNY+THHNKVMLLGHS
Sbjct  200  RTASDGDAISIFGGSHVWVDHCSLSNCADGLVDAIHGSTAITISNNYLTHHNKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTINSQ
Sbjct  260  DSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPND   KEVTK+EDAP+S+WK WNWRSEGDL LNGAFFT      ASSSYAKAS
Sbjct  320  GNRFLAPNDHVFKEVTKYEDAPQSKWKKWNWRSEGDLFLNGAFFTP-AGGRASSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPS+LV S+TG AGAL CKKG  C
Sbjct  379  SLSARPSALVASVTGNAGALYCKKGSRC  406



>ref|XP_010935685.1| PREDICTED: probable pectate lyase 8 isoform X1 [Elaeis guineensis]
Length=453

 Score =   417 bits (1073),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 210/268 (78%), Positives = 235/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G CITIQ++TN+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  187  ELIMNSFKTIDGRGANVHIANGACITIQFITNVIIHGLHIHDCKPTGNAMVRSSPSHYGW  246

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD VSIFG SHVWVDHCSLSNC DGLVDAI GSTAITISNN++THHN+VMLLGHS
Sbjct  247  RTMADGDAVSIFGSSHVWVDHCSLSNCADGLVDAIMGSTAITISNNHLTHHNEVMLLGHS  306

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  307  DSYERDKDMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  366

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  DA  S WK WNWRSEGDL+LNGA+FT    AGAS+SY++AS
Sbjct  367  GNRYLAPANPFAKEVTKRLDASSSAWKNWNWRSEGDLLLNGAYFTP-SGAGASASYSRAS  425

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+PSS+VG++T GAGAL C+K   C
Sbjct  426  SLGAKPSSMVGTITSGAGALSCRKAAQC  453



>ref|XP_009127577.1| PREDICTED: probable pectate lyase 5 [Brassica rapa]
Length=406

 Score =   415 bits (1067),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 224/268 (84%), Positives = 240/268 (90%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGA+VHIAGG CIT QYVTNIIIHG+NIHDC++ GNA VRDSP HYGW
Sbjct  140  ELLMNSFKTIDGRGANVHIAGGACITAQYVTNIIIHGINIHDCKKRGNAYVRDSPSHYGW  199

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT SDGD +SIFGGSHVWVDHCSLSNC DGLVDAI GSTAITISNNY+THHNKVMLLGHS
Sbjct  200  RTASDGDAISIFGGSHVWVDHCSLSNCADGLVDAIHGSTAITISNNYLTHHNKVMLLGHS  259

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTINSQ
Sbjct  260  DSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTINSQ  319

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPND   KEVT++EDAP+S+WK WNWRSEGDL LNGAFFT      ASSSYAKAS
Sbjct  320  GNRFLAPNDHVFKEVTRYEDAPQSKWKKWNWRSEGDLFLNGAFFTP-AGGRASSSYAKAS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLV S+TG AGAL CKKG  C
Sbjct  379  SLSARPSSLVASVTGNAGALYCKKGSRC  406



>ref|XP_008667903.1| PREDICTED: pectate lyase 8 isoform X1 [Zea mays]
 tpg|DAA38670.1| TPA: pectate lyase 8 [Zea mays]
Length=479

 Score =   418 bits (1074),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 207/268 (77%), Positives = 237/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G C+TIQYVTN+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  213  ELIMNSFKTIDGRGANVHIANGACVTIQYVTNVIIHGLHIHDCRPTGNAMVRSSPSHYGW  272

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGDGVSIFG SHVWVDHCSLSNC DGL+DAI GSTAIT+SNNY THHN+VMLLGHS
Sbjct  273  RTMADGDGVSIFGSSHVWVDHCSLSNCADGLIDAIMGSTAITLSNNYFTHHNEVMLLGHS  332

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  333  DSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQ  392

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  +  ++ WK WNWRSEGDL+LNGA+FT    AGAS+SY++AS
Sbjct  393  GNRYLAPTNPFAKEVTKRVETAQTVWKSWNWRSEGDLLLNGAYFTP-SGAGASASYSRAS  451

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VG++T  AGAL C+KG +C
Sbjct  452  SLGAKSSSMVGTITSDAGALSCRKGAAC  479



>ref|XP_009340844.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=404

 Score =   415 bits (1066),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 219/268 (82%), Positives = 241/268 (90%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVHIAGGPCITI Y TNIIIHG++IHDC+  GN N+R+SPEH GW
Sbjct  138  ELVMNSFKTIDGRGASVHIAGGPCITIHYATNIIIHGIHIHDCKPAGNGNIRNSPEHSGW  197

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
             T+SDGDGVSIF G H+WVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  198  WTVSDGDGVSIFNGQHIWVDHCSLSNCHDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  257

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTI SQ
Sbjct  258  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTILSQ  317

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+ RF+KEVTKHEDAPES+W+ WNWRSEGD++LNGAFF     AGASSSYA+AS
Sbjct  318  GNRFLAPDRRFDKEVTKHEDAPESEWRKWNWRSEGDMLLNGAFF-RQSGAGASSSYARAS  376

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVGS+T  AGAL C++G  C
Sbjct  377  SLSARPSSLVGSITTAAGALNCRRGSRC  404



>ref|XP_010322529.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 18 [Solanum 
lycopersicum]
Length=405

 Score =   414 bits (1065),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 206/268 (77%), Positives = 238/268 (89%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIAGGPCITIQYV+N+IIHG++IHDC+QGGNA VR +P+HYGW
Sbjct  139  ELIMNSFKTIDGRGANVHIAGGPCITIQYVSNVIIHGIHIHDCKQGGNAMVRSTPQHYGW  198

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGS +W+DHCSLSNC DGL+DAI GST+IT SNNYMT+H+KVMLLGHS
Sbjct  199  RTISDGDGVSIFGGSDIWIDHCSLSNCVDGLIDAIMGSTSITXSNNYMTNHDKVMLLGHS  258

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+++QDK MQVTIAFNHFGEGL+QR+PRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  259  DSHVQDKNMQVTIAFNHFGEGLVQRIPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  318

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLA + RF+KEVTKHE+APES+WK WNWRS+GDLMLNGAFF  SG+  +S+    +S
Sbjct  319  GNRFLASDIRFSKEVTKHENAPESEWKNWNWRSDGDLMLNGAFFVKSGAGASSNYAKASS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
              +   SSL+ SL  GAGAL C KG  C
Sbjct  379  LSAKS-SSLISSLVSGAGALSCWKGSRC  405



>ref|XP_003618787.1| Pectate lyase [Medicago truncatula]
 gb|AES75005.1| pectate lyase family protein [Medicago truncatula]
 gb|AFK34950.1| unknown [Medicago truncatula]
Length=404

 Score =   414 bits (1064),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 204/268 (76%), Positives = 233/268 (87%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL++NS+KTIDGRGASVHIA G CITI YV N+IIHG+++HDC   GN N+RDSPEH G+
Sbjct  138  ELLVNSYKTIDGRGASVHIANGGCITIHYVNNVIIHGIHVHDCVPTGNTNIRDSPEHSGF  197

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
             T+SDGDG+S+F   H+W+DHCSLSNCRDGL+D I GS AITISNNYMTHH+KVMLLGHS
Sbjct  198  WTVSDGDGISVFNSQHIWIDHCSLSNCRDGLIDVIHGSNAITISNNYMTHHDKVMLLGHS  257

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  258  DSYTQDKDMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  317

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP++RF+KEVTKHEDA ES++  WNWRSEGDL LNGAFF     A +SS YA+AS
Sbjct  318  GNRFLAPDNRFSKEVTKHEDASESEYNSWNWRSEGDLFLNGAFF-RQTGAESSSIYARAS  376

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARP+SLVGS+T  +G L CKKG  C
Sbjct  377  SLSARPASLVGSITTTSGVLTCKKGNRC  404



>ref|XP_011073763.1| PREDICTED: probable pectate lyase 8 [Sesamum indicum]
Length=444

 Score =   415 bits (1066),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 207/268 (77%), Positives = 236/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRG +VHIA G CITIQ++TN+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  178  ELIMNSFKTIDGRGVNVHIANGACITIQFITNVIIHGLHIHDCKPTGNAMVRSSPSHYGW  237

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGDG+SIFG SH+WVDH SLSNC DGLVDA+ GSTAITISNNY THHN+VMLLGHS
Sbjct  238  RTMADGDGISIFGSSHIWVDHNSLSNCADGLVDAVMGSTAITISNNYFTHHNEVMLLGHS  297

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIA+NHFGEGLIQRMPRCRHGY+HVVNNDYTHWEMYAIGGSADPTINSQ
Sbjct  298  DSYVRDKQMQVTIAYNHFGEGLIQRMPRCRHGYYHVVNNDYTHWEMYAIGGSADPTINSQ  357

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  D  E QWK WNWRSEGDLMLNGA+FT    AGAS+SYA+AS
Sbjct  358  GNRYLAPVNPFAKEVTKRVDTAEGQWKSWNWRSEGDLMLNGAYFTP-SGAGASASYARAS  416

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VG++T GAGAL C++G+ C
Sbjct  417  SLGAKSSSMVGTITAGAGALGCRRGRQC  444



>ref|NP_001234029.1| probable pectate lyase P18 precursor [Solanum lycopersicum]
 sp|P24396.1|PLY18_SOLLC RecName: Full=Probable pectate lyase P18; AltName: Full=Style 
development-specific protein 9612; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA38979.1| 9612 [Solanum lycopersicum]
Length=404

 Score =   413 bits (1062),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 213/269 (79%), Positives = 241/269 (90%), Gaps = 1/269 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNS+KTIDGRGASVHI+GGPCITI + +NIIIHG+NIHDC+Q GN N+RDSP H GW
Sbjct  136  ELVMNSYKTIDGRGASVHISGGPCITIHHTSNIIIHGINIHDCKQSGNGNIRDSPNHSGW  195

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
              +SDGDG+SIFGG ++WVDHCSLSNC DGL+DAI GSTAITISNNY THH+KVMLLGHS
Sbjct  196  WDVSDGDGISIFGGKNIWVDHCSLSNCHDGLIDAIHGSTAITISNNYFTHHDKVMLLGHS  255

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D++ QDKGMQVT+AFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  256  DSFTQDKGMQVTVAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQ  315

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFF-TTsgsagasssyaka  173
            GNRFLAPN+++ KEVTKHEDAPESQW+ WNWRSEGDLMLNGA+F  T   A +SS+YA+A
Sbjct  316  GNRFLAPNEKYRKEVTKHEDAPESQWRSWNWRSEGDLMLNGAYFRQTGAGASSSSTYARA  375

Query  172  sslsARPSSLVGSLTGGAGALPCKKGKSC  86
            SSLSARPSSLVGS+T  AG + CKKG  C
Sbjct  376  SSLSARPSSLVGSITTNAGPVNCKKGSRC  404



>ref|XP_010918897.1| PREDICTED: probable pectate lyase 8 isoform X2 [Elaeis guineensis]
Length=426

 Score =   414 bits (1063),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 209/268 (78%), Positives = 233/268 (87%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA VR SP HYGW
Sbjct  160  ELIMNSFKTIDGRGANVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHYGW  219

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGDGVSIFG SH+WVDHCSLSNC DGL+DAI GSTAITISNNY THHN+VMLLGHS
Sbjct  220  RTMADGDGVSIFGSSHIWVDHCSLSNCADGLIDAIMGSTAITISNNYFTHHNEVMLLGHS  279

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ
Sbjct  280  DSYVRDKSMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  339

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP D F KEVTK  D   S+WK WNWRSEGDL+LNGA+FT    AGAS+SY++AS
Sbjct  340  GNRYLAPADPFAKEVTKRVDTDASEWKSWNWRSEGDLLLNGAYFTP-SGAGASASYSRAS  398

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+V S+T  AG L C++   C
Sbjct  399  SLGAKSSSMVASITSEAGVLQCRRNAHC  426



>ref|XP_008796023.1| PREDICTED: probable pectate lyase 5 [Phoenix dactylifera]
Length=409

 Score =   413 bits (1061),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 240/268 (90%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNS+KT+DGRGASVHIAGGPCITIQYV +IIIHGL+IHDC+ GGNA VRDSPEHYGW
Sbjct  143  ELIMNSYKTLDGRGASVHIAGGPCITIQYVNHIIIHGLHIHDCKPGGNAYVRDSPEHYGW  202

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGSHVWVDHC+LS+C DGLVDAI GSTAITISNNYM+HH+KVMLLGHS
Sbjct  203  RTVSDGDGVSIFGGSHVWVDHCTLSSCHDGLVDAIHGSTAITISNNYMSHHDKVMLLGHS  262

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D +  DK MQ TIAFNHFGEGLIQRMPRCR GYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  263  DGFTNDKNMQATIAFNHFGEGLIQRMPRCRLGYFHVVNNDYTHWEMYAIGGSAAPTINSQ  322

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+ RF+KEVTK EDA E +WK WNWRSEGDLMLNGAFFT    AGASSSYAKAS
Sbjct  323  GNRFLAPDTRFSKEVTKREDASEGEWKNWNWRSEGDLMLNGAFFTP-SGAGASSSYAKAS  381

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL ARPSSLV S+T  AGAL CKKG  C
Sbjct  382  SLGARPSSLVSSITMSAGALLCKKGSHC  409



>ref|XP_008804450.1| PREDICTED: probable pectate lyase 8 isoform X2 [Phoenix dactylifera]
Length=426

 Score =   413 bits (1062),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 208/268 (78%), Positives = 233/268 (87%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA VR SP HYGW
Sbjct  160  ELIMNSFKTIDGRGANVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHYGW  219

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGDGVSIFG SH+WVDHCSLSNC DGL+DAI GSTAITI+NNY THHN+VMLLGHS
Sbjct  220  RTMADGDGVSIFGSSHIWVDHCSLSNCADGLIDAIMGSTAITITNNYFTHHNEVMLLGHS  279

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ
Sbjct  280  DSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  339

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP D F KEVTK  D   S+WK WNWRSEGDL+LNGA+FT    AGAS+SY++AS
Sbjct  340  GNRYLAPADPFAKEVTKRVDTDTSEWKSWNWRSEGDLLLNGAYFTP-SGAGASASYSRAS  398

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+V S+T  AG L C++   C
Sbjct  399  SLGAKSSSMVASITTDAGVLQCRRNSQC  426



>ref|XP_004975048.1| PREDICTED: probable pectate lyase 15-like isoform X3 [Setaria 
italica]
Length=440

 Score =   414 bits (1064),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 205/268 (76%), Positives = 237/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHI+GG CITIQYV+N+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  174  ELIMNSFKTIDGRGANVHISGGACITIQYVSNVIIHGLHIHDCKPTGNAMVRSSPSHYGW  233

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD VSIFG SH+WVDHCSLSNC DGL+DAI GSTAIT+SNNY THHN+VMLLGHS
Sbjct  234  RTIADGDAVSIFGASHIWVDHCSLSNCADGLIDAIMGSTAITVSNNYFTHHNEVMLLGHS  293

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  294  DSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQ  353

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  +  ++ W+ WNWRSEGDL+LNGA+FT    AGAS+SY++AS
Sbjct  354  GNRYLAPTNPFAKEVTKRVETAQTVWQSWNWRSEGDLLLNGAYFTP-SGAGASASYSRAS  412

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VGS+T  AGAL C+KG +C
Sbjct  413  SLGAKSSSMVGSITSDAGALSCRKGVAC  440



>ref|XP_010918895.1| PREDICTED: probable pectate lyase 8 isoform X1 [Elaeis guineensis]
Length=451

 Score =   414 bits (1064),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 209/268 (78%), Positives = 233/268 (87%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA VR SP HYGW
Sbjct  185  ELIMNSFKTIDGRGANVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHYGW  244

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGDGVSIFG SH+WVDHCSLSNC DGL+DAI GSTAITISNNY THHN+VMLLGHS
Sbjct  245  RTMADGDGVSIFGSSHIWVDHCSLSNCADGLIDAIMGSTAITISNNYFTHHNEVMLLGHS  304

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ
Sbjct  305  DSYVRDKSMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  364

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP D F KEVTK  D   S+WK WNWRSEGDL+LNGA+FT    AGAS+SY++AS
Sbjct  365  GNRYLAPADPFAKEVTKRVDTDASEWKSWNWRSEGDLLLNGAYFTP-SGAGASASYSRAS  423

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+V S+T  AG L C++   C
Sbjct  424  SLGAKSSSMVASITSEAGVLQCRRNAHC  451



>ref|XP_004143054.1| PREDICTED: probable pectate lyase 5-like [Cucumis sativus]
 ref|XP_004171247.1| PREDICTED: probable pectate lyase 5-like [Cucumis sativus]
 gb|KGN62338.1| hypothetical protein Csa_2G350210 [Cucumis sativus]
Length=415

 Score =   413 bits (1061),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 212/268 (79%), Positives = 237/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRG SVHIAGGPCITIQ+VTNIIIHG+NIHDC+QGGN  VRDSPEHYGW
Sbjct  149  ELLMNSFKTIDGRGVSVHIAGGPCITIQFVTNIIIHGINIHDCKQGGNTYVRDSPEHYGW  208

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDG+SIFGGSHVW+DHCSLSNCRDGL+DAI GSTAIT+SNNYMTHHNKVMLLGHS
Sbjct  209  RTVSDGDGISIFGGSHVWIDHCSLSNCRDGLIDAIHGSTAITVSNNYMTHHNKVMLLGHS  268

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW MYAIGGSA PTINSQ
Sbjct  269  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWIMYAIGGSASPTINSQ  328

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAPN++ +KEVTK ED P+S+WK WNWRS+GDLMLNGAFF  SG+  +SS    +S
Sbjct  329  GNRYLAPNNQNSKEVTKREDTPQSRWKNWNWRSDGDLMLNGAFFVRSGAGASSSYARASS  388

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
              +   SSL+ S+T GAG L C+KG  C
Sbjct  389  LSAKS-SSLINSITAGAGVLKCRKGSRC  415



>ref|XP_009408120.1| PREDICTED: probable pectate lyase 8 [Musa acuminata subsp. malaccensis]
Length=447

 Score =   414 bits (1063),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/268 (78%), Positives = 231/268 (86%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKT+DGRGA+VHIA G CITIQ +TN+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  181  ELIMNSFKTVDGRGANVHIANGACITIQDITNVIIHGLHIHDCKPTGNAMVRSSPSHYGW  240

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGDGVSIF  SH+WVDHCSLSNC DGLVDA+ GSTAITISNNY THHN+VMLLGHS
Sbjct  241  RTMADGDGVSIFSSSHIWVDHCSLSNCADGLVDAVVGSTAITISNNYFTHHNEVMLLGHS  300

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  301  DSYVRDKSMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  360

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP D F KEVTK  D   S WK WNWRSEGDL+LNGA+FT    AGAS+SYA+AS
Sbjct  361  GNRYLAPTDPFAKEVTKRVDTDASVWKSWNWRSEGDLLLNGAYFTP-SGAGASASYARAS  419

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+PSSLV +LT  AG L C+ G  C
Sbjct  420  SLGAKPSSLVATLTSNAGVLSCRAGAQC  447



>ref|XP_008804449.1| PREDICTED: probable pectate lyase 8 isoform X1 [Phoenix dactylifera]
Length=451

 Score =   414 bits (1063),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/268 (78%), Positives = 233/268 (87%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA VR SP HYGW
Sbjct  185  ELIMNSFKTIDGRGANVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHYGW  244

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGDGVSIFG SH+WVDHCSLSNC DGL+DAI GSTAITI+NNY THHN+VMLLGHS
Sbjct  245  RTMADGDGVSIFGSSHIWVDHCSLSNCADGLIDAIMGSTAITITNNYFTHHNEVMLLGHS  304

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ
Sbjct  305  DSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  364

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP D F KEVTK  D   S+WK WNWRSEGDL+LNGA+FT    AGAS+SY++AS
Sbjct  365  GNRYLAPADPFAKEVTKRVDTDTSEWKSWNWRSEGDLLLNGAYFTP-SGAGASASYSRAS  423

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+V S+T  AG L C++   C
Sbjct  424  SLGAKSSSMVASITTDAGVLQCRRNSQC  451



>ref|XP_009411363.1| PREDICTED: probable pectate lyase 8 [Musa acuminata subsp. malaccensis]
Length=454

 Score =   414 bits (1063),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 211/268 (79%), Positives = 234/268 (87%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRG  VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA VR SP HYGW
Sbjct  188  ELIMNSFKTIDGRGVDVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHYGW  247

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD VS+FG SH+WVDH SLSNC DGLVDAI GSTAITISNNY THHN+VMLLGHS
Sbjct  248  RTMADGDAVSMFGASHIWVDHNSLSNCADGLVDAIMGSTAITISNNYFTHHNEVMLLGHS  307

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ
Sbjct  308  DSYVRDKAMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  367

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP D+  KEVTK  D  ES+WKGWNWRSEGDL+LNGA+FT    AGAS+SYAKAS
Sbjct  368  GNRYLAPVDQSAKEVTKRVDTDESEWKGWNWRSEGDLLLNGAYFTP-SGAGASASYAKAS  426

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VGS+T  AGAL C++G  C
Sbjct  427  SLGAKSSSMVGSITSDAGALNCRRGSHC  454



>ref|XP_006338637.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P18-like 
[Solanum tuberosum]
Length=403

 Score =   412 bits (1058),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 210/268 (78%), Positives = 241/268 (90%), Gaps = 0/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNS+KTIDGRGASVHI+GGPCITI + +NIIIHG+NIHDC+Q GN N+RDSP H GW
Sbjct  136  ELVMNSYKTIDGRGASVHISGGPCITIHHTSNIIIHGINIHDCKQSGNGNIRDSPNHSGW  195

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
              +SDGDG+SIFGG ++WVDHCSLSNC DGL+DAI GSTAITISNNY THH+KVMLLGHS
Sbjct  196  WDVSDGDGISIFGGKNIWVDHCSLSNCHDGLIDAIHGSTAITISNNYFTHHDKVMLLGHS  255

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D++ QD+GMQVT+AFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  256  DSFTQDQGMQVTVAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQ  315

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP +++ KEVTKHEDAPESQW+ WNWRSEGDLMLNGA+F  +G+  +SS+YA+AS
Sbjct  316  GNRFLAPYEKYRKEVTKHEDAPESQWRSWNWRSEGDLMLNGAYFRQTGAGASSSTYARAS  375

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVGS+T  AG + CKKG  C
Sbjct  376  SLSARPSSLVGSITTNAGPINCKKGSRC  403



>ref|XP_003551943.1| PREDICTED: probable pectate lyase 5-like [Glycine max]
 gb|KHN24116.1| Putative pectate lyase 5 [Glycine soja]
Length=405

 Score =   412 bits (1058),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 218/268 (81%), Positives = 236/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRG SVHIAGGPCITIQYVTNIIIHG+NIHDC+QGGNA VRDSP HYGW
Sbjct  139  ELMMNSFKTIDGRGVSVHIAGGPCITIQYVTNIIIHGINIHDCKQGGNAYVRDSPTHYGW  198

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGL+DAI GSTAITISNNYMTHHNKVMLLGHS
Sbjct  199  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIHGSTAITISNNYMTHHNKVMLLGHS  258

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DT+ +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW MYAIGGSA PTINSQ
Sbjct  259  DTFTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWRMYAIGGSAAPTINSQ  318

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPND   KEVTK E++P+S+WK WNWRS GDLMLNGAFFT SG+  +SS    +S
Sbjct  319  GNRFLAPNDNTFKEVTKRENSPQSKWKNWNWRSNGDLMLNGAFFTASGAGASSSYARASS  378

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
              +   SSLV S+T  AG+L C+KG  C
Sbjct  379  LAAKS-SSLVSSITASAGSLRCRKGSRC  405



>gb|EYU43815.1| hypothetical protein MIMGU_mgv1a006554mg [Erythranthe guttata]
Length=439

 Score =   413 bits (1061),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 208/268 (78%), Positives = 235/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  171  ELIMNSFKTIDGRGANVHIANGGCITIQYVTNVIIHGLHIHDCKPTGNAMVRSSPSHYGW  230

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD +SIFG SH+WVDH SLSNC DGLVDA+ GSTAIT+SNNY THHN+VMLLGHS
Sbjct  231  RTMADGDAISIFGSSHIWVDHNSLSNCADGLVDAVMGSTAITVSNNYFTHHNEVMLLGHS  290

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIA+NHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  291  DSYMKDKQMQVTIAYNHFGEGLMQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQ  350

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  D  E QWKGWNWRSEGDLMLNGA+FT    AGAS+SYA+AS
Sbjct  351  GNRYLAPVNPFAKEVTKRVDTGEGQWKGWNWRSEGDLMLNGAYFTP-SGAGASASYARAS  409

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VG++T GAG L CK+G  C
Sbjct  410  SLGAKSSSMVGTITSGAGVLGCKRGHQC  437



>ref|XP_010023767.1| PREDICTED: probable pectate lyase 8 isoform X1 [Eucalyptus grandis]
 gb|KCW60135.1| hypothetical protein EUGRSUZ_H02860 [Eucalyptus grandis]
Length=444

 Score =   413 bits (1061),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 207/268 (77%), Positives = 234/268 (87%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGA+VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA +R SP HYGW
Sbjct  178  ELLMNSFKTIDGRGANVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMIRSSPTHYGW  237

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD VSIFG SH+WVDH SLS C DGLVDAI GSTAITISNN+MTHHN+VMLLGHS
Sbjct  238  RTMADGDAVSIFGASHIWVDHNSLSKCADGLVDAIMGSTAITISNNHMTHHNEVMLLGHS  297

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  298  DSYTRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  357

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+ AP++ F KEVTK  D   SQWK WNWRSEGDL+LNGA+FT    AGAS+SYA+AS
Sbjct  358  GNRYAAPSNPFAKEVTKRVDTATSQWKSWNWRSEGDLLLNGAYFTP-SGAGASASYARAS  416

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VGS+T GAG LPC++G+ C
Sbjct  417  SLGAKSSSMVGSITSGAGPLPCRRGRQC  444



>gb|ABK25017.1| unknown [Picea sitchensis]
Length=436

 Score =   412 bits (1060),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 218/268 (81%), Positives = 241/268 (90%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNS+KTIDGRGA+VHIA GPCIT+QYV +IIIHG++IHDC+  GNA VRDSP HYGW
Sbjct  170  ELIMNSYKTIDGRGANVHIANGPCITVQYVHHIIIHGIHIHDCKPAGNAMVRDSPGHYGW  229

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDGVSIFGGS++WVDHCSLSNC DGLVDAIRGSTAIT+SNNYM+HHNKVMLLGHS
Sbjct  230  RTVSDGDGVSIFGGSNIWVDHCSLSNCADGLVDAIRGSTAITVSNNYMSHHNKVMLLGHS  289

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D Y QD  MQVTIA+NHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  290  DDYTQDVNMQVTIAYNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  349

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP + F+KEVTKHEDAPES+W+ WNWRS+GD MLNGAFFT    AGASSSY+KAS
Sbjct  350  GNRFLAPTNPFSKEVTKHEDAPESKWRQWNWRSDGDQMLNGAFFTP-SGAGASSSYSKAS  408

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL+ARPSSLV SLT  AG L C+ G  C
Sbjct  409  SLAARPSSLVPSLTTNAGVLTCRSGSRC  436



>ref|XP_010940647.1| PREDICTED: probable pectate lyase 8 [Elaeis guineensis]
Length=448

 Score =   412 bits (1060),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 208/268 (78%), Positives = 233/268 (87%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G CITIQ+VTNIIIHGL++HDC+  GNA VR SP HYGW
Sbjct  182  ELIMNSFKTIDGRGANVHIANGACITIQFVTNIIIHGLHVHDCKPTGNAMVRSSPSHYGW  241

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGDG+SIFG SH+WVDHCSLSNC DGLVDA+  ST+ITISNNY THHN+VMLLGHS
Sbjct  242  RTMADGDGISIFGSSHLWVDHCSLSNCADGLVDAVVDSTSITISNNYFTHHNEVMLLGHS  301

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  302  DSYERDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  361

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  D P   WK WNWRSEGDL+LNGAFFT    AGAS+SY++AS
Sbjct  362  GNRYLAPVNPFAKEVTKRLDTPSGVWKSWNWRSEGDLLLNGAFFTP-SGAGASASYSRAS  420

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+PSS+VG++T  AGAL C+K   C
Sbjct  421  SLGAKPSSMVGTITSEAGALSCRKAAKC  448



>emb|CDO99404.1| unnamed protein product [Coffea canephora]
Length=452

 Score =   413 bits (1061),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 206/268 (77%), Positives = 233/268 (87%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTID RG +VHIA   CITIQ+VTNIIIHGL+IHDC+  GNA VR SP HYGW
Sbjct  186  ELIMNSFKTIDARGVNVHIANRACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHYGW  245

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD +SIFG SH+WVDH SLSNC DGLVDA+ GSTAITISNNY THHN+VMLLGHS
Sbjct  246  RTMADGDAISIFGSSHIWVDHNSLSNCADGLVDAVMGSTAITISNNYFTHHNEVMLLGHS  305

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  306  DSYVRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  365

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  +  ESQWKGWNWRSEGDLMLNGA+FT    AGAS+SYA+AS
Sbjct  366  GNRYLAPLNPFAKEVTKRVETAESQWKGWNWRSEGDLMLNGAYFTP-SGAGASASYARAS  424

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+V S+T GAG L C++G++C
Sbjct  425  SLGAKSSSMVASMTSGAGVLSCRRGRTC  452



>ref|XP_004975047.1| PREDICTED: probable pectate lyase 15-like isoform X2 [Setaria 
italica]
Length=473

 Score =   413 bits (1062),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 205/268 (76%), Positives = 237/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHI+GG CITIQYV+N+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  207  ELIMNSFKTIDGRGANVHISGGACITIQYVSNVIIHGLHIHDCKPTGNAMVRSSPSHYGW  266

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD VSIFG SH+WVDHCSLSNC DGL+DAI GSTAIT+SNNY THHN+VMLLGHS
Sbjct  267  RTIADGDAVSIFGASHIWVDHCSLSNCADGLIDAIMGSTAITVSNNYFTHHNEVMLLGHS  326

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  327  DSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQ  386

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  +  ++ W+ WNWRSEGDL+LNGA+FT    AGAS+SY++AS
Sbjct  387  GNRYLAPTNPFAKEVTKRVETAQTVWQSWNWRSEGDLLLNGAYFTP-SGAGASASYSRAS  445

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VGS+T  AGAL C+KG +C
Sbjct  446  SLGAKSSSMVGSITSDAGALSCRKGVAC  473



>ref|XP_004975046.1| PREDICTED: probable pectate lyase 15-like isoform X1 [Setaria 
italica]
Length=509

 Score =   414 bits (1065),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 205/268 (76%), Positives = 237/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHI+GG CITIQYV+N+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  243  ELIMNSFKTIDGRGANVHISGGACITIQYVSNVIIHGLHIHDCKPTGNAMVRSSPSHYGW  302

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD VSIFG SH+WVDHCSLSNC DGL+DAI GSTAIT+SNNY THHN+VMLLGHS
Sbjct  303  RTIADGDAVSIFGASHIWVDHCSLSNCADGLIDAIMGSTAITVSNNYFTHHNEVMLLGHS  362

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  363  DSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQ  422

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  +  ++ W+ WNWRSEGDL+LNGA+FT    AGAS+SY++AS
Sbjct  423  GNRYLAPTNPFAKEVTKRVETAQTVWQSWNWRSEGDLLLNGAYFTP-SGAGASASYSRAS  481

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VGS+T  AGAL C+KG +C
Sbjct  482  SLGAKSSSMVGSITSDAGALSCRKGVAC  509



>ref|XP_009400922.1| PREDICTED: probable pectate lyase 8 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=447

 Score =   412 bits (1059),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 207/268 (77%), Positives = 233/268 (87%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA VR SP HYGW
Sbjct  181  ELIMNSFKTIDGRGANVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHYGW  240

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD +SIFG SH+WVDH SLSNC DGLVDAI GSTAITISNNY THHN+VMLLGHS
Sbjct  241  RTIADGDAISIFGSSHIWVDHNSLSNCADGLVDAIMGSTAITISNNYFTHHNEVMLLGHS  300

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  301  DSYVRDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  360

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
             NR+LAP + F KEVTK  +     W+ WNWRSEGDL+LNGA+FT    AGAS+SY++AS
Sbjct  361  SNRYLAPTNPFAKEVTKRVETSSDVWESWNWRSEGDLLLNGAYFTP-SGAGASASYSRAS  419

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VGS+T GAGALPC+KG  C
Sbjct  420  SLGAKSSSMVGSITAGAGALPCRKGSLC  447



>ref|XP_004304685.1| PREDICTED: pectate lyase-like [Fragaria vesca subsp. vesca]
Length=399

 Score =   410 bits (1054),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 216/268 (81%), Positives = 238/268 (89%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVHIA GPCITI +VTNIIIHG++IHDC+Q GN ++RDSP H GW
Sbjct  133  ELVMNSFKTIDGRGASVHIANGPCITIHHVTNIIIHGIHIHDCKQAGNGDIRDSPSHAGW  192

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
             T SDGDGVSIFGG HVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  193  WTQSDGDGVSIFGGKHVWVDHCSLSNCHDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  252

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D++ +DKGM VTIAFNHFGEGL+QRMPRCR GYFHVVNNDYTHWEMYAIGGSA PTI SQ
Sbjct  253  DSFTEDKGMHVTIAFNHFGEGLVQRMPRCRLGYFHVVNNDYTHWEMYAIGGSAAPTIYSQ  312

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAP+ RF+KEVTKHEDAPES+W+ WNWRSEGDLMLNGAFF     AG+ SSYA+AS
Sbjct  313  GNRFLAPDRRFDKEVTKHEDAPESKWRKWNWRSEGDLMLNGAFFRQ-SGAGSWSSYARAS  371

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLS RPSSLVGS+T  AGAL C++G  C
Sbjct  372  SLSGRPSSLVGSMTVTAGALNCRRGSRC  399



>gb|KJB37786.1| hypothetical protein B456_006G219800 [Gossypium raimondii]
Length=447

 Score =   412 bits (1059),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 206/268 (77%), Positives = 234/268 (87%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRG +VHIA G CITIQYVTN+IIHGL+IHDC+  GNA VR SP H+GW
Sbjct  181  ELIMNSFKTIDGRGVNVHIANGACITIQYVTNVIIHGLHIHDCKPTGNAMVRSSPSHFGW  240

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD +SIFG SH+WVDH SLSNC DGLVDA+ GSTAITISNN+MTHHN+VMLLGHS
Sbjct  241  RTMADGDAISIFGSSHIWVDHNSLSNCADGLVDAVMGSTAITISNNHMTHHNEVMLLGHS  300

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  301  DSYTRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  360

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+ AP + F KEVTK  D  E QWK WNWRSEGDL+LNGA+FT    AGAS+SYA+AS
Sbjct  361  GNRYAAPTNPFAKEVTKRVDTAEGQWKSWNWRSEGDLLLNGAYFTP-SGAGASASYARAS  419

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VG++T  AGALPC++GK C
Sbjct  420  SLGAKSSSMVGAMTSNAGALPCRRGKQC  447



>ref|XP_009400924.1| PREDICTED: probable pectate lyase 8 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=446

 Score =   412 bits (1059),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 207/268 (77%), Positives = 233/268 (87%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA VR SP HYGW
Sbjct  180  ELIMNSFKTIDGRGANVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHYGW  239

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD +SIFG SH+WVDH SLSNC DGLVDAI GSTAITISNNY THHN+VMLLGHS
Sbjct  240  RTIADGDAISIFGSSHIWVDHNSLSNCADGLVDAIMGSTAITISNNYFTHHNEVMLLGHS  299

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  300  DSYVRDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  359

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
             NR+LAP + F KEVTK  +     W+ WNWRSEGDL+LNGA+FT    AGAS+SY++AS
Sbjct  360  SNRYLAPTNPFAKEVTKRVETSSDVWESWNWRSEGDLLLNGAYFTP-SGAGASASYSRAS  418

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VGS+T GAGALPC+KG  C
Sbjct  419  SLGAKSSSMVGSITAGAGALPCRKGSLC  446



>emb|CDY03964.1| BnaC02g36790D [Brassica napus]
Length=412

 Score =   410 bits (1055),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 202/268 (75%), Positives = 228/268 (85%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELI+ SFKTIDGRG+SVHI  GPCI I Y TNII+HG+NIHDC+ G    +RD P H GW
Sbjct  146  ELIITSFKTIDGRGSSVHITDGPCIKIHYATNIIVHGINIHDCKPGSAGMIRDGPRHTGW  205

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
               SDGD V++FGG HVW+DHCS SNC DGL+DAI GSTAITISNN+MTHH+KVMLLGH 
Sbjct  206  WVKSDGDAVALFGGRHVWIDHCSFSNCDDGLIDAIHGSTAITISNNHMTHHDKVMLLGHH  265

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTI SQ
Sbjct  266  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTIFSQ  325

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPN RFNKEVTKHEDAPES+W+ WNWRSEGD++LNGA+F     A +SS+YA+AS
Sbjct  326  GNRFLAPNTRFNKEVTKHEDAPESKWRHWNWRSEGDILLNGAYF-RQSGARSSSTYARAS  384

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVGS+T  AG L C++G+ C
Sbjct  385  SLSARPSSLVGSITTTAGTLSCRRGRRC  412



>gb|AFK42760.1| unknown [Medicago truncatula]
Length=274

 Score =   405 bits (1042),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 216/268 (81%), Positives = 240/268 (90%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRG +VHIAGGPCIT+Q+VTNIIIHG+NIHDC++GGN  VRD+P HYG+
Sbjct  8    ELMMNSFKTIDGRGTNVHIAGGPCITVQFVTNIIIHGINIHDCKRGGNTYVRDTPTHYGF  67

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGL+D I GSTAITISNN+MTHHNKVMLLGHS
Sbjct  68   RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDVIHGSTAITISNNFMTHHNKVMLLGHS  127

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D++ +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW MYAIGGSA+PTINSQ
Sbjct  128  DSFTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWRMYAIGGSANPTINSQ  187

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLA ND   KEVTK E+A +SQWK WNWRS GDLMLNGAFF     AG+SSSYA+AS
Sbjct  188  GNRFLASNDNTFKEVTKRENAGQSQWKNWNWRSSGDLMLNGAFFRP-SGAGSSSSYARAS  246

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL+A+PSSLV SLT  AG+L C+KG  C
Sbjct  247  SLAAKPSSLVASLTASAGSLNCRKGSRC  274



>gb|KHN07207.1| Putative pectate lyase 15 [Glycine soja]
Length=274

 Score =   405 bits (1041),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 204/268 (76%), Positives = 233/268 (87%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRG +VHIA G CITIQ+VTN+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  8    ELIMNSFKTIDGRGVNVHIAYGACITIQFVTNVIIHGLHIHDCKVTGNAMVRSSPSHYGW  67

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RTL+DGDG+SIFG SH+W+DH SLS+C DGLVDA+ GSTAITISNNY THHN+VMLLGHS
Sbjct  68   RTLADGDGISIFGSSHIWIDHNSLSSCADGLVDAVMGSTAITISNNYFTHHNEVMLLGHS  127

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHW MYAIGGSA+PTINSQ
Sbjct  128  DSYVRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWVMYAIGGSANPTINSQ  187

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  D   S WK WNWRSEGDL+LNGAFFT+   AGA++SYA+AS
Sbjct  188  GNRYLAPLNPFAKEVTKRVDTGSSVWKSWNWRSEGDLLLNGAFFTS-SGAGAAASYARAS  246

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SSLVG++T GAG L C++G  C
Sbjct  247  SLGAKSSSLVGTITSGAGVLKCRRGVMC  274



>ref|XP_010023768.1| PREDICTED: probable pectate lyase 1 isoform X2 [Eucalyptus grandis]
 gb|KCW60136.1| hypothetical protein EUGRSUZ_H02860 [Eucalyptus grandis]
Length=427

 Score =   411 bits (1056),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 207/268 (77%), Positives = 234/268 (87%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGA+VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA +R SP HYGW
Sbjct  161  ELLMNSFKTIDGRGANVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMIRSSPTHYGW  220

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD VSIFG SH+WVDH SLS C DGLVDAI GSTAITISNN+MTHHN+VMLLGHS
Sbjct  221  RTMADGDAVSIFGASHIWVDHNSLSKCADGLVDAIMGSTAITISNNHMTHHNEVMLLGHS  280

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  281  DSYTRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  340

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+ AP++ F KEVTK  D   SQWK WNWRSEGDL+LNGA+FT    AGAS+SYA+AS
Sbjct  341  GNRYAAPSNPFAKEVTKRVDTATSQWKSWNWRSEGDLLLNGAYFTP-SGAGASASYARAS  399

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VGS+T GAG LPC++G+ C
Sbjct  400  SLGAKSSSMVGSITSGAGPLPCRRGRQC  427



>ref|NP_001141589.1| uncharacterized protein LOC100273705 [Zea mays]
 gb|ACF86672.1| unknown [Zea mays]
 gb|AFW57904.1| hypothetical protein ZEAMMB73_963462 [Zea mays]
Length=466

 Score =   412 bits (1060),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 207/268 (77%), Positives = 235/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G CITIQY+TN+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  200  ELIMNSFKTIDGRGANVHIANGACITIQYITNVIIHGLHIHDCKPTGNAMVRSSPSHYGW  259

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGDGVSIFG SHVWVDHCSLSNC DGL+DAI GSTAIT+SNNY THHN+VMLLGHS
Sbjct  260  RTMADGDGVSIFGSSHVWVDHCSLSNCADGLIDAIMGSTAITVSNNYFTHHNEVMLLGHS  319

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  320  DSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQ  379

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  +   + WK WNWRSEGDL+LNGA+FT    AGAS+SY++AS
Sbjct  380  GNRYLAPTNPFAKEVTKRVETAHTVWKRWNWRSEGDLLLNGAYFTP-SGAGASASYSRAS  438

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VG++T  AGAL C KG +C
Sbjct  439  SLGAKSSSMVGTITLDAGALSCHKGAAC  466



>gb|KHN35421.1| Putative pectate lyase P18 [Glycine soja]
Length=274

 Score =   405 bits (1041),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 217/268 (81%), Positives = 239/268 (89%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL++NSFKTIDGRGASVHIA G CITI YV+NIIIHG++IHDC+  GN N+RDSP H G+
Sbjct  8    ELLVNSFKTIDGRGASVHIANGGCITIHYVSNIIIHGIHIHDCKPTGNTNIRDSPHHSGF  67

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
             T SDGDGVSIF   H+WVDHCSLSNCRDGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  68   WTQSDGDGVSIFNSKHIWVDHCSLSNCRDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  127

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  128  DSYTQDKDMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  187

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPN RF+KEVTKHEDAP+S+W GWNWRSEGD+ LNGA+F     AGASSSYA+AS
Sbjct  188  GNRFLAPNIRFSKEVTKHEDAPQSEWMGWNWRSEGDMFLNGAYF-RQSGAGASSSYARAS  246

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVGS+T  AGAL C+KG  C
Sbjct  247  SLSARPSSLVGSMTTTAGALTCRKGNRC  274



>ref|XP_007034463.1| Pectin lyase-like superfamily protein [Theobroma cacao]
 gb|EOY05389.1| Pectin lyase-like superfamily protein [Theobroma cacao]
Length=447

 Score =   411 bits (1057),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 205/268 (76%), Positives = 236/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRG +VHIA G CITIQ+VTN+IIHGL+IHDC+  GNA VR SP H+GW
Sbjct  181  ELIMNSFKTIDGRGVNVHIANGACITIQFVTNVIIHGLHIHDCKPTGNAMVRSSPSHFGW  240

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGDG+SIFG SH+WVDH SLSNC DGLVDA+ GSTAITISNN++THHN+VMLLGHS
Sbjct  241  RTMADGDGISIFGSSHIWVDHNSLSNCADGLVDAVMGSTAITISNNHLTHHNEVMLLGHS  300

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  301  DSYTRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  360

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+ AP + F KEVTK  D  ESQWK WNWRSEGDL+LNGA+FT    AGAS+SYA+AS
Sbjct  361  GNRYAAPTNPFAKEVTKRVDTGESQWKSWNWRSEGDLLLNGAYFTP-SGAGASASYARAS  419

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VG++T  AGALPC++G+ C
Sbjct  420  SLGAKSSSMVGAMTSNAGALPCRRGRQC  447



>ref|XP_011091390.1| PREDICTED: probable pectate lyase 8 [Sesamum indicum]
Length=452

 Score =   411 bits (1057),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 207/268 (77%), Positives = 231/268 (86%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTID RG +VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA VR SP HYGW
Sbjct  186  ELIMNSFKTIDARGVNVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPTHYGW  245

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD +SIFG SH+WVDH SLSNC DGLVDA+ GSTAITISNNY THHN+VMLLGHS
Sbjct  246  RTMADGDAISIFGSSHIWVDHNSLSNCADGLVDAVMGSTAITISNNYFTHHNEVMLLGHS  305

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  306  DSYVRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  365

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  D  E QWKGWNWRSEGDLMLNGA+FT    AGAS+SYA+AS
Sbjct  366  GNRYLAPTNPFAKEVTKRVDTAEGQWKGWNWRSEGDLMLNGAYFTP-SGAGASASYARAS  424

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+V S+T GAG L C++G  C
Sbjct  425  SLGAKSSSMVASITSGAGVLACRRGHQC  452



>ref|XP_004138973.1| PREDICTED: probable pectate lyase 15-like [Cucumis sativus]
 gb|KGN61525.1| hypothetical protein Csa_2G155600 [Cucumis sativus]
Length=449

 Score =   411 bits (1057),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 202/268 (75%), Positives = 235/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTID RG +VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA VR SP H+GW
Sbjct  183  ELIMNSFKTIDARGVNVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHFGW  242

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD +SIFG SH+W+DH SLSNC DGLVDA+ GSTAITISNN+ THHN+VMLLGHS
Sbjct  243  RTMADGDAISIFGSSHIWIDHNSLSNCADGLVDAVMGSTAITISNNHFTHHNEVMLLGHS  302

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  303  DSYTKDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  362

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+ AP +RF KEVTK  + PES+WKGWNWRSEGD++LNGA+FT    AGAS+SYA+AS
Sbjct  363  GNRYAAPTNRFAKEVTKRVETPESEWKGWNWRSEGDMLLNGAYFTP-SGAGASASYARAS  421

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ +S+VGS+T  AG+LPC++G  C
Sbjct  422  SLGAKSASMVGSITSSAGSLPCRRGHPC  449



>ref|XP_004171543.1| PREDICTED: probable pectate lyase 15-like [Cucumis sativus]
Length=444

 Score =   411 bits (1056),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 202/268 (75%), Positives = 235/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTID RG +VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA VR SP H+GW
Sbjct  178  ELIMNSFKTIDARGVNVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHFGW  237

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD +SIFG SH+W+DH SLSNC DGLVDA+ GSTAITISNN+ THHN+VMLLGHS
Sbjct  238  RTMADGDAISIFGSSHIWIDHNSLSNCADGLVDAVMGSTAITISNNHFTHHNEVMLLGHS  297

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  298  DSYTKDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  357

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+ AP +RF KEVTK  + PES+WKGWNWRSEGD++LNGA+FT    AGAS+SYA+AS
Sbjct  358  GNRYAAPTNRFAKEVTKRVETPESEWKGWNWRSEGDMLLNGAYFTP-SGAGASASYARAS  416

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ +S+VGS+T  AG+LPC++G  C
Sbjct  417  SLGAKSASMVGSITSSAGSLPCRRGHPC  444



>ref|XP_009384552.1| PREDICTED: probable pectate lyase 8 [Musa acuminata subsp. malaccensis]
Length=457

 Score =   411 bits (1057),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 210/268 (78%), Positives = 233/268 (87%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G CITIQ+VTN+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  191  ELIMNSFKTIDGRGANVHIANGACITIQFVTNVIIHGLHIHDCKPTGNAMVRSSPSHYGW  250

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGDGVSIFG SH+WVDH SLSNC DGLVDA+ GSTAITISNNY THHN+VMLLGHS
Sbjct  251  RTMADGDGVSIFGASHIWVDHNSLSNCADGLVDAVMGSTAITISNNYFTHHNEVMLLGHS  310

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ
Sbjct  311  DSYVRDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  370

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  D   + WK WNWRSEGDL+LNGA+FT    AGAS+SYAKAS
Sbjct  371  GNRYLAPTNPFAKEVTKRVDTDSNMWKSWNWRSEGDLLLNGAYFTP-SGAGASASYAKAS  429

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VGS+T  AGAL C+K   C
Sbjct  430  SLGAKSSSMVGSITSDAGALGCRKRSQC  457



>ref|XP_009382167.1| PREDICTED: probable pectate lyase 8 [Musa acuminata subsp. malaccensis]
Length=427

 Score =   410 bits (1054),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 207/268 (77%), Positives = 231/268 (86%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA VR SP HYGW
Sbjct  161  ELIMNSFKTIDGRGAEVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHYGW  220

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGDGVSIFG SH+WVDH SLSNC DGL+DAI GSTAITISNNY T+HN+V+LLGHS
Sbjct  221  RTIADGDGVSIFGASHIWVDHNSLSNCADGLIDAIIGSTAITISNNYFTNHNEVILLGHS  280

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ
Sbjct  281  DSYVRDKAMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  340

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  D   S WK WNWRS+ DL+LNGA+FTT    G+S SYAKAS
Sbjct  341  GNRYLAPTNPFAKEVTKRVDTDSSVWKSWNWRSDDDLLLNGAYFTT-SGGGSSGSYAKAS  399

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VGS+T  AGAL C+KG  C
Sbjct  400  SLGAKSSSMVGSITSDAGALRCRKGSQC  427



>ref|XP_006854398.1| hypothetical protein AMTR_s00039p00189000 [Amborella trichopoda]
 gb|ERN15865.1| hypothetical protein AMTR_s00039p00189000 [Amborella trichopoda]
Length=457

 Score =   411 bits (1056),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 206/268 (77%), Positives = 232/268 (87%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRG +VHIAGG CIT+Q+VTNIIIHGL+IHDC   GNA VR SP HYGW
Sbjct  191  ELIMNSFKTIDGRGVNVHIAGGACITVQFVTNIIIHGLHIHDCHPTGNAMVRSSPSHYGW  250

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGDGVSIFG SH+WVDHCSLSNC DGLVDAI GST+ITISNNY THHN+VMLLGHS
Sbjct  251  RTIADGDGVSIFGSSHIWVDHCSLSNCADGLVDAIMGSTSITISNNYFTHHNEVMLLGHS  310

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  311  DSYERDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQ  370

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  D  +  WKGWNWRS+ DLMLNGA+FT    AGAS+SY++AS
Sbjct  371  GNRYLAPTNPFAKEVTKRVDTADGVWKGWNWRSQNDLMLNGAYFTP-SGAGASASYSRAS  429

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ +S+V S+T GAG L C++   C
Sbjct  430  SLGAKSASMVASITSGAGVLTCRRDSVC  457



>gb|EMS64552.1| hypothetical protein TRIUR3_22914 [Triticum urartu]
Length=538

 Score =   414 bits (1063),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 207/268 (77%), Positives = 233/268 (87%), Gaps = 3/268 (1%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  274  ELIMNSFKTIDGRGANVHIANGACITIQYVTNVIIHGLHIHDCRPTGNAMVRSSPSHYGW  333

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD VSIFG SHVWVDHCSLSNC DGLVDAI GSTAIT+SNNY THHN+VMLLGHS
Sbjct  334  RTMADGDAVSIFGASHVWVDHCSLSNCADGLVDAIMGSTAITVSNNYFTHHNEVMLLGHS  393

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIAFNHFGEGLIQRMP  RHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  394  DSYLKDKAMQVTIAFNHFGEGLIQRMP--RHGYFHVVNNDYTHWEMYAIGGSAEPTINSQ  451

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  +  ++ WK WNWRSEGD++LNGAFFT    AGAS+SY++AS
Sbjct  452  GNRYLAPTNPFAKEVTKRVETAQTTWKAWNWRSEGDMLLNGAFFTP-SGAGASASYSRAS  510

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+V ++T GAGAL C KG SC
Sbjct  511  SLGAKSSSMVATITSGAGALSCHKGSSC  538



>ref|XP_004156698.1| PREDICTED: putative pectate lyase 11-like [Cucumis sativus]
Length=418

 Score =   409 bits (1050),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 213/268 (79%), Positives = 238/268 (89%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVH+AGGPCI I Y TNIIIHG++IHDC++GGNAN+RDSP+H GW
Sbjct  152  ELVMNSFKTIDGRGASVHLAGGPCIKIHYATNIIIHGIHIHDCKRGGNANIRDSPQHAGW  211

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
             T SDGDGVSI GG  +W+DHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  212  WTASDGDGVSILGGKQIWIDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  271

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D++ QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTI SQ
Sbjct  272  DSFTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTIYSQ  331

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+AP +RF KEVTKHEDAPES+W+ WNWRSEGDL+LNGA+F     AGASSSYA+A 
Sbjct  332  GNRFVAPYNRFRKEVTKHEDAPESEWRHWNWRSEGDLLLNGAYFRQ-SGAGASSSYARAY  390

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVG +T  AGAL C++G  C
Sbjct  391  SLSARPSSLVGDITITAGALNCRRGSRC  418



>ref|XP_004142773.1| PREDICTED: putative pectate lyase 11-like [Cucumis sativus]
 gb|KGN51335.1| hypothetical protein Csa_5G517820 [Cucumis sativus]
Length=418

 Score =   409 bits (1050),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 213/268 (79%), Positives = 238/268 (89%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVH+AGGPCI I Y TNIIIHG++IHDC++GGNAN+RDSP+H GW
Sbjct  152  ELVMNSFKTIDGRGASVHLAGGPCIKIHYATNIIIHGIHIHDCKRGGNANIRDSPQHAGW  211

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
             T SDGDGVSI GG  +W+DHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  212  WTASDGDGVSILGGKQIWIDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  271

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D++ QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTI SQ
Sbjct  272  DSFTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTIYSQ  331

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+AP +RF KEVTKHEDAPES+W+ WNWRSEGDL+LNGA+F     AGASSSYA+A 
Sbjct  332  GNRFVAPYNRFRKEVTKHEDAPESEWRHWNWRSEGDLLLNGAYFRQ-SGAGASSSYARAY  390

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVG +T  AGAL C++G  C
Sbjct  391  SLSARPSSLVGDITITAGALNCRRGSRC  418



>ref|XP_010038352.1| PREDICTED: probable pectate lyase 8 [Eucalyptus grandis]
 gb|KCW50165.1| hypothetical protein EUGRSUZ_K03600 [Eucalyptus grandis]
Length=444

 Score =   409 bits (1052),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 199/268 (74%), Positives = 232/268 (87%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGA+VHIA G CITIQY+TN+IIHG+++HDC+  G A VR SP HYGW
Sbjct  178  ELLMNSFKTIDGRGANVHIANGACITIQYITNVIIHGVHVHDCKSTGKAMVRSSPSHYGW  237

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGDG+S+FG SHVW+DH SLSNC DGL+DAI GSTAITISNNY THHN+VMLLGHS
Sbjct  238  RTMADGDGISLFGASHVWIDHNSLSNCADGLIDAIMGSTAITISNNYFTHHNEVMLLGHS  297

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y++DK MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  298  DSYVKDKTMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQ  357

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAP + F KEVTK  +   S WK WNWRSEGDLMLNGAFFT    AGA + Y++AS
Sbjct  358  GNRYLAPTNPFAKEVTKRVETSTSMWKSWNWRSEGDLMLNGAFFTP-SGAGAGAGYSRAS  416

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SSLVG+LT  +G L C++G++C
Sbjct  417  SLGAKSSSLVGTLTSDSGVLVCRRGRAC  444



>ref|XP_006591479.1| PREDICTED: probable pectate lyase 5-like [Glycine max]
 gb|KHN44386.1| Putative pectate lyase 5 [Glycine soja]
Length=402

 Score =   408 bits (1048),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 216/268 (81%), Positives = 235/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG+NIHDC+QGGNA VRDSP HYGW
Sbjct  136  ELMMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGINIHDCKQGGNAYVRDSPTHYGW  195

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGL+DAI GST ITISNNY+THHNKVMLLGHS
Sbjct  196  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIHGSTGITISNNYLTHHNKVMLLGHS  255

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            DT+ +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW MYAIGGSA PTINSQ
Sbjct  256  DTFTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWRMYAIGGSAAPTINSQ  315

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRFLAPND   KEVTK E++ +S+WK WNWRS GDLMLNGAFFT SG+  +SS    +S
Sbjct  316  GNRFLAPNDNTFKEVTKRENSAQSKWKNWNWRSSGDLMLNGAFFTASGAGASSSYARASS  375

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
              +   SSLV S+T  AG+L C+KG  C
Sbjct  376  LAAKS-SSLVSSITASAGSLSCRKGSRC  402



>emb|CDP16631.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   408 bits (1048),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 212/269 (79%), Positives = 238/269 (88%), Gaps = 1/269 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNS KTIDGRGASVHI+ GPCITI Y TNIIIHG++IHDC+QGGN N+R+SPEH G+
Sbjct  145  ELVMNSHKTIDGRGASVHISDGPCITIHYATNIIIHGIHIHDCKQGGNGNIRNSPEHSGY  204

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
             T+SDGDG+SIFGG HVWVDHCSLSNC DGL+DAI GSTAITISNNY T+H+KVMLLGHS
Sbjct  205  WTVSDGDGISIFGGQHVWVDHCSLSNCHDGLIDAIHGSTAITISNNYFTNHDKVMLLGHS  264

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D Y QDK MQ TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  265  DYYTQDKNMQATIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQ  324

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFF-TTsgsagasssyaka  173
            GNRFLAPN+ F KEVTKHEDAPES+W+ WNWRSEGDLMLNGA+F  +  +  +S++YA+A
Sbjct  325  GNRFLAPNENFRKEVTKHEDAPESEWQHWNWRSEGDLMLNGAYFRESGAAGASSTNYARA  384

Query  172  sslsARPSSLVGSLTGGAGALPCKKGKSC  86
            SSLSARPSSLVGS+T  AGAL C+ G  C
Sbjct  385  SSLSARPSSLVGSMTVAAGALTCRGGSRC  413



>ref|XP_004289729.1| PREDICTED: probable pectate lyase 8 [Fragaria vesca subsp. vesca]
Length=451

 Score =   409 bits (1052),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 200/268 (75%), Positives = 236/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            ELIMNSFKTIDGRG +VHIA G CITIQ+VTN+I+HGL+IHDC+  GNA VR SP H+GW
Sbjct  185  ELIMNSFKTIDGRGVNVHIANGACITIQFVTNVIVHGLHIHDCKPTGNALVRSSPSHFGW  244

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD +SIFG SH+WVDH SLSNC DGLVDA+ GSTAITISNN++THHN+VMLLGHS
Sbjct  245  RTMADGDAISIFGSSHIWVDHNSLSNCADGLVDAVMGSTAITISNNHLTHHNEVMLLGHS  304

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ
Sbjct  305  DSYTRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  364

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+ AP + F KEVTK  +  ++QW+GWNWRSEGDL+LNGAFFT    AGAS+ YA+AS
Sbjct  365  GNRYAAPTNPFAKEVTKRVETSQTQWRGWNWRSEGDLLLNGAFFTP-SGAGASAVYARAS  423

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ S++VG++T GAGAL C++G++C
Sbjct  424  SLGAKSSAMVGTITAGAGALGCRRGRTC  451



>ref|XP_008458848.1| PREDICTED: pectate lyase-like [Cucumis melo]
Length=417

 Score =   408 bits (1048),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 211/268 (79%), Positives = 237/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRGASVH+AGGPCI I Y TNIIIHG++IHDC++GGNAN+RDSP+H GW
Sbjct  151  ELVMNSFKTIDGRGASVHVAGGPCIKIHYATNIIIHGIHIHDCKRGGNANIRDSPQHAGW  210

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
             T SDGDGVSI GG  +W+DHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  211  WTASDGDGVSILGGKQIWIDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  270

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D++ QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTI SQ
Sbjct  271  DSFTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTIYSQ  330

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNRF+AP +RF KEVTKHEDAPES+W+ WNWRSEGD++LNGA+F     AGA SSYA+A 
Sbjct  331  GNRFVAPYNRFRKEVTKHEDAPESEWRYWNWRSEGDMLLNGAYFRQ-SGAGARSSYARAY  389

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SLSARPSSLVG +T  AGAL C++G  C
Sbjct  390  SLSARPSSLVGDITLTAGALNCRRGSRC  417



>ref|XP_008444399.1| PREDICTED: probable pectate lyase 5 [Cucumis melo]
 ref|XP_008444400.1| PREDICTED: probable pectate lyase 5 [Cucumis melo]
Length=415

 Score =   408 bits (1048),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 213/268 (79%), Positives = 236/268 (88%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL+MNSFKTIDGRG SVHIAGGPCITIQ+VTNIIIHG+NIHDC+QGGN  VRDSPEHYGW
Sbjct  149  ELLMNSFKTIDGRGVSVHIAGGPCITIQFVTNIIIHGINIHDCKQGGNTYVRDSPEHYGW  208

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT+SDGDG+SIFGGSHVW+DHCSLSNCRDGL+DAI GSTAIT+SNNYMTHHNKVMLLGHS
Sbjct  209  RTVSDGDGISIFGGSHVWIDHCSLSNCRDGLIDAIHGSTAITVSNNYMTHHNKVMLLGHS  268

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW MYAIGGSA PTINSQ
Sbjct  269  DSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWIMYAIGGSASPTINSQ  328

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+LAPN++  KEVTK EDAP+S+WK WNWRS+GDLMLNGAFF  SG+  +S     +S
Sbjct  329  GNRYLAPNNQDRKEVTKREDAPQSKWKNWNWRSDGDLMLNGAFFVRSGAGASSRYARASS  388

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
              +   SSLV S+T GAG L C+KG  C
Sbjct  389  LSAKS-SSLVSSITSGAGVLKCRKGSRC  415



>gb|KHG30349.1| hypothetical protein F383_15991 [Gossypium arboreum]
Length=487

 Score =   410 bits (1055),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 203/268 (76%), Positives = 234/268 (87%), Gaps = 1/268 (0%)
 Frame = -1

Query  889  ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  710
            EL++NSFKTIDGRG +VHIA G CITIQYVTN+I+HGL+IHDC+  GNA VR SP H+GW
Sbjct  221  ELLVNSFKTIDGRGVNVHIANGACITIQYVTNVIVHGLHIHDCKPTGNAMVRSSPTHFGW  280

Query  709  RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  530
            RT++DGD +SIFG SHVWVDH SLSNC DGLVDA+ GSTAITISNN++THHN+VMLLGHS
Sbjct  281  RTMADGDAISIFGSSHVWVDHNSLSNCADGLVDAVMGSTAITISNNHLTHHNEVMLLGHS  340

Query  529  DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  350
            D+Y +DK MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  341  DSYTRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  400

Query  349  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  170
            GNR+ AP + F KEVTK  D  ES WK WNWRSEGDL+LNGA+FT    AGAS+SYA+AS
Sbjct  401  GNRYAAPRNPFAKEVTKRVDTAESHWKSWNWRSEGDLLLNGAYFTP-SGAGASASYARAS  459

Query  169  slsARPSSLVGSLTGGAGALPCKKGKSC  86
            SL A+ SS+VGS+T  AGALPC++G+ C
Sbjct  460  SLGAKSSSMVGSMTSNAGALPCRRGRQC  487



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1956020332800